CN106632689A - Polypeptide probe, kit comprising same and application of polypeptide probe or kit - Google Patents
Polypeptide probe, kit comprising same and application of polypeptide probe or kit Download PDFInfo
- Publication number
- CN106632689A CN106632689A CN201611209386.2A CN201611209386A CN106632689A CN 106632689 A CN106632689 A CN 106632689A CN 201611209386 A CN201611209386 A CN 201611209386A CN 106632689 A CN106632689 A CN 106632689A
- Authority
- CN
- China
- Prior art keywords
- probe
- polypeptide
- polypeptide probe
- cells
- amino acid
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K5/00—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof
- C07K5/04—Peptides containing up to four amino acids in a fully defined sequence; Derivatives thereof containing only normal peptide links
- C07K5/06—Dipeptides
- C07K5/06008—Dipeptides with the first amino acid being neutral
- C07K5/06017—Dipeptides with the first amino acid being neutral and aliphatic
- C07K5/0606—Dipeptides with the first amino acid being neutral and aliphatic the side chain containing heteroatoms not provided for by C07K5/06086 - C07K5/06139, e.g. Ser, Met, Cys, Thr
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12Q—MEASURING OR TESTING PROCESSES INVOLVING ENZYMES, NUCLEIC ACIDS OR MICROORGANISMS; COMPOSITIONS OR TEST PAPERS THEREFOR; PROCESSES OF PREPARING SUCH COMPOSITIONS; CONDITION-RESPONSIVE CONTROL IN MICROBIOLOGICAL OR ENZYMOLOGICAL PROCESSES
- C12Q1/00—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions
- C12Q1/34—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase
- C12Q1/37—Measuring or testing processes involving enzymes, nucleic acids or microorganisms; Compositions therefor; Processes of preparing such compositions involving hydrolase involving peptidase or proteinase
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5008—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics
- G01N33/5011—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing or evaluating the effect of chemical or biological compounds, e.g. drugs, cosmetics for testing antineoplastic activity
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/5005—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells
- G01N33/5091—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving human or animal cells for testing the pathological state of an organism
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/50—Fusion polypeptide containing protease site
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/70—Fusion polypeptide containing domain for protein-protein interaction
- C07K2319/73—Fusion polypeptide containing domain for protein-protein interaction containing coiled-coiled motif (leucine zippers)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/90—Enzymes; Proenzymes
- G01N2333/914—Hydrolases (3)
- G01N2333/948—Hydrolases (3) acting on peptide bonds (3.4)
- G01N2333/95—Proteinases, i.e. endopeptidases (3.4.21-3.4.99)
- G01N2333/964—Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue
- G01N2333/96402—Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from non-mammals
- G01N2333/96405—Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from non-mammals in general
- G01N2333/96408—Proteinases, i.e. endopeptidases (3.4.21-3.4.99) derived from animal tissue from non-mammals in general with EC number
- G01N2333/96413—Cysteine endopeptidases (3.4.22)
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2500/00—Screening for compounds of potential therapeutic value
- G01N2500/10—Screening for compounds of potential therapeutic value involving cells
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/04—Endocrine or metabolic disorders
- G01N2800/046—Thyroid disorders
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/10—Musculoskeletal or connective tissue disorders
- G01N2800/101—Diffuse connective tissue disease, e.g. Sjögren, Wegener's granulomatosis
- G01N2800/102—Arthritis; Rheumatoid arthritis, i.e. inflammation of peripheral joints
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/10—Musculoskeletal or connective tissue disorders
- G01N2800/101—Diffuse connective tissue disease, e.g. Sjögren, Wegener's granulomatosis
- G01N2800/104—Lupus erythematosus [SLE]
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2814—Dementia; Cognitive disorders
- G01N2800/2821—Alzheimer
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2835—Movement disorders, e.g. Parkinson, Huntington, Tourette
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2871—Cerebrovascular disorders, e.g. stroke, cerebral infarct, cerebral haemorrhage, transient ischemic event
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/28—Neurological disorders
- G01N2800/2878—Muscular dystrophy
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Urology & Nephrology (AREA)
- Hematology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Organic Chemistry (AREA)
- Analytical Chemistry (AREA)
- Biotechnology (AREA)
- Physics & Mathematics (AREA)
- Microbiology (AREA)
- Medicinal Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Cell Biology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pathology (AREA)
- Food Science & Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Biophysics (AREA)
- Toxicology (AREA)
- Genetics & Genomics (AREA)
- Wood Science & Technology (AREA)
- Zoology (AREA)
- General Engineering & Computer Science (AREA)
- Physiology (AREA)
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention relates to the field of biomedical treatment, in particular to a polypeptide probe, a kit comprising the probe and application of the polypeptide probe or the kit. The polypeptide probe is selected from a composition of the following substances and dimers thereof: X<1>-Y<1>-CC, where X<1> is a polypeptide with dimerization capability; Y<1> is selected from a restriction enzyme cutting site sequence of an enzyme to be detected. According to the probe, a simple and sensitive enzyme activity measurement method is further developed by fully utilizing the characteristic of a bi-arsenic dye-tetracysteine tag complex that the stability and the quantum yield greatly depend on the spatial conformation of a tetracysteine tag.
