CN104356220B - A kind of have AntiHIV1 RT activity Aedes albopictus albumen of anticoagulant function and preparation method thereof - Google Patents
A kind of have AntiHIV1 RT activity Aedes albopictus albumen of anticoagulant function and preparation method thereof Download PDFInfo
- Publication number
- CN104356220B CN104356220B CN201410636317.4A CN201410636317A CN104356220B CN 104356220 B CN104356220 B CN 104356220B CN 201410636317 A CN201410636317 A CN 201410636317A CN 104356220 B CN104356220 B CN 104356220B
- Authority
- CN
- China
- Prior art keywords
- aedes albopictus
- activity
- albumen
- antihiv1
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Expired - Fee Related
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
- C07K14/43563—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates from insects
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Organic Chemistry (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Toxicology (AREA)
- Tropical Medicine & Parasitology (AREA)
- Biophysics (AREA)
- General Health & Medical Sciences (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Insects & Arthropods (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The present invention relates to a kind of AntiHIV1 RT activity Aedes albopictus albumen with anticoagulant function, the aminoacid sequence of this albumen is SEQ ID NO:Sequence shown in 1.AntiHIV1 RT activity Aedes albopictus albumen of the present invention be by Aedes albopictus salivary gland total serum IgE purified, amplify total cDNA, then, again with total cDNA for its gene cloning of template amplification to prokaryotic expression carrier, after folding through IPTG abduction delivering, the inclusion body degeneration to expression and renaturation, gel filtration and ion exchange mechansim purification obtain.The AntiHIV1 RT activity Aedes albopictus albumen of the present invention has the activity that can suppress HIV propagation in the cell and the platelet aggregation of several agonist inductions, and the advantage of no cytotoxicity and AntiHIV1 RT activity high specificity, can be used for preparing the medicine of anti-AIDS and its relevant disease.
Description
Technical field:
The present invention relates to there is peptide more than 20 aminoacid and in particular to a kind of albumen obtaining from animal tissue, should
Albumen has the biological activity of AntiHIV1 RT activity.
Background technology:
Acquired immune deficiency syndrome (AIDS) (AIDS) is seriously to damage, with systemic immune system, the infectious disease being characterized, from its be found with
Come, seriously threaten the existence of the mankind, the development to population in the world health and social economy produces tremendous influence.Along with many
Research over year, has many anti-AIDS drugs at present.Act on the difference of viral targets, the anti-AIDS drugs of listing according to medicine
Be broadly divided into glycoside reverse transcriptase inhibitors, non-nucleoside reverse transcriptase inhibitor, protease inhibitor, entry inhibitor,
Integrase inhibitor etc..These medicines suppress respectively inhibition of HIV propagation entrance, fusion, reverse transcription, integration, transcription, translation,
Group merge overflow etc. process, make AIDS treatment on make great progress (Infect Dis Rep.2013,5
(Suppl1):e2).At present AIDS sickness rate declines rapidly, and people no longer talk AIDS and complexion changed.Due to above-mentioned all medicines only
It is link specific for certain in inhibition of HIV reproduction process, easily induction inhibition of HIV produces variation and forms drug resistance strain, leads
Some drugses are caused to lose therapeutic value.The drug resistance problems of inhibition of HIV become a century property difficult problem for puzzlement AIDS treatment.Research is high
Effect, the anti-AIDS drugs of low toxicity and method are the focuses of current international research.
Joint antiretroviral therapy (cART) the energy effective control disease process of application multi-medicament, and part solution
The drug resistance problems of inhibition of HIV.But after the method treatment, many is lived and HIV relevant disease with the patient that must grow,
As, chronic inflammation disease and nervus cognition disorder etc. (J Pathol.2008,10:231-241).Additionally, in HIV person
Thrombus in vivo disease, the rate of delivering of cardiovascular disease significantly rise, especially thrombocytopenia, and it is in the urgency of HIV patient
Often (Circulation.2008,10 in property infection period and acquired immune deficiency syndrome (AIDS) phase:e36–e40;Curr
Cardiol Rev.2008,10:203-218).Therefore it is necessary to research and develop effective treatment meanss while suppressing HIV propagation
Control these diseases.
