CN104211782A - Truncated human papillomavirus 45 type L1 protein - Google Patents
Truncated human papillomavirus 45 type L1 protein Download PDFInfo
- Publication number
- CN104211782A CN104211782A CN201310217863.XA CN201310217863A CN104211782A CN 104211782 A CN104211782 A CN 104211782A CN 201310217863 A CN201310217863 A CN 201310217863A CN 104211782 A CN104211782 A CN 104211782A
- Authority
- CN
- China
- Prior art keywords
- particle
- albumen
- virus
- hpv
- hpv45l1
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/12—Viral antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/51—Medicinal preparations containing antigens or antibodies comprising whole cells, viruses or DNA/RNA
- A61K2039/525—Virus
- A61K2039/5258—Virus-like particles
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20022—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2710/00—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA dsDNA viruses
- C12N2710/00011—Details
- C12N2710/20011—Papillomaviridae
- C12N2710/20023—Virus like particles [VLP]
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Biophysics (AREA)
- Pharmacology & Pharmacy (AREA)
- Biochemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Immunology (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Genetics & Genomics (AREA)
- Epidemiology (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to a truncated human papillomavirus (HPV) 45 type L1 protein and a coded sequence and a preparation method thereof, and virus-like particles containing the protein, wherein the protein and the virus-like particles can be used for preventing HPV (particularly HPV45) infection and diseases such as cervical cancer and the like caused by the HPV (particularly HPV45) infection. The invention further relates to an application of the protein and the virus-like particles in preparation of a pharmaceutical composition or a vaccine, wherein the pharmaceutical composition or the vaccine is used for preventing the HPV (particularly HPV45) infection and the diseases such as cervical cancer and the like caused by the HPV (particularly HPV45) infection.
Description
Technical field
The present invention relates to Molecular Virology and field of immunology.Particularly, the present invention relates to a kind of human papillomavirus 45 type L1 albumen of brachymemma, its encoding sequence and preparation method, and comprise its virus-like particle, described albumen and virus-like particle can be used for preventing HPV(particularly HPV45) infect and by HPV(particularly HPV45) infect the disease such as cervical cancer etc. caused.The invention still further relates to above-mentioned albumen and the virus-like particle purposes for the preparation of pharmaceutical composition or vaccine, described pharmaceutical composition or vaccine are for preventing HPV(particularly HPV45) infect and by HPV(particularly HPV45) infect the disease such as cervical cancer etc. caused.
Background technology
Human papillomavirus (Human Papillomavirus, HPV) belongs to Papillomaviridae (Papillomaviridae) Papillomavirus, for without coating DNA virus.This viral genome is double-strand closed-circular DNA, and size is about 7.2 ~ 8kb, has 8 open reading frame.This viral genome can be divided into three regions by the difference of function: 1. early stage district (E), and about 4.5kb, coding E1, E2, E4 ~ E7 totally 6 and virus replication, transcribes and transform relevant Nonstructural Protein; 2. late region (L), about 2.5kb, coding Major capsid protein L1 and secondary capsid protein L2; 3. long control region (LCR), between L district end and E district initiating terminal, is about 800 ~ 900bp, and any albumen of not encoding, containing DNA replication dna and expression regulation element.HPV virion diameter is 45 ~ 55nm, and nucleocapsid is 20 body symmetries, has 72 shell particulates, is made up of L1 and L2.
HPV known at present about has more than 90 kind of hypotype, in crowd, mainly cause skin, the excipuliform pathology of mucous membrane.According to itself and tumorigenic relation, HPV can be divided into 3 groups: 1. low or without carcinogenic risk group, comprises HPV6,11,39,41,42,43; 2. moderate carcinogenic risk group, comprises HPV31,33,35,51,52; 3. height carcinogenic risk group, comprises HPV16,18,58,45.
HPV Molecule Epidemiology Investigation confirms, it is the important startup factor that cervical cancer occurs that high-risk HPV infects.In all cervical cancer samples, HPV DNA recall rate is up to more than 80%.Cervical cancer is a kind of common female malignant, and its sickness rate is only second to mammary cancer, is the killer of serious threat women's health.According to statistics, about have 490 in annual world wide, the new cases of 000 example, about have 270, and 000 people dies from this disease (Boyle, P., and J.Ferlay.Ann Oncol2005,16:481-8).In all cases of cervical cancer, what betide developing country account for about 83%, and in these countries, cervical cancer even can account for 15% of female malignant.And in developed country, this numeral only accounts for 1.5%.In areas to the south of the Sahara, Central and South Asia, Latin America, East Asia is the district occurred frequently of cervical cancer.China also belongs to cervical cancer district occurred frequently.In Lueyang, Shaanxi Province county, in married woman, the sickness rate of cervical cancer is up to 1026/100000.
About the meta-analysis of HPV type distribution in cervical cancer sample in world wide finds, in cervical cancer modal HPV type be 16 successively, 18,58,33,45,31,52,35,59,39,51,59,68,6,73,66,70,82(is according to descending sort).In cervical cancer patient, the infection rate of HPV45 is 4.4%, after HPV16 (54.4%), HPV18 (16.5%), HPV58 (5.1%), HPV33 (4.7%), be positioned at the 5th (Y P Bao, N Li, J S Smith and Y L Qiao.International Journal of STD & AIDS, 2008,19:106-111).This illustrates that the infection rate in HPV45 woman uterus cancer patient is worldwide higher, is one of general susceptible HPV type.
The HPV vaccine gone on the market at present is Merck's
and GSK
above-mentioned two kinds of vaccines respectively containing HPV6/11/16/18 and HPV16/18VLP, but are not all included in the HPV45 type VLP of general susceptible in China and Asia women.
Therefore, for China and the developing country women HPV vaccine safely and effectively such as Asia, particularly for HPV16, the vaccine of the high-risk types such as 18 and 45, be effectively prevent cervical cancer, improve the effective way of numerous women (particularly China and Asia women) healthy state.
HPV L1 albumen is major capsid protein, and molecular weight is 55-60kDa, is HPV vaccine major target proteins.The HPV L1 albumen of expressing in multiple expression system without the need to L2 albumen auxiliary can be formed on morphological structure with virus-like particle like natural viral Particle Phase (Virus-Like Particle, VLP).This virus-like particle is icosahedron cubic symmetry structure, is made up of the pentamer of 72 L1 albumen.It remains the natural epitopes of virion, there is stronger immunogenicity, neutralizing antibody (Kirnbauer, R. for homotype HPV virus can be induced, F.Booy, et al.1992Proc Natl Acad Sci U S A89 (24): 12180-4).Further, virus-like particle, without viral nucleic acid, without potential carcinogenic danger, has good security.Therefore, VLP vaccine has become the Main way of HPV Vaccine Development.
The key of HPV VLP vaccine development can efficiently prepare VLP sample in a large number.VLP expression system comparatively conventional at present can be divided into eukaryotic expression system and prokaryotic expression system.
Conventional eukaryotic expression system has pox viruses express system, insect baculovirus expression system, yeast expression system.HPV L1 albumen native conformation expressed in eukaryotic expression system destroys few, and the spontaneous formation VLP of energy, often only need carry out the VLP that simple density gradient centrifugation can obtain purifying, for purification work provides great facility.But because the expression amount of eukaryotic expression system is low, toxigenic capacity is high, brings extreme difficulties to large-scale industrial production.The HPV vaccine gone on the market at present
have employed Saccharomyces Serevisiae Expression System, its expression amount is low, and production cost is high, and therefore this product price is higher, affects its widespread use.
In prokaryotic expression system, utilize escherichia expression system to express HPV L1 albumen have been reported.Such as report and utilized escherichia coli expression HPV16L1 albumen (Banks, L., G.Matlashewski, et al. (1987) .J Gen Virol68 (Pt12): 3081-9).But the HPV L1 albumen of escherichia coli expression loses its native conformation mostly, can not produce the protection antibody for HPV.Although or above-mentioned albumen is by occlusion body purifying, the steps such as renaturation also can obtain HPV VLP(Kelsall, S.R.and J.K.Kulski (1995) .J Virol Methods53 (1): 75-90), but loss of proteins amount is large in renaturation process, yield is low, therefore, be difficult to apply in scale operation.Although HPV L1 albumen also can be expressed with correct conformation solubility in intestinal bacteria, be dissolved in the cracking supernatant of thalline, its expression amount is lower, and in supernatant, foreign protein kind is many and amount is large, will therefrom be purified into target protein difficulty quite large.Although also there is bibliographical information can increase the expression amount of L1 albumen in supernatant by the mode of GST amalgamation and expression, and help the purifying (Li of target protein, M., T.P.Cripe, et al. (1997) .J Virol71 (4): 2988-95), but the cutting of fusion rotein often needs expensive enzyme, still scale operation cannot be applied to.
Therefore, this area still need can low cost obtain and can induce for the protection antibody of HPV HPV L1 albumen and consisting of virus-like particle, thus make large-scale industrial production vaccine for cervical cancer become possibility.
Summary of the invention
The present invention is at least partly based on the beat all discovery of contriver: utilize escherichia expression system energy great expression can induce the HPV45L1 albumen of the brachymemma of the neutralizing antibody for HPV45; the HPV45L1 albumen of this brachymemma has high yield; and purified rear purity can reach 96% or higher, and the described albumen after purifying is through processing the virus-like particle that can obtain the protection antibody can induced for HPV45 further.
Therefore, in one aspect, the present invention relates to a kind of HPV45L1 albumen or its variant of brachymemma, it is compared with wild-type HPV45L1 albumen, N holds brachymemma 27-40 amino acid, such as 27,28,29,30,31,32,33,34,35,36,37,38,39 and 40 amino acid.
In a preferred embodiment, compared with wild-type HPV45L1 albumen, the N of the HPV45L1 albumen of this brachymemma holds brachymemma 27,30,35 or 40 amino acid.
In another preferred embodiment, the HPV45L1 albumen (hereinafter also referred to as truncated protein) of this brachymemma has SEQ ID NO:3, the aminoacid sequence shown in SEQ ID NO:4, SEQ ID NO:5 or SEQ ID NO:6.In another preferred embodiment, this truncated protein has the aminoacid sequence as shown in SEQ ID NO:3.
In yet another aspect, the present invention relates to the polynucleotide of coding truncated protein of the present invention or its variant and the carrier containing these polynucleotide.
The carrier that can be used for inserting polynucleotide of interest is well known in the art, includes but not limited to cloning vector and expression vector.In one embodiment, carrier is such as plasmid, clay, phage, coemid etc.
In yet another aspect, the invention still further relates to the host cell comprising above-mentioned polynucleotide or carrier.This type of host cell includes but not limited to, prokaryotic cell prokaryocyte is Bacillus coli cells such as, and eukaryotic cell such as yeast cell, insect cell, vegetable cell and zooblast (such as, as mammalian cell, mouse cell, people's cell etc.).Host cell of the present invention can also be clone, such as 293T cell.
In yet another aspect, the present invention relates to a kind of HPV45 virus-like particle, wherein this virus-like particle contains truncated protein of the present invention or its variant, or is formed by truncated protein of the present invention or its variant or formed.
In a preferred embodiment, HPV45 virus-like particle of the present invention comprises compared with wild-type HPV45L1 albumen, N holds brachymemma 27-40 amino acid, the HPV45L1 albumen of such as 27,30,35 or 40 amino acid whose brachymemmas, or is made up of described albumen or is formed.In an especially preferred embodiment, HPV45 virus-like particle of the present invention comprises and has SEQ ID NO:3, the HPV45L1 albumen of the brachymemma of sequence shown in 4,5 or 6, or is made up of described albumen or is formed.
In yet another aspect, the invention still further relates to and comprise above-mentioned truncated protein or its variant, or the composition of above-mentioned polynucleotide or carrier or host cell or HPV45 virus-like particle.In a preferred embodiment, described composition comprises truncated protein of the present invention or its variant.In another preferred embodiment, described composition comprises HPV45 virus-like particle of the present invention.
