CN105770858A - Human-derived obesity inhibitory peptide - Google Patents
Human-derived obesity inhibitory peptide Download PDFInfo
- Publication number
- CN105770858A CN105770858A CN201610156484.8A CN201610156484A CN105770858A CN 105770858 A CN105770858 A CN 105770858A CN 201610156484 A CN201610156484 A CN 201610156484A CN 105770858 A CN105770858 A CN 105770858A
- Authority
- CN
- China
- Prior art keywords
- irs
- polypeptide
- mouse
- present
- aminoterminal
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title abstract description 66
- 208000008589 Obesity Diseases 0.000 title abstract description 17
- 235000020824 obesity Nutrition 0.000 title abstract description 17
- 230000002401 inhibitory effect Effects 0.000 title description 5
- 101710201824 Insulin receptor substrate 1 Proteins 0.000 claims abstract description 64
- 102100025087 Insulin receptor substrate 1 Human genes 0.000 claims abstract description 61
- 239000003814 drug Substances 0.000 claims abstract description 14
- 235000013305 food Nutrition 0.000 claims description 13
- 235000005911 diet Nutrition 0.000 claims description 6
- 230000037213 diet Effects 0.000 claims description 6
- 229920001184 polypeptide Polymers 0.000 abstract description 56
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 55
- 241000699666 Mus <mouse, genus> Species 0.000 abstract description 31
- 230000000694 effects Effects 0.000 abstract description 23
- 210000003486 adipose tissue brown Anatomy 0.000 abstract description 15
- 230000004069 differentiation Effects 0.000 abstract description 13
- 210000000593 adipose tissue white Anatomy 0.000 abstract description 12
- 238000007920 subcutaneous administration Methods 0.000 abstract description 12
- 150000001413 amino acids Chemical class 0.000 abstract description 8
- 241000699670 Mus sp. Species 0.000 abstract description 7
- 229940079593 drug Drugs 0.000 abstract description 5
- 235000009200 high fat diet Nutrition 0.000 abstract description 5
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 abstract description 3
- 238000010171 animal model Methods 0.000 abstract description 2
- 230000002265 prevention Effects 0.000 abstract description 2
- 230000001737 promoting effect Effects 0.000 abstract 1
- 210000001593 brown adipocyte Anatomy 0.000 description 20
- 210000000636 white adipocyte Anatomy 0.000 description 20
- 102000015494 Mitochondrial Uncoupling Proteins Human genes 0.000 description 18
- 108010050258 Mitochondrial Uncoupling Proteins Proteins 0.000 description 18
- 230000006698 induction Effects 0.000 description 18
- 210000004027 cell Anatomy 0.000 description 13
- 238000011956 best available technology Methods 0.000 description 12
- 238000000034 method Methods 0.000 description 12
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 11
- 238000012360 testing method Methods 0.000 description 10
- 238000001514 detection method Methods 0.000 description 9
- 230000008859 change Effects 0.000 description 7
- NPGIHFRTRXVWOY-UHFFFAOYSA-N Oil red O Chemical compound Cc1ccc(C)c(c1)N=Nc1cc(C)c(cc1C)N=Nc1c(O)ccc2ccccc12 NPGIHFRTRXVWOY-UHFFFAOYSA-N 0.000 description 6
- 238000010586 diagram Methods 0.000 description 6
- 238000010348 incorporation Methods 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 210000001789 adipocyte Anatomy 0.000 description 5
- 238000011529 RT qPCR Methods 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 230000037396 body weight Effects 0.000 description 4
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 4
- 150000002632 lipids Chemical class 0.000 description 4
- 108090000623 proteins and genes Proteins 0.000 description 4
- 102000004169 proteins and genes Human genes 0.000 description 4
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 238000006243 chemical reaction Methods 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 239000000835 fiber Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 208000031648 Body Weight Changes Diseases 0.000 description 2
- 241000288673 Chiroptera Species 0.000 description 2
- XUIIKFGFIJCVMT-GFCCVEGCSA-N D-thyroxine Chemical compound IC1=CC(C[C@@H](N)C(O)=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-GFCCVEGCSA-N 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 2
- 102000004877 Insulin Human genes 0.000 description 2
- 108090001061 Insulin Proteins 0.000 description 2
- 101100220687 Mus musculus Cidea gene Proteins 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 102000019280 Pancreatic lipases Human genes 0.000 description 2
- 108050006759 Pancreatic lipases Proteins 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- 239000002830 appetite depressant Substances 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000004579 body weight change Effects 0.000 description 2
- 230000004663 cell proliferation Effects 0.000 description 2
- 230000001079 digestive effect Effects 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 239000000975 dye Substances 0.000 description 2
- 230000002526 effect on cardiovascular system Effects 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 230000009246 food effect Effects 0.000 description 2
- 235000021471 food effect Nutrition 0.000 description 2
- 235000011389 fruit/vegetable juice Nutrition 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 238000007490 hematoxylin and eosin (H&E) staining Methods 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 229940125396 insulin Drugs 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 238000002156 mixing Methods 0.000 description 2
- JMANVNJQNLATNU-UHFFFAOYSA-N oxalonitrile Chemical compound N#CC#N JMANVNJQNLATNU-UHFFFAOYSA-N 0.000 description 2
- 229940116369 pancreatic lipase Drugs 0.000 description 2
- 231100000614 poison Toxicity 0.000 description 2
- 239000002574 poison Substances 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 238000001556 precipitation Methods 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000002062 proliferating effect Effects 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 229940034208 thyroxine Drugs 0.000 description 2
- XUIIKFGFIJCVMT-UHFFFAOYSA-N thyroxine-binding globulin Natural products IC1=CC(CC([NH3+])C([O-])=O)=CC(I)=C1OC1=CC(I)=C(O)C(I)=C1 XUIIKFGFIJCVMT-UHFFFAOYSA-N 0.000 description 2
- IQFYYKKMVGJFEH-OFKYTIFKSA-N 1-[(2r,4s,5r)-4-hydroxy-5-(tritiooxymethyl)oxolan-2-yl]-5-methylpyrimidine-2,4-dione Chemical compound C1[C@H](O)[C@@H](CO[3H])O[C@H]1N1C(=O)NC(=O)C(C)=C1 IQFYYKKMVGJFEH-OFKYTIFKSA-N 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 241000256844 Apis mellifera Species 0.000 description 1
- 208000000412 Avitaminosis Diseases 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 102000008131 Bone Morphogenetic Protein 7 Human genes 0.000 description 1
- 108010049870 Bone Morphogenetic Protein 7 Proteins 0.000 description 1
- 208000024172 Cardiovascular disease Diseases 0.000 description 1