Platelet is a part for inflammation systems, closely related with the pathogenesis of HIV person.On the one hand, blood is little
Plate can in conjunction with, phagocytosis, internalization HIV, and can use as after activation virus bin so that virus is bred wherein and be transmitted to
Farther organ.On the other hand, the platelet being activated by HIV can be discharged many Inflammatory substances, such as sCD40L and blood
Platelet activation factor etc. promotes platelet activation and inflammation to occur further, the process (PLoS of aggravation AIDS and relevant disease
One.2012,10:e44454;Blood.2012,10:1334–1343).Therefore, suppression platelet contribute to treat AIDS and its
Relevant disease.Many is with regard to anti-blood such as aspirin, adp receptor blocker, GPIIb-IIIa Disintegrin and statins
The research of platelet molecule reports them and can reduce HIV person's cardiovascular disease, the thrombotic disease inflammatory disease related with HIV
The incidence rate of disease.Among them, Statins can suppress inflammation, weakens platelet activation and because blocking inhibition of HIV granule and rush
Infection cellular component between combination and there is direct HIV (human immunodeficiency virus)-resistant activity.Many HIV persons can control after accepting Statins
Hyperlipemia (the Curr Opin Endocrinol Diabetes Obes.2011,10 that joint antiretroviral therapy is brought:
144-147;Viral Immunol.2005,10:474–489).Therefore Statins is considered as very promising AIDS treatment
Drug candidate.Lack enough datas due to current, this compound may be deposited on the road becoming AIDS medicine
In unexpected obstacle it is therefore necessary to develop more AntiHIV1 RT activity and hematoblastic drug candidate be used for treating AIDS and its
Relevant disease.
The Nature breeds all things on earth, contains the material that many counteracts each other wherein, gives birth to from Chinese herbal medicine and ocean at present
It is isolated to multiple alkaloidss with suppression HIV activity, protide, terpenoid, flavonoid, lignanoids and tonkabean in object
Plain class etc..Although currently without the active substance finding HIV (human immunodeficiency virus)-resistant activity in HAEMATOPHAGOUS ARTHROPODS body, the film sugar egg of HIV
It is found (Insect in soft ticks Antricola delacruzi and Ornithodorus parkeri salivary gland in vain
Biochem Mol Biol.2012,42(5):332-42;Insect Biochem Mol Biol.2008,38(1):1-21).
Therefore, HAEMATOPHAGOUS ARTHROPODS is probably the important sources of natural AntiHIV1 RT activity protein drug.
There is long history in China to the medicinal study of zootoxin, but pharmacology in the HAEMATOPHAGOUS ARTHROPODS body such as mosquito is lived
Property component research few.Aedes albopictus (Aedes albopictus) are the important insect vectors of China, all have throughout the country
Distribution.
Content of the invention:
The technical problem to be solved is to provide one kind to belong to biomedical sector to have anticoagulant
The Aedes albopictus albumen of the AntiHIV1 RT activity of function, this albumen has high specificity, the good and cheap and easy to get advantage of activity.
The scheme that the present invention solves above-mentioned technical problem is as follows:
A kind of AntiHIV1 RT activity Aedes albopictus albumen with anticoagulant function, the aminoacid sequence of this albumen is
MAPIWNAKNPEQIQYLAARCMEEWSPKAKDPKAAIKNWMEWKIQPSNEEATQCYTKCMIENIGYYEPGEKRIKGVRV
MQQWETFNRYQSADRNKVHDITDTFDFIKPLKSSSCSDVFNAYKDVHAKHLETIKAILFCDGKSAEKYYKDKGKNVK
QKGESIFVHCEEIHYPVGSPQRNELCKVRKYELGTGKPFENLMECIFKGVRYFNDKNELNIDEIARDFTQVGKKPDA
VKAAMENCKSKTKETDPGKKAVEYYKCLLADSKVKKDFMEAFDYRELRSKDYYAQLTGKIKPYSASDVRKEVNDLDS
NKCV(SEQ ID NO:1)
Above-mentioned Aedes albopictus albumen is a kind of single chain protein of Aedes albopictus salivary gland DNA recombinant expression, and its molecular weight is
36656.83 dalton, isoelectric point, IP is 8.501.
It is of the present invention that to have anticoagulant function AntiHIV1 RT activity Aedes albopictus albumen be using from the lineae ablicantes sucked blood
Yellow-fever mosquito salivary gland DNA recombinant expression obtains, and its concrete preparation method comprises the steps of:
(1) use PROMEGA company after extracting Aedes albopictus salivary gland total serum IgEmRNA Isolation
Systems test kit isolates and purifies mRNA and utilizes CLONTECH company CreatorTMSMARTTMcDNA Library
Construction Kit Construction of Plasmid cDNA Library test kit amplifies the total cDNA of Aedes albopictus salivary gland, then adopts SEQ
ID NO:Forward primer shown in 2 and SEQ ID NO:Downstream primer amplification coding SEQ ID NO shown in 3:Anti- shown in 4
The gene of HIV Aedes albopictus albumen, then first by this gene cloning in pET-17b expression vector, then be transformed into BL21 (DE3)
Recombinant expressed in pLysS escherichia coli, and collect inclusion body protein between 28-37kDa for the purpose band;
(2) by collected inclusion body guanidine hydrochloride dissolution and fold after go up successively Sephadex SR-100 solvent resistant column,
Hiprep SP cation-exchange chromatography post, Sephadex G75 solvent resistant column and Sephadex G75 gel filtration chromatography,
Obtain as SEQ ID NO:The Aedes albopictus salivary gland DNA recombinant expression albumen of sequence shown in 1.