In yet another aspect, the invention still further relates to a kind of pharmaceutical composition or vaccine, it comprises HPV45 virus-like particle of the present invention, optionally also comprises pharmaceutically acceptable carrier and/or vehicle.Pharmaceutical composition of the present invention or vaccine may be used for preventing HPV(particularly HPV45) infect or by HPV(particularly HPV45) infect the disease such as cervical cancer etc. caused.
In a preferred embodiment, described HPV45 virus-like particle is to prevent HPV to infect or the existence of cervical cancer significant quantity.In another preferred embodiment, pharmaceutical composition of the present invention or vaccine also comprise at least one and are selected from following virus-like particle: HPV6L1 prion sample particle, HPV11L1 prion sample particle, HPV16L1 prion sample particle, HPV18L1 prion sample particle, HPV31L1 prion sample particle, HPV33L1 prion sample particle, HPV52L1 prion sample particle, humanpapilloma virus 58 L1 protein virus-like particle; Preferably, these virus-like particles are independently of one another to prevent cervical cancer or corresponding HPV Subtypes significant quantity to exist.
Pharmaceutical composition of the present invention or vaccine are used by method well known in the art, use such as but not limited to by oral or injection.In the present invention, particularly preferred method of application is injection.
In a preferred embodiment, pharmaceutical composition of the present invention or vaccine are used in a unit.Such as but be not intended to limit the present invention, the amount of the HPV45 virus-like particle comprised in per unit dosage is 5 μ g-80 μ g, preferably 20 μ g-40 μ g.
In yet another aspect, the present invention relates to a kind of method obtaining truncated protein of the present invention, it comprises and utilizes escherichia expression system to express truncated protein of the present invention, then the cracking supernatant containing this truncated protein is carried out purification process.
In a preferred embodiment, the method obtaining truncated protein of the present invention comprises
A) truncated protein described in expression in escherichia coli,
B) being broken in the solution of 100mM-600mM in salt concn by expressing the intestinal bacteria of described truncated protein, being separated and obtaining supernatant liquor,
C) with water or low salt solutions, the salt concn of supernatant liquor b) obtained is down to 100mM or following, is low to moderate 0 most, and collecting precipitation,
D) being deposited in 150mM-2500mM salts solution of c) obtaining is dissolved again, add reductive agent simultaneously, be separated and obtain solution, containing the HPV45L1 albumen of the brachymemma of purity at least 50% in this solution.
More generally, the invention still further relates to a kind of method obtaining HPV L1 albumen such as truncated protein of the present invention, it comprises
A) at the HPV L1 gene of expression in escherichia coli coding HPV L1 albumen,
B) by the intestinal bacteria of expressing HPV L1 albumen in salt concn be 100mM-600mM solution in broken, be separated and obtain supernatant liquor,
C) with water or low salt solutions, the salt concn of supernatant liquor b) obtained is down to 100mM or following, is low to moderate 0 most, collecting precipitation,
D) being deposited in 150mM-2500mM salts solution of c) obtaining is dissolved again, add reductive agent simultaneously, be separated and obtain solution, containing the HPV L1 albumen of purity at least 50% in this solution.
The invention still further relates to a kind of method obtaining HPV45 virus-like particle of the present invention, it, on the basis obtaining truncated protein of the present invention, comprises step:
E) by the HPV45L1 albumen of the above-mentioned brachymemma of purity at least 50% further by chromatographic purification,
F) by step e) in the truncated protein that obtains remove reductive agent.
The invention still further relates to a kind of method preparing vaccine, it comprises HPV45 virus-like particle of the present invention and pharmaceutically acceptable carrier and/or mixed with excipients, optionally also mixes one or more and is selected from HPV6,11,16,18, the virus-like particle of the HPV type of 31,33,52 and 58.As discussed above, the vaccine obtained may be used for preventing HPV(particularly HPV45) infect or by HPV(particularly HPV45) infect the disease such as cervical cancer etc. caused.
In yet another aspect, the present invention relates to a kind of HPV of prevention and infect or infected by HPV the method for caused disease, it comprise by prevention significant quantity according to HPV45 virus-like particle of the present invention or pharmaceutical composition or vaccine administration to experimenter.In a preferred embodiment, described HPV infects is that HPV45 infects.In another preferred embodiment, describedly infect caused disease by HPV and include but not limited to, cervical cancer.In another preferred embodiment, described experimenter is Mammals, such as people.
In yet another aspect, also relate to the purposes in pharmaceutical compositions or vaccine according to truncated protein of the present invention or HPV45 virus-like particle, described pharmaceutical composition or vaccine infect for preventing HPV or infect caused disease by HPV.In a preferred embodiment, described HPV infects is that HPV45 infects.In another preferred embodiment, describedly infect caused disease by HPV and include but not limited to, cervical cancer.
the explanation of relational language and explanation in the present invention
In the present invention, unless otherwise stated, Science and Technology noun used herein has the implication that those skilled in the art understand usually.Further, cell cultures used herein, molecular genetics, nucleic acid chemistry, Immunology Lab operation steps are widely used conventional steps in corresponding field.Meanwhile, in order to understand the present invention better, provide definition and the explanation of relational language below.
According to the present invention, statement " N holds a brachymemma X amino acid whose protein " refers to, the protein that the 1-X amino acids residue of the methionine residues replacement protein matter N-terminal of encoding by initiator codon (for initiation protein translation) obtains.Such as N holds brachymemma 27 amino acid whose HPV45L1 albumen to refer to, the protein obtained with the 1-27 amino acids residue of the methionine residues displacement wild-type HPV45L1 protein N terminal of initiator codon coding.
According to the present invention, term " variant " refers to such albumen, and the HPV45L1 albumen of its aminoacid sequence and brachymemma of the present invention is (as SEQ ID NO:3, albumen shown in 4,5 or 6) aminoacid sequence there is one or more (such as 1-10 or 1-5 or 1-3) amino acid be different or have at least 60%, 80%, 85%, 90%, 95%, 96%, 97%, 98%, or the identity of 99%, and it remains the necessary characteristic of described truncated protein.Term " necessary characteristic " can be one or more in following characteristic herein: can induce the neutralizing antibody for HPV45; Can express to solubility in intestinal bacteria; Utilize expression and purification method involved in the present invention can obtain the purifying protein of high yield.Term " identity " is measuring the similarity of nucleotide sequence or aminoacid sequence.Usually series arrangement is got up, mate to greatest extent to obtain." identity " itself has meaning well known in the art and available disclosed algorithm (such as BLAST) calculates.
According to the present invention, term " escherichia expression system " refers to the expression system be made up of intestinal bacteria (bacterial strain) and carrier, wherein intestinal bacteria (bacterial strain) derive from bacterial strain available on the market, such as but not limited to: ER2566, BL21 (DE3), B834 (DE3), BLR (DE3).
According to the present invention, term " carrier (vector) " refers to, polynucleotide can be inserted a kind of nucleic acid launch vehicle wherein.When carrier can make the albumen coded by the polynucleotide of insertion obtain expression, carrier is called expression vector.Carrier can by transforming, and transduction or transfection import host cell, and the genetic material element making it carry obtains expression in host cell.Carrier well known to a person skilled in the art, includes but not limited to: plasmid; Phage; Coemid etc.
According to the present invention, term " the HPV45L1 albumen of brachymemma " refers to the protein after the N of wild-type HPV45L1 albumen holds and/or C end removes one or more amino acid, and wherein the example of wild-type HPV45L1 albumen includes but not limited in ncbi database
p36741.1,
aBP99903.1,
aBP99887.1,
aBP99855.1or
aBP99839.1etc. total length L1 albumen.
Term " the HPV45L1 protein gene fragment of brachymemma " refers to such gene fragment, it is compared with wild-type HPV45L1 protein gene (cDNA), remove the one or more amino acid whose Nucleotide of coding at 5' end or 3' end, wherein the full length sequence of wild-type HPV45L1 protein gene is such as but not limited to sequence following in ncbi database:
qv31748,
qv26351,
qv06560,
qv00550,
qv34178,
qv27565,
qv31035,
qv25000,
qv35960or
qv30004deng.
According to the present invention, term " pharmaceutically acceptable carrier and/or vehicle " refers to carrier compatible with activeconstituents with experimenter on pharmacology and/or physiology and/or vehicle, it is well known in the art (see such as Remington's Pharmaceutical Sciences.Edited by Gennaro AR, 19th ed.Pennsylvania:Mack Publishing Company, 1995), and include but not limited to: pH adjusting agent, tensio-active agent, adjuvant, ionic strength toughener.Such as, pH adjusting agent includes but not limited to phosphate buffered saline buffer; Tensio-active agent includes but not limited to positively charged ion, negatively charged ion or nonionic surface active agent, such as Tween-80; Adjuvant includes but not limited to aluminium adjuvant (such as aluminium hydroxide), freund's adjuvant (such as complete Freund's adjuvant); Ionic strength toughener includes but not limited to sodium-chlor.
According to the present invention, term " significant quantity " refers to the amount that effectively can realize expection object.Such as, preventing disease (such as HPV infects) significant quantity refers to, can effectively prevent, and stops, or the amount of the generation of delay disease (such as HPV infects).Measure such significant quantity within the limit of power of those skilled in the art.
According to the present invention, term " chromatography " includes but not limited to: ion-exchange chromatography (such as cation-exchange chromatography), hydrophobic interaction chromatograph, adsorption chromatography (such as hydroxylapatite chromatography), gel-filtration (gel exclusion) chromatography, affinity chromatography.
According to the present invention, the HPV45L1 albumen of brachymemma of the present invention obtains preferably by following steps: be 100-600mM by the intestinal bacteria of HPV45L1 albumen of expressing brachymemma in salt concn, carry out fragmentation in the damping fluid of preferred 200-500mM, centrifugal breaking solution, obtains supernatant liquor; Reduce the salt concn of gained supernatant liquor to salt concn 100mM-0mM with the solution of water or low salt concn (being usually less than broken salt concn), thus the HPV45L1 albumen of brachymemma precipitates in supernatant liquor; To be deposited in containing reductive agent and salt concn is 150-2500mM, again dissolve in the solution of preferred more than 200mM, thus be separated the solution of the HPV45L1 albumen obtained containing brachymemma, the purity of wherein said albumen is at least 50%, preferably at least 70%, more preferably at least 80%.
Damping fluid in method used in the present invention is well known in the art, includes but not limited to, Tris damping fluid, phosphate buffered saline buffer, HEPES damping fluid, MOPS damping fluid etc.
According to the present invention, the fragmentation of host cell realizes by various method well known to those skilled in the art, include but not limited to that homogenizer is broken, clarifixator is broken, ultrasonication, grinding, high-pressure extrusion, N,O-Diacetylmuramidase process etc.
Salt in method used in the present invention includes but not limited to acid salt, subsalt, neutral salt, such as an alkali metal salt, alkaline earth salt, ammonium salt, hydrochloride, vitriol, supercarbonate, phosphoric acid salt or hydrophosphate, particularly NaCl, KCl, NH
4cl, (NH
4)
2sO
4in one or more.Particularly preferred salt is NaCl.Reductive agent in method used in the present invention includes but not limited to DTT, 2 mercapto ethanol, and its consumption includes but not limited to 10mM-100mM.
HPV45 virus-like particle according to the present invention obtains by following steps: be separated further by such as chromatography by the HPV45L1 albumen of the brachymemma of above-mentioned purity at least 50%, obtains purified truncated protein solution; Remove the reductive agent in this solution, obtain described HPV45 virus-like particle.The mode removing reductive agent is known in the art, includes but not limited to, dialysis, ultrafiltration or chromatography etc.
The beneficial effect of the invention
Expression system at present for the preparation of HPV virus-like particle can be divided into eukaryotic expression system and prokaryotic expression system.
The HPV L1 albumen native conformation of expressing in eukaryotic expression system destroys few, and the spontaneous formation VLP of energy, often only need carry out simple purge process can obtain the VLP with correct conformation.But the defects such as it is low that current eukaryotic expression system such as baculovirus expression system and yeast expression system exist expression amount, and toxigenic capacity is high, bring extreme difficulties to large-scale industrial production.