- 108050004290 Cecropin Proteins 0.000 description 1
- 108020004705 Codon Proteins 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 108010092674 Enkephalins Proteins 0.000 description 1
- 108090000790 Enzymes Proteins 0.000 description 1
- 102000004190 Enzymes Human genes 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 206010064571 Gene mutation Diseases 0.000 description 1
- 102000007625 Hirudins Human genes 0.000 description 1
- 108010007267 Hirudins Proteins 0.000 description 1
- 206010020772 Hypertension Diseases 0.000 description 1
- 206010021135 Hypovitaminosis Diseases 0.000 description 1
- 102100021711 Ileal sodium/bile acid cotransporter Human genes 0.000 description 1
- 101710156096 Ileal sodium/bile acid cotransporter Proteins 0.000 description 1
- URLZCHNOLZSCCA-VABKMULXSA-N Leu-enkephalin Chemical class C([C@@H](C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 URLZCHNOLZSCCA-VABKMULXSA-N 0.000 description 1
- 208000017170 Lipid metabolism disease Diseases 0.000 description 1
- 101000796206 Mus musculus L-dopachrome tautomerase Proteins 0.000 description 1
- 241001597008 Nomeidae Species 0.000 description 1
- 208000001132 Osteoporosis Diseases 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 206010041243 Social avoidant behaviour Diseases 0.000 description 1
- 206010041969 Steatorrhoea Diseases 0.000 description 1
- 241000282898 Sus scrofa Species 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 230000002293 adipogenic effect Effects 0.000 description 1
- 210000000577 adipose tissue Anatomy 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 230000001195 anabolic effect Effects 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 235000002201 avitaminosis Nutrition 0.000 description 1
- 230000003796 beauty Effects 0.000 description 1
- 230000006399 behavior Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 244000309464 bull Species 0.000 description 1
- 210000000748 cardiovascular system Anatomy 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 239000013553 cell monolayer Substances 0.000 description 1
- 239000006285 cell suspension Substances 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 208000026106 cerebrovascular disease Diseases 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 238000004737 colorimetric analysis Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 229940088598 enzyme Drugs 0.000 description 1
- 210000002468 fat body Anatomy 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- JEIPFZHSYJVQDO-UHFFFAOYSA-N ferric oxide Chemical compound O=[Fe]O[Fe]=O JEIPFZHSYJVQDO-UHFFFAOYSA-N 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 210000004013 groin Anatomy 0.000 description 1
- 230000012447 hatching Effects 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 229940006607 hirudin Drugs 0.000 description 1
- WQPDUTSPKFMPDP-OUMQNGNKSA-N hirudin Chemical compound C([C@@H](C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC(OS(O)(=O)=O)=CC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CCCCN)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H]1NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@@H]2CSSC[C@@H](C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CO)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@H](C(=O)N[C@H](C(NCC(=O)N[C@@H](CCC(N)=O)C(=O)NCC(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N2)=O)CSSC1)C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=2C=CC(O)=CC=2)NC(=O)[C@@H](NC(=O)[C@@H](N)C(C)C)C(C)C)[C@@H](C)O)CSSC1)C(C)C)[C@@H](C)O)[C@@H](C)O)C1=CC=CC=C1 WQPDUTSPKFMPDP-OUMQNGNKSA-N 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 230000031700 light absorption Effects 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 208000020442 loss of weight Diseases 0.000 description 1
- 239000006166 lysate Substances 0.000 description 1
- 238000001819 mass spectrum Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 230000010534 mechanism of action Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 230000004660 morphological change Effects 0.000 description 1
- 230000000869 mutational effect Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 210000000653 nervous system Anatomy 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 150000007523 nucleic acids Chemical class 0.000 description 1
- 239000002773 nucleotide Substances 0.000 description 1
- 125000003729 nucleotide group Chemical group 0.000 description 1
- 230000000474 nursing effect Effects 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 230000010355 oscillation Effects 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 210000004896 polypeptide structure Anatomy 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 239000002795 scorpion venom Substances 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 1
- 238000004513 sizing Methods 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 239000003998 snake venom Substances 0.000 description 1
- 230000002269 spontaneous effect Effects 0.000 description 1
- 208000001162 steatorrhea Diseases 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 230000002992 thymic effect Effects 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- YNJBWRMUSHSURL-UHFFFAOYSA-N trichloroacetic acid Chemical compound OC(=O)C(Cl)(Cl)Cl YNJBWRMUSHSURL-UHFFFAOYSA-N 0.000 description 1
- 208000030401 vitamin deficiency disease Diseases 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- -1 without expression Proteins 0.000 description 1
- 239000012224 working solution Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/1703—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- A61K38/1709—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Marine Sciences & Fisheries (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Zoology (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention discloses a novel human-derived polypeptide capable of promoting white adipose browning and brown adipose differentiation. The polypeptide derived from IRS-1 protein and containing 56 amino acids is of great significance to prevention and treatment of obesity and complications thereof. An animal model is based on that a mouse only with IRS-1 amino terminal 56aa being kept is identified; compared with wild-type and heterozygous mice, the mouse is characterized in that subcutaneous white adipose tissues decrease obviously and brown adipose tissues in interscapular regions increase obviously, and is resistant to obesity caused by high-fat diet; compared with mice with IRS-1 genes being knocked out completely, the mouse with more brown adipose is capable of resisting the obesity and the complications thereof caused by high-fat diet, so that effect of IRS-1 amino terminal 56aa is determined primarily, and the technical problem of large side effect of slimming drugs in the prior art can be solved.