Description
Technical field
The present invention relates to biologic medical field, in particular to a kind of polypeptide probe, the kit comprising the probe and
Its application.
Background technology
Apoptosis is a kind of cell active death process controlled by gene, to the individual development of multicellular organism, just
Often cell turnover, tissue keep normal configuration and function to have positive and important meaning, and aberrant apoptotic then can cause to swell
The generation of the diseases such as knurl, nerve degenerative diseases.Apoptotic enforcement is caused by a series of cysteine proteinases
Cascade reaction come realize (Cold Spring Harb.Perspect.Biol., 2013,5 (4):A008656), in half Guang ammonia
In pepsin family, cysteine proteinase-3 belongs to effect type apoptosis enzyme, and the cysteine proteinase-3 of activation is degradable
A series of substrates, including apoptosis inhibitor, extracellular matrix and skelemin and DNA reparation correlation factors, make cellular biochemical
And morphology changes, cause Apoptosis (Oncogene, 2008,27 (48):6194-6206).Cysteine protein
Enzyme -3 is the key protein enzyme that Apoptosis performs the stage, therefore can be surveyed by determining the activity of cysteine proteinase-3
Determine apoptosis process.
The cysteine label system of double arsenic dyestuffs-four is a kind of mark of the living cells protein fluorescence with broad prospect of application
Method (Science, 1998,281 (5374):269-272).Within the system, four cysteine labels are one comprising four
Cysteine residues hexapeptide or dodecapeptide (Nat.biotechnol., 2005,23 (10):1308-1314), cysteine is residual
Base is combined together two-by-two, forms cysteine-cysteine bigeminy, and the two bigeminy are by proline-glycine bigeminy
Son is separated.Four cysteine labels have higher specificity and affinity to double arsenic dyestuffs.Double arsenic dyestuffs are by 1,2-
Dithioglycol does not fluoresce in the case of chelating, but will send very strong fluorescence once being combined with four cysteine labels.
In addition to existing in a linear fashion, two cysteine-cysteine bigeminy in four cysteine labels can be being divided
Leave come, but they spatially must mutually close on (Nat.Chem.Biol., 2007,3 (12):779-784).In the mark
In system, the space conformation of four cysteine labels can be stablized to forming double cysteine label compounds of arsenic dyestuff-four
Property and quantum yield produce strong influence (J.Am.Chem.Soc., 2002,124 (21):6063-6076).
Cysteine proteinase-3 generally exists in cell with inactive proenzyme, needs by the activated form apoptosis enzyme of upstream
Cut and activated.The cysteine proteinase-3 of activation can be with specificity cutting Asp-Glu-valine-day
A series of winter propylhomoserin tetrapeptide array, according to this characteristic, probe quilts based on Asp-Glu-valine aspartic acid
The activity for determining cysteine proteinase-3 is developed, corresponding method has fluorescence detection, electrochemical process, colorimetric
Method, surface plasmon resonance, biloluminescence method, electrogenerated chemiluminescence method.With the development of nanometer technology, some are based on and receive
Polypeptide probe such as quantum dot complex polypeptide probe, nm of gold complex polypeptide probe, the Graphene complex polypeptide probe of rice material
Be developed for use in determine cysteine proteinase-3 activity (Chem.rev., 2015,115 (22):12546-12629).
Additionally, some based on FRET reaction albumen probe and fluorescent switch (Nat.Commun., 2013;, 4:
2157) also it is developed for use in the activity for determining intracellular cysteine proteinase-3.In these methods, fluorescence labeling meeting
Cutting efficiency of the cysteine proteinase-3 to substrate is reduced to a certain extent, is prepared nano-sensor and is then caused detection process
Become complicated and poorly efficient.Therefore in the urgent need to developing simple, sensitive, efficient method determining intracellular cysteine albumen
The activity of enzyme -3 is so as to detecting apoptosis process.Additionally, this area detect other enzymes it is active when also more or less deposit
In the problems referred to above, and lack a kind of technology that efficiently can be detected for the activity of various enzymes.
In view of this, it is special to propose the present invention.
The content of the invention
In the present invention, we make full use of the stability and quantum of double cysteine label compounds of arsenic dyestuff-four to produce
Rate is very dependent on four cysteine Label space conformation this characteristic, devises a kind of new unmarked peptide molecule probe,
A kind of simple, method of sensitive determination enzymatic activity is further developed.
Before compound, composition, protein, peptide in the description present invention etc. and method, it will be appreciated that these enforcements
Mode is not limited to described ad hoc approach, scheme and reagent, this is because they can change.It is also understood that herein
The term for being used is only used for describing particular implementation purpose, and is not intended to limit the model of present embodiment or claim
Enclose.
In order to realize the above-mentioned purpose of the present invention, spy employs the following technical solutions:
A kind of polypeptide probe, the polypeptide probe is selected from following material and its dimeric composition:
X1-Y1-CC;
Wherein, X1It is the polypeptide with dimerization ability;
Y1Selected from the restriction enzyme site sequence of enzyme to be detected.