In prokaryotic expression system, it is low that escherichia expression system has toxigenic capacity, the advantage that expression amount is large.But, often lose correct native conformation at the HPV L1 albumen of expression in escherichia coli, be expressed in precipitation with occlusion body form.Carrying out renaturation to the albumen be expressed in occlusion body is at present still a global problem.Renaturation difficulty and inefficiency make the VLP obtaining correct conformation from occlusion body be difficult to implement in scale operation, can only be confined in small-scale laboratory study.Although HPV L1 also can be expressed in intestinal bacteria with correct conformation solubility, its expression amount is low.And, from the intestinal bacteria cracking supernatant comprising miscellaneous soluble proteins, be purified into HPV L1 albumen also quite difficult, often need by the means such as amalgamation and expression and affinity chromatography, and these means often need expensive enzyme, therefore, still suitability for industrialized production cannot be realized.
N provided by the invention holds the HPV45L1 albumen of brachymemma and its preparation method to efficiently solve the problems referred to above.First, the present invention uses escherichia expression system to express the HPV45L1 albumen that N holds brachymemma, ensure that its high expression level amount.Secondly, the present invention adopts the truncated protein in gentle means selective precipitation intestinal bacteria cracking supernatant, then adopt and again dissolve truncated protein containing salt buffer, thus purity of protein is had significantly improve under the prerequisite of correct conformation keeping truncated protein, and the truncated protein solution obtained can be directly further purified by chromatography such as ion exchange chromatography and hydrophobic exchange chromatography, obtains highly purified target protein (such as purity reaches 96%).Further, the high purity truncated protein obtained can be assembled into virus-like particle, and this virus-like particle can the neutralizing antibody for HPV45 of induced high titers in vivo, has good immunogenicity, be a kind of good vaccine form, can be used for prevention HPV45 to the infection of human body.As can be seen here, the present invention has the following advantages: truncated protein of the present invention, while the antigenicity retaining total length HPV45L1 albumen and particle assembling ability, can realize great expression in escherichia expression system; Preparation method of the present invention is without the need to using expensive enzyme, with low cost; Truncated protein conformation in purge process does not pass through violent sex change renaturation process, and lose little, productive rate is high; The virus-like particle that truncated protein is formed can the protection antibody for HPV of induced high titers, can be used for producing vaccine.Therefore, truncated protein of the present invention and its preparation method can be applicable to large-scale industrial production, and make large-scale industrial production vaccine for cervical cancer become possibility.
Below in conjunction with drawings and Examples, embodiment of the present invention are described in detail, but it will be understood by those skilled in the art that following drawings and Examples are only for illustration of the present invention, instead of the restriction to scope of the present invention.With reference to the accompanying drawings with the following detailed description of preferred embodiment, various object of the present invention and favourable aspect will become obvious to those skilled in the art.
Accompanying drawing explanation
Fig. 1 shows the result of the sds polyacrylamide gel electrophoresis of the HPV45N27C-L1 albumen obtained in the different step of embodiment 2.Swimming lane 1: bacteria break supernatant (that is, the supernatant of centrifugal acquisition after broken thalline); Swimming lane 2: salt-free precipitated product (that is, the precipitation of centrifugal acquisition after dialysis); Swimming lane 3: heavy molten rear supernatant (that is, salt-free precipitated product being dissolved again the supernatant of rear centrifugal acquisition); Swimming lane 4: heavy molten postprecipitation (that is, salt-free precipitated product being dissolved again the precipitation of rear centrifugal acquisition).Result shows, and HPV45N27C-L1 albumen is passing through precipitation, and after heavy molten step, purity has brought up to about 70%(see swimming lane 1 and 3 from about 10% before).
Fig. 2 shows the result through the sds polyacrylamide gel electrophoresis of the HPV45N27C-L1 of CHT Sepharose4Fast Flow column purification acquisition in embodiment 3.Swimming lane M: protein markers; Swimming lane 1:CHT Sepharose4Fast Flow post 1000mmol/L NaCl elutriated fraction (10 μ l); Swimming lane 2: carry out the sample before purifying with CHT Sepharose4Fast Flow post.Result shows, and after CHT Sepharose4Fast Flow column purification, HPV45N27C-L1 purity of protein reaches more than 95% (see swimming lane 1).
Fig. 3 shows transmission electron microscope observing (amplifying 100,000 times, the Bar=0.1 μm) result of the HPV45N27C-L1 virus-like particle of gained in embodiment 4.In the visual field, visible a large amount of radius is the virus-like particle of about 25nm, and granular size conforms to theoretical size, and uniformity.
Fig. 4 shows the result of low temp. electric sem observation and the three-dimensional structure of reconstruction thereof of the HPV45N27C-L1 virus-like particle of embodiment 4 gained described in embodiment 5.The low temp. electric sem observation result of Fig. 4 A, HPV45N27C-L1 virus-like particle; The three-dimensional structure of the reconstruction of Fig. 4 B, HPV45N27C-L1 virus-like particle.The three-dimensional structure display of rebuilding, HPV45N27C-L1VLP is the icosahedral structure of virus (h=1, k=2) of the T=7 formed by 72 capsomeres (form subunit, pentamer).Different from the general icosahedral virus capsid meeting quasi-equivalence principle, composition subunits all in HPV45N27C-L1VLP structure is pentamer, and has no six aggressiveness, and the outermost diameter of VLP is about 60nm.This with the natural HPV virion to report before and eukaryotic expression system (such as, pox viruses express system) three-dimensional structure (the Baker TS of HPV VLP that originates, Newcomb WW, Olson NH.et al.Biophys J. (1991), 60 (6): 1445-1456; Hagensee ME, Olson NH, Baker TS, et al.J Virol. (1994), 68 (7): 4503-4505; Buck CB, Cheng N, Thompson CD.et al.J Virol. (2008), 82 (11): 5190-7) similar.
Fig. 5 shows the dynamic light scattering observed result of the HPV45N27C-L1 virus-like particle of gained in embodiment 4.Result shows, and the hydrated molecule kinetics radius of HPV45N27C-L1 virus-like particle is 28.68nm, and particle assembling per-cent is 92.7%.
Fig. 6 shows the NAT with different steps serum after HPV45N27C-L1 virus-like particle Mice Inoculated in embodiment 6.Red arrow instruction place is immunization time point, and at initial immunity after 1 week, namely NAT has obvious rising; After twice booster immunization, the titre of neutralizing antibody can reach close to 10
6higher level.
Fig. 7 shows the NAT with different steps serum after HPV45N27C-L1 virus-like particle inoculation rabbit in embodiment 6.Red arrow instruction place is immunization time point, and at initial immunity after two weeks, namely NAT has obvious rising; After twice booster immunization, the titre of neutralizing antibody can reach 10
6higher level.
Fig. 8 shows the result of the sds polyacrylamide gel electrophoresis of the expression of each HPV45L1 truncated protein in intestinal bacteria in embodiment 7.Swimming lane M, protein markers; Swimming lane 1, HPV45L1 total length bacteria break supernatant, loading volume is 10 μ l; Swimming lane 2, HPV45N24C-L1 bacteria break supernatant, loading volume is 10 μ l; Swimming lane 3, HPV45N27C-L1 bacteria break supernatant, loading volume is 10 μ l; Swimming lane 4, HPV45N30C-L1 bacteria break supernatant, loading volume is 10 μ l; Swimming lane 5, HPV45N35C-L1 bacteria break supernatant, loading volume is 10 μ l; Swimming lane 6, HPV45N40C-L1 bacteria break supernatant, loading volume is 10 μ l; Swimming lane 7, HPV45N45C-L1 bacteria break supernatant, loading volume is 10 μ l.
Fig. 9 shows that embodiment 7 obtains, purified N and holds brachymemma 30,35 or 40 amino acid whose HPV45L1 albumen--HPV45N30C-L1, HPV45N35C-L1, its aminoacid sequence of HPV45N40C-L1(is SEQ ID NO:4 respectively, SEQ ID NO:5, SEQ ID NO:6) the result of sds polyacrylamide gel electrophoresis.Swimming lane M, protein markers; Swimming lane 1, HPV45N30C-L1 albumen, loading volume is 10 μ l; Swimming lane 2, HPV45N35C-L1 albumen, loading volume is 10 μ l; Swimming lane 3, HPV45N40C-L1 albumen, loading volume is 10 μ l.Result shows, and the albumen HPV45N30C-L1 that embodiment 6 obtains, the purity of protein of HPV45N35C-L1, HPV45N40C-L1 all reaches more than 95%.
Figure 10 shows transmission electron microscope observing (100,000 times, the 0.1um) result of the HPV45N30C-L1 virus-like particle described in embodiment 7.Result shows, and in the visual field, visible a large amount of radius is the virus-like particle of about 25nm, and granular size conforms to theoretical size, and uniformity.
Figure 11 shows transmission electron microscope observing (100,000 times, the 0.1um) result of the HPV45N35C-L1 virus-like particle described in embodiment 7.Result shows, and in the visual field, visible a large amount of radius is the virus-like particle of about 25nm, and granular size conforms to theoretical size, and uniformity.
Figure 12 shows transmission electron microscope observing (100,000 times, the 0.1um) result of the HPV45N40C-L1 virus-like particle described in embodiment 7.Result shows, and in the visual field, visible a large amount of radius is the virus-like particle of about 25nm, and granular size conforms to theoretical size, and uniformity.
Figure 13 shows the dynamic light scattering observed result of the HPV45N30C-L1 virus-like particle described in embodiment 7.Result shows, and the hydrated molecule kinetics radius of HPV45N30C-L1 virus-like particle is about 32.02nm, and particle assembling per-cent is 95.7%.
Figure 14 shows the dynamic light scattering observed result of the HPV45N35C-L1 virus-like particle described in embodiment 7.Result shows, and the hydrated molecule kinetics radius of HPV45N35C-L1 virus-like particle is about 29.17m, and particle assembling per-cent is 95.4%.
Figure 15 shows the dynamic light scattering observed result of the HPV45N40C-L1 virus-like particle described in embodiment 7.Result shows, and the hydrated molecule kinetics radius of HPV45N40C-L1 virus-like particle is about 29.98nm, and particle assembling per-cent is 93.0%.
The information of the sequence that the present invention relates to is provided in table 1 below.
