CN106902750A - Affine in immunity sorbing material based on anti-c Myc labels single domain heavy chain antibody - Google Patents
Affine in immunity sorbing material based on anti-c Myc labels single domain heavy chain antibody Download PDFInfo
- Publication number
- CN106902750A CN106902750A CN201710100127.4A CN201710100127A CN106902750A CN 106902750 A CN106902750 A CN 106902750A CN 201710100127 A CN201710100127 A CN 201710100127A CN 106902750 A CN106902750 A CN 106902750A
- Authority
- CN
- China
- Prior art keywords
- myc
- heavy chain
- single domain
- affine
- myc labels
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01J—CHEMICAL OR PHYSICAL PROCESSES, e.g. CATALYSIS OR COLLOID CHEMISTRY; THEIR RELEVANT APPARATUS
- B01J20/00—Solid sorbent compositions or filter aid compositions; Sorbents for chromatography; Processes for preparing, regenerating or reactivating thereof
- B01J20/22—Solid sorbent compositions or filter aid compositions; Sorbents for chromatography; Processes for preparing, regenerating or reactivating thereof comprising organic material
- B01J20/24—Naturally occurring macromolecular compounds, e.g. humic acids or their derivatives
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
- B01D15/08—Selective adsorption, e.g. chromatography
- B01D15/10—Selective adsorption, e.g. chromatography characterised by constructional or operational features
- B01D15/20—Selective adsorption, e.g. chromatography characterised by constructional or operational features relating to the conditioning of the sorbent material
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
- B01D15/08—Selective adsorption, e.g. chromatography
- B01D15/10—Selective adsorption, e.g. chromatography characterised by constructional or operational features
- B01D15/22—Selective adsorption, e.g. chromatography characterised by constructional or operational features relating to the construction of the column
-
- B—PERFORMING OPERATIONS; TRANSPORTING
- B01—PHYSICAL OR CHEMICAL PROCESSES OR APPARATUS IN GENERAL
- B01D—SEPARATION
- B01D15/00—Separating processes involving the treatment of liquids with solid sorbents; Apparatus therefor
- B01D15/08—Selective adsorption, e.g. chromatography
- B01D15/26—Selective adsorption, e.g. chromatography characterised by the separation mechanism
- B01D15/38—Selective adsorption, e.g. chromatography characterised by the separation mechanism involving specific interaction not covered by one or more of groups B01D15/265 - B01D15/36
- B01D15/3804—Affinity chromatography
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54313—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals the carrier being characterised by its particulate form
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/543—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals
- G01N33/54313—Immunoassay; Biospecific binding assay; Materials therefor with an insoluble carrier for immobilising immunochemicals the carrier being characterised by its particulate form
- G01N33/54326—Magnetic particles
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/558—Immunoassay; Biospecific binding assay; Materials therefor using diffusion or migration of antigen or antibody
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Analytical Chemistry (AREA)
- Hematology (AREA)
- Molecular Biology (AREA)
- Biomedical Technology (AREA)
- Urology & Nephrology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Medicinal Chemistry (AREA)
- Microbiology (AREA)
- Cell Biology (AREA)
- Food Science & Technology (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Organic Chemistry (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention belongs to genetic engineering field, specially for the single domain heavy chain antibody (also known as nano antibody) of c Myc labels, it has SEQ ID NO.:Amino acid sequence shown in 1.Amino acid sequence provided by the present invention can be as precursor, transformed by random or site-directed mutagenesis technique, it is obtained in that property (compatibility, specificity, stability etc.) preferably mutant, the nano antibody of the high specific can be purified as the affine in immunity sorbing material for c Myc to the recombinant protein containing c Myc labels.
Description
Technical field
It is special the present invention relates to affine in immunity sorbing material of the one kind based on single domain heavy chain antibody (also known as nano antibody technology)
It is not directed to the affine in immunity sorbing material of c-Myc labels.
Technical background
The discovery of c-Myc label proteins comes from Evan in 1985 and has prepared one plant for people's Oncoprotein Myc
The monoclonal antibody 9E10 of albumen, hereafter research finds that the epitope of the antibody recognition is made up of 10 amino acid residues, its sequence
It is Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu, and this 10 amino acid and other protein fusion expressions
Very strong antigen active can be still kept afterwards, can be recognized by corresponding antibodies, and do not influenceed by albumen framework.Cause
This, c-Myc tag systems are widely used in the fields such as immunology detection, cell imaging, affinity purification and protein engineering.