Wherein, X1The dimer that section is formed can be spontaneously formed, and (example also can be formed under other auxilins or subsidiary conditions
Such as X1Section some amino acid residues are modified or peptide fragment is in the hydrophobic environment), it is preferred that the dimer is to spontaneously form.
The probe includes at least three different functional areas, and CC is two cysteines, is combined with double arsenic dyestuffs
Position, for reading the activity of enzyme to be detected.(spontaneous) when not by cleavage to be detected, between polypeptide probe
Dimerization can cause two cysteine-cysteine bigeminy spatially close to each other, so as to be combined with double arsenic dyestuffs
Send stronger fluorescence;Conversely, the enzymolysis of enzyme to be detected can dissociate cysteine-cysteine bigeminy from polypeptide
Get off, although cut polypeptide still can dimerization, but lacked the position of the double arsenic dyestuff of grappling, double arsenic dyestuffs thus not
Can be luminous.Therefore, by the change of fluorescence before and after measure cutting, the activity of enzyme to be detected can be quantitative determined.
By changing Y1The sequence of section polypeptide, the probe that in theory present invention is provided can be to all with cutting peptide fragment ability
The activity of enzyme detected.
Preferably, polypeptide probe as above, the X1All or part of amino acid sequence be selected from D configuration amino
Acid.
Because during biological evolution, amino acid natural selection is L-type, biological internal enzyme None- identified simultaneously cuts D
Amino acids.This design can prevent X1Section also can effectively extend offer of the present invention by other protease Non-specific cleavages
Polypeptide probe half-life.
X1In section the amino acid of D configurations and L-configuration can cross arrangement, one L-configuration of such as one D configuration replaces phase
Connect, it is also possible to function as described above;Most preferably, X1Amino acid sequence all selected from D amino acids.
Preferably, polypeptide probe as above, the X1For leucine zipper, or comprising many of leucine zipper structure
Peptide.
Leucine zipper is a kind of supersecondary structure as Dimerized domain, and the alpha-helix for making to be parallel to each other it
Between produce adhesion.One leucine zipper contains multiple leucine residues, generally occurs as soon as one per seven amino acid residue
It is secondary, this results in the alpha-helix of a both sexes, hydrophobic region only side wherein.This hydrophobic region provides the region of dimerization,
Motif is pulled up as " slide fastener ".
In addition, the enlightenment of the technology contents for being provided according to the present invention, X1Section polypeptide can be according to egg common in biology
The albumen section for being responsible for dimerization in white dimer is designed, such as receptor tyrosine kinase, some nuclear receptor proteins, 14-
3-3 albumen, driving albumen, Factor XI, Factor XIII, Toll-like receptor, fiber original albumen, the β γ subunits two of G-protein
Aggressiveness etc., this is easy to those skilled in the art.Leucine zipper is only as most preferred technical scheme.
Preferably, X1Section polypeptide may be selected from following amino acid sequences:
QLEDKVEELLSKNYHLENEVARLKKLVG;
KLEALEGKLEAEGKGKLEAUGICLEALE;
GEIAALKQEIAALKKENAALKWEIAALKQGYY;
ASIARLEEKVKTLKAQNYELASTANMLREQVAQLGAP;
ASAAELEERVKTLKAEIYELQSEANMLREQIAQLGAP;
ASAAELEERVKTLKAEIYELQSEANMLREQGAP;
ASAAELEERVKTLKAEIYELQSEGAP;
ESKVSSLESKVSSLESKVSSLESKVSSLESKVSSLESKVSS。
It is furthermore preferred that above-mentioned amino acid sequence is D amino acids.
Preferably, polypeptide probe as above, the N-terminal of the polypeptide probe has carried out acetylation modification;
And/or;
The C-terminal of the polypeptide probe has carried out amidatioon modification.
The modification at polypeptide probe two ends can play a part of the stability for increasing probe.
Preferably, polypeptide probe as above, the X1With the Y1Between also include the Linker1 and/or Y1With
Also include Linker2 between the CC;
Preferably, the amino acid number of the Linker1 is 1~30, more preferably 1~5;
Preferably, the amino acid number of the Linker2 is 1~30, more preferably 1~5.
The amino acid quantity of Linker1 and Linker2 can be 1,2,3,4,5,6,7,8,9,10,11,12,13,14,
15th, 16,17,18,19,20,21,22,23,24,25,26,27,28,29 or 30.
The sequence of Linker1 and Linker2 can also be selected from (GGGGS) n, (GGGS) n, (GGS) n or Gn, and wherein n can be with
It is 1,2,3,4,5 or 6.
Preferably, polypeptide probe as above, the Y1Sequence be DEVD.
DEVD is the digestion position of cysteine proteinase-3 (Caspase3) and Caspase-7 (Caspase7)
Point.
Preferably, polypeptide probe as above, the X1Amino acid sequence for D configurations
asaaeleervktlkaeiyelrskanmlreqiaqlgap。
This sequence is the leucine zipper structure of D configurations.
Preferably, polypeptide probe as above, the amino acid sequence of the Linker2 is G.