The Aedes albopictus albumen of AntiHIV1 RT activity of the present invention has specific inhibitory effect, IC to HIV difference strain50It is situated between
In between 10-35nM and have no toxic side effect, ADP, U can be suppressed46619Platelet aggregation with collagen induction.
Brief description:
Fig. 1 is AntiHIV1 RT activity Aedes albopictus albumen escherichia coli expression electrophoretogram of the present invention, in figure, is purpose peak shown in arrow
Position, band 1 is to be not added with negative bacterium comparison, and band 2 induces result for positive bacteria, and band 3 is positive bacteria non-induced result, and band 4 is albumen
Matter standard.
Fig. 2 is AntiHIV1 RT activity Aedes albopictus protein purification chromatogram of the present invention, is purpose peak shown in figure arrow, and A, B, C, D scheme
It is Sephadex SR-100 gel filtration chromatography, Hiprep SP cation-exchange chromatography column chromatography, Sephadex respectively
G75 gel filtration chromatography, Sephadex G75 gel filtration chromatography result figure, in Fig. 2 D, electrophoretogram is final step
The electrophoresis result of the Peak Activity of Sephadex SR-100 gel filtration chromatography is it is illustrated that band is purpose albumen.
Fig. 3 is that AntiHIV1 RT activity Aedes albopictus albumen of the present invention suppresses platelet aggregation figure, in figure, and a is negative control;B is 1.85
μM albumen is to Convuxlin, U46619Inhibitory action with Collengen induced platelet aggregation;C is 9 μM of PROTEIN C onvuxlin
The inhibitory action of induced platelet aggregation.
Specific embodiment:
There is the preparation of AntiHIV1 RT activity Aedes albopictus albumen and the identification of anticoagulant function:
One) there is the clone of the AntiHIV1 RT activity Aedes albopictus protein gene of anticoagulant function:
I, Aedes albopictus salivary gland Total RNAs extraction:
A. live body Aedes albopictus are placed on 30-60 minute frost anesthesia on ice, dissect 50 Aedes albopictus under the microscope and obtain
To salivary gland, add 1m1 Total RNAs extraction buffer (Trizol solution, U.S.'s GIBCOBRL Products), even in 5m1 glass
It is homogenized 1 minute in slurry device.
B. add equal-volume phenol/chloroformic solution, acutely mix, room temperature is placed 1 minute, and 4 DEG C, 12000rpm is centrifuged 10 points
Clock, reject precipitates.
C. supernatant adds isopyknic isopropanol, and room temperature is placed 4 minutes, and 4 DEG C, 12000rpm is centrifuged 10 minutes, and precipitation is used
75% ethanol is washed once, dries, and ttom of pipe precipitate is Xanthopsyllacheopis salivary gland total serum IgE.
II, the purification of Aedes albopictus salivary gland mRNA:
Aedes albopictus salivary gland mRNA isolates and purifies using PROMEGA company of the U.S.mRNA
Isolation Systems test kit.
A. take Aedes albopictus salivary gland total serum IgE 500 μ g to be dissolved in 500 μ l DEPC water, put into 65 DEG C of water-baths 10 minutes, plus
Oligo (dT) probe of people 3 μ l and 13 μ l 20 × SSC solution, mix, and place room temperature cooling, referred to as A liquid.
B. the washing of magnetic bead (SA-PMP):Magnetic bead is flicked mixing, adsorbs 30 seconds to magnetic frame, abandon supernatant, plus 0.5 ×
SSC0.3m1, to magnetic frame adsorb 30 seconds, finally plus 0.1ml 0.5 × SSC suspend, referred to as B liquid.
C. A liquid is added in B liquid, room temperature is placed 10 minutes, adsorb 30 seconds to magnetic frame, abandon supernatant, washed with 0.1 × SSC
Wash 4 times, finally abandon supernatant, plus 0.l ml DEPC aqueous suspension, adsorb 30 seconds to magnetic frame, supernatant is moved to new test tube, then
Add 0.15m1DEPC water Eddy diffusion, adsorb 30 seconds to magnetic frame, move supernatant to above-mentioned test tube, be then the white of purification in supernatant
Stricture of vagina yellow-fever mosquito salivary gland mRNA.
D. add 1/10 volume 3M sodium acetate, pH 5.2, equal-volume isopropanol, place 30 minutes in -70 DEG C, 4 DEG C,
12000rpm is centrifuged 10 minutes, abandons supernatant, is precipitated and dissolved in 10 μ l DEPC water.
III, the total cDNA of Aedes albopictus salivary gland expand:
Using CLONTECH company CreatorTMSMARTTMCDNA Library Construction Kit plasmid
CDNA library builds test kit amplification.
A.cDNA first chain synthesizes (mRNA reverse transcription):
1. add 1 μ l Aedes albopictus salivary gland mRNA, 1 μ l SMART IV oligonucleotides in the aseptic centrifuge tube of 0.5ml
Acid, 1 μ l CDS III/3 ' PCR primer, plus 2 μ l deionized waters make cumulative volume reach 5 μ l.