Table 1: the explanation of sequence
SEQ?ID?NO | Explanation |
1 | The aminoacid sequence of wild-type HPV45L1 albumen (P36741.1) |
2 | N holds the amino acid whose HPV45L1 protein sequence of disappearance 24 |
3 | N holds the amino acid whose HPV45L1 protein sequence of disappearance 27 |
4 | N holds the amino acid whose HPV45L1 protein sequence of disappearance 30 |
5 | N holds the amino acid whose HPV45L1 protein sequence of disappearance 35 |
6 | N holds the amino acid whose HPV45L1 protein sequence of disappearance 40 |
7 | N holds the amino acid whose HPV45L1 protein sequence of disappearance 45 |
8 | The DNA sequence dna of coding SEQ ID NO:1 |
9 | The DNA sequence dna of coding SEQ ID NO:2 |
10 | The DNA sequence dna of coding SEQ ID NO:3 |
11 | The DNA sequence dna of coding SEQ ID NO:4 |
12 | The DNA sequence dna of coding SEQ ID NO:5 |
13 | The DNA sequence dna of coding SEQ ID NO:6 |
14 | The DNA sequence dna of coding SEQ ID NO:7 |
15 | Primer |
16 | Primer |
Sequence 1 (SEQ ID NO:1):
MAHNIIYGHGIIIFLKNVNVFPIFLQMALWRPSDSTVYLPPPSVARVVSTDDYVSRTSIFYHAGSSRLLTVGNPYFRVVP?NGAGNKQAVPKVSAYQYRVFRVALPDPNKFGLPDSTIYNPETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAH?AATAVITQDVRDNVSVDYKQTQLCILGCVPAIGEHWAKGTLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTL?QDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRREQLFARHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVY?SPSPSGSIITSDSQLFNKPYWLHKAQGHNNGICWHNQLFVTVVDTTRSTNLTLCASTQNPVPSTYDPTKFKQYSRHVEEY?DLQFIFQLCTITLTAEVMSYIHSMNSSILENWNFGVPPPPTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVD?LKEKFSSDLDQYPLGRKFLVQAGLRRRPTIGPRKRPAASTSTASTASRPAKRVRIRSKK
Sequence 2 (SEQ ID NO:2):
MLQMALWRPSDSTVYLPPPSVARVVSTDDYVSRTSIFYHAGSSRLLTVGNPYFRVVPNGAGNKQAVPKVSAYQYRVFRVA?LPDPNKFGLPDSTIYNPETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAHAATAVITQDVRDNVSVDYKQTQL?CILGCVPAIGEHWAKGTLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQ?MSADPYGDSMFFCLRREQLFARHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVYSPSPSGSIITSDSQLFNKPYWLH?KAQGHNNGICWHNQLFVTVVDTTRSTNLTLCASTQNPVPSTYDPTKFKQYSRHVEEYDLQFIFQLCTITLTAEVMSYIHS?MNSSILENWNFGVPPPPTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVDLKEKFSSDLDQYPLGRKFLVQAG?LRRRPTIGPRKRPAASTSTASTASRPAKRVRIRSKK
Sequence 3 (SEQ ID NO:3):
MALWRPSDSTVYLPPPSVARVVSTDDYVSRTSIFYHAGSSRLLTVGNPYFRVVPNGAGNKQAVPKVSAYQYRVFRVALPD?PNKFGLPDSTIYNPETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAHAATAVITQDVRDNVSVDYKQTQLCIL?GCVPAIGEHWAKGTLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSA?DPYGDSMFFCLRREQLFARHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVYSPSPSGSIITSDSQLFNKPYWLHKAQ?GHNNGICWHNQLFVTVVDTTRSTNLTLCASTQNPVPSTYDPTKFKQYSRHVEEYDLQFIFQLCTITLTAEVMSYIHSMNS?SILENWNFGVPPPPTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVDLKEKFSSDLDQYPLGRKFLVQAGLRR?RPTIGPRKRPAASTSTASTASRPAKRVRIRSKK
Sequence 4 (SEQ ID NO:4):
MRPSDSTVYLPPPSVARVVSTDDYVSRTSIFYHAGSSRLLTVGNPYFRVVPNGAGNKQAVPKVSAYQYRVFRVALPDPNK?FGLPDSTIYNPETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAHAATAVITQDVRDNVSVDYKQTQLCILGCV?PAIGEHWAKGTLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPY?GDSMFFCLRREQLFARHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVYSPSPSGSIITSDSQLFNKPYWLHKAQGHN?NGICWHNQLFVTVVDTTRSTNLTLCASTQNPVPSTYDPTKFKQYSRHVEEYDLQFIFQLCTITLTAEVMSYIHSMNSSIL?ENWNFGVPPPPTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVDLKEKFSSDLDQYPLGRKFLVQAGLRRRPT?IGPRKRPAASTSTASTASRPAKRVRIRSKK
Sequence 5 (SEQ ID NO:5):
MTVYLPPPSVARVVSTDDYVSRTSIFYHAGSSRLLTVGNPYFRVVPNGAGNKQAVPKVSAYQYRVFRVALPDPNKFGLPD?STIYNPETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAHAATAVITQDVRDNVSVDYKQTQLCILGCVPAIGE?HWAKGTLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMF?FCLRREQLFARHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVYSPSPSGSIITSDSQLFNKPYWLHKAQGHNNGICW?HNQLFVTVVDTTRSTNLTLCASTQNPVPSTYDPTKFKQYSRHVEEYDLQFIFQLCTITLTAEVMSYIHSMNSSILENWNF?GVPPPPTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVDLKEKFSSDLDQYPLGRKFLVQAGLRRRPTIGPRK?RPAASTSTASTASRPAKRVRIRSKK
Sequence 6 (SEQ ID NO:6):
MPPSVARVVSTDDYVSRTSIFYHAGSSRLLTVGNPYFRVVPNGAGNKQAVPKVSAYQYRVFRVALPDPNKFGLPDSTIYN?PETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAHAATAVITQDVRDNVSVDYKQTQLCILGCVPAIGEHWAKG?TLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDSMFFCLRR?EQLFARHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVYSPSPSGSIITSDSQLFNKPYWLHKAQGHNNGICWHNQLF?VTVVDTTRSTNLTLCASTQNPVPSTYDPTKFKQYSRHVEEYDLQFIFQLCTITLTAEVMSYIHSMNSSILENWNFGVPPP?PTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVDLKEKFSSDLDQYPLGRKFLVQAGLRRRPTIGPRKRPAAS?TSTASTASRPAKRVRIRSKK
Sequence 7 (SEQ ID NO:7):
MRVVSTDDYVSRTSIFYHAGSSRLLTVGNPYFRVVPNGAGNKQAVPKVSAYQYRVFRVALPDPNKFGLPDSTIYNP?ETQRLVWACVGMEIGRGQPLGIGLSGHPFYNKLDDTESAHAATAVITQDVRDNVSVDYKQTQLCILGCVPAIGEHW?AKGTLCKPAQLQPGDCPPLELKNTIIEDGDMVDTGYGAMDFSTLQDTKCEVPLDICQSICKYPDYLQMSADPYGDS?MFFCLRREQLFARHFWNRAGVMGDTVPTDLYIKGTSANMRETPGSCVYSPSPSGSIITSDSQLFNKPYWLHKAQGH?NNGICWHNQLFVTVVDTTRSTNLTLCASTQNPVPSTYDPTKFKQYSRHVEEYDLQFIFQLCTITLTAEVMSYIHSM?NSSILENWNFGVPPPPTTSLVDTYRFVQSVAVTCQKDTTPPEKQDPYDKLKFWTVDLKEKFSSDLDQYPLGRKFLV?QAGLRRRPTIGPRKRPAASTSTASTASRPAKRVRIRSKK
Sequence 8 (SEQ ID NO:8):
ATGGCACACAATATTATTTATGGCCATGGTATTATTATTTTCCTAAAAAACGTAAACGTATTCCCTATTTTTTTGCAGA?TGGCCCTGTGGAGGCCCAGCGACAGCACCGTGTACCTGCCCCCCCCCAGCGTGGCCAGGGTGGTGAGCACCGACGACTA?CGTGAGCAGGACCAGCATCTTCTACCACGCCGGCAGCAGCAGGCTGCTGACCGTGGGCAACCCCTACTTCAGGGTGGTGC?CCAACGGCGCCGGCAACAAGCAGGCCGTGCCCAAGGTGAGCGCCTACCAGTACAGGGTGTTCAGGGTGGCCCTGCCCGAC?CCCAACAAGTTCGGCCTGCCCGACAGCACCATCTACAACCCCGAGACCCAGAGGCTGGTGTGGGCCTGCGTGGGCATGGA?GATCGGCAGGGGCCAGCCCCTGGGCATCGGCCTGAGCGGCCACCCCTTCTACAACAAGCTGGACGACACCGAGAGCGCCC?ACGCCGCCACCGCCGTGATCACCCAGGACGTGAGGGACAACGTGAGCGTGGACTACAAGCAGACCCAGCTGTGCATCCTG?GGCTGCGTGCCCGCCATCGGCGAGCACTGGGCCAAGGGCACCCTGTGCAAGCCCGCCCAGCTGCAGCCCGGCGACTGCCC?CCCCCTGGAGCTGAAGAACACCATCATCGAGGACGGCGACATGGTGGACACCGGCTACGGCGCCATGGACTTCAGCACCC?TGCAGGACACCAAGTGCGAGGTGCCCCTGGACATCTGCCAGAGCATCTGCAAGTACCCCGACTACCTGCAGATGAGCGCC?GACCCCTACGGCGACAGCATGTTCTTCTGCCTGAGGAGGGAGCAGCTGTTCGCCAGGCACTTCTGGAACAGGGCCGGCGT?GATGGGCGACACCGTGCCCACCGACCTGTACATCAAGGGCACCAGCGCCAACATGAGGGAGACCCCCGGCAGCTGCGTGT?ACAGCCCCAGCCCCAGCGGCAGCATCATCACCAGCGACAGCCAGCTGTTCAACAAGCCCTACTGGCTGCACAAGGCCCAG?GGCCACAACAACGGCATCTGCTGGCACAACCAGCTGTTCGTGACCGTGGTGGACACCACCAGGAGCACCAACCTGACCCT?GTGCGCCAGCACCCAGAACCCCGTGCCCAGCACCTACGACCCCACCAAGTTCAAGCAGTACAGCAGGCACGTGGAGGAGT?ACGACCTGCAGTTCATCTTCCAGCTGTGCACCATCACCCTGACCGCCGAGGTGATGAGCTACATCCACAGCATGAACAGC?AGCATCCTGGAGAACTGGAACTTCGGCGTGCCCCCCCCCCCCACCACCAGCCTGGTGGACACCTACAGGTTCGTGCAGAG?CGTGGCCGTGACCTGCCAGAAGGACACCACCCCCCCCGAGAAGCAGGACCCCTACGACAAGCTGAAGTTCTGGACCGTGG?ACCTGAAGGAGAAGTTCAGCAGCGACCTGGACCAGTACCCCCTGGGCAGGAAGTTCCTGGTGCAGGCCGGCCTGAGGAGG?AGGCCCACCATCGGCCCCAGGAAGAGGCCCGCCGCCAGCACCAGCACCGCCAGCACCGCCAGCAGGCCCGCCAAGAGGGT?GAGGATCAGGAGCAAGAAGTGA
Sequence 9 (SEQ ID NO:9):