The technologies such as immunoaffinity chromatography, affine in immunity magnetic bead and co-immunoprecipitation are usually used in isolating and purifying and contain c-Myc marks
Sign fusion protein.This kind of affinity purification technology is based on the principle of aglucon and the specific binding of c-Myc labels, usually, will be special
Property combination c-Myc labels aglucon and carrier conjugation or absorption, be subsequently used for the specific adsorption c-Myc tag fusions from solution
Albumen.
In the market is directed to the affinity column and affine magnetic bead of c-Myc tag fusion protein purifying, and the aglucon of coupling is mostly
Monoclonal antibody or polyclonal antibody.Research and development of monoclonal antibody and production process is relatively complicated and complexity, polyclonal antibody comes
Source is limited.Existing affinity column and affine magnetic bead price for the purifying of c-Myc tag fusion proteins is generally higher.And nanometer is anti-
Body can Escherichia coli, yeast etc. biology in great expression, advantageously reduce the production cost of correlated product.
Need to use acid in protein purification procedures or alkaline solution is eluted to destination protein.Due to monoclonal antibody or
Polyclonal antibody is made up of heavy chain and light chain, and soda acid wash-out can inevitably cause the antibody activity to reduce, thus can not repeat
Use.By contrast, single domain heavy chain antibody is only made up of a domain, with acid and alkali-resistance, high temperature resistant.There is provided in the present invention
Affine sorbing material can be repeated several times and use.
The content of the invention
It is an object of the invention to provide a kind of for the affine in immunity sorbing material of c-Myc labels and its application.
To achieve the above object, the present invention is adopted the following technical scheme that:
Affine in immunity sorbing material for c-Myc labels includes carrier and aglucon, and the aglucon is single domain heavy chain antibody,
With SEQ ID NO.:Amino acid sequence shown in 1.The aglucon can specific recognition c-Myc labels.
The aglucon can also be to be changed by random or site-directed mutagenesis technique on the basis of foregoing single domain heavy chain antibody
Make the antibody that can be specifically bound with c-Myc labels for being obtained.
The carrier is magnetic bead, agarose gel microsphere, silica gel microball or porous material.
The preparation method of above-mentioned c-Myc labels affine in immunity sorbing material, it is characterized by:
When the carrier is magnetic bead, preparation method is:1mg carboxyl magnetic beads are taken in centrifuge tube, adds 600~1000 μ l to live
Change buffer solution (10mM, NaH2PO4, pH 6.0), vortex mixed is uniform, and magnetic frame reclaims magnetic bead, then washs 2 with activation buffer
Time.1~5mg carbodiimides (EDC) and N-hydroxy-succinamide (NHS) are separately added into, after vortex mixed, 35min is stood.With
Coupling buffer (10mM, Na2HPO4, pH 7.4) and wash magnetic bead 5 times, anti-c-Myc labels single domain heavy chain antibody is added, room temperature is anti-
3~5h is answered, the immunomagnetic beads of the anti-c-Myc labels single domain heavy chain antibody of covalent coupling is obtained;
When the carrier is agarose gel microsphere, preparation method is:The dry glue that CNBr is activated is washed with 0.1M HCl
10~20 times, 6~10min is balanced every time.Washed 5~20 times with coupling buffer (10mM, Na2HPO4, pH 7.2), added anti-
C-Myc label single domain heavy chain antibodies, 3~10h of room temperature reaction obtains the anti-c-Myc labels single domain heavy chain antibody of covalent coupling
Affine in immunity sorbing material;
When the carrier is silica gel microball, preparation method is:By silica gel microball pure water and phosphate buffer (PBS,
10mM, pH 6.5) alternately washing 5~15 times, with PBS suspension silica gel microball, add anti-c-Myc labels single domain heavy chain to resist
Body, is mixed, and adds the carbodiimide (EDC) of 1~10mg/ml of final concentration, and rapid to mix, 4 DEG C of 12~20h of stirring reaction are obtained
The covalent coupling affine in immunity sorbing material of anti-c-Myc labels single domain heavy chain antibody.
Above-mentioned affine in immunity sorbing material (carrier is agarose gel microsphere and silica gel microball) is filled to chromatographic column, i.e.,
C-Myc label immune affinity chromatographic columns are obtained, method is:According to chromatography column capacity, appropriate above-mentioned affine in immunity sorbing material is taken
In chromatographic column, after adding 8~10 times of PBS of bed volume (10mM, pH 7.2) washings, 4 DEG C, 20% ethanol solution is stored in.
Affinity column the invention further relates to be mounted with c-Myc labels affine in immunity sorbing material described in claim 1.