Description
Technical field
The present invention relates to biological technical field, particularly relate to a kind of humanized's obesity peptide for inhibiting.
Background technology
At present, the whole world has the population of nearly 1/5th to suffer from obesity, obesity can involve the multiple organ of whole body and
System, with diseases such as cardiovascular and cerebrovascular disease, hypertension, diabetes, blood fat disorder, OSAS even cancers
There is close association.Every year because of total more than the death toll because of war, the attack of terrorism and smoking of the fat and number of death
With;Additionally, obesity patient's especially child patient is because build obesity easily forms the individual character such as timidity, Social Withdrawal and behavior
Feature.Therefore, the focus that the most effectively obesity controlling, always scientists are explored.
Moving and going on a diet is safest method of weight-reducing, but obese patient is gone on a diet only with simple and being moved not
Obvious fat-reducing effect can be played, and people are extremely urgent to physically and mentally healthy and body shaping beauty treatment pursuit, so that newly
Type medicine becomes the only selection for the treatment of obesity.At present slimming drugs the most on the market probably can be divided into appetite inhibitor,
Pancreatic lipase inhibitor and thyroxine preparation etc..
But, slimming drugs are while quick weight-lossing is shaped, mostly with multiple side effect and bad reaction.Such as appetite
Inhibitor can cause nervous system, intestines and stomach and cardiovascular system bad reaction;Pancreatic lipase inhibitor can cause steatorrhea, makes
Become fat-soluble avitaminosis, may also result in hepatic disorder simultaneously;Thyroxine preparation makes fat body during loss of weight
Weight excessively reduces, and causes osteoporosis and cardiovascular bad reaction.
Polypeptide drugs have molecular structure transformation little, easy synthesis, purity is high, biologically active is high, pharmaceutical dosage is little, security
The plurality of advantages such as height, high specificity, industrialization development are with the obvious advantage, is widely used to tumour, hepatitis, AIDS, generation at present
The prevention of thanking property disease etc., diagnose and treat, there is wide Prospect of R & D.Polypeptide can be divided into two big classes: endogenous polypeptide, i.e.
Endogenous polypeptide (such as enkephalins, thymic peptide, pancreas polypeptide etc.) that human body is intrinsic and exogenous polypeptid are (such as snake venom, sialic acid, honeybee
Poison, frog poison, scorpion venom, hirudin, an ancient wind instrument spiral shell toxin derivant and the cecropin etc. of fly secretion).Wherein, endogenous polypeptide structure is clear
Chu, mechanism of action clearly, quality level close to traditional small-molecule chemical medicine, activity close to pharmaceutical grade protein, self
Immune response is inconspicuous, and above feature becomes the main source of polypeptide drugs.
Summary of the invention
The present invention provides a kind of humanized's obesity peptide for inhibiting, to solve the technology that in prior art, fat-reducing medicine side effect is big
Problem.
The present invention provides a kind of IRS-1 aminoterminal 56aa application in preparing slimming medicine.
Preferably, the described IRS-1 aminoterminal 56aa concentration that plays a role is 0.4-2 μ g/ml.
Preferably, the described IRS-1 aminoterminal 56aa concentration that plays a role is 1 μ g/ml.
The present invention provides a kind of IRS-1 aminoterminal 56aa application in preparing diet food.
Preferably, the described IRS-1 aminoterminal 56aa concentration that plays a role is 0.4-2 μ g/ml.
Preferably, the described IRS-1 aminoterminal 56aa concentration that plays a role is 1 μ g/ml.
The technical scheme that embodiments of the invention provide can include following beneficial effect:
The present invention be a kind of based on humanized, have promote white adipose brown and brown fat differentiation novel many
Peptide, this polypeptide derives from IRS-1 albumen, comprises 56 amino acid, has important function in the fat preventing and treating with its complication.
The animal model of the present invention is according to being: we identify a kind of mouse only retaining IRS-1 aminoterminal 56aa, compared with wild type and miscellaneous
Zygote is compared by mouse, and the subcutaneous white adipose tissue of this mouse significantly reduces, interscapular region BAT showed increased, and
IRS-1-/-Mouse can resist the obesity caused by high fat diet.Compared with the mouse that IRS-1 gene is rejected completely, this mouse has
There is more brown fat, and obesity and the complication thereof of high fat diet induction can be resisted, thus primarily determine that in vivo
The effect of IRS-1 aminoterminal 56aa, can solve the technical problem that in prior art, fat-reducing medicine side effect is big.
It should be appreciated that it is only exemplary and explanatory, not that above general description and details hereinafter describe
The present invention can be limited.