2. mix the reagent in centrifuge tube and be centrifuged 15 seconds with 12000rpm, 72 DEG C are incubated 2 minutes.
3. centrifuge tube is incubated on ice 2 minutes.
4. add 2.0 μ l 5 × the first chain buffering, 1.0 μ l 20mM dithiothreitol, DTTs, 1.0 μ l in centrifuge tube
10mMdNTP mixture, 1.0 μ l PowerScript reverse transcription.
5. mixing centrifuge tube in reagent and with 12000rpm be centrifuged 15 seconds, 42 DEG C be incubated 1 hour.
6. centrifuge tube is placed in the synthesis stopping the first chain on ice.
7. take cDNA first chain synthesized by 2 μ l standby from centrifuge tube.
B. long end polymeric polymerase chain reaction (LD-PCR) method is adopted to expand the second chain
1.95 DEG C of preheating PCR instrument.
2. 2 μ l cDNA the first chain (mRNA reverse transcription), 80 μ l deionized waters, 10 μ l 10 × Advantage 2PCR are delayed
Punching, 2 μ l 50 × dNTP mixture, 2 μ l 5 ' PCR primer, 2 μ l CDS III/3 ' PCR primer and the polymerization of 2 μ l escherichia coli
Enzyme centrifuge tube is reacted.
3. press following procedure in PCR instrument to expand:1. 95 DEG C, 20 seconds;2. 22 circulations:95 DEG C, 5 seconds;68 DEG C, 6
Minute
4., after loop ends, the cDNA synthesizing in centrifuge tube double-strand is stripped.
C.PCR product PROMEGA companySV Gel and PCR Clean-Up System test kit enters
Row extracting and reclaiming, step is as follows:
1. the cDNA double-strand obtaining by PCR is added the reverse mixing of isopyknic film combination buffering, then by mixed liquor
Proceed to centrifugal purification post, room temperature stands 5 minutes, so that DNA is fully combined with pellosil.It is centrifuged 30 seconds with 12000rpm, outwell receipts
Waste liquid in collector.
2. add the eluent (containing ethanol) of 700 μ l in centrifugal purification post, be centrifuged 30 seconds with 12000rpm, outwell collection
Waste liquid in pipe.
3. repeat step 2,12000rpm is centrifuged 5 minutes.
4. centrifugal purification post is placed in new centrifuge tube, adds 30 μ l ultra-pure waters, stand 5 minutes at room temperature, with
12000rpm is centrifuged 30 seconds, and ttom of pipe solution is the total cDNA of Aedes albopictus salivary gland of purified mistake.
IVth, there is the clone of the AntiHIV1 RT activity Aedes albopictus protein gene of anticoagulant function:
Aedes albopictus salivary gland nucleotide sequence (GenBank according to report:AY826093.1) it is Reference Design primer
D7F:5’TGCATATGGCACCTCTGTGGAATGCAAAGAATCC’3(SEQ ID NO:2) and D7R:5’
CCCTCGAGTTAAACACACTTGTTGCTGTCGATATC’3(SEQ ID NO:3).With 100 times of dilution lineae ablicantes of crossing of purification she
The total cDNA of mosquito salivary gland has the AntiHIV1 RT activity Aedes albopictus protein gene of anticoagulant function for template amplification.PCR reacts
Program is:1. 95 DEG C, 4 minutes;2. 35 circulations:94 DEG C, 30 seconds;56 DEG C, 30 seconds;72 DEG C, 45 seconds;3. 72 DEG C, 10
Minute.By amplified production 1% agarose gel electrophoresiies, cut purpose band, carry out purification with DNA purification kit.Will be pure
The purpose fragment changed is connected in pMD19-T carrier, obtains final product connection product.Connection product is transformed into the large intestine of Takara company
Bacillus DH5 α competent cell.Appropriate converted product is taken to be applied on the LB flat board containing Amp, the list being formed through 37 DEG C of culture 16h
Bacterium colony is the positive colony containing purpose fragment.The picking single bacterium colony size of M13 primer detection Insert Fragment.Select containing purpose
The positive plasmid of fragment send company to be sequenced.It is (SEQ ID NO that sequencing result display gene is held to 3 ' terminal sequences from 5 ':4):
catatggcacctatctggaatgcaaagaatcccgagcaaatccagtacctagctgcccgttgtatggaagaatggtc
tccgaaggcaaaggatccgaaagcggctatcaaaaactggatggaatggaaaatccagccatcgaacgaagaagcca
ctcagtgttataccaagtgtatgatcgagaacatagggtactatgagccgggtgaaaagcgaatcaagggagttcgt
gttatgcaacaatgggaaacgttcaaccgataccagtcagcagatcgaaacaaagttcatgatatcacggatacatt
cgacttcataaagccgctgaaatcgtccagctgctcggatgtgttcaacgcctacaaagacgtccatgccaaacatc