ATGTTGCAGATGGCCCTGTGGAGGCCCAGCGACAGCACCGTGTACCTGCCCCCCCCCAGCGTGGCCAGGGTGGTGAGCAC?CGACGACTACGTGAGCAGGACCAGCATCTTCTACCACGCCGGCAGCAGCAGGCTGCTGACCGTGGGCAACCCCTACTTCA?GGGTGGTGCCCAACGGCGCCGGCAACAAGCAGGCCGTGCCCAAGGTGAGCGCCTACCAGTACAGGGTGTTCAGGGTGGCC?CTGCCCGACCCCAACAAGTTCGGCCTGCCCGACAGCACCATCTACAACCCCGAGACCCAGAGGCTGGTGTGGGCCTGCGT?GGGCATGGAGATCGGCAGGGGCCAGCCCCTGGGCATCGGCCTGAGCGGCCACCCCTTCTACAACAAGCTGGACGACACCG?AGAGCGCCCACGCCGCCACCGCCGTGATCACCCAGGACGTGAGGGACAACGTGAGCGTGGACTACAAGCAGACCCAGCTG?TGCATCCTGGGCTGCGTGCCCGCCATCGGCGAGCACTGGGCCAAGGGCACCCTGTGCAAGCCCGCCCAGCTGCAGCCCGG?CGACTGCCCCCCCCTGGAGCTGAAGAACACCATCATCGAGGACGGCGACATGGTGGACACCGGCTACGGCGCCATGGACT?TCAGCACCCTGCAGGACACCAAGTGCGAGGTGCCCCTGGACATCTGCCAGAGCATCTGCAAGTACCCCGACTACCTGCAG?ATGAGCGCCGACCCCTACGGCGACAGCATGTTCTTCTGCCTGAGGAGGGAGCAGCTGTTCGCCAGGCACTTCTGGAACAG?GGCCGGCGTGATGGGCGACACCGTGCCCACCGACCTGTACATCAAGGGCACCAGCGCCAACATGAGGGAGACCCCCGGCA?GCTGCGTGTACAGCCCCAGCCCCAGCGGCAGCATCATCACCAGCGACAGCCAGCTGTTCAACAAGCCCTACTGGCTGCAC?AAGGCCCAGGGCCACAACAACGGCATCTGCTGGCACAACCAGCTGTTCGTGACCGTGGTGGACACCACCAGGAGCACCAA?CCTGACCCTGTGCGCCAGCACCCAGAACCCCGTGCCCAGCACCTACGACCCCACCAAGTTCAAGCAGTACAGCAGGCACG?TGGAGGAGTACGACCTGCAGTTCATCTTCCAGCTGTGCACCATCACCCTGACCGCCGAGGTGATGAGCTACATCCACAGC?ATGAACAGCAGCATCCTGGAGAACTGGAACTTCGGCGTGCCCCCCCCCCCCACCACCAGCCTGGTGGACACCTACAGGTT?CGTGCAGAGCGTGGCCGTGACCTGCCAGAAGGACACCACCCCCCCCGAGAAGCAGGACCCCTACGACAAGCTGAAGTTCT?GGACCGTGGACCTGAAGGAGAAGTTCAGCAGCGACCTGGACCAGTACCCCCTGGGCAGGAAGTTCCTGGTGCAGGCCGGC?CTGAGGAGGAGGCCCACCATCGGCCCCAGGAAGAGGCCCGCCGCCAGCACCAGCACCGCCAGCACCGCCAGCAGGCCCGC?CAAGAGGGTGAGGATCAGGAGCAAGAAGTGA
Sequence 10 (SEQ ID NO:10):
ATGGCCCTGTGGAGGCCCAGCGACAGCACCGTGTACCTGCCCCCCCCCAGCGTGGCCAGGGTGGTGAGCACCGACGACTA?CGTGAGCAGGACCAGCATCTTCTACCACGCCGGCAGCAGCAGGCTGCTGACCGTGGGCAACCCCTACTTCAGGGTGGTGC?CCAACGGCGCCGGCAACAAGCAGGCCGTGCCCAAGGTGAGCGCCTACCAGTACAGGGTGTTCAGGGTGGCCCTGCCCGAC?CCCAACAAGTTCGGCCTGCCCGACAGCACCATCTACAACCCCGAGACCCAGAGGCTGGTGTGGGCCTGCGTGGGCATGGA?GATCGGCAGGGGCCAGCCCCTGGGCATCGGCCTGAGCGGCCACCCCTTCTACAACAAGCTGGACGACACCGAGAGCGCCC?ACGCCGCCACCGCCGTGATCACCCAGGACGTGAGGGACAACGTGAGCGTGGACTACAAGCAGACCCAGCTGTGCATCCTG?GGCTGCGTGCCCGCCATCGGCGAGCACTGGGCCAAGGGCACCCTGTGCAAGCCCGCCCAGCTGCAGCCCGGCGACTGCCC?CCCCCTGGAGCTGAAGAACACCATCATCGAGGACGGCGACATGGTGGACACCGGCTACGGCGCCATGGACTTCAGCACCC?TGCAGGACACCAAGTGCGAGGTGCCCCTGGACATCTGCCAGAGCATCTGCAAGTACCCCGACTACCTGCAGATGAGCGCC?GACCCCTACGGCGACAGCATGTTCTTCTGCCTGAGGAGGGAGCAGCTGTTCGCCAGGCACTTCTGGAACAGGGCCGGCGT?GATGGGCGACACCGTGCCCACCGACCTGTACATCAAGGGCACCAGCGCCAACATGAGGGAGACCCCCGGCAGCTGCGTGT?ACAGCCCCAGCCCCAGCGGCAGCATCATCACCAGCGACAGCCAGCTGTTCAACAAGCCCTACTGGCTGCACAAGGCCCAG?GGCCACAACAACGGCATCTGCTGGCACAACCAGCTGTTCGTGACCGTGGTGGACACCACCAGGAGCACCAACCTGACCCT?GTGCGCCAGCACCCAGAACCCCGTGCCCAGCACCTACGACCCCACCAAGTTCAAGCAGTACAGCAGGCACGTGGAGGAGT?ACGACCTGCAGTTCATCTTCCAGCTGTGCACCATCACCCTGACCGCCGAGGTGATGAGCTACATCCACAGCATGAACAGC?AGCATCCTGGAGAACTGGAACTTCGGCGTGCCCCCCCCCCCCACCACCAGCCTGGTGGACACCTACAGGTTCGTGCAGAG?CGTGGCCGTGACCTGCCAGAAGGACACCACCCCCCCCGAGAAGCAGGACCCCTACGACAAGCTGAAGTTCTGGACCGTGG?ACCTGAAGGAGAAGTTCAGCAGCGACCTGGACCAGTACCCCCTGGGCAGGAAGTTCCTGGTGCAGGCCGGCCTGAGGAGG?AGGCCCACCATCGGCCCCAGGAAGAGGCCCGCCGCCAGCACCAGCACCGCCAGCACCGCCAGCAGGCCCGCCAAGAGGGT?GAGGATCAGGAGCAAGAAGTGA
Sequence 11 (SEQ ID NO:11):
ATGAGGCCCAGCGACAGCACCGTGTACCTGCCCCCCCCCAGCGTGGCCAGGGTGGTGAGCACCGACGACTACGTGAGCAG?GACCAGCATCTTCTACCACGCCGGCAGCAGCAGGCTGCTGACCGTGGGCAACCCCTACTTCAGGGTGGTGCCCAACGGCG?CCGGCAACAAGCAGGCCGTGCCCAAGGTGAGCGCCTACCAGTACAGGGTGTTCAGGGTGGCCCTGCCCGACCCCAACAAG?TTCGGCCTGCCCGACAGCACCATCTACAACCCCGAGACCCAGAGGCTGGTGTGGGCCTGCGTGGGCATGGAGATCGGCAG?GGGCCAGCCCCTGGGCATCGGCCTGAGCGGCCACCCCTTCTACAACAAGCTGGACGACACCGAGAGCGCCCACGCCGCCA?CCGCCGTGATCACCCAGGACGTGAGGGACAACGTGAGCGTGGACTACAAGCAGACCCAGCTGTGCATCCTGGGCTGCGTG?CCCGCCATCGGCGAGCACTGGGCCAAGGGCACCCTGTGCAAGCCCGCCCAGCTGCAGCCCGGCGACTGCCCCCCCCTGGA?GCTGAAGAACACCATCATCGAGGACGGCGACATGGTGGACACCGGCTACGGCGCCATGGACTTCAGCACCCTGCAGGACA?CCAAGTGCGAGGTGCCCCTGGACATCTGCCAGAGCATCTGCAAGTACCCCGACTACCTGCAGATGAGCGCCGACCCCTAC?GGCGACAGCATGTTCTTCTGCCTGAGGAGGGAGCAGCTGTTCGCCAGGCACTTCTGGAACAGGGCCGGCGTGATGGGCGA?CACCGTGCCCACCGACCTGTACATCAAGGGCACCAGCGCCAACATGAGGGAGACCCCCGGCAGCTGCGTGTACAGCCCCA?GCCCCAGCGGCAGCATCATCACCAGCGACAGCCAGCTGTTCAACAAGCCCTACTGGCTGCACAAGGCCCAGGGCCACAAC?AACGGCATCTGCTGGCACAACCAGCTGTTCGTGACCGTGGTGGACACCACCAGGAGCACCAACCTGACCCTGTGCGCCAG?CACCCAGAACCCCGTGCCCAGCACCTACGACCCCACCAAGTTCAAGCAGTACAGCAGGCACGTGGAGGAGTACGACCTGC?AGTTCATCTTCCAGCTGTGCACCATCACCCTGACCGCCGAGGTGATGAGCTACATCCACAGCATGAACAGCAGCATCCTG?GAGAACTGGAACTTCGGCGTGCCCCCCCCCCCCACCACCAGCCTGGTGGACACCTACAGGTTCGTGCAGAGCGTGGCCGT?GACCTGCCAGAAGGACACCACCCCCCCCGAGAAGCAGGACCCCTACGACAAGCTGAAGTTCTGGACCGTGGACCTGAAGG?AGAAGTTCAGCAGCGACCTGGACCAGTACCCCCTGGGCAGGAAGTTCCTGGTGCAGGCCGGCCTGAGGAGGAGGCCCACC?ATCGGCCCCAGGAAGAGGCCCGCCGCCAGCACCAGCACCGCCAGCACCGCCAGCAGGCCCGCCAAGAGGGTGAGGATCAG?GAGCAAGAAGTGA
Sequence 12 (SEQ ID NO:12):
ATGACCGTGTACCTGCCCCCCCCCAGCGTGGCCAGGGTGGTGAGCACCGACGACTACGTGAGCAGGACCAGCATCTTCTA?CCACGCCGGCAGCAGCAGGCTGCTGACCGTGGGCAACCCCTACTTCAGGGTGGTGCCCAACGGCGCCGGCAACAAGCAGG?CCGTGCCCAAGGTGAGCGCCTACCAGTACAGGGTGTTCAGGGTGGCCCTGCCCGACCCCAACAAGTTCGGCCTGCCCGAC?AGCACCATCTACAACCCCGAGACCCAGAGGCTGGTGTGGGCCTGCGTGGGCATGGAGATCGGCAGGGGCCAGCCCCTGGG?CATCGGCCTGAGCGGCCACCCCTTCTACAACAAGCTGGACGACACCGAGAGCGCCCACGCCGCCACCGCCGTGATCACCC?AGGACGTGAGGGACAACGTGAGCGTGGACTACAAGCAGACCCAGCTGTGCATCCTGGGCTGCGTGCCCGCCATCGGCGAG?CACTGGGCCAAGGGCACCCTGTGCAAGCCCGCCCAGCTGCAGCCCGGCGACTGCCCCCCCCTGGAGCTGAAGAACACCAT?CATCGAGGACGGCGACATGGTGGACACCGGCTACGGCGCCATGGACTTCAGCACCCTGCAGGACACCAAGTGCGAGGTGC?CCCTGGACATCTGCCAGAGCATCTGCAAGTACCCCGACTACCTGCAGATGAGCGCCGACCCCTACGGCGACAGCATGTTC?TTCTGCCTGAGGAGGGAGCAGCTGTTCGCCAGGCACTTCTGGAACAGGGCCGGCGTGATGGGCGACACCGTGCCCACCGA?CCTGTACATCAAGGGCACCAGCGCCAACATGAGGGAGACCCCCGGCAGCTGCGTGTACAGCCCCAGCCCCAGCGGCAGCA?TCATCACCAGCGACAGCCAGCTGTTCAACAAGCCCTACTGGCTGCACAAGGCCCAGGGCCACAACAACGGCATCTGCTGG?CACAACCAGCTGTTCGTGACCGTGGTGGACACCACCAGGAGCACCAACCTGACCCTGTGCGCCAGCACCCAGAACCCCGT?GCCCAGCACCTACGACCCCACCAAGTTCAAGCAGTACAGCAGGCACGTGGAGGAGTACGACCTGCAGTTCATCTTCCAGC?TGTGCACCATCACCCTGACCGCCGAGGTGATGAGCTACATCCACAGCATGAACAGCAGCATCCTGGAGAACTGGAACTTC?GGCGTGCCCCCCCCCCCCACCACCAGCCTGGTGGACACCTACAGGTTCGTGCAGAGCGTGGCCGTGACCTGCCAGAAGGA?CACCACCCCCCCCGAGAAGCAGGACCCCTACGACAAGCTGAAGTTCTGGACCGTGGACCTGAAGGAGAAGTTCAGCAGCG?ACCTGGACCAGTACCCCCTGGGCAGGAAGTTCCTGGTGCAGGCCGGCCTGAGGAGGAGGCCCACCATCGGCCCCAGGAAG?AGGCCCGCCGCCAGCACCAGCACCGCCAGCACCGCCAGCAGGCCCGCCAAGAGGGTGAGGATCAGGAGCAAGAAGTGA
Sequence 13 (SEQ ID NO:13):
ATGCCCCCCAGCGTGGCCAGGGTGGTGAGCACCGACGACTACGTGAGCAGGACCAGCATCTTCTACCACGCCGGCAGCAG?CAGGCTGCTGACCGTGGGCAACCCCTACTTCAGGGTGGTGCCCAACGGCGCCGGCAACAAGCAGGCCGTGCCCAAGGTGA?GCGCCTACCAGTACAGGGTGTTCAGGGTGGCCCTGCCCGACCCCAACAAGTTCGGCCTGCCCGACAGCACCATCTACAAC?CCCGAGACCCAGAGGCTGGTGTGGGCCTGCGTGGGCATGGAGATCGGCAGGGGCCAGCCCCTGGGCATCGGCCTGAGCGG?CCACCCCTTCTACAACAAGCTGGACGACACCGAGAGCGCCCACGCCGCCACCGCCGTGATCACCCAGGACGTGAGGGACA?ACGTGAGCGTGGACTACAAGCAGACCCAGCTGTGCATCCTGGGCTGCGTGCCCGCCATCGGCGAGCACTGGGCCAAGGGC?ACCCTGTGCAAGCCCGCCCAGCTGCAGCCCGGCGACTGCCCCCCCCTGGAGCTGAAGAACACCATCATCGAGGACGGCGA?CATGGTGGACACCGGCTACGGCGCCATGGACTTCAGCACCCTGCAGGACACCAAGTGCGAGGTGCCCCTGGACATCTGCC?AGAGCATCTGCAAGTACCCCGACTACCTGCAGATGAGCGCCGACCCCTACGGCGACAGCATGTTCTTCTGCCTGAGGAGG?GAGCAGCTGTTCGCCAGGCACTTCTGGAACAGGGCCGGCGTGATGGGCGACACCGTGCCCACCGACCTGTACATCAAGGG?CACCAGCGCCAACATGAGGGAGACCCCCGGCAGCTGCGTGTACAGCCCCAGCCCCAGCGGCAGCATCATCACCAGCGACA?GCCAGCTGTTCAACAAGCCCTACTGGCTGCACAAGGCCCAGGGCCACAACAACGGCATCTGCTGGCACAACCAGCTGTTC?GTGACCGTGGTGGACACCACCAGGAGCACCAACCTGACCCTGTGCGCCAGCACCCAGAACCCCGTGCCCAGCACCTACGA?CCCCACCAAGTTCAAGCAGTACAGCAGGCACGTGGAGGAGTACGACCTGCAGTTCATCTTCCAGCTGTGCACCATCACCC?TGACCGCCGAGGTGATGAGCTACATCCACAGCATGAACAGCAGCATCCTGGAGAACTGGAACTTCGGCGTGCCCCCCCCC?CCCACCACCAGCCTGGTGGACACCTACAGGTTCGTGCAGAGCGTGGCCGTGACCTGCCAGAAGGACACCACCCCCCCCGA?GAAGCAGGACCCCTACGACAAGCTGAAGTTCTGGACCGTGGACCTGAAGGAGAAGTTCAGCAGCGACCTGGACCAGTACC?CCCTGGGCAGGAAGTTCCTGGTGCAGGCCGGCCTGAGGAGGAGGCCCACCATCGGCCCCAGGAAGAGGCCCGCCGCCAGC?ACCAGCACCGCCAGCACCGCCAGCAGGCCCGCCAAGAGGGTGAGGATCAGGAGCAAGAAGTGA