The application of above-mentioned c-Myc labels affine in immunity sorbing material, with the c-Myc labels affine in immunity sorbing material pair
The albumen containing c-Myc labels is purified in sample.When the carrier of immune absorption material is that agarose gel microsphere and silica gel are micro-
During ball, method is:Immune absorption material is washed with PBS (10mM, pH 7.2) first, sample extracting solution is added, pure water is then used
Drip washing, then the recombinant protein of label containing c-Myc of specific adsorption is eluted with glycine hydrochloride (pH 2.2), the eluent of collection,
Sample extracting solution after purification, can be used for subsequent analysis detection.When carrier is magnetic bead, method is:Immunomagnetic beads is added pure
In water, magnetic frame reclaims magnetic bead, and repeated washing 3~5 times, then by immunomagnetic beads addition sample extracting solution, is mixed, magnetic frame
Magnetic bead is reclaimed, after pure water cleans 3~5 times, the c-Myc labels for eluting specific adsorption with glycine hydrochloride (pH 2.2) recombinate egg
In vain, the eluent of collection, sample extracting solution as after purification can be used for subsequent analysis detection.
The present invention is single domain heavy chain antibody for the affine in immunity sorbing material aglucon of c-Myc labels, with SEQ ID
NO.:Amino acid sequence shown in 1, the aglucon can specific recognition c-Myc labels.The single domain heavy chain antibody is readily available, resistance to
Heat, it is single domain heavy chain antibody that can produce aglucon by biological method mass propgation, it is to avoid the cumbersome production such as artificial antibody
Method, greatly reduces production cost, and reusable, has a extensive future.
Specific embodiment
Below by the preparation and application of c-Myc label affine in immunity sorbing materials, the present invention will be further described, this
A little specific embodiments are not construed in any way as limiting range of application of the invention.
Embodiment 1:
The structure of anti-c-Myc labels single domain heavy chain antibody (i.e. for the single domain heavy chain antibody of c-Myc labels) non-immune libraries
By c-Myc labels and bovine serum albumin(BSA) (Bovine serum albumin, BSA) covalent coupling, c-Myc is obtained
Artificial antigen c-Myc-BSA, after taking 300 μ g c-Myc-BSA and Freund's complete adjuvant emulsification, enters to alpaca (Lama pacos)
The subcutaneous multi-point injection of row is immunized.Booster immunization is emulsified using 150 μ g c-Myc-BSA with incomplete Freund's adjuvant, and interval is entered for 2 weeks
OK, venous blood sampling after being immunized 7 days every time, serum titer, selection serum titer highest sample point are determined using indirect elisa method
From lymphocyte, RNA is extracted.
The extraction of RNA is carried out with reference to TAKARA companies RNAiso reagents specification.With RNA as template, oligo dT are to draw
Thing, with reference to the TAKARA companies reverse transcriptase specification synthesis chains of cDNA first.
Using PrimeSTAR high-fidelity DNA polymerases, the variable region encoding gene for obtaining heavy chain antibody through nest-type PRC (is adopted
1) primer is shown in Table.First round PCR expands cDNA with primer AlpVh-LD and CH2-R respectively, and reaction condition is, 98 DEG C,
10s, 55 DEG C, 20s, 72 DEG C, 1min, 20 circulations, 98 DEG C, 10s, 68 DEG C, 1min, 72 DEG C of extension 10min.
By first round PCR primer with 1.2% agarose gel electrophoresis, the DNA fragmentation of 600bp~750bp is reclaimed, as
The template of the second wheel PCR, respectively with primer AlpVh-SfiI and AlpVHHR1-NotI, AlpVh-SfiI and AlpVHHR2-
NotI, is expanded, and reaction condition is, 98 DEG C, 10s, 50 DEG C, 20s, 72 DEG C, 40s, 5 circulations, 98 DEG C, 10s, 68 DEG C,
40s, 30 circulations, 72 DEG C of extension 10min.Reclaimed through DNA fragmentation QIAquick Gel Extraction Kit, quantified, saved backup in -20 DEG C.To bite
Bacterium grain pHEN1 and pcr amplification product use Sfi I, Not I double digestions respectively, after Ago-Gel recovery, quantifying, are rubbed with 1: 3
You compare, and at 16 DEG C, overnight connect.
The library construction of table 1 and identification primer used
Note:Underscore represents restriction endonuclease recognition sequence
After connection product is through ethanol precipitation, 10 μ L sterilized waters are dissolved in, Electroporation Transformation e. coli tg1 is carried out in ten times.
The bacterium solution doubling dilution after 10 μ L electric shocks, culture is taken, ampicillin 2 × YT culture plates are coated with, storage capacity is calculated.Remainder is complete
Portion coats 24cm × 24cm ampicillin 2 × YT culture plates, 37 DEG C, is inverted 13~16h of culture.With 10mL, 2 × YT cultures
After base scrapes the lawn on culture plate, the glycerine of final concentration 20~30% is added, dispensed, -80 DEG C save backup.