tggaaacaatcaaagcaattctgttttgcgatggaaagtctgccgagaagtattataaggataagggtaaaaatgtc
aagcaaaagggggaatctatctttgtacattgtgaagaaatacactacccagtgggtagtccacagcggaatgaatt
atgtaaagttagaaagtatgagttgggcactggaaagccattcgaaaatctcatggaatgcatatttaagggcgtac
gctacttcaatgataagaacgagttaaatattgacgaaattgcaagggatttcacccaggttggcaagaaacccgat
gcggtgaaagcggcaatggaaaactgcaagtccaaaacgaaagaaaccgacccagggaaaaaggctgttgagtacta
caagtgcttgctggccgattcaaaagtaaagaaagacttcatggaagcgttcgactatcgagaactaagatccaagg
actattacgctcagctaacgggcaaaatcaaaccctacagtgccagtgatgtgcgcaaggaggtcaatgatctagac
agcaacaagtgtgtttaactcgag
The AntiHIV1 RT activity Aedes albopictus protein gene cloning E. with anticoagulant function is to pET-17b expression vector:
1. add the pMD19-T carrier containing HIV protein gene for the 1 μ g, 2 μ l H buffer, 0.5 μ l in microcentrifugal tube
Nde I and 0.5 μ l Xhol I restricted enzyme, adding water to cause final volume is 20 μ l;1 μ g pET-17b plasmid adopts
Same enzyme action system.Enzyme action condition is:37 DEG C are reacted 2 hours;
2. digestion products are used 1% agarose gel electrophoresiies respectively, cut purpose band, carried out with DNA purification kit
Purification.
3. by the purpose fragment of purification according to moles 3:1 (protein gene:PET-17b carrier) ratio be mixed to join
It is attached in the ligase buffer solution mixture of amount.Connect and be adjusted to 16 DEG C of reactions 8 hours
4. connection product is transformed into the bacillus coli DH 5 alpha competent cell of Takara company.Appropriate converted product is taken to apply
Cloth, to the LB flat board containing Amp, is, through the single bacterium colony that 37 DEG C of culture 16h are formed, the positive colony containing purpose fragment, extracts matter
Grain carries out enzyme action and sequencing identification.
Two) there is the escherichia coli expression of the AntiHIV1 RT activity Aedes albopictus albumen of anticoagulant function:
By the expression vector chemical conversion containing coding AntiHIV1 RT activity Aedes albopictus protein gene to BL21(DE3) pLysS large intestine bar
Recombinant expressed in bacterium.Access 10ml incubated overnight seed bacterium solution in 1L LB culture medium, cultivate 3 hours, when antibacterial light absorption value for 37 DEG C
OD600Reach addition IPTG final concentration of 1mM when 0.8 about, continue culture 3 hours, 8000rpm is collected by centrifugation bacterium in 10 minutes
Body, with the 25mM Tris-HCl solution suspension precipitation of 100ml pH 8.0, is then centrifuged for 8000rpm and is centrifuged 10 minutes collection bacterium
Body, adds the 25mM Tris-HCl solution of 100ml pH 8.0,4 DEG C of ultrasonic disruption cells, surpasses 30 seconds and stop 30 seconds continuous 4 times,
Centrifugation 12000rpm is centrifuged 10 minutes and collects inclusion body precipitation afterwards, obtains Fig. 1, purpose using the expression that SDS-PAGE detects albumen
Band should be between 28-37kDa.
Two) folding of the escherichia coli expression inclusion body of AntiHIV1 RT activity Aedes albopictus albumen:
25mM Tris-HCl pH 8.0 solution adding 100ml to contain 0.1%Triton 100 in ultrasonic centrifugation product,
Stirring at low speed 1 hour under room temperature.It is then centrifuged for 12000rpm and be centrifuged 10 minutes collection precipitations, with the 25mM Tris- of pH 8.0
HCl solution washing precipitation 4 times, adds 25ml to contain the 25mM Tris-HCl solution of 6M guanidine hydrochloride in last centrifugation,
After most of dissolving to be precipitated in 1 hour is stirred at room temperature, 12000rpm is centrifuged 10 minutes, takes and adds DTT in supernatant to final concentration
For 10mM, the lower stirring of temperature 1 hour, 12000rpm is centrifuged 10 minutes and collects supernatant.According to 1:Supernatant is slowly added dropwise by 200 ratios
To in the 25mM Tris-HCl solution of the pH of arginine containing 300mM 7.6, it is stirred overnight rapidly in 4 DEG C.Using 10kDa flat board
Ultrafiltration concentration system concentrates and folds protein solution to 25ml, and it is pure that sample centrifugation 12000rpm is used for separation after being centrifuged 20 minutes
Change.
Three) the isolating and purifying and identifying of AntiHIV1 RT activity Aedes albopictus inclusion bodies of protein folded product:
The first step, Sephadex SR-100 gel filtration chromatography.The AntiHIV1 RT activity Aedes albopictus egg obtaining as stated above
The supernatant that white inclusion body folded product concentrates after centrifugation is splined on 25mM Tris-HCl 0.15M NaCl pH 8.0 solution equilibria
GE company Sephadex SR-100 gel permeation chromatography post.Obtain Fig. 2A with same buffer solution elution, collect as shown in the figure
Peak Activity.
Second step, Hiprep SP cation-exchange chromatography column chromatography.AntiHIV1 RT activity Aedes albopictus albumen by molecular sieve purification
Dialysed 24 hours in the PBS solution of 10L pH 6.0 with 10kDa bag filter, 12000rpm is centrifuged 20 minutes, by supernatant loading
Hiprep SP cation-exchange chromatography chromatographic column in GE company.Hiprep SP cation-exchange chromatography post 20mM
Na2HPO4-NaH2PO4The buffer balance of pH 6.0, with the linear ladder from 0% to 100% for the same buffer containing 1M NaCl
Degree affords Fig. 2 B, collects Peak Activity as shown in the figure.
3rd step, Sephadex G75 gel filtration chromatography.Hiprep SP cation-exchange chromatography column chromatography obtains
Peak Activity is splined on 25mM Tris-HCl 0.15NaCl pH 8.0 buffer balance after the concentration of 10kDa super filter tube
Sephadex G75 gel permeation chromatography post.Obtain Fig. 2 C with same buffer solution elution, collect Peak Activity as shown in the figure.
4th step, Sephadex G75 gel filtration chromatography.The work that Sephadex G75 gel filtration chromatography obtains
Property peak through 10kDa super filter tube concentration after be splined on 25mM Tris-HCl 0.15NaCl pH 8.0 buffer balance
Sephadex G75 gel permeation chromatography post.Obtain Fig. 2 D with same buffer solution elution and isolate and purify figure, collect and live as shown in the figure
Property peak.
5th step, obtains Fig. 2 D electrophoretogram after the AntiHIV1 RT activity Aedes albopictus protein electrophoresises that purification obtains, and then transferring film is with automatically
Protein Sequencer measures N-terminal aminoacid sequence.
The AntiHIV1 RT activity Aedes albopictus albumen with anticoagulant function prepared by said method is to utilize lineae ablicantes
A kind of albumen of yellow-fever mosquito salivary gland DNA recombinant expression, molecular weight 36656.83 dalton, isoelectric point, IP 8.501, particular sequence is such as
SEQ IDNO:Shown in 1.
Four) there is the preparation of the AntiHIV1 RT activity Aedes albopictus albumen medical solution of anticoagulant function:
Medicine preparation for the AntiHIV1 RT activity Aedes albopictus albumen of pharmacological experiment:The albumen of recombinant expressed purification is through 10kDa
It is made into 10mg/ml solution with PBS solution after super filter tube thickening filtration, add final concentration of 1% Triton X-114 acute immediately
After strong vibration mixing ice educates 10min, 20 DEG C of incubation 10min, 10000rpm room temperature is centrifuged 10 minutes, careful in superclean bench
Aspirate supernatant, to no thermal source vessel, detects that through tachypleus amebocyte lysate endotoxin is less than after 10EU/ml with normal saline or pH 7-8
PBS solution makes 45 μM of sterile solutions.
There is the pharmacological evaluation of the AntiHIV1 RT activity Aedes albopictus albumen of anticoagulant function:
One) the AntiHIV1 RT activity Aedes albopictus protein-specific suppression HIV with anticoagulant function is in cell proliferation
10000/hole TZM-Bl cell is inoculated in 96 orifice plates, 37 DEG C of 5%CO2Overnight incubation.With the DMEM without serum
AntiHIV1 RT activity Aedes albopictus albumen is formulated as the medicinal liquid of variable concentrations, the every hole of 60 μ l, each three multiple holes by culture medium.VSVG and HIV disease
After poison dilutes 8 times with the DMEM culture medium without serum, 60 μ l/ holes are added in medicinal liquid, slightly mix, 37 DEG C, 5%CO2 incubation
30 minutes.100 μ l medicines and virus mixture is taken to be added in target cell.After 48 hours, Luciferase method detection AntiHIV1 RT activity is white
The suppression ratio that stricture of vagina yellow-fever mosquito albumen replicates to VSV-G and inhibition of HIV.