Accompanying drawing explanation
Figure 1A is the genotype mice figure figure provided in the embodiment of the present invention;
Figure 1B is each mouse genotypes white adipose tissue and BAT's body weight provided in the embodiment of the present invention
Ratio chart;
Fig. 1 C is the food effect experimental result picture provided in the embodiment of the present invention;
Fig. 1 D is the three kinds of subcutaneous white adipose tissue of mouse genotypes provided in the embodiment of the present invention and interscapular region palm fibre
The HE staining versus figure of look adipose tissue;
Fig. 1 E is the qPCR test knot of the three kinds of subcutaneous white adipose tissue of mouse genotypes provided in the embodiment of the present invention
Fruit figure;
Fig. 1 F is the WB test result of the three kinds of subcutaneous white adipose tissue of mouse genotypes provided in the embodiment of the present invention
Figure;
Fig. 1 G is that the qPCR of the three kinds of mouse genotypes interscapular region BATs provided in the embodiment of the present invention surveys
Test result figure;
Fig. 1 H is the WB test of the three kinds of mouse genotypes interscapular region BATs provided in the embodiment of the present invention
Result figure;
Fig. 2 A is the molecular secondary structural representation of the IRS-1 provided in the embodiment of the present invention;
Fig. 2 B is the three-dimensional structure schematic diagram of the IRS-1 molecule provided in the embodiment of the present invention;
Fig. 3 A is that the polypeptide analysis device provided in the embodiment of the present invention measures IRS-1 aminoterminal 56aa polypeptide physicochemical property
Test result figure;
Fig. 3 B is the mass spectrogram of the purifying IRS-1 aminoterminal 56aa polypeptide provided in the embodiment of the present invention;
Fig. 4 A is that the mtt assay provided in the embodiment of the present invention measures the variable concentrations polypeptide propagation to front white adipocyte
Effect figure;
Fig. 4 B is that the mtt assay provided in the embodiment of the present invention measures the variable concentrations polypeptide propagation to front brown fat cell
Effect figure;
Fig. 4 C is to provide in the embodiment of the present invention3It is thin to front white adipose that H-TdR incorporation methods measures variable concentrations polypeptide
The multiplication effect figure of born of the same parents;
Fig. 4 D is to provide in the embodiment of the present invention3It is thin to front brown fat that H-TdR incorporation methods measures variable concentrations polypeptide
The multiplication effect figure of born of the same parents;
Fig. 4 E is that in the embodiment of the present invention, before the polypeptide intervention of the variable concentrations gradient of offer, white adipocyte becomes fat to lure
Lead rear UCP1 and express tendency chart;
Fig. 4 F is that in the embodiment of the present invention, before the polypeptide intervention of the variable concentrations gradient of offer, brown fat cell becomes fat to lure
Lead rear UCP1 and express tendency chart;
Fig. 5 A is the 9th day oil red O stain pair after the front white adipocyte brownization induction provided in the embodiment of the present invention
Than figure;
Fig. 5 B is the 9th day oil red O stain comparison diagram after the front brown fat cell induction provided in the embodiment of the present invention;
Fig. 5 C is white adipocyte brownization induction UCP1 expression change before the WB detection provided in the embodiment of the present invention
Figure;
Fig. 5 D is UCP1 expression variation diagram after the front brown fat cell induction of WB detection provided in the embodiment of the present invention.
Detailed description of the invention
Here will illustrate exemplary embodiment in detail, its example represents in the accompanying drawings.Explained below relates to
During accompanying drawing, unless otherwise indicated, the same numbers in different accompanying drawings represents same or analogous key element.Following exemplary embodiment
Described in embodiment do not represent all embodiments consistent with the present invention.On the contrary, they are only with the most appended
The example of the device that some aspects that described in detail in claims, the present invention are consistent.
Each embodiment in this specification all uses the mode gone forward one by one to describe, identical similar portion between each embodiment
Dividing and see mutually, what each embodiment stressed is the difference with other embodiments.
The explanation of the abbreviation appeared in the present invention:
IBAT: interscapular region BAT
SWAT: subcutaneous white adipose tissue
HE: haematoxylin eosin staining procedures
WB: protein imprinted
QPCR: real time fluorescent quantitative nucleic acid amplification detects
MTT: colorimetric method
3H-TdR: tritiated thymidine
DMSO: dimethyl sulfoxide (DMSO)
PBS: phosphate buffer
TCA: trichloroacetic acid
RhBMP7: humanized's BMP-7
Insulin: insulin
T3: trilute
IBMX:3-isobutyl group-1-methyl xanthine
Dex: dexamethasone
The amino acid sequence of IRS-1 aminoterminal 56aa: MASPPESDGFSDVRKVGYLRKPKSMHK
RFFVLRAASEAGGPARLEYYENEKKWRHK, the nucleotides sequence encoding described humanized's obesity peptide for inhibiting is classified as:
atggcgagccctccggagagcgatggcttctcagacgtgcgcaaggtgggctacctgcgcaagcccaagagtatgca
taagcgctttttcgtgctgcgggcggccagcgaggccgggggcccagcgcgcctggagtattatgagaacgagaaga
agtggcggcacaagtcg.Spontaneous gene mutation can cause the sequence after IRS-1 coding aminoterminal 56 amino acids the most eventually
Only.
Embodiment 1
IRS-1-/-Mouse phenotype checking and sWAT and iBAT change:
Randomly select the 1 sub-IRS-1 of monthly age Male homozygous-/-, heterozygote IRS-1+/-And wild type IRS-1+/+Each 3 of mouse,
Take iBAT, sWAT respectively and weigh, relatively each mouse genotypes white and BAT's body weight ratio;HE dyes observation group
Knit morphological change;The differential expression of WB and qPCR detection brown fat mark UCP1.56aa regulation and control before internal confirmation IRS-1
BAT differentiation and sWAT brown.
Refer to Figure 1A, show in the embodiment of the present invention provide genotype mice figure figure, picture from a left side to
The right side is followed successively by the IRS-1 at 1 monthly age-/-、IRS-1+/-And IRS-1+/+Mouse.By Figure 1A it can be seen that IRS-1 protein function lacks
IRS-1-/-Mouse, with IRS-1+/-And IRS-1+/+Mouse is compared, and build is the most modest, loses weight.