According to calculate storage capacity result, inoculation 10 times of living cells of storage capacity in 20mL 2 × YT (contain 2% glucose,
100 μ g/mL ampicillins), 37 DEG C, 200r/min is cultivated to OD600Up to 0.5, helper phage is added by infection multiplicity 20: 1
Body, 37 DEG C, 200r/min, 60min.Culture is centrifuged, (100 μ g/mL ampicillins and 50 μ g/ are contained with the 2 × YT of 50mL
ML kanamycins) resuspended precipitation, 37 DEG C, after 200r/min incubated overnights, 8000rpm centrifuging and taking supernatants add 5 × PEG/NaCl
Solution, places 1.5h or 4 DEG C overnight on ice, and 8000rpm is centrifuged 30min, resuspended to be deposited in the phosphate buffer containing 10% glycerine
(PBS, 0.01M, pH 7.4), that is, obtain anti-c-Myc labels single domain heavy chain antibody non-immune libraries, takes 10 μ L and determines titre, remaining
- 80 DEG C are sub-packed in save backup.
Embodiment 2:
The elutriation of anti-c-Myc labels single domain heavy chain antibody and identification
Using the method for the affine elutriation of solid phase from the anti-c-Myc labels single domain heavy chain antibody non-immune libraries of gained of embodiment 1
Single domain heavy chain antibody of the elutriation for c-Myc labels.Merged to the Myc-GST for adding 120 μ L PBS to dilute in each enzyme mark hole
Albumen (albumen that Myc labels are merged with glutathione), 4 DEG C, overnight, the coating concentration for often taking turns elutriation is respectively 100 to coating,
75,50 μ g/mL;Coating buffer is suctioned out, PBS board-washings 5 times add 300 μ L 3%BSA-PBS per hole, 37 DEG C, close 2h;PBS board-washings
5 times, 100 μ L phage antibody libraries are added (containing about 1 × 1011CFU), 37 DEG C, it is incubated 2.0h;Uncombined bacteriophage is suctioned out,
With PBST (contain 0.5%Tween-20) board-washing 3-5 time (by wheel increase by 5 times), then with PBS board-washings 15-25 times;Eluted with 100 μ L
Bacteriophage of liquid (glycine-HCI, pH 2.2) the wash-out absorption in enzyme mark hole, with 35 μ L Tris-HCl (1mol/L, pH
8.0) eluate is neutralized, 10 μ L is taken for titer determination, next round elutriation is used for after the amplification of remaining 125 μ L eluate.
After through four-wheel elutriation, the monoclonal of random picking is rescued using helper phage KM13, respectively obtain exhibition
Show the phage particle of antibody variable region, then the binding activity and specificity of phage particle determined with indirect phage-ELISA,
Experiment setting control, specific load procedure is shown in Table 2.
The indirect phage-ELISA of table 2 is loaded table
Send the biotechnology service company to carry out sequencing ELISA positive colonies, obtain the DNA sequence dna of Insert Fragment,
Single domain heavy chain antibody of its coding for c-Myc labels.
DNA sequence dna (SEQ ID NO.:2):
CAGTTGCAGCTCGTGGAGTCAGGGGGAGGCGAGGTAAACCCTGGCGGATCTCTGACACTCTCCTGTGTA
GCTTCTGGATTCCCCTTCGGTATCAATATCATGAGCTGGGTCCGCCAGGTTCCAGGCAAGGAGCCCGAGTGGGTCGC
AGGTATTGATAATGGCGGCAGGCGTACAACATATGCGGACTCCGTGAGGGGCCGCTTCACCATCTCCAGAGACAACG
ACAAGAACACGTTATATCTACAGTTGGACAACCTCCAACCTAACGACACGGCCCTATATTACTGTTCGAGACAGGGG
TGGGGGCAACTTCCTGCAAAGCGCTACTGGGGCAAGGGAACCCTGGTCACCGTCTCCGCA
Coding has SEQ ID NO.:Amino acid sequence shown in 1:
QLQLVESGGGEVNPGGSLTLSCVASGFPFGINIMSWVRQVPGKEPEWVAGIDNGGRRTTYADSVRGRFTISRDNDKN
TLYLQLDNLQPNDTALYYCSRQGWGQLPAKRYWGKGTLVTVSA。
Embodiment 3:
It is prepared by the scale of anti-c-Myc labels single domain heavy chain antibody
Encode the acquisition of the DNA fragmentation of anti-c-Myc labels single domain heavy chain antibody:1. using restriction enzyme SfiI/
NotI, double digestion phasmid pHEN-anti-c-Myc single domain heavy chain antibody genes, agarose gel electrophoresis reclaims anti-c-Myc marks
Sign a bill domain heavy chain antibody genes;2. biotechnology service company directly is sent by anti-c-Myc labels single domain heavy chain antibody coded sequence
Carry out chemical synthesis;3. specific primer is designed, is expanded by the cDNA storehouses that round pcr is originated from alpaca (Lama pacos)
Increase.