AntiHIV1 RT activity Aedes albopictus albumen suppresses H5N1The Activity determination of influenza pseudoviruss is as follows:MDCK and 293T cell is cultured
In the DMEM culture medium containing L-Glutamine, 10% hyclone.Express H using 293T cell transfecting5N1Type influenza strain A/
Thailand/Kan353/2004(H5N1) HA and NA plasmid to pack H5N1Pseudoviruss.The full 293T cell of 70-80% adopts
Polyethyleneimine is in 6 orifice plates every hole cotransfection 1 μ g HA plasmid, 1 μ g NA plasmid and 3 μ g HIV skeleton plasmid (pNL4-
3.luc.R_E_), change liquid after 12 hours.Transfection collected supernatant after 48 hours, and 2000g is centrifuged 10 minutes.For detecting to be detectedization
Compound anti-cape horn fever cytotoxic activity, mdck cell (104/ hole) plant plate in 96 orifice plates and overnight incubation.Treat AntiHIV1 RT activity Aedes albopictus albumen with
After pseudoviruss are incubated 30 minutes altogether in 37 DEG C, virus-medicinal mixture is transferred to mdck cell, and continues to cultivate 48 hours, PBS
After washing cell, Luciferase method detection AntiHIV1 RT activity Aedes albopictus albumen is to H5N1The suppression ratio that influenza pseudoviruss replicate.Will be above-mentioned
AntiHIV1 RT activity, VSVG and H5N1Data summarization obtains table 1.
Table 1:The specific inhibitory effect to HIV difference strain for the albumen
As seen from the above table, AntiHIV1 RT activity Aedes albopictus albumen can significantly inhibit propagation on cell for the HIV, and this suppression tool
There is very strong specificity it is impossible to suppress VSVG and H5N1Propagation on corresponding cell.This albumen does not have to mammalian cell yet
Toxicity.
Two) there is AntiHIV1 RT activity Aedes albopictus albumen suppression Convuxlin, U of anticoagulant function46619With
The platelet aggregation of Collengen induction
Fresh and healthy people richness plasma platelet 500rpm under room temperature is centrifuged 5 minutes, and at supernatant discarded night, precipitation is with containing
Tyrode's solution (137mM NaCl, 2.7mM KCl, the 4mM NaH of 0.1mM EGTA2PO4,33mM NaHCO3,1mM MgCl2,
5.55mM glucose, 0.35%gelatin, pH 6.5) wash twice under same centrifugal condition, finally washing platelet is hanged
Float over containing 2mM CaCl2Tyrode's solution (pH 7.4) in, PC is adjusted to 3 × 108Individual/ml referred to as washs platelet.
Healthy human blood platelets diluted plasma is to 2.5 × 108Individual/ml is referred to as rich plasma platelet.To 300 μ l richness plasma platelets or
After adding final concentration of 1.85 μM or 9 μM of AntiHIV1 RT activity Aedes albopictus albumen to be incubated 2min in washing platelet, it is separately added into end
Dense Convuxlin, 2.5 μM of U for 60pM46619, the Collengen induced aggregation of 1.0 μ g/ml, little with Chrono-Lumi blood
Plate is assembled instrument (Chronol-Log, Havertown, PA, USA) and is measured light transmission, observes platelet aggregation in 5min and stirs at 37 DEG C
Mix the gathering situation under state, and obtain Fig. 3.
Assemble the calculating of suppression ratio (I):I=B/A × 100% (A=derivant can reach maximum assemble (herein for
Light transmittance, %);B=adds the maximum gathering that derivant can reach after adding inhibitor.)
Visible as shown in Figure 3,1.85 μM or 9 μM of Aedes albopictus AntiHIV1 RT activity and suppression platelet aggregation bifunctional protein
Significantly suppress the Convuxlin of 60pM, 2.5 μM of U with after platelet insulation 2min46619, the Collengen of 1.0 μ g/ml lures
The platelet aggregation led.U to 2.5 μM46619It is with the suppression ratio of the platelet aggregation of the Collengen induction of 1.0 μ g/ml
100%, and to the suppression ratio of the Convuxlin of 60pM induction be 1.85 μM be 25% and 9 μM be 50%.Suppression have dosage according to
Lai Xing.
Claims (2)
1. aminoacid sequence such as SEQ ID NO:AntiHIV1 RT activity Aedes albopictus albumen shown in 1 is in the medicine of preparation suppression platelet aggregation
Application in thing.
2. application according to claim 1 is it is characterised in that described AntiHIV1 RT activity Aedes albopictus albumen is by following methods system
?:
(1) use PROMEGA company after extracting Aedes albopictus salivary gland total serum IgEmRNA Isolation
Systems test kit isolates and purifies mRNA and utilizes CLONTECH company CreatorTMSMARTTMcDNA Library
Construction Kit Construction of Plasmid cDNA Library test kit amplifies the total cDNA of Aedes albopictus salivary gland, then adopts SEQ
ID NO:Forward primer shown in 2 and SEQ ID NO:Downstream primer amplification coding SEQ ID NO shown in 3:Anti- shown in 4
The gene of HIV Aedes albopictus albumen, then first by this gene cloning in pET-17b expression vector, then be transformed into BL21 (DE3)
Recombinant expressed in pLysS escherichia coli, and collect inclusion body between 28-37kDa for the purpose band;
(2) by collected inclusion body guanidine hydrochloride dissolution, renaturation fold after go up successively Sephadex SR-100 solvent resistant column,
Hiprep SP cation-exchange chromatography post, Sephadex G75 solvent resistant column and Sephadex G75 gel filtration chromatography,
Obtain as SEQ ID NO:The Aedes albopictus salivary gland DNA recombinant expression albumen of sequence shown in 1.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201410636317.4A CN104356220B (en) | 2014-11-13 | 2014-11-13 | A kind of have AntiHIV1 RT activity Aedes albopictus albumen of anticoagulant function and preparation method thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201410636317.4A CN104356220B (en) | 2014-11-13 | 2014-11-13 | A kind of have AntiHIV1 RT activity Aedes albopictus albumen of anticoagulant function and preparation method thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN104356220A CN104356220A (en) | 2015-02-18 |
CN104356220B true CN104356220B (en) | 2017-03-08 |
Family
ID=52523550
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201410636317.4A Expired - Fee Related CN104356220B (en) | 2014-11-13 | 2014-11-13 | A kind of have AntiHIV1 RT activity Aedes albopictus albumen of anticoagulant function and preparation method thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN104356220B (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN107236028B (en) * | 2017-07-05 | 2020-12-04 | 贵州医科大学 | Application of aedes albopictus saliva 34K2 recombinant protein in infection of HaCaT cells by DENV2 |
WO2019028585A1 (en) * | 2017-08-07 | 2019-02-14 | 广州威佰昆生物科技有限公司 | Aedes albopictus and production method therefor |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102851264A (en) * | 2011-06-30 | 2013-01-02 | 复旦大学 | An apyrase encoding gene of Aedes albopictus, and preparation method and application of protein thereof |
-
2014
- 2014-11-13 CN CN201410636317.4A patent/CN104356220B/en not_active Expired - Fee Related
Also Published As
Publication number | Publication date |
---|---|
CN104356220A (en) | 2015-02-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
ES2608974T3 (en) | Compositions of purified mesenchymal stem cells | |
Gondim et al. | Potent antiviral activity of carbohydrate-specific algal and leguminous lectins from the Brazilian biodiversity | |
AT398080B (en) | IMMORTALIZED CELL LINE, METHOD FOR THEIR PRODUCTION AND METHOD FOR THE PRODUCTION OF MONOCLONAL ANTIBODIES, AND DIAGNOSTIC METHODS AND MEANS | |
JP5709800B2 (en) | Interferon with altered spatial structure and its application | |
CN102942629B (en) | Humanized antibody for resisting severe fever with thrombocytopenia syndrome bunyavirus (SFTSV) | |
CN104356220B (en) | A kind of have AntiHIV1 RT activity Aedes albopictus albumen of anticoagulant function and preparation method thereof | |
CN103025756A (en) | Banana lectins and uses thereof | |
CN109535232A (en) | Polypeptide, preparation method and the purposes for inhibiting AIDS virus | |
CN105497884B (en) | Application of the outer membrane protein Omp22 as Acinetobacter bauamnnii vaccine target spot | |
CN102731658B (en) | Tat PTD-Endostatin recombination protein, preparation method and application thereof | |
CN106267410B (en) | HIV infection cell separator | |
Li et al. | Algal lectins for potential prevention of HIV transmission | |
Campbell et al. | Studies of three variants of mengo Encephalomyelitis virus III. Effect of overlay and polyanions on plaque size | |
CN116370335A (en) | Virus protection solution for wiping and virus protection wiping product | |
CN100390200C (en) | Recombinant targeted fusion protein for treating acquired immunodeficiency syndrome | |
CN104356219B (en) | A kind of Xanthopsyllacheopis antiarrhythmic polypeptide and preparation method thereof | |
CN106267416A (en) | AIDS therapeutic equipment | |
CN1752211B (en) | Recombination target fused protein for treating acquired immunodeficiency syndrome | |
CA2481325C (en) | Anti-hiv composition, production method thereof and medicament | |
US7309501B2 (en) | Conditioned media to inhibit growth of tumor cells | |
CN106110422A (en) | Acquired immune deficiency syndrome (AIDS) immunization therapy adsorber | |
ES2375601T3 (en) | FIGHT AGAINST INFECTIONS BY IH VIRUSES WITH BLOOD PLASMA OXIDIZED HUMAN NEO WITH HYPOCLOROUS ACID. | |
CN101235083B (en) | HIV-I resisting polypeptide, coded sequence and use thereof | |
CN101838318B (en) | Anti-HIV-I polypeptide and coding sequence and use thereof | |
CN105542003A (en) | Fully-humanized monoclonal antibody for RSV (respiratory syncytial virus) adhesion protein G surface antigen |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C14 | Grant of patent or utility model | ||
GR01 | Patent grant | ||
CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20170308 Termination date: 20211113 |
|
CF01 | Termination of patent right due to non-payment of annual fee |