Sequence 14 (SEQ ID NO:14):
ATGAGGGTGGTGAGCACCGACGACTACGTGAGCAGGACCAGCATCTTCTACCACGCCGGCAGCAGCAGGCTGCTGACCGTG?GGCAACCCCTACTTCAGGGTGGTGCCCAACGGCGCCGGCAACAAGCAGGCCGTGCCCAAGGTGAGCGCCTACCAGTACAGG?GTGTTCAGGGTGGCCCTGCCCGACCCCAACAAGTTCGGCCTGCCCGACAGCACCATCTACAACCCCGAGACCCAGAGGCTG?GTGTGGGCCTGCGTGGGCATGGAGATCGGCAGGGGCCAGCCCCTGGGCATCGGCCTGAGCGGCCACCCCTTCTACAACAAG?CTGGACGACACCGAGAGCGCCCACGCCGCCACCGCCGTGATCACCCAGGACGTGAGGGACAACGTGAGCGTGGACTACAAG?CAGACCCAGCTGTGCATCCTGGGCTGCGTGCCCGCCATCGGCGAGCACTGGGCCAAGGGCACCCTGTGCAAGCCCGCCCAG?CTGCAGCCCGGCGACTGCCCCCCCCTGGAGCTGAAGAACACCATCATCGAGGACGGCGACATGGTGGACACCGGCTACGGC?GCCATGGACTTCAGCACCCTGCAGGACACCAAGTGCGAGGTGCCCCTGGACATCTGCCAGAGCATCTGCAAGTACCCCGAC?TACCTGCAGATGAGCGCCGACCCCTACGGCGACAGCATGTTCTTCTGCCTGAGGAGGGAGCAGCTGTTCGCCAGGCACTTC?TGGAACAGGGCCGGCGTGATGGGCGACACCGTGCCCACCGACCTGTACATCAAGGGCACCAGCGCCAACATGAGGGAGACC?CCCGGCAGCTGCGTGTACAGCCCCAGCCCCAGCGGCAGCATCATCACCAGCGACAGCCAGCTGTTCAACAAGCCCTACTGG?CTGCACAAGGCCCAGGGCCACAACAACGGCATCTGCTGGCACAACCAGCTGTTCGTGACCGTGGTGGACACCACCAGGAGC?ACCAACCTGACCCTGTGCGCCAGCACCCAGAACCCCGTGCCCAGCACCTACGACCCCACCAAGTTCAAGCAGTACAGCAGG?CACGTGGAGGAGTACGACCTGCAGTTCATCTTCCAGCTGTGCACCATCACCCTGACCGCCGAGGTGATGAGCTACATCCAC?AGCATGAACAGCAGCATCCTGGAGAACTGGAACTTCGGCGTGCCCCCCCCCCCCACCACCAGCCTGGTGGACACCTACAGG?TTCGTGCAGAGCGTGGCCGTGACCTGCCAGAAGGACACCACCCCCCCCGAGAAGCAGGACCCCTACGACAAGCTGAAGTTC?TGGACCGTGGACCTGAAGGAGAAGTTCAGCAGCGACCTGGACCAGTACCCCCTGGGCAGGAAGTTCCTGGTGCAGGCCGGC?CTGAGGAGGAGGCCCACCATCGGCCCCAGGAAGAGGCCCGCCGCCAGCACCAGCACCGCCAGCACCGCCAGCAGGCCCGCC?AAGAGGGTGAGGATCAGGAGCAAGAAGTGA
Sequence 15 (SEQ ID NO:15):
CATATGGCCCTGTGGAGGCCCAGCGAC
Sequence 16 (SEQ ID NO:16):
GTCGACTCACTTCTTGCTCCTGATCCTCACCCT
Embodiment
Illustrate that the embodiment of the present invention (and non-limiting the present invention) is to describe the present invention referring now to following being intended to.
Unless specifically stated otherwise, the experimental methods of molecular biology used in the present invention and immunodetection, substantially with reference to people such as J.Sambrook, molecular cloning: laboratory manual, 2nd edition, CSH Press, 1989, and the people such as F.M.Ausubel, fine works molecular biology experiment guide, the 3rd edition, John Wiley & Sons, Inc., the method described in 1995 is carried out; The condition that the use of restriction enzyme is recommended according to goods producer.Those skilled in the art know, and embodiment describes the present invention by way of example, and are not intended to limit the present invention's scope required for protection.
Embodiment 1. has the expression of the HPV45L1 albumen of the brachymemma of sequence shown in SEQ ID NO:3
be used as the preparation of the total length HPV45L1 gene fragment of template
The total length HPV45L1 gene fragment being used as template is synthesized by Shanghai Bo Ya company.Synthesized gene fragment total length is 1620bp (SEQ ID NO:8).On the basis of the total length HPV45L1 gene fragment of this synthetic, the polynucleotide of the HPV45L1 albumen of preparation coding brachymemma of the present invention.
the structure of the nonfusion expression vector of the HPV45L1 gene of brachymemma
The HPV45L1 full-length gene fragment obtained with previous step is template, with HPV45N27F:5'-
cAT ATggCC CTg Tgg Agg CCC AgC gAC-3'(SEQ ID NO:15) be forward primer (its 5' holds and introduces restriction enzyme NdeI site CAT ATG, and ATG is the initiator codon in E. coli system); With HPV45R:5'-
gTC gACtCA CTT CTT gCT CCT gAT CCT CAC CCT-3'(SEQ ID NO:16) be reverse primer (its 5' holds and introduces restriction enzyme SalI site), in PCR thermal cycler (Biometra T3), carry out PCR reaction according to following condition.
Amplification obtains the special DNA fragmentation of the size of about 1.5kb.This PCR primer is connected with pMD18-T carrier (TAKARA company produces) commercially, proceeds to intestinal bacteria; Extract plasmid, cut qualification through NdeI/SalI enzyme, obtain the positive colony pMD18-T-HPV45N27C-L1 of the HPV45L1 gene inserting brachymemma.
Utilize M13 (+)/(-) primer, record the nucleotide sequence of the object fragment inserted in pMD18-T-HPV45N27C-L1 plasmid as shown in SEQ ID NO:10, the aminoacid sequence of its coding is as shown in SEQ ID NO:3.The protein that this sequence pair is answered is that N end is held not by the HPV45L1 albumen of brachymemma, by its called after HPV45N27C-L1 by brachymemma 27 amino acid, C.
Above-mentioned pMD18-T-HPV45N27C-L1 plasmid is carried out NdeI/SalI enzyme cut, obtain HPV45N27C-L1 gene fragment.Again by this fragment and the nonfusion expression vector pTO-T7(Luo Wenxin etc. cut through NdeI/SalI enzyme, biotechnology journal, 2000,16:53-57) be connected, proceed to ER2566 bacterium; Extract plasmid, cut through NdeI/SalI enzyme the positive expression clone pTO-T7 – HPV45N27C-L1 that qualification obtains inserting object fragment.
The pTO-T7-HPV45N27C-L1 plasmid (0.15mg/ml) getting 1 μ L transforms the competence e. coli bl21 (purchased from New England Biolabs, Inc. (US) Massachusetts, United States of America) that 40 μ L are prepared with Calcium Chloride Method, coated containing kantlex (final concentration 25mg/mL, solid LB media (LB medium component: 10g/L peptone down together), 5g/L yeast powder, 10g/L sodium-chlor, lower same), and 37 DEG C of quiescent culture 10-12 are little clear and legible up to single bacterium colony.Picking list bacterium colony to containing the test tube of 4mL LB liquid medium (containing kantlex), 37 DEG C 220 revs/min lower shaking culture 10 hours, therefrom gets 1mL bacterium liquid in-70 DEG C of preservations.
the great expression of HPV45N27C-L1 albumen
From-70 DEG C, take out the Escherichia coli bacteria liquid carrying recombinant plasmid pTO-T7-HPV45N27C-L1, inoculate 50ml containing in the LB liquid nutrient medium of kantlex, at 200rpm, at 37 DEG C, cultivate about 8 hours; Then the 10 bottles of 500ml that transfer are containing in the LB substratum of kantlex (every bottle graft enters 5ml bacterium liquid), and at 200rpm, overnight incubation at 37 DEG C, as seed liquor.
The 50L fermentor tank adopting Shanghai Bao Xing biotech firm to produce carries out large scale culturing.Correct fermentor tank PH electrode, 30L LB substratum is loaded fermentor tank, original position 121 DEG C of sterilizing 30min; Correct dissolved oxygen electrode, with before not ventilating after sterilizing for zero point, be 100% during initial stirring velocity 100rpm before not inoculating after ventilation during to ferment.
Feed supplement prepares: the peptone of preparation 30% and yeast extract paste mixture (20g peptone, 10g yeast extract paste are molten to 100ml), the glucose (50g is molten to 100ml) of 50%, 121 DEG C of sterilizing 20min.
Next day, design temperature 37 DEG C, pH value 7.0, manual regulation stirring velocity and air flow, maintained dissolved oxygen more than 40% by 10 bottles of seed liquor altogether 5L access fermentor tank.
Flow feeding: the glucose of 50% and the peptone of 30% and yeast extract paste mixture are mixed in the ratio of Solute mass than 2:1.
Flow acceleration is as follows: first hour: 5%; Second hour: 10%; 3rd hour: 20%; 4th hour: 40%; 5th hour and later 60%(with 25mL/min for 100%).