The anti-c-Myc tags single domain heavy chain antibody genes fragment that will be obtained is cloned into expression vector pET25-flag
(by carrier, institute band c-Myc tag replacements are Flag labels in itself:DYKDDDDK), identified through PCR and digestion, build and complete anti-
The colibacillus expression plasmid of c-Myc label single domain heavy chain antibodies.
Expression plasmid is converted to Escherichia coli rosetta, picking single bacterium colony carries out induced expression.Single bacterium colony is accessed
In 5mL LB-A (the μ g/mL ampicillin of Luria-Bertani broth with 100) fluid nutrient medium, 37 DEG C, 220r/
Min shaken cultivations 12h;It is transferred in 50mL LB-A fluid nutrient mediums with the inoculum concentration of 1% culture volume, 37 DEG C,
220r/min shaken cultivations are to OD6000.5 (about needing 3~3.5h) is reached, the IPTG, 30 DEG C, 200r/ of final concentration 0.1mM is added
Min Fiber differentiations.
Induced cultures 8000r/min is centrifuged, and adds 25mL phosphate buffers (pH 7.4) to mix in cell precipitation,
8000r/min is centrifuged, and removes supernatant, retains cell precipitation;15mL same buffers are added in cell precipitation, is mixed, surpassed on ice
Sound wave clasmatosis is processed, and ultrasonication condition is 200W, crushes 2s, interval 5s, totally 250 circulations, broken to cell at 4 DEG C
The 8000r/min that minces is centrifuged 15min, and taking supernatant carries out affinitive layer purification and SDS-PAGE electrophoretic analysis, or adds in supernatant
Enter the glycerine of final concentration 20%, mix, be stored in -20 DEG C of refrigerator-freezers stand-by.
By optimizing induced expression condition (such as Host Strains, expression vector, Fiber differentiation time, temperature and IPTG concentration
Deng), destination protein (single domain heavy chain antibody) expression quantity can be further improved, it is largely to prepare anti-c-Myc labels single domain heavy chain
Antibody provides approach.
The amalgamation and expression of anti-c-Myc labels single domain heavy chain antibody:
Anti- c-Myc labels single domain heavy chain antibody genes of the invention are cloned into fusion expression vector pAP and (contain alkaline phosphatase
Enzyme gene), identified through PCR and digestion, build the alkaline phosphatase fusion expression matter for completing anti-c-Myc labels single domain heavy chain antibody
Grain.
Alkaline phosphatase can be with non-specific catalytic phosphatase monoesters hydrolysis generation inorganic phosphate and corresponding alcohol, phenol or carbohydrate
Compound.The enzyme is used for the detection methods such as ELISA, Western blotting, histochemistry frequently as signal element.Fusion expression plasmid will
Anti- c-Myc labels single domain heavy chain antibody is blended in the N-terminal of alkaline phosphatase, with reference to the expression in application example 3, Ke Yi
Expression in escherichia coli, it is purified into fusion protein AP-anti-c-Myc label single domain heavy chain antibodies.
The heat-resistant experiment of the nano antibody of anti-c-Myc labels
Tested by ELISA and nano antibody heat endurance is measured, experimental technique is as follows:
Concentration is taken for 5 μ g/mL Myc-GST albumen, in adding 96 hole elisa Plates with the μ L of every hole 100,4 DEG C of coatings are overnight;
0.05%PBST board-washings 3 times;3% 37 DEG C of closing l h of skim milk;The c-Myc nano antibodies after dilution are added, per the μ of hole 100
L, is incubated 1h by 37 DEG C;Add 1:The anti-His labels secondary antibody of 2000 working concentration HRP marks, 100 μ L are added per hole, 37 DEG C, are incubated
Educate 1h;TMB nitrite ions are added, 100 μ L are added per hole;30min is incubated at a temperature of in multigroup difference;After reaction terminates, add
2M sulfuric acid terminating reactions, 50 μ L are added per hole, and 450nm light absorption values are determined after mixing terminating reaction.
Even if result shows that temperature is up to 70 DEG C, 80 DEG C, 90 DEG C, protein active still has bioactivity, OD450Value point
Not Wei 1.5,1.4,1.2, with preferable heat resistance.