A kind of polypeptide probe, for detecting the enzymatic activity of Caspase3 or Caspase7, its sequence is
asaaeleervktlkaeiyelrskanmlreqiaqlgapDEVDGCC;Wherein
Asaaeleervktlkaeiyelrskanmlreqiaqlgap is the amino acid of D configurations.
Preferably, the N-terminal and C-terminal of asaaeleervktlkaeiyelrskanmlreqiaqlgapDEVDGCC is carried out respectively
Acetylation and amidatioon modification.
A kind of diagnostic kit, it includes polypeptide probe as above, double arsenic dyestuffs, polypeptide described in cleavage to be detected
Probe buffer solution 1 used when obtaining digestion products and described pair of arsenic dyestuff are used when being marked to the digestion products
Buffer solution 2;
Preferably, the buffer solution 1 is containing the reducing agent for avoiding disulfide bond from occurring, it is furthermore preferred that the reduction
Agent is selected from dithiothreitol (DTT) and/or three (2- carbonylethyls) microcosmic salt hydrochlorates;
Preferably, the buffer solution 2 is containing for avoiding the combination of the single CC fragments and described pair of arsenic dyestuff
Eluant, eluent, it is furthermore preferred that the eluant, eluent is selected from 2,3- dimercapto -1- propyl alcohol and/or 1,2- dithioglycol.
Preferably, diagnostic kit as above, described pair of arsenic dyestuff is selected from ReAsH-EDT2、FlAsH-EDT2、
One or more in F2FlAsH or F4FlAsH.
Preferably, diagnostic kit as above, when the reducing agent is selected from dithiothreitol (DTT), the reducing agent
Concentration is 0.5~2mM.
Preferably, diagnostic kit as above, it is described when the eluant, eluent is selected from 2,3- dimercapto -1- propyl alcohol
The concentration of eluant, eluent is 0.03~0.10mM.
Polypeptide probe as above or diagnostic kit as above are in detection Y1In the activity of corresponding enzyme
Using;
Preferably, the detection is carried out in cell pyrolysis liquid or in body cell;
It is furthermore preferred that the cell selected from HeLa cells, NIH/3T3 cells, C6 cells, MCF7 cells, people's HCE cells,
Any one in Jurkat T cells, Huh-7 cells, DU145 cells, U-937 cells and HepG2 cells.
Polypeptide probe as above or diagnostic kit as described above are in detection individual cells in the activity of certain enzyme
Application.
Polypeptide probe as above or diagnostic kit as described above are in detection cysteine proteinase-3 and/or half Guang
Application in the activity of serine protease -7.
The application of polypeptide probe as above or diagnostic kit as described above in detection Apoptosis.
Preferably, the Apoptosis can be Apoptosis that abiogenous apoptosis, disease be caused or
The cell that the Apoptosis that environment is caused, such as ultraviolet irradiation, hydrogen peroxide, dexamethasone, TNF etc. are induced withers
The measure died.
Polypeptide probe as above or diagnostic kit as described above are being prepared and/or evaluated for treating Apoptosis
Application in the medicine of relevant disease;
Preferably, application as above, the apoptosis related disease is tumour, autoimmune disease or nerve
DD;
It is furthermore preferred that as above apply, the tumour includes:Leukaemia, lymthoma, SCCHN,
Lung cancer, cancer of the esophagus, liver cancer, colorectal cancer, breast cancer, oophoroma, cervical carcinoma, clear-cell carcinoma and melanoma;
It is furthermore preferred that as above apply, the autoimmune disease includes:Systemic lupus erythematosis, itself
Immunity lymphoproliferative syndrome, rheumatoid arthritis, thyroiditis;
It is furthermore preferred that as above apply, the nerve degenerative diseases include:Alzheimer, Huntington dance
Step disease, Parkinson's, apoplexy and amyotrophic lateral sclerosis.
A kind of method of diagnosis cell apoptosis-associated diseases, including:
By the cell pyrolysis liquid or Tissue lysates of main body to be diagnosed and polypeptide probe as above, or examine as mentioned above
Composition in disconnected kit is contacted, and the main body is diagnosed according to reaction gained signal value.
Preferably, the method for diagnosis cell apoptosis-associated diseases as above, the signal value is the polypeptide probe
The fluorescence signal value for producing is reacted with double arsenic dyestuffs.
Preferably, the method for diagnosis cell apoptosis-associated diseases as above, the main body is animal, is more preferably fed
Newborn animal, more preferably primate, are more preferably people.
Preferably, the method for diagnosis cell apoptosis-associated diseases as above, the apoptosis related disease is swollen
Knurl, autoimmune disease or nerve degenerative diseases;
It is furthermore preferred that the tumour includes:Leukaemia, lymthoma, SCCHN, lung cancer, cancer of the esophagus, liver
Cancer, colorectal cancer, breast cancer, oophoroma, cervical carcinoma, clear-cell carcinoma and melanoma;
It is furthermore preferred that the autoimmune disease includes:Systemic lupus erythematosis, LADA lymphocyte increase
Raw syndrome, rheumatoid arthritis, thyroiditis;
It is furthermore preferred that the neurodegenerative disorders include:Alzheimer, Huntington's disease, Parkinson's, in
Wind and amyotrophic lateral sclerosis.