Refer to Figure 1B, each mouse genotypes white adipose tissue and brown fat provided is provided in the embodiment of the present invention
Fat organizer anharmonic ratio illustration.From Figure 1B, IRS-1-/-Mouse subcutaneous white adipose tissue weight ratio significantly reduces, and iBAT
Mass body anharmonic ratio dramatically increases, and illustrates that (i.e. in IRS-1, amino acid sequence is the IRS-1 aminoterminal 56aa that the present invention provides
The polypeptide of MASPPESDGFSDVRKVGYLRKPKSMHK RFFVLRAASEAGGPARLEYYENEKKWRHK) there is promotion white
The function of fat brown.
Refer to Fig. 1 C, the food effect experimental result picture provided is provided in the embodiment of the present invention.The present embodiment is random
Choose the 1 sub-IRS-1 of monthly age Male homozygous-/-And wild type IRS-1+/+Mouse feeds common food and high lipid food 16 weeks respectively,
In figure, curve C-IRS-1-/-And C-IRS-1+/+Represent that homozygote and wild-type mice feed the body weight change of common food respectively
Change;Curve HF-IRS-1-/-And HF-IRS-1+/+Represent that homozygote and wild-type mice feed the body weight change of high lipid food respectively
Change.From Fig. 1 C, no matter IRS-1-/-The nursing food of mouse is common food or high lipid food, its body weight the most relatively IRS-1+/+Mouse is greatly reduced, and IRS-1-/-Mouse is being fed in the case of high lipid food, body weight relatively IRS-1+/+Mouse is fed common
Food is also light, thus illustrates, IRS-1-/-Mouse can resist the obesity caused by high fat diet.
Refer to Fig. 1 D, the HE dye of three kinds of mouse genotypes sWAT and the iBAT provided is provided in the embodiment of the present invention
Look.The visible IRS-1 of HE dyeing-/-Mouse sWAT volume is obviously reduced, and is dispersed with the more little fat in many rooms and drips;Meanwhile, IRS-
1-/-Mouse iBAT relatively wild type is compared with heterozygote, drips containing substantial amounts of little fat, illustrates that IRS-1 aminoterminal 56aa can promote
White adipose brown and the differentiation of brown fat.
Refer to Fig. 1 E, Fig. 1 F, Fig. 1 G and Fig. 1 H, the three kinds of genotype provided in the shown respectively embodiment of the present invention are little
The three kinds of mouse genotypes provided in qPCR and the WB test result figure of the subcutaneous white adipose tissue of mouse and the embodiment of the present invention
QPCR and the WB test result figure of interscapular region BAT.From Fig. 1 E and Fig. 1 F, the subcutaneous white adipose of homozygote
Show that brown fat mark UCP1, PGC1a and Cidea mrna expression relatively other two kinds of genotype substantially raise, at protein level
On, homozygote IRS-1, without expression, UCP1 up-regulated, these results suggest that the subcutaneous white adipose tissue of homozygote exists white
Fat brown phenomenon.From Fig. 1 G and Fig. 1 H, homozygote and heterozygote interscapular region BAT UCP1, PGC1a
And Cidea mrna expression relatively wild type substantially raises, on protein level, homozygote IRS-1 is without expression, UCP1, PGC1a table
Reach rise, these results suggest that homozygote interscapular region BAT exists the phenomenon of differentiation.
Embodiment 2
IRS-1 aminoterminal 56aa analyzes
Refer to Fig. 2 A, the molecular secondary structural representation of the IRS-1 provided is provided in the embodiment of the present invention.Fig. 2 A table
Bright IRS-1 gene comprises the N-terminal high conservative of PH and PTB domain.56 amino acid whose sequences of N end are entered by further
Row is analyzed and is found: 56aa is high conservative in people, mouse, chicken, pig even frog.Refer to Fig. 2 B, show the present invention
The three-dimensional structure schematic diagram of the IRS-1 molecule provided in embodiment.This section of polypeptide of 56aa is carried out three-dimensional structural analysis discovery: this
56aa can form the structure of 4 hairpin structures, hairpin structure herein and other parts of IRS-1 the most not at the N end of IRS-1
With, the 56aa further illustrating IRS-1N end has specific function.
Embodiment 3
According to IRS-1 aminoterminal 56aa sequent synthesis polypeptide and analysis of physical and chemical property thereof
56aa sequence MASPPESDGFSDVRKVGYLRKPKSMHKRFFVLRAASEAGGPAR is encoded according to people's IRS-1 aminoterminal
LEYYENEKKWRHK, specific as follows: (the 6th and 7 amino acids people ES, mouse DT, 57aa codon c-a are IRS-
1-/-The mutational site of mouse, is terminator codon by mutant serine):
Refer to Fig. 3 A, it is many that the polypeptide analysis device that showing in the embodiment of the present invention provides measures IRS-1 aminoterminal 56aa
The test result figure of peptide physicochemical property.From Fig. 3 A, application polypeptide analysis program also carries out physics and chemistry to IRS-1 aminoterminal 56aa
Character finds: this section of polypeptide molecular weight 6540.5Da, net charge during isoelectric point 10.5, PH=7, and average hydrophilicity 0.5 is hydrophilic
Residue ratio 45%, favorable solubility in water.Synthesize IRS-1 aminoterminal 56aa polypeptide fragment according to amino acid sequence and carry out
Functional study.
Refer to Fig. 3 B, the mass spectrogram of the purified polypeptide provided is provided in the embodiment of the present invention.From Fig. 3 B, this
The theoretical molecular of bright polypeptide is 6540.5Da (100%M+H), Mass Spectrometer Method condition: flow velocity, 1.0ml/min, and wavelength is
220nm, volume is 20 μ l, and flow phase system is 0.1% trifluoracetic acid/second cyanogen solution-0.1% trifluoracetic acid/aqueous solution, purifies
The mass spectrum of polypeptide shows, its molecular weight is consistent with calculated value, and after synthesis, its purity is 95.97%.
Embodiment 4
Polypeptide is to front white adipocyte and the proliferative effect of front brown fat cell
White adipocyte and front brown fat cell before the polypeptide of variable concentrations gradient is intervened be set, respectively row MTT and3H-TdR incorporation methods surveys cell proliferation, intervenes PECTORAL LIMB SKELETON with the polypeptide of variable concentrations simultaneously, then carries out into brown fat
Induction differentiation, detects brown fat label UCP1, finally determines that the intervention concentration intervening cells play effect is 0.4-2 μ g/
Ml, optimal peptide concentration is 1 μ g/ml.
1, before mouse primary, brown fat cell and front white adipocyte are cultivated: (following steps are the most in an aseptic environment
Carry out)
(1) front white adipocyte is cultivated:
S11: take mouse in 7-10 days ages 6, along ventrimeson incision of skin, scissors blunt separation skin and peritoneal tissues are also cut
Open skin at lower abdomen and groin, take iliac region and subcutaneous white adipose;
S12: after being cut into small pieces by above-mentioned subcutaneous white adipose, uses 1mg/ml clostridiopetidase A to digest 45 at a temperature of 37 DEG C
Minute, repeatedly dispel mixing;
S13: when digestive juice becomes liquid completely, terminates digestion with the F12/DMEM culture medium containing 10% hyclone, and
The adipocyte of maturation is fallen at 70 μm strainer filterings;
S14:1200rpm × 10min is centrifuged, and outwells supernatant, is centrifuged again, so repeats two after the resuspended precipitation of complete medium
Time, cell is precipitated resuspended after plant in the culture dish of 3.5cm, 37 DEG C, 5%CO2Cultivate under environment.
(2) front brown fat cell is cultivated:
S21: take mouse in 2-3 days ages 6, along dorsal midline incision of skin, scissors blunt separation skin and hypodermis, takes
Interscapular region BAT;
S22: after above-mentioned interscapular region BAT being cut into small pieces, uses 1mg/ml clostridiopetidase A the temperature of 37 DEG C
Lower digestion 45 minutes, dispels mixing repeatedly;
S23: when digestive juice becomes liquid completely, terminates digestion with the F12/DMEM culture medium containing 10% hyclone, and
The adipocyte of maturation is fallen at 70 μm strainer filterings;
S24:1200rpm × 10min is centrifuged, and outwells supernatant, is centrifuged again, so repeats two after the resuspended precipitation of complete medium
Time, cell is precipitated resuspended after plant in the culture dish of 3.5cm, 37 DEG C, 5%CO2Cultivate under environment.
2, brown fat cell and front white adipocyte propagation before MTT detection
S31: collect logarithmic phase cell, adjusts concentration of cell suspension, and every hole adds 100 μ l, and bed board makes front white adipose thin
Born of the same parents and front brown lipocyte density are 5 × 103/ hole;
S32:5%CO2, hatch under conditions of 37 DEG C, be paved with (96 hole flat underside) at the bottom of hole to cell monolayer, after 12 hours,
Add the polypeptide intervention (0,10 of variable concentrations gradient-3, 10-2,10-1, 1,2,5 μ g/ml), every hole 100 μ l, each concentration sets 8
Multiple hole, and stay 8 blank well;
S33:5%CO2, after hatching 24 hours under conditions of 37 DEG C, every hole add 10 μ l MTT solution (5mg/ml, i.e.
0.5%MTT), terminate cultivating after continuing to cultivate 4 hours, carefully suck nutrient solution in hole;
S34: every hole adds 100 μ l DMSO, puts low-speed oscillation 10 minutes on shaking table, makes crystal fully dissolve, and joins at enzyme
The light absorption value in each hole is measured at immune detector 490nm.
Refer to Fig. 4 A and Fig. 4 B, the shown mtt assay provided that is respectively in the embodiment of the present invention measures variable concentrations polypeptide
The mtt assay provided in the multiplication effect figure of front white adipocyte and the embodiment of the present invention is measured variable concentrations polypeptide to front palm fibre
The multiplication effect figure of look adipocyte.From Fig. 4 A and Fig. 4 B, front white adipocyte and front brown fat cell MTT curve
Figure shows that polypeptide promotes that the concentration range of cell proliferation is 0.4-2 μ g/ml, and both OD values all reach when concentration is 1 μ g/ml
Big value, illustrating that polypeptide intervenes the concentration of cells play effect is 0.4-2 μ g/ml, and the most most preferably intervening concentration is 1 μ g/ml.
3、3Brown fat cell and front white adipocyte propagation before the detection of H-TdR incorporation methods
Principle illustrates: thymidine (TdR) is the distinctive base of DNA, is also the required material of DNA synthesis, apparatus
Active isotope3H mark TdR is i.e.3The front physical efficiency that H-TdR synthesizes as DNA mixes DNA anabolic process, by surveying
Determine the radioactive intensity of cell, cell DNA metabolism and cell proliferative conditions can be reflected.Detailed process is as follows:
S41: front white adipocyte or front brown fat cell are with 5 × 103/ ml density is inoculated in 96 orifice plates, 37 DEG C,
5%CO2Middle cultivation 24 hours;
After S42:12 hour, add the polypeptide intervention (0,10 of variable concentrations gradient-3, 10-2,10-1, 1 μ g/ml), every hole
100 μ l, not add any medicine group as blank (each concentration group sets 8 groups of parallel holes);
S43: after cultivating 24 hours respectively, every hole adds 50 μ l's3H-TdR working solution (0.5uCi) cultivates 24 hours;
S44: cultivate after terminating, be centrifuged and suck supernatant, wash 3 times with the 200 cold PBS of μ l, then add 200 μ l precoolings
5%TCA washes 1 time, then washes twice with 95% ethanol, and the NaOH adding 200 μ l 0.5M in every hole dissolves, and is cracked by cell with the volley of rifle fire
Liquid is transferred in special 96 orifice plates of scintiloscope configuration, is dried at 60 DEG C and processes 30 minutes, is then allowed to be cooled to room temperature;
S45: collect lysate with DYQ-II type bull cell collector, moves in flicker plate, adds scintillation solution 100 μ l, put
Liquid scintillation counter measures radiocounting (cpm);
With SI (SI), S46: represent propagation degree with umber of pulse per minute (cpm), represents that experimental group relatively compares
The propagation degree that group is compared and propagation efficiency;SI=experimental port cpm/ control wells cpm;If the SI value of given the test agent group is significantly higher than
The SI value of control group, i.e. can determine that this experimental result positive.