Embodiment 4:
It is prepared by a small amount of of c-Myc label affine in immunity magnetic beads
Using nanometer magnetic bead as carrier, after being coupled anti-c-Myc labels single domain heavy chain antibody, obtain c-Myc labels and be immunized
Magnetic bead, specific preparation method is as follows:
The magnetic bead of 1mg carboxyl modifieds is taken in centrifuge tube, 500 μ l activation buffers (10mM, NaH are added2PO4, pH
6.0), vortex mixed is uniform, and magnetic frame reclaims magnetic bead, then is washed with activation buffer 3 times.It is separately added into 2mg carbodiimides
(EDC) and N-hydroxy-succinamide (NHS), after vortex mixed, 25min is stood.With coupling buffer (10mM, Na2HPO4, pH
7.4) washing magnetic bead 3 times, addition is dissolved in anti-c-Myc labels single domain heavy chain antibody 1mg, the room temperature reaction 3.5h of coupling buffer,
Magnetic bead is washed with coupling buffer 5 times, add 500 μ l to contain 1% (w/v) bovine serum albumin(BSA) (BSA) or 1% (w/v) egg white egg
The coupling buffer of (OVA) closes unreacted active group, room temperature reaction 35min in vain.Magnetic bead 5 is washed with coupling buffer
It is secondary, PBS solution (10mM, pH 7.2,0.02%w/v, Na3N 4 DEG C are stored in after) resuspended.
Embodiment 5:
The preparation of c-Myc label affine in immunity sorbing materials and affinity column
Using agarose microbeads as carrier, anti-c-Myc labels single domain heavy chain antibody is coupled, specific preparation method is as follows:
The dry glue that CNBr is activated is washed 10 times with 0.1M HCl, 5min is balanced every time.With coupling buffer (10mM,
Na2HPO4, pH 7.2) wash 10 times, anti-c-Myc labels single domain heavy chain antibody (every gram of agarose microbeads of 2mg/) is added, room temperature is anti-
3.5h is answered, makes the agarose gel microsphere covalent coupling of anti-c-Myc labels single domain heavy chain antibody and CNBr activation.Buffered with coupling
Liquid (10mM, Na2HPO4, pH 7.2) and after washing 3 times, confining liquid room temperature reaction 2.5h is added closing unreacted active group.
The phosphate buffer (10mM, pH 7.2) and acetate buffer solution (0.1M, pH 4.5) accumulated with 6 times of colloids alternately washing 3 times, obtain
The covalent coupling affine in immunity sorbing material of anti-c-Myc labels single domain heavy chain antibody.Take the above-mentioned affine in immunity adsorption materials of 0.2ml
Expect the chromatographic column for 1ml in capacity, after 8~10 times of PBS of bed volume (10mM, pH 7.2) washings, add 20% ethanol molten
Liquid, 4 DEG C of preservations.
Embodiment 6:
The preparation of c-Myc label affine in immunity sorbing materials and affinity column
Using silica gel microball as carrier, anti-c-Myc labels single domain heavy chain antibody is coupled, specific preparation method is as follows:
Alternately washing 6~10 times of 2g silica gel microballs pure water and phosphate buffer (PBS, 10mM, pH 6.5) are taken, 10ml is used
PBS suspension silica gel microball, adds the anti-c-Myc labels single domain heavy chain antibodies of 5mg, mixes, and adds final concentration 5mg/ml's
Carbodiimide (EDC), rapid to mix, 4 DEG C of 12~20h of stirring reaction obtain the anti-c-Myc labels single domain heavy chain of covalent coupling and resist
The affine in immunity sorbing material of body.The above-mentioned affine in immunity sorbing materials of 0.2ml are taken in the chromatographic column that capacity is 1ml, 58~10 times
After PBS (10mM, the pH 6.5) washings of bed volume, add and contain 0.02% (w/v) Na3The PBS (10mM, pH 6.5) of N, 4 DEG C
Preserve.
Embodiment 7:
The adsorbance of c-Myc label affinity columns, reuse are determined
Pillars are cleaned with 6 times of bed volume PBS (10mM, pH 7.2), protein sample solution is added, efflux mistake again
Post.Then with 3 times of bed volume pure water drip washing, then being marked containing c-Myc for specific adsorption is eluted with glycine hydrochloride (pH 2.2)
Sign recombinant protein, the eluent of collection, protein solution as after purification.Test result indicate that, be filled with 1mL embodiments 5,6,
7 affinity column/the magnetic beads for preparing can be with specific adsorption destination protein.Reuse 10 times afterwards, the rate of recovery is still above 80%.