Compared with prior art, beneficial effects of the present invention are:
1), peptide molecule probe does not have any mark, has preferable biocompatibility between enzyme to be detected, can improve
Cutting efficiency;
2), in the whole detection course of reaction of kit provided by the present invention, without separation and cleaning step, operation letter
Single and convenience;
3), detection pattern has flexibility, and probe can be marked by exciting with difference with double arsenic dyestuffs of launch wavelength
Note, thus there are ways to determine Level of Apoptosis;
4), the polypeptide probe for determining Caspase3 and Caspase7 of specific offer of the invention is by Amino acid profile,
The DNA of coded polypeptide probe is proceeded to intracellular, the apoptosis situation of individual cells can be determined.
Description of the drawings
In order to be illustrated more clearly that the specific embodiment of the invention or technical scheme of the prior art, below will be to concrete
The accompanying drawing to be used needed for embodiment or description of the prior art is briefly described, it should be apparent that, in describing below
Accompanying drawing is some embodiments of the present invention, for those of ordinary skill in the art, before creative work is not paid
Put, can be with according to these other accompanying drawings of accompanying drawings acquisition.
Fig. 1 is the performance measurement of new unmarked peptide molecule probe;(A) polypeptide probe and double arsenic dyestuff FlAsH-EDT2
With reference to the emission spectrum of formed compound;(B) polypeptide probe and double arsenic dyestuff FlAsH-EDT2Binding kineticses determine;
Fig. 2 is to quantitative determine vitro recombination cysteine proteinase-3 using novel probe;(A) cysteine proteinase-3
Cutting to polypeptide probe can reduce the fluorescence intensity of polypeptide probe-bis- arsenic dye compositions;What curve above was represented
It is Jun-CCC, what underlying curve was represented is Jun-CCC+ cysteine proteinase-3s;(B) to the quantitative analysis of figure A;
(C) activity of polypeptide probe specific assay cysteine proteinase-3;(D) cysteine proteinase-3 cutting causes fluorescence strong
The reduction (Δ F) of degree and the graph of a relation between cysteine proteinase-3 concentration;
Fig. 3 is to determine the apoptosis that staurosporine induces RAW264.7 cells using novel probe;(A) staurosporine induction
The apoptotic immunoblotting assays of RAW264.7;(B) polypeptide probe determines the apoptosis that staurosporine induces RAW264.7 cells;
(C) Ac-DEVD-CHO suppresses the immunoblotting assay of intracellular cysteine proteinase-3 active;(D) Ac-DEVD-CHO suppresses
The fluorescence analysis of cysteine proteinase-3 active in apoptotic cell.
Specific embodiment
Unless otherwise defined, all technologies for using of the present invention and scientific terminology have with belonging to disclosed embodiment
The identical implication that the those of ordinary skill in field is generally understood that.Although similar or equivalent with method of the present invention and material
Method and material can be used in the practice or test of present embodiment, but hereafter still describe suitable method and material.
All publications, patent application, patent and other bibliography that the present invention is referred to are incorporated into this by quoting full content
Wen Zhong.In the case of a conflict, this specification (including definition) will play dominating role.Additionally, material, method and embodiment are only
It is merely illustrative, and is not intended to limit.The further feature and advantage of embodiment will be from following detailed description of book and right
Become in requirement obvious.
In order to promote to understand implementations described herein this purpose, with reference to some embodiments, and will will use
Language-specific is describing these embodiments.Term as used herein is only used for describing specific embodiment purpose, and not purport
Limiting the scope of the present disclosure.
Embodiment of the present invention is described in detail below in conjunction with embodiment, but those skilled in the art will
Understand, the following example is merely to illustrate the present invention, and is not construed as limiting the scope of the present invention.It is unreceipted concrete in embodiment
Condition person, the condition advised according to normal condition or manufacturer is carried out.Agents useful for same or the unreceipted production firm person of instrument, are
The conventional products that commercially available purchase is obtained can be passed through.
In an embodiment of the present invention, for illustrating the effect of probe of the present invention as a example by the probe for determining Caspase3
Really.It is the design of the technical scheme of the embodiment including new unmarked peptide molecule probe, the performance measurement of novel probe, new
Probe quantitative determines four aspects of measure of vitro recombination cysteine proteinase-3, novel probe to apoptotic cell.
Embodiment
1. the design of new unmarked peptide molecule probe
Designed peptide molecule probe is named as Jun-CCC, and its sequence is asaaeleervktlkaeiyelrskanml
ReqiaqlgapDEVDGCC, the N-terminal and C-terminal of probe have carried out respectively acetylation and amidatioon modification to increase stablizing for probe
Property.The probe includes three different functional areas, and wherein asaaeleervktlkaeiyelrskanmlreqiaqlgap is
Dimerization functional areas, to prevent polypeptide probe by other protease Non-specific cleavages, the region is all by D- type amino acid structures
Into;DEVD is the specific cutting sequence of cysteine proteinase-3, by L-type Amino acid profile;Thereafter amino acid G is
Linker, to increase the flexibility that CC reacts with double arsenic dyestuffs;CC is the position combined with double arsenic dyestuffs, for reading half Guang
The activity of serine protease -3.When not cut by cysteine proteinase-3, between polypeptide probe from dimerization
Two cysteine-cysteine bigeminy can be caused spatially close to each other, so as to combined with double arsenic dyestuffs send compared with
Strong fluorescence;Conversely, the enzymolysis of cysteine proteinase-3 can solve cysteine-cysteine bigeminy from polypeptide
From getting off, although cut polypeptide still can dimerization, but lacked the position of the double arsenic dyestuffs of grappling, double arsenic dyestuffs thus
Can not light.Therefore, by the change of fluorescence before and after measure cutting, the activity of cysteine proteinase-3 can be quantitative determined,
And then measure apoptosis process.