Refer to Fig. 4 C and Fig. 4 D, the shown respectively embodiment of the present invention provides3H-TdR incorporation methods measures different dense
Degree polypeptide is to providing in the multiplication effect figure of front white adipocyte and the embodiment of the present invention3H-TdR incorporation methods measures difference
The concentration polypeptide multiplication effect figure to front brown fat cell.From Fig. 4 C and Fig. 4 D, front white adipocyte and front brown
Adipocyte all reach maximum when concentration is 1 μ g/ml, illustrate intervene cells play effect optimal peptide concentration be 1 μ g/
ml。
4, determine and most preferably intervene concentration
When current white adipocyte and front brown fat cell attachment 80%, respectively with the polypeptide of variable concentrations gradient
(0,10-3, 10-2,10-1, 1 μ g/ml) intervene 48 hours after, 3.3nM rhBMP7 intervene 72h (day 0), use 20nM insul
In, 1nM T3,0.5mM IBMX, 5 μMs of Dex with 0.125mM Indomethacins become brown fat induction differentiation, induction the 3rd day
(day 3) WB detection UCP1 expresses, and before further clear and definite IRS-1, the polypeptide of 56aa most preferably intervenes concentration is 1 μ g/ml.
Refer to Fig. 4 E and Fig. 4 F, the shown polypeptide intervention that the variable concentrations gradient provided is provided in the embodiment of the present invention
After front white adipocyte and front brown fat cell adipogenic induction, UCP1 expresses tendency chart.From Fig. 4 E and Fig. 4 F, UCP1
Expression effect along with intervene concentration (0,10-3, 10-2,10-1, 1) increase and raise, intervene concentration be 1 μ g/ml time,
The expression of UCP1 is optimal, illustrates that the optimal peptide concentration intervening cells play effect is 1 μ g/ml.
IRS-1 amino terminal 56aa effect experimental
Front white adipocyte and front brown fat cell are divided into the 5 groups: 1st group to be negative control group, and remaining 4 groups carry out palm fibre
It is further divided into ins+T after lookization induction differentiation3(positive control), polypeptide+T3, T3, ins+ polypeptide+T3Changing liquid, polypeptide is intervened concentration and is
1 μ g/ml, in the 9th day (day 9) oil red O stain observation of cell differentiation situation of induction, and utilizes Western blot to detect brown fat
Mark UCP1 expresses change.
Refer to Fig. 5 A and Fig. 5 B, the shown front white adipocyte brownization induction that embodiment of the present invention offer is provided
9th day oil red O stain figure after latter 9th day oil red O stain figure and front brown fat cell induction.From Fig. 5 A and Fig. 5 B,
In front white adipose and the induction differentiation of front brown fat, polypeptide+T3Organize relatively T3Group fat drips increased number, ins+ polypeptide+T3Group fat drips
Relatively ins+T3Group increases, and shows that IRS-1 aminoterminal 56aa polypeptide can promote white adipose brown and brown fat differentiation.
Separate the front white adipose of wild-type mice and front brown fat cell, when cell attachment 80% with 1 μ g/ml's
After the polypeptide of IRS-1 aminoterminal 56aa is intervened 48 hours, 3.3nM rhBMP7 intervene 72 hours after (day 0), use 20nM
insul in,1nM T3, 0.5mM IBMX, 5 μMs of Dex with 0.125mM Indomethacins become brown fat induction 3 days (day of differentiation
3) respectively with ins+T after,3(positive control), polypeptide+T3, T3, ins+ polypeptide+T3Change liquid 3 times, at the 9th day (day 9) of induction
Oil red O stain, observes polypeptide for becoming the effect of fat differentiation.Collect the 9th day (day 9) product, utilize the table of WB detection UCP1
Reach change, using β-actin as internal reference, compare the polypeptide impact on two groups of cellular fat differentiation marks.
Refer to Fig. 5 C and Fig. 5 D, white adipocyte brown before the shown WB detection that embodiment of the present invention offer is provided
Change UCP1 after induction UCP1 expresses variation diagram and the front brown fat cell induction of WB detection and express variation diagram.Shown in Fig. 5 C and Fig. 5 D
WB testing result show that polypeptide group UCP1 is expressed and increase, further checking IRS-1 aminoterminal 56aa polypeptide can promote white
The sizing differentiation of fat brown and front brown fat cell.
Invention described above embodiment, is not intended that limiting the scope of the present invention.Any in the present invention
Spirit and principle within amendment, equivalent and the improvement etc. made, should be included within the scope of the present invention.
The above is only the detailed description of the invention of the present invention, makes to skilled artisans appreciate that or realize this
Bright.Multiple amendment to these embodiments will be apparent to one skilled in the art, as defined herein
General Principle can realize without departing from the spirit or scope of the present invention in other embodiments.Therefore, the present invention
It is not intended to be limited to the embodiments shown herein, and is to fit to and principles disclosed herein and features of novelty phase one
The widest scope caused.
Claims (6)
1.IRS-1 aminoterminal 56aa application in preparing slimming medicine.
The IRS-1 aminoterminal 56aa the most according to claim 1 application in preparing slimming medicine, it is characterised in that institute
Stating the IRS-1 aminoterminal 56aa concentration that plays a role is 0.4-2 μ g/ml.