It is single domain heavy chain antibody that aglucon can be produced by biological method mass propgation, it is to avoid the cumbersome producer such as artificial antibody
Method, greatly reduces production cost, and reusable, has a extensive future.
SEQUENCE LISTING
<110>University Of Nanchang
<120>Affine in immunity sorbing material based on anti-c-Myc labels nano antibody
<130> 2017
<160> 9
<170> PatentIn version 3.3
<210> 1
<211> 124
<212> PRT
<213>Artificial sequence
<400> 1
Gln Leu Gln Leu Val Glu Ser Gly Gly Gly Leu Val Gln Pro Gly Glu
1 5 10 15
Ser Leu Thr Leu Thr Cys Val Ala Ser Gly Gly Thr Leu Glu Asn Trp
20 25 30
Asp Ile Ala Trp Phe Arg Gln Ala Pro Gly Lys Glu Arg Glu Gly Val
35 40 45
Ala Tyr Phe Ser Ser Asp Gly Ile Arg Asn Tyr Gly Asp Ser Met Arg
50 55 60
Gly Arg Phe Lys Ile Ser Arg Asp Asn Ala Lys Asn Thr Ala Trp Leu
65 70 75 80
Gln Met Asn Arg Leu Ser Val Glu Asp Thr Ser Thr Tyr Tyr Cys Ala
85 90 95
Ala Lys Glu Arg Val Gly Arg Ala Trp Arg Asn Asp Gly Leu Tyr Arg
100 105 110
Tyr Trp Gly Gln Gly Thr Gln Val Thr Val Ser Ser
115 120
<210> 2
<211> 372
<212> DNA
<213> Lama pacos
<400> 2
cagttgcagc tcgtggagtc agggggaggc ttggtgcagc ctggggagtc actgacgctc 60
acctgtgtag cctcaggcgg cactttggag aattgggata tagcctggtt ccgtcaggcc 120
ccagggaagg agcgtgaggg ggtcgcatat tttagtagtg atggtattag aaattatgga 180
gactccatga ggggccgatt caaaatctct agagacaacg ccaagaacac agcgtggctg 240
cagatgaatc gcctgagcgt tgaagacacg tccacatatt attgtgcggc caaagaaagg 300
gtcggacgtg catggcgaaa tgatggactt taccgctact ggggccaggg gacccaggtc 360
accgtctcct ca 372
<210> 3
<211> 18
<212> DNA
<213>Artificial sequence
<400> 3
cttggtggtc ctggctgc 18
<210> 4
<211> 49
<212> DNA
<213>Artificial sequence
<220>
<221> misc_feature
<222> (44)..(44)
<223> n is a, c, g, or t
<220>
<221> misc_feature
<222> (47)..(47)
<223> n is a, c, g, or t
<400> 4
tcgcggccca gccggccatg gcccagktgc agctcgtgga gtcnggngg 49
<210> 5
<211> 33
<212> DNA
<213>Artificial sequence
<400> 5
cgagtgcggc cgcggggtct tcgctgtggt gcg 33
<210> 6
<211> 34
<212> DNA
<213>Artificial sequence
<400> 6
cgagtgcggc cgcttgtggt tttggtgtct tggg 34
<210> 7
<211> 23
<212> DNA
<213>Artificial sequence
<400> 7
ggtacgtgct gttgaactgt tcc 23
<210> 8
<211> 24
<212> DNA
<213>Artificial sequence
<400> 8
agcggataac aatttcacac agga 24
<210> 9
<211> 20
<212> DNA
<213>Artificial sequence
<400> 9
gccccattca gatcctcttc 20
Claims (5)
1. a kind of c-Myc labels affine in immunity sorbing material, including carrier, is mounted in the aglucon on carrier, it is characterised in that should
Material is using the single domain heavy chain antibody of specific recognition c-Myc labels as aglucon, the single domain of the specific recognition c-Myc labels
Heavy chain antibody has SEQ ID NO.:Amino acid sequence shown in 1.
2. c-Myc labels affine in immunity sorbing material according to claim 1, it is characterised in that the aglucon is in SEQ
ID NO.:The energy and c-Myc of house of correction acquisition are carried out on the basis of amino acid sequence shown in 1 by random or site-directed mutagenesis technique
The antibody of label specific binding.
3. c-Myc labels affine in immunity sorbing material according to claim 1, it is characterised in that the carrier is magnetic bead.
4. c-Myc labels affine in immunity sorbing material according to claim 1, it is characterised in that the carrier is agar
Sugared microballoon.
5. c-Myc labels affine in immunity sorbing material according to claim 1, it is characterised in that the carrier is silica gel
Microballoon or porous material.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201710100127.4A CN106902750A (en) | 2017-02-23 | 2017-02-23 | Affine in immunity sorbing material based on anti-c Myc labels single domain heavy chain antibody |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201710100127.4A CN106902750A (en) | 2017-02-23 | 2017-02-23 | Affine in immunity sorbing material based on anti-c Myc labels single domain heavy chain antibody |
Publications (1)
Publication Number | Publication Date |
---|---|
CN106902750A true CN106902750A (en) | 2017-06-30 |
Family
ID=59208498
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201710100127.4A Pending CN106902750A (en) | 2017-02-23 | 2017-02-23 | Affine in immunity sorbing material based on anti-c Myc labels single domain heavy chain antibody |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN106902750A (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105396559A (en) * | 2015-12-02 | 2016-03-16 | 南昌大学 | Affinity adsorption material based on anti-aflatoxin nanometer antibody |
CN105498705A (en) * | 2015-12-02 | 2016-04-20 | 南昌大学 | Immune-affinity adsorbing material based on single-domain heavy chain antibody resisting to aflatoxin |
CN105968201A (en) * | 2016-02-03 | 2016-09-28 | 南昌大学 | Single-domain heavy-chain antibody aiming at prostate specific membrane antigen |
-
2017
- 2017-02-23 CN CN201710100127.4A patent/CN106902750A/en active Pending
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN105396559A (en) * | 2015-12-02 | 2016-03-16 | 南昌大学 | Affinity adsorption material based on anti-aflatoxin nanometer antibody |
CN105498705A (en) * | 2015-12-02 | 2016-04-20 | 南昌大学 | Immune-affinity adsorbing material based on single-domain heavy chain antibody resisting to aflatoxin |
CN105968201A (en) * | 2016-02-03 | 2016-09-28 | 南昌大学 | Single-domain heavy-chain antibody aiming at prostate specific membrane antigen |
Non-Patent Citations (2)
Title |
---|
汪世华等: "《抗体技术》", 31 March 2009 * |
许菲: ""抗c-Myc纳米抗体的淘选、表达及应用"", 《中国优秀硕士学位论文全文数据库医药卫生科技辑》 * |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN107085098A (en) | A kind of aflatoxin nano antibody affine in immunity sorbing material | |
CN107042091A (en) | Affine in immunity sorbing material based on specific recognition c Myc label nano antibodies | |
CN105968205B (en) | A kind of nano antibody of anti-prostate-specific membrane antigen | |
CN106188279A (en) | A kind of nano antibody of the specific recognition immunoglobulin Fc section in immune library source | |
CN107042090A (en) | Affine in immunity sorbing material based on specific recognition c Myc label single domain heavy chain antibodies | |
CN107042099A (en) | The affine in immunity material of Specific adsorption c Myc label single domain heavy chain antibodies | |
CN107042098A (en) | The affine in immunity material of Specific adsorption c Myc label nano antibodies | |
CN107042092A (en) | Affine sorbing material based on specific recognition c Myc label single domain heavy chain antibodies | |
CN107051397A (en) | The affine in immunity sorbing material of specific recognition c Myc label nano antibodies | |
CN107081136A (en) | Affine sorbing material based on anti-c Myc labels single domain heavy chain antibody | |
CN106831991A (en) | The nano antibody of anti-c Myc labels | |
CN106946990A (en) | A kind of nano antibody for c Myc labels | |
CN106902751A (en) | Affine in immunity sorbing material based on anti-c Myc label nano antibodies | |
CN106902750A (en) | Affine in immunity sorbing material based on anti-c Myc labels single domain heavy chain antibody | |
CN106831990A (en) | A kind of nano antibody that can specifically bind c Myc labels | |
CN106146653A (en) | For histidine-tagged single domain heavy chain antibody | |
CN106890622A (en) | Affine sorbing material based on anti-c Myc label nano antibodies | |
CN107043421A (en) | The single domain heavy chain antibody of anti-c Myc labels | |
CN106914229A (en) | Affine sorbing material based on specific recognition c Myc label nano antibodies | |
CN106946991A (en) | The nano antibody of c Myc labels can be specifically bound | |
CN106831993A (en) | A kind of single domain heavy chain antibody of specific recognition c Myc labels | |
CN106946992A (en) | For the single domain heavy chain antibody of c Myc labels | |
CN106831992A (en) | For the nano antibody of c Myc labels | |
CN106905430A (en) | A kind of single domain heavy chain antibody for c Myc labels | |
CN106946993A (en) | It is a kind of to specifically bind the single domain heavy chain antibody of c Myc labels |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
RJ01 | Rejection of invention patent application after publication | ||
RJ01 | Rejection of invention patent application after publication |
Application publication date: 20170630 |