2. the performance measurement of novel probe
To show that the combination of double arsenic dyestuffs and probe depends on the dimerization between probe to act on, we devise two simultaneously
Bar does not have the probe Jun of dimerization abilityP- CCC and CCC, wherein JunPThe sequence of-CCC is asaaepeervktpkaeiyeprs
The sequence of kanmpreqiaqpgapDEVDGCC, CCC is GCC, JunP- CCC is by the bright ammonia in dimerisation domain in Jun-CCC
Sour residue all sports proline residue to lose its dimerization function, and CCC is by the dimerization work(in disappearance Jun-CCC
Energy area is allowed to be unable to dimerization.In addition, the N-terminal and C-terminal of two polypeptides have carried out respectively acetylation modification and amidatioon modification.I
Determine Jun-CCC, JunPBinding ability between-CCC and CCC and double arsenic dyestuffs.As shown in Figure 1A, Jun-CCC can
To be combined with double arsenic dyestuffs, very strong fluorescence signal is produced, conversely, lacking the Jun of dimerization abilityP- CCC and CCC then can only
Some background fluorescence signals are produced, this is shown to be the probe of dimerization rather than single probe is in combination with double arsenic dyestuffs.Also,
Combination between Jun-CCC probes and double arsenic dyestuffs is that very rapidly the time of about ten minutes or so can just reach maximum
Fluorescence intensity (Figure 1B);Additionally, the combination between Jun-CCC probes and double arsenic dyestuffs is the more stable (equilibrium solution of measure
It is 3.17 ± 0.39 per liter of micromoles from constant).
3. quantitative determination of the novel probe to vitro recombination cysteine proteinase-3
Can be cut by cysteine proteinase-3 to determine probe Jun-CCC, we add 0.1 microlitre of 1 mmoles
Your per liter of Jun-CCC and 0.2 microlitre of cysteine proteinase-3 to 10 microlitres cutting buffer (25mM HEPES,
100mM NaCl, 1mM EDTA, 10%sucrose, 0.1%CHAPS, 1mM DTT, pH=7.4) in, and it is incubated one at 37 degree
Hour.The mixture is subsequently added to 40 microlitres and includes every liter of FlAsH-EDT of 1 micromole2Double arsenic dye marker buffer solutions
In (100mM TrisCl, 75mM NaCl, 1mM EDTA, 1mM DTT, 0.05mM BAL, pH=7.4), and in room temperature lucifuge
Incubation 30 minutes.We determine the fluorescence level (Fig. 2A) before and after enzymolysis.The cutting of cysteine proteinase-3 can cause
The fluorescence intensity of the double arsenic dye compositions of Jun-CCC- declines 30 times (Fig. 2 B).Further, we determine the probe can be special
Property determine cysteine proteinase-3 activity, it is general that we determine trypsase, fibrin ferment, class in identical reaction system
Dissection of the fibroin enzyme 1 to Jun-CCC, it will be seen that trypsase, fibrin ferment, ubiquitin-like proteins from Fig. 2 C
Enzyme 1 can not cut Jun-CCC, therefore, probe Jun-CCC can be with the activity of specific assay cysteine proteinase-3.Enter one
Step, we are mutually incubated Jun-CCC probes with variable concentrations cysteine proteinase-3, and determine every kind of concentration cysteine egg
White enzyme -3 causes the decline Δ F of fluorescence, the relation between Δ F and cysteine proteinase-3 concentration as shown in Figure 2 D, to calculate
The lowest detection for going out is limited to 0.128 nanograms per milliliter, better than existing most of detection method.
4. measure of the novel probe to apoptotic cell
Further, we determine the Apoptosis of staurosporine induction using probe Jun-CCC.We adopt
RAW264.7 cells induce the apoptosis of RAW264.7 cells using the staurosporine of 1 per liter of micromole as research model,
Simultaneously by not through any process cell as a control group.The apoptosis of cell is simultaneously using Western blot and based on spy
The fluorescence method of pin Jun-CCC is determining.Staurosporine is added to be clearly visible the appearance (figure of cysteine proteinase-3 large subunit
3A), show that intracellular cysteine proteinase-3 is successfully activated.It is consistent with immunoblot results, at staurosporine
Its fluorescence signal will be weaker than control group (Fig. 3 B) in the cell managed.Also, staurosporine induces the apoptosis of RAW264.7 cells
It is time dependent, with the increase of induction time, it may appear that more cysteine proteinase-3 large subunits and weaker
Fluorescence signal.For further verify fluorescence it is less be due to activating cutting institute of the cysteine proteinase-3 to probe Jun-CCC
Caused, we add cysteine proteinase-3 specific inhibitor Ac-DEVD-CHO to suppress intracellular cysteine
The activity of proteinase-3.As illustrated in figures 3 c and 3d, Ac-DEVD-CHO is added to change the albumen of cysteine proteinase-3
Amount, but can but cause fluorescence to recover, and the reduction for showing fluorescence is because cysteine proteinase-3 is cut to probe Jun-CCC
Cut what is caused.Therefore, probe Jun-CCC can be effectively to determine apoptotic.