When bacterial concentration reaches OD
600when being about 10, culture temperature is down to 25 DEG C, adds 4g IPTG inducing culture 4 hours.Final concentration is about 60(OD
600), lower tank, collected by centrifugation thalline.Obtain the thalline that have expressed HPV45N27C-L1 albumen, great about 2.5kg.
The acquisition of the HPV45N27C-L1 albumen of embodiment 2. purity about 70%
By the resuspended thalline of ratio of corresponding 10mL lysate (20mM Tris damping fluid, pH7.2,300mM NaCl) of 1g thalline.Adopt APV clarifixator (An Invensys Group product) with 600bar pressure breaking thalline 5 times.With 13500rpm (30000g) centrifugal bacterial cell disruption liquid 15min, leave and take supernatant (that is, bacteria break supernatant).Detect supernatant by 10%SDS-polyacrylamide gel electrophoresis, now in supernatant, the purity of HPV45N27C-L1 is about 10%(see Fig. 1, swimming lane 1).
CENTRASETTE5 tangential flow apparatus (PALL product) is adopted to dialyse to supernatant, film bag molecular weight cut-off used is 30kDa, dialyzate is 10mM phosphate buffered saline buffer pH6.0, dialysis volume is three times of supernatant volumes, operating pressure is 0.5psi, flow velocity is 500mL/min, and tangential flow velocity is 200mL/min.
After enough hemodialysis, use Beckman J25 supercentrifuge with 9500rpm (12000g) centrifugal 20min, results precipitation (that is, salt-free precipitated product).With the 20mM phosphate buffered saline buffer pH8.0 of 1/10 supernatant volume, the resuspended precipitation of 20mM DTT, 300mM NaCl, stir 30min, then use Beckman J25 supercentrifuge with 13500rpm (30000g) centrifugal 20min, and the upper cleer and peaceful precipitation of results (that is, heavy molten postprecipitation).Use 20mM phosphate buffered saline buffer pH8.0,20mM DTT dilutes this supernatant to 3 times volume, to make NaCl final concentration for 0.1M, then 0.22 μm of aperture filter membrane is used to filter, the sample (that is, heavy molten rear supernatant) obtained is for carrying out cation exchange chromatography (as described in Example 3).Get 150 μ L post-filtration samples, add 30 μ L6X Loading Buffer(12% (w/v) SDS, 0.6% (w/v) tetrabromophenol sulfonphthalein, 0.3M Tris-HCl pH6.8,60% (v/v) glycerine, 5% (v/v) beta-mercaptoethanol), mixing and in 80 DEG C of water-bath 10min; Then 10 μ L are got in 10%SDS-polyacrylamide gel with 120V electrophoresis 120min; Then with Coomassie brilliant blue dyeing display electrophoretic band.Electrophoresis result is shown in Fig. 1.Result shows, and HPV45N27C-L1 albumen is after precipitation, heavy molten step, and obtain purifying and enrichment, its purity has been brought up to about 70%(from about 10% before and seen Fig. 1, swimming lane 1 and 3).
The chromatogram purification of embodiment 3:HPV45N27C-L1
the cation exchange chromatography of HPV45N27C-L1
Instrument system: the AKTA explorer100 type preparative liquid chromatography system that GE Healthcare company (former Amershan Pharmacia company) produces.
Chromatography media: SP Sepharose4Fast Flow(GE Healthcare company).
Column volume: 5.5cm × 20cm.
Damping fluid: 20mM phosphate buffered saline buffer pH8.0,20mM DTT
20mM phosphate buffered saline buffer pH8.0,20mM DTT, 2M NaCl.
Flow velocity: 25mL/min
Detector wavelength: 280nm.
Sample be in embodiment 2 obtain through 0.22 μm of aperture membrane filtration, purity be about 70% HPV45N27C-L1 protein solution.
Elution program is: 400mM NaCl wash-out foreign protein, 800mM NaCl wash-out target protein, collects 800mM NaCl elutriated fraction.
the hydroxylapatite chromatography purifying of HPV45N27C-L1
Instrument system: the AKTA explorer100 type preparative liquid chromatography system that GE Healthcare company (former Amershan Pharmacia company) produces.
Chromatography media: CHT Sepharose4Fast Flow (purchased from Bio-RAD)
Column volume: 5.5cm × 20cm
Damping fluid: 20mM phosphate buffered saline buffer pH8.0,20mM DTT
20mM phosphate buffered saline buffer pH8.0,20mM DTT, 2M NaCl.
Flow velocity: 20mL/min.
Detector wavelength: 280nm.
Sample is: the 800mM NaCl elutriated fraction that previous step obtains, by NaCl concentration dilution to 0.5M.
Elution program is: 500mM NaCl wash-out foreign protein, 1000mM NaCl wash-out target protein, collects elutriated fraction during 1000mM NaCl concentration.
Get final elutriated fraction 150 μ L, add 30 μ L6X Loading Buffer, mixing and in 80 DEG C of water-bath 10min; Then 10 μ l are got in 10%SDS-polyacrylamide gel with 120V electrophoresis 120min; Then with Coomassie brilliant blue dyeing display electrophoretic band.Electrophoresis result is shown in Fig. 2.Result shows, and after above-mentioned purification step, HPV45N27C-L1 purity of protein reaches more than 95% (see swimming lane 1).
The assembling of embodiment 4:HPV45N27C-L1 virus-like particle
Instrument system is the CENTRASETTE5 tangential flow systems that PALL produces; Film bag molecular weight cut-off is 30kDa; Sample is the HPV45N27C-L1 that the purity of embodiment 3 gained is greater than 95%.
The renaturation of sample: with renaturation buffer (50mM PB(sodium phosphate buffer) pH6.0,2mM CaCl
2, 2mM MgCl
2, 0.5M NaCl, 0.003%Tween-80) fully exchange sample buffer, exchange more than 10 times that volume is sample initial volume.The operating pressure of tangential flow apparatus is 0.5psi, and tangential flow speed is 10mL/min.After renaturation buffer has exchanged, with store buffer liquid (20mM PB(sodium phosphate buffer) pH6.5,0.5M NaCl) exchange, exchanging volume is sample volume more than 4 times.The operating pressure of tangential flow apparatus is 0.5psi, and tangential flow speed is 25mL/min.After exchange, use PALL0.20 μm of filter sterility filtered sample, obtain HPV45N27C-L1 virus-like particle, be placed on 4 DEG C and save backup.
The morphologic detection of embodiment 5:HPV45N27C-L1VLP
the transmission electron microscope observing of HPV45N27C-L1 virus-like particle
The 100kV transmission electron microscope that the instrument used is produced for NEC company, magnification is 100,000 times.By embodiment 4 gained HPV45N27C-L1 virus-like particle 2% phospho-wolframic acid pH7.0 negative staining, be fixed on the copper mesh of spray charcoal, observe.Electronic Speculum the results are shown in Figure 3, and wherein visible a large amount of radius is the virus-like particle of about 25nm, and size is even, is rendered as hollow form.
the three-dimensional structure of HPV45N27C-L1 virus-like particle is rebuild
Low temperature Electronic Speculum three-dimensional structure is used to rebuild experiment (Wolf M, Garcea RL, Grigorieff N.et al.Proc Natl Acad Sci U S A. (2010), 107 (14): 6298-303) three-dimensional structure of HPV45N27C-L1 virus-like particle is rebuild.In brief, in the Ice mapping image of HPV45N27C-L1VLP, (Fig. 4 A) chooses that 400 sizes are homogeneous respectively, diameter carries out the overlapping and structural remodeling of computer more than the particle of 50nm, thus obtain the three-dimensional structure of HPV45N27C-L1VLP.As shown in Figure 4 B, wherein the resolving power of HPV45N27C-L1VLP is the three-dimensional structure obtained
result shows, and HPV45N27C-L1VLP is the icosahedral structure of virus (h=1, k=2) of the T=7 formed by 72 capsomeres (form subunit, pentamer).Different from the general icosahedral virus capsid meeting quasi-equivalence principle, composition subunits all in HPV45N27C-L1VLP structure is pentamer, and has no six aggressiveness, and the outermost diameter of VLP is about 60nm.This is similar with the three-dimensional structure of the HPV VLP that the natural HPV virion reported before and eukaryotic expression system (such as, pox viruses express system) are originated.
hPV45N27C-L1 virus-like particle dynamic light scattering is observed
DynaPro MS/X type dynamic light scattering (containing temperature regulator) that the instrument used is produced for Protein Solutions company of the U.S., the algorithm of use is Regulation algorithm.Sample is embodiment 4 gained HPV45N27C-L1 virus-like particle.Sample is measured after 0.22 μm of membrane filtration.Measuring result is shown in Fig. 5.Result shows, and the hydrated molecule kinetics radius of HPV45N27C-L1VLP is 28.68nm.
The immunogenicity determining of embodiment 6:HPV45N27C-L1VLP
with the foundation of cell model in HPV45 pseudovirus
Because HPV is difficult to cultivate in vitro, and HPV host specificity is strong, is difficult to the host beyond people breeds; lack suitable animal model; therefore, in order to rapid evaluation can be carried out to the immune protective of HPV vaccine, need to set up effective external Neutralizing test model.
Pseudovirus (pseudovirions) Infection in Vitro model: utilize HPV VLP can the characteristic of non-specific packaging nucleic acid, by L1 and the L2 albumen at cell inner expression HPV, by wrapping up the reporter plasmid of intracellular episome viral DNA or external source importing, composition HPV pseudovirus (Yeager, M.D, Aste-Amezaga, M.et al (2000) Virology (278) 570-7).Concrete grammar comprises expression of recombinant virus systems approach and many plasmid co-transfections method.The exemplary employing of the present embodiment many plasmid co-transfections method.
The construction process of HPV pseudovirus is as follows:
(coding HPV45L1 albumen (ncbi database is carried with CsCl density gradient centrifugation method difference plasmid purification p45L1h, the pAAV carrier of nucleotide sequence P36741.1)), plasmid p45L2h (carrying the pAAV carrier of nucleotide sequence of coding HPV45L2 albumen (ncbi database, AAY86493.1)) and present with the plasmid pN31-EGFP(pN31-EGFP of green fluorescence protein gene and above-mentioned pAAV carrier John professor T.Schiller by NIH).The method utilizing CsCl density gradient centrifugation to carry out plasmid purification is well known in the art, see " molecular cloning: the third edition ".
Use calcium phosphate transfection method, cultivate the 293FT cell (Invitrogen) in 10cm Tissue Culture Dish with each 40 μ g cotransfections of p45L1h, p45L2h, the pN31-EGFP after purifying.Calcium phosphate transfection method is well known in the art, see " molecular cloning: the third edition ".In brief, each to p45L1h, p45L2h, pN31-EGFP 40 μ g are added the HEPES solution (every 50mL deionized water contains the 1M Hepes125 μ L of pH=7.3,4 DEG C of storages) of 1mL and the 0.5mol/L CaCl of 1mL
2in the mixing solutions of solution, mixing, then dropwise adds 2mL2 × HeBS solution (0.28M NaCl (16.36g), 0.05M HEPES (11.9g), 1.5mM Na
2hPO
4(0.213g), 1000mL deionized water is dissolved in, pH=6.96 ,-70 DEG C of storages) in, left at room temperature 1min; Then being added by mixed solution to cultivate has in the 10cm Tissue Culture Dish of 293FT cell, cultivates 6hr; Then discard original fluid, add the fresh complete culture solution of 10mL (Invitrogen company).After transfection 48hr, discard substratum, clean cell 2 times with PBS; Then cell is scraped collecting cell, carry out cell counting, and every 10
8individual cell 1mL lysate (0.25%Brij58,9.5mM MgCl
2) resuspended.After cracking, with the centrifugal 10min of 5000g, collect supernatant, adding 5M NaCl(final concentration is 850mM), thus obtain cape horn fever venom, be packed as aliquot and be placed on-20 DEG C of preservations.
with the mensuration of titre in antibody
293FT cell (Invitrogen) to be laid in 96 porocyte culture plates (1.5 × 10
4/ hole).Carry out Neutralizing test as follows after 5hr: serum sample (containing test antibodies) to be measured is carried out continuous doubling dilution with 10%DMEM respectively, the cape horn fever venom as above prepared be diluted in 10%DMEM mixes (moi=0.1) with 50 μ L respectively then to get each diluted sample of 50 μ L; Hatch 1h at 4 DEG C after, mixture is added respectively and is covered with in advance in 96 porocyte culture plates of 293FT cell, and cultivate 72h at 37 DEG C; Then first by the antibody titers that Fluirescence observation determination each sample is general, then use flow cytometer (EPICS XL, Beckman Coulter company of the U.S.) to detect the infection rate of each porocyte, calculate the accurate antibody titers of serum.Infection rate is that the cell quantity percentage of cell sample to be measured in hot spot deducts the quantity percentage of compared with control cells sample in hot spot do not infected.