The IRS-1 aminoterminal 56aa the most according to claim 2 application in preparing slimming medicine, it is characterised in that institute
Stating the IRS-1 aminoterminal 56aa concentration that plays a role is 1 μ g/ml.
4.IRS-1 aminoterminal 56aa application in preparing diet food.
The IRS-1 aminoterminal 56aa the most according to claim 4 application in preparing diet food, it is characterised in that institute
Stating the IRS-1 aminoterminal 56aa concentration that plays a role is 0.4-2 μ g/ml.
The IRS-1 aminoterminal 56aa the most according to claim 5 application in preparing diet food, it is characterised in that institute
Stating the IRS-1 aminoterminal 56aa concentration that plays a role is 1 μ g/ml.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201610156484.8A CN105770858B (en) | 2016-03-18 | 2016-03-18 | Human obesity inhibitory peptide |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201610156484.8A CN105770858B (en) | 2016-03-18 | 2016-03-18 | Human obesity inhibitory peptide |
Publications (2)
Publication Number | Publication Date |
---|---|
CN105770858A true CN105770858A (en) | 2016-07-20 |
CN105770858B CN105770858B (en) | 2020-07-21 |
Family
ID=56393037
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201610156484.8A Expired - Fee Related CN105770858B (en) | 2016-03-18 | 2016-03-18 | Human obesity inhibitory peptide |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN105770858B (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102078315A (en) * | 2011-02-25 | 2011-06-01 | 昆明医学院 | Application of ampelopsin in preparing medicines for treating obesity |
CN102716134A (en) * | 2012-06-07 | 2012-10-10 | 中国人民解放军第四军医大学 | Application of oleanolic acid to medicine for treating obesity |
-
2016
- 2016-03-18 CN CN201610156484.8A patent/CN105770858B/en not_active Expired - Fee Related
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102078315A (en) * | 2011-02-25 | 2011-06-01 | 昆明医学院 | Application of ampelopsin in preparing medicines for treating obesity |
CN102716134A (en) * | 2012-06-07 | 2012-10-10 | 中国人民解放军第四军医大学 | Application of oleanolic acid to medicine for treating obesity |
Non-Patent Citations (2)
Title |
---|
VINCENZO MARZOLLA等: "Mineralocorticoid Receptor Antagonism Promotes Brown-like Remodeling of Murine White Adipose Tissue Via Reduction of Autophagic Flux in Adipocytes", 《JOURNAL OF PHARMACOLOGICAL SCIENCES》 * |
洪靖等: "IRS-1基因与肥胖、2型糖尿病", 《中日友好医院学报》 * |
Also Published As
Publication number | Publication date |
---|---|
CN105770858B (en) | 2020-07-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN104039960B (en) | Micro-rnas and compositions comprising same for the treatment and diagnosis of serotonin-, adrenalin-, noradrenalin-, glutamate-, and corticotropin-releasing hormone- associated medical conditions | |
CN110484615A (en) | LncRNA regulates and controls the polarized application of macrophage in vital myocarditis | |
CN104740648A (en) | Application of miRNA-214 inhibitor for inhibition of regulatory T cells | |
Wang et al. | Effects of microRNA-494 on astrocyte proliferation and synaptic remodeling in the spinal cord of a rat model of chronic compressive spinal cord injury by regulating the Nogo/Ngr signaling pathway | |
CN107088223A (en) | The application of Metrnl albumen or gene in treatment Endothelial dysfunction | |
CN103724410B (en) | The fusion protein and method of one class regulation and control CCR5 and CXCR4 genes | |
CN104628870A (en) | Human IL12Rbeta1-CHR protein and Fc fusion protein thereof | |
CN104145864B (en) | The cultural method of lucky richness strain bolti | |
CN104531760B (en) | The short hairpin RNA interference plasmid and its application process of Dp71 albumen | |
CN105457028B (en) | The stress sensitivity microRNA of regulating and controlling effect is played in bon e formation | |
CN105770858A (en) | Human-derived obesity inhibitory peptide | |
CN106434680B (en) | A kind of shrimps masculine gene and its application | |
CN108997491A (en) | Epinephelus coioides innate immunity receptor TLR5S gene and its new application for encoding albumen | |
CN104232643A (en) | RNAi (ribonucleic acid interference) interference segment, interference vector, and preparation method and application thereof | |
CN110003342B (en) | Polypeptide and application thereof in improving adverse effect of low social level on organism | |
CN104988151A (en) | Application of miRNA-9-5p compound in preparing chronic pain diagnosis marker and treatment drugs | |
CN101747414B (en) | Tumor necrosis factor (TNF)-alpha binding peptide and tumor necrosis factor receptor 1(TNFR1) blocking peptide and applications thereof in treatment of TNF related diseases | |
CN106492230B (en) | Function and application of the leukocytic immunity globulin sample receptor B4 in treatment nonalcoholic fatty liver and type II diabetes | |
CN111321145B (en) | SiRNA of schistosoma japonicum PHB1 and PHB2 genes and application thereof | |
CN105331617B (en) | Gene for encoding human hepassocin, carrier and transgenic cell, application thereof as well as preparation method of human hepassocin | |
CN106399362B (en) | The construction method of transgenic mice bone muscular dystrophy model | |
CN104491496B (en) | Application of the Gastrodin/Rhizoma Gastrodiae powder in anti-hepatic fibrosis medicines are prepared | |
CN107582525A (en) | TRIM31 inhibitor magnetic target drug bearing microspheres are preparing the application in suppressing PDAC multiplication capacity medicines | |
CN106749548A (en) | ATF3 albumen excitement polypeptide and its application | |
CN109419795B (en) | Combined medicine for treating tumor necrosis factor family related diseases |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
GR01 | Patent grant | ||
GR01 | Patent grant | ||
CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20200721 |
|
CF01 | Termination of patent right due to non-payment of annual fee |