Finally it should be noted that:Various embodiments above only to illustrate technical scheme, rather than a limitation;To the greatest extent
Pipe has been described in detail with reference to foregoing embodiments to the present invention, but it will be understood by those within the art that:Its
Still the technical scheme described in foregoing embodiments can be modified, either to which part or all technical characteristic
Carry out equivalent;And these modifications or replacement, do not make the essence disengaging various embodiments of the present invention skill of appropriate technical solution
The scope of art scheme.
Claims (10)
1. a kind of polypeptide probe, it is characterised in that the polypeptide probe is selected from following material and its dimeric composition:
X1-Y1-CC;
Wherein, X1It is the polypeptide with dimerization ability;
Preferably, the dimer is to spontaneously form;
Preferably, the X1All or part of amino acid sequence be selected from D amino acids;
Preferably, the X1For leucine zipper, or the polypeptide comprising leucine zipper structure;
Y1Selected from the restriction enzyme site sequence of enzyme to be detected;
Preferably, the N-terminal of the polypeptide probe has carried out acetylation modification;
And/or;
The C-terminal of the polypeptide probe has carried out amidatioon modification.
2. polypeptide probe according to claim 1, it is characterised in that the X1With the Y1Between also include Linker1
And/or the Y1Also include Linker2 between the CC;
Preferably, the amino acid number of the Linker1 is 1~5;
Preferably, the amino acid number of the Linker2 is 1~5.
3. polypeptide probe according to claim 1 and 2, it is characterised in that the Y1Sequence be DEVD.
4. polypeptide probe according to claim 3, it is characterised in that the X1Amino acid sequence for D configurations
asaaeleervktlkaeiyelrskanmlreqiaqlgap。
5. polypeptide probe according to claim 3, it is characterised in that the amino acid sequence of the Linker2 is G.
6. a kind of diagnostic kit, it includes polypeptide probe, double arsenic dyestuffs, the enzyme to be detected described in any one of Claims 1 to 5
Cutting the polypeptide probe and obtaining buffer solution 1 used during digestion products and described pair of arsenic dyestuff is carried out to the digestion products
Buffer solution 2 used during mark;
Preferably, the buffer solution 1 is containing the reducing agent for avoiding disulfide bond from occurring, it is furthermore preferred that reducing agent choosing
From dithiothreitol (DTT) and/or three (2- carbonylethyls) microcosmic salt hydrochlorates;Most preferably, the reducing agent is selected from dithiothreitol (DTT), and
The concentration of the reducing agent is 0.5~2mM;
Preferably, the buffer solution 2 be containing for avoiding the eluant, eluent that the single CC fragments are combined with described pair of arsenic dyestuff,
It is furthermore preferred that the eluant, eluent is selected from 2,3- dimercapto -1- propyl alcohol and/or 1,2- dithioglycol;Most preferably, the eluant, eluent
Selected from 2,3- dimercapto -1- propyl alcohol, and the concentration of the eluant, eluent is 0.03~0.10mM.
7. diagnostic kit according to claim 6, it is characterised in that described pair of arsenic dyestuff is selected from ReAsH-EDT2、
FlAsH-EDT2, one or more in F2FlAsH or F4FlAsH.
8. the diagnostic kit described in polypeptide probe described in any one of Claims 1 to 5 or any one of claim 6~7 exists
Detection Y1Application in the activity of corresponding enzyme;
Preferably, the detection is carried out in cell pyrolysis liquid or in body cell;
It is furthermore preferred that the cell selected from HeLa cells, NIH/3T3 cells, C6 cells, MCF7 cells, people's HCE cells,
Any one in Jurkat T cells, Huh-7 cells, DU145 cells, U-937 cells and HepG2 cells.
9. polypeptide probe or diagnostic kit described in any one of claim 6~7 described in any one of claim 3~5 is being examined
Application in surveying cysteine proteinase-3 and/or Caspase-7 activity.