Infect inhibiting rate=(1 ﹣ adds the infection rate in the infection rate in the hole of serum/the do not add hole of serum) × 100%.
Be defined as with titre in antibody: reach the maximum dilution multiple infecting inhibiting rate higher than 50%.After 50 times of dilutions, still can reach more than 50% antibody infecting inhibiting rate be regarded as that there is neutralising capacity.
hPV45VLP is used for the evaluation of the immune protective of immune animal
Mouse is used to evaluate the immune protective of HPV45VLP of the present invention.Immunity is 4-5 SPF level BALB/c mouse in age in week 8 with animal.According to embodiment 1-4, method prepares HPV45N27C-L1 virus-like particle.This particle is diluted to 0.1mg/ml, then adds isopyknic complete Freund's adjuvant (for initial immunity) or isopyknic incomplete Freund's adjuvant (for booster immunization), mix.Immune programme for children is: initial immunity when 0 week; Strengthen when 2,4 and 6 weeks.Immunization ways is intramuscular injection, and initial immunity dosage is 10 μ g/, and booster immunization dosage is 10 μ g/.
After initial immunity, extract peripheric venous blood weekly, separation of serum.Then the NAT for HPV45 pseudovirion in the 0th, 1,5,7,9 week mice serum is detected according to aforesaid method.Detected result as shown in Figure 6.Result shows, the HPV45N27C-L1 virus-like particle that method obtains according to embodiment 1-4 has good immunogenicity, can in Mice Body the neutralizing antibody for HPV45 of induced high titers, can be used as the effective vaccine preventing HPV45 to infect.Except using freund's adjuvant, this vaccine also can use other adjuvants well known in the art, such as aluminium hydroxide or Aluminium phosphate adjuvant.
Rabbit is also used to evaluate the immune protective of HPV45VLP of the present invention.Immunity is the female rabbit of regular grade in 6 ~ 8 week age 4 (purchased from disease prevention and control center, Guangxi province) with animal.HPV45N27C-L1 virus-like particle prepared by embodiment 1-4 is diluted to 1.0mg/ml, then adds isopyknic complete Freund's adjuvant (for initial immunity) or isopyknic incomplete Freund's adjuvant (for booster immunization), mix.Immune programme for children is: initial immunity when 0 week; Strengthen when 4,8 and 12 weeks.Immunization ways is intramuscular injection, and initial immunity dosage is 1.0mg/, and booster immunization dosage is 1.0mg/.
After initial immunity, extract peripheric venous blood weekly, separation of serum.Then the NAT for HPV45 pseudovirion in the 0th, 2,4,6,9,11,22 week rabbit anteserum is detected according to aforesaid method.Detected result as shown in Figure 7.Result shows, the HPV45N27C-L1 virus-like particle that method obtains according to embodiment 1-4 has good immunogenicity, at the neutralizing antibody for HPV45 of rabbit Immune inducing in vivo high titre, can be used as the effective vaccine preventing HPV45 to infect.Except using freund's adjuvant, this vaccine also can use other adjuvants well known in the art, such as aluminium hydroxide or Aluminium phosphate adjuvant.
Above result shows, the HPV45 virus-like particle obtained by method of the present invention has good immunogenicity, can the neutralizing antibody of induced high titers in animal body, thus can be used as the vaccine that prevents HPV to infect.
The preparation of embodiment 7:HPV45N30C-L1, HPV45N35C-L1, HPV45N40C-L1 albumen and virus-like particle and morphological observation
According to the method that embodiment 1-2 describes, (its aminoacid sequence is respectively SEQ ID NO:2-7 to the HPV45L1 albumen of acquisition coding N end brachymemma 24,27,30,35,40 or 45 amino acid whose brachymemmas; Nucleotide sequence is respectively SEQ ID NO:9-14) expression plasmid, then in intestinal bacteria, the expression of these expression plasmids is identified.Result is shown in Figure 8.Result shows, and coding N holds brachymemma 27,30, the expression plasmid of the HPV45L1 albumen of 35 or 40 amino acid whose brachymemmas can at E. coli, and wherein, N hold the expression amount of the amino acid whose HPV45L1 albumen of brachymemma 27 the highest (see, Fig. 8, swimming lane 3-6).In addition, result shows, N hold brachymemma 24 or 45 amino acid whose HPV45L1 albumen can not E. coli (see, Fig. 8, swimming lane 2 and 7).These results show, the amino acid holding brachymemma too many (such as more than 45) or (be such as less than 24) very little number at the N of HPV45L1 albumen is all inappropriate, is unfavorable for the high expression in intestinal bacteria.
According to the method that embodiment 1-3 describes, preparation and purifying N end brachymemma 30,35 or 40 amino acid whose HPV45L1 albumen (its aminoacid sequence is respectively SEQ ID NO:4, and 5 and 6; Nucleotide sequence is respectively SEQ ID NO:11, and 12 and 13).The purity of these protein all reaches more than 95% (see figure 9).
According to the method for embodiment 4, by purified HPV45N30C-L1, HPV45N35C-L1, HPV45N40C-L1 albumen assembling assembly virus-like particle.
According to the method that embodiment 5 describes, transmission electron microscope observing and dynamic light scattering observation are carried out to HPV45N30C-L1, HPV45N35C-L1, HPV45N40C-L1 virus-like particle.Result is shown in Figure 10-15.Figure 10,11 and 12 displays, these truncated proteins can forming radius be the virus-like particle of about 25nm, and granular size conforms to theoretical size, and uniformity.Figure 13,14 and 15 displays, the hydrated molecule kinetics radius of these virus-like particles is at about 30nm.
In addition, by the method susceptible of proof using embodiment 6 to describe, the HPV45N30C-L1 that the present invention obtains, HPV45N35C-L1, HPV45N40C-L1 virus-like particle has good immunogenicity equally, can the neutralizing antibody of induced high titers in animal body, thus can be used as the vaccine that prevents HPV to infect.
Although the specific embodiment of the present invention has obtained detailed description, those skilled in the art will appreciate that according to disclosed all instructions, various modifications and changes can be carried out to details, and these have changed all within protection scope of the present invention.Four corner of the present invention is provided by claims and any equivalent thereof.
Claims (12)
1. the HPV45L1 albumen of brachymemma or its variant, it is compared with wild-type HPV45L1 albumen, and N holds brachymemma 27-40 amino acid, such as 27,28,29,30,31,32,33,34,35,36,37,38,39 and 40 amino acid;
Preferably, compared with wild-type HPV45L1 albumen, the HPV45L1 albumen n end brachymemma of this brachymemma 27,30,35 or 40 amino acid;
Preferably, the HPV45L1 albumen of this brachymemma has SEQ ID NO:3, and the aminoacid sequence shown in SEQ ID NO:4, SEQ ID NO:5 or SEQ ID NO:6, more preferably has the aminoacid sequence shown in SEQ ID NO:3.
2. the nucleic acid be separated, the HPV45L1 albumen of the brachymemma of its coding claim 1 or its variant.
3. comprise the carrier of the nucleic acid of the separation of claim 2.
4. comprise the host cell of the nucleic acid of the separation of claim 2 and/or the carrier of claim 3.
5. a HPV45 virus-like particle, it contains truncated protein or its variant of claim 1, or is made up of the truncated protein of claim 1 or its variant.
6. a composition, it comprises HPV45L1 albumen or its variant of the brachymemma of claim 1, or the nucleic acid of the separation of claim 2, or the carrier of claim 3, or the host cell of claim 4, or the HPV45 virus-like particle of claim 5.
7. pharmaceutical composition or a vaccine, it comprises the HPV45 virus-like particle of claim 5, optionally also comprises pharmaceutically acceptable carrier and/or vehicle,
Preferably, described HPV45 virus-like particle is to prevent HPV to infect or the existence of cervical cancer significant quantity;
Preferably, described pharmaceutical composition or vaccine also comprise at least one and are selected from following virus-like particle: HPV6L1 prion sample particle, HPV11L1 prion sample particle, HPV16L1 prion sample particle, HPV18L1 prion sample particle, HPV31L1 prion sample particle, HPV33L1 prion sample particle, HPV52L1 prion sample particle and humanpapilloma virus 58 L1 protein virus-like particle.
8. obtain the method for the HPV45L1 albumen of brachymemma, it comprises the HPV45L1 albumen utilizing escherichia expression system to express the brachymemma of claim 1, then the cracking supernatant containing this albumen is carried out purification process,
Preferably, described method comprises step:
A) truncated protein described in expression in escherichia coli,
B) being broken in the solution of 100mM-600mM in salt concn by expressing the intestinal bacteria of described truncated protein, being separated and obtaining supernatant liquor,
C) with water or low salt solutions, the salt concn of supernatant liquor b) obtained is down to 100mM or following, is low to moderate 0 most, and collecting precipitation,
D) being deposited in 150mM-2500mM salts solution of c) obtaining is dissolved again, add reductive agent simultaneously, be separated and obtain solution, containing the HPV45L1 albumen of the brachymemma of purity at least 50% in this solution.
9. prepare the method for the HPV45 virus-like particle of claim 5, it comprises step:
The HPV45L1 albumen of the brachymemma a) method according to claim 8 obtained carries out purifying by chromatography,
B) by step a) in the truncated protein that obtains remove reductive agent.
10. prepare the method for vaccine for one kind; it comprises the HPV45 virus-like particle of claim 5 or the HPV45 virus-like particle obtained by the method for claim 9 and pharmaceutically acceptable carrier and/or mixed with excipients; optionally also mix one or more and be selected from HPV6; 11; 16,18,31; the virus-like particle of the HPV type of 33,52 and 58.
11. 1 kinds are prevented HPV to infect or are infected the method for caused disease by HPV, it comprises the HPV45 virus-like particle of the claim 5 of prevention significant quantity, or by HPV45 virus-like particle that the method for claim 9 obtains, or the pharmaceutical composition of claim 7 or vaccine, or the vaccine administration to be obtained by the method for claim 10 is to experimenter
Preferably, described HPV infects is that HPV45 infects;
It is preferably, described that to infect caused disease by HPV be cervical cancer.
12. the HPV45L1 albumen of the brachymemma of claim 1 or its variant, or the HPV45 virus-like particle of claim 5, or the HPV45L1 albumen of the brachymemma to be obtained by the method for claim 8, or by the purposes of HPV45 virus-like particle in pharmaceutical compositions or vaccine that the method for claim 9 obtains, described pharmaceutical composition or vaccine infect for preventing HPV or infect caused disease by HPV
Preferably, described HPV infects is that HPV45 infects;
It is preferably, described that to infect caused disease by HPV be cervical cancer.
Priority Applications (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201310217863.XA CN104211782B (en) | 2013-06-04 | 2013-06-04 | The type L1 albumen of HPV 45 of truncation |
HK15105714.7A HK1205147A1 (en) | 2013-06-04 | 2015-06-16 | Truncated l1 proteins of human papillomavirus type 45 45 l1 |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201310217863.XA CN104211782B (en) | 2013-06-04 | 2013-06-04 | The type L1 albumen of HPV 45 of truncation |
Publications (2)
Publication Number | Publication Date |
---|---|
CN104211782A true CN104211782A (en) | 2014-12-17 |
CN104211782B CN104211782B (en) | 2017-11-17 |
Family
ID=52093718
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201310217863.XA Active CN104211782B (en) | 2013-06-04 | 2013-06-04 | The type L1 albumen of HPV 45 of truncation |
Country Status (2)
Country | Link |