10. polypeptide probe or diagnostic kit described in any one of claim 6~7 described in any one of claim 3~5 is being made
It is standby and/or evaluate for the application in the medicine for treating apoptosis related disease;
Preferably, the apoptosis related disease is tumour, autoimmune disease or nerve degenerative diseases;
It is furthermore preferred that the tumour includes:Leukaemia, lymthoma, SCCHN, lung cancer, cancer of the esophagus, liver cancer, knot
The carcinoma of the rectum, breast cancer, oophoroma, cervical carcinoma, clear-cell carcinoma and melanoma;
It is furthermore preferred that the autoimmune disease includes:Systemic lupus erythematosis, LADA lymphocytosis are comprehensive
Simulator sickness, rheumatoid arthritis, thyroiditis;
It is furthermore preferred that the nerve degenerative diseases include:Alzheimer, Huntington's disease, Parkinson's, apoplexy and
Amyotrophic lateral sclerosis.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201611209386.2A CN106632689B (en) | 2016-12-23 | 2016-12-23 | Polypeptide probe, kit containing same and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201611209386.2A CN106632689B (en) | 2016-12-23 | 2016-12-23 | Polypeptide probe, kit containing same and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN106632689A true CN106632689A (en) | 2017-05-10 |
CN106632689B CN106632689B (en) | 2020-04-14 |
Family
ID=58828417
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201611209386.2A Active CN106632689B (en) | 2016-12-23 | 2016-12-23 | Polypeptide probe, kit containing same and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN106632689B (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023178704A1 (en) * | 2022-03-25 | 2023-09-28 | 京东方科技集团股份有限公司 | Polypeptide probe, and preparation method therefor and use thereof |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101768625A (en) * | 2010-02-23 | 2010-07-07 | 厦门大学 | Pathogen detection method |
CN103667194A (en) * | 2013-12-06 | 2014-03-26 | 华中科技大学同济医学院附属同济医院 | Human liver cancer cell line for observing life period of hepatitis B virus in cells and applications thereof |
-
2016
- 2016-12-23 CN CN201611209386.2A patent/CN106632689B/en active Active
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101768625A (en) * | 2010-02-23 | 2010-07-07 | 厦门大学 | Pathogen detection method |
CN103667194A (en) * | 2013-12-06 | 2014-03-26 | 华中科技大学同济医学院附属同济医院 | Human liver cancer cell line for observing life period of hepatitis B virus in cells and applications thereof |
Non-Patent Citations (2)
Title |
---|
JODY M.MASON等: "Improved Stability of the Jun-Fos Activator Protein-1 Coiled Coil Motif", 《THE JOURNAL OF BIOLOGY CHEMISTRY》 * |
陈磊,姚祝军: "特异性的蛋白小分子荧光探针及其标记技术", 《生命科学》 * |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2023178704A1 (en) * | 2022-03-25 | 2023-09-28 | 京东方科技集团股份有限公司 | Polypeptide probe, and preparation method therefor and use thereof |
Also Published As
Publication number | Publication date |
---|---|
CN106632689B (en) | 2020-04-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
JP4298796B2 (en) | Compositions for the detection of proteases in biological samples and methods of use thereof | |
de Jong et al. | Ubiquitin‐based probes prepared by total synthesis to profile the activity of deubiquitinating enzymes | |
JP2005507650A (en) | Assays for novel fusion proteins and molecular binding | |
JPH10508471A (en) | Compositions for detecting proteases in biological samples and methods of using the same | |
US11360096B2 (en) | Complex BRET technique for measuring biological interactions | |
US7135325B2 (en) | Short enzyme donor fragment | |
DE602004013361D1 (en) | Amp | |
Byzia et al. | Activity profiling of aminopeptidases in cell lysates using a fluorogenic substrate library | |
US7166475B2 (en) | Compositions and methods for monitoring the modification state of a pair of polypeptides | |
Cheng et al. | Peptide cleavage induced assembly enables highly sensitive electrochemiluminescence detection of protease activity | |
Safa et al. | Direct measurement of deubiquitinating enzyme activity in intact cells using a protease-resistant, cell-permeable, peptide-based reporter | |
CN106632689A (en) | Polypeptide probe, kit comprising same and application of polypeptide probe or kit | |
JP2003508080A (en) | Compositions for detecting proteases in biological samples and methods of using the same | |
US11630109B2 (en) | Sensors and assays for ubiquitin or ubiquitin-like proteins | |
Shaw et al. | Activity of subtilisin Carlsberg in macromolecular crowding | |
JP5170407B2 (en) | Diabetes complication test reagent | |
Roth et al. | Ubiquitin Binds to a Short Peptide Segment of Hydrolase UCH‐L3: A Study by FCS, RIfS, ITC and NMR | |
McCallum et al. | Proton flux through the chloroplast ATP synthase is altered by cleavage of its gamma subunit | |
US7528230B2 (en) | Enhanced inserted yellow fluorescence protein and its application | |
Grant et al. | A novel sensing technique to detect thrombin | |
WO2014147191A1 (en) | Self-cell penetrating fluorescent peptide biosensors to probe and quantify cdk/cyclin kinases | |
Mo et al. | Prototypical Kinase Sensor Design Motifs for In Vitro and In Vivo Imaging | |
Cotton et al. | Expressed protein ligation: A new tool for studying protein structure and function | |
Agnew | Rapid Construction of Protein Capture Agents with Chemically Designed Stability and Antibody-Like Recognition Properties | |
AU2006200291A1 (en) | Compositions for the detection of enzyme activity in biological samples and methods of use thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
SE01 | Entry into force of request for substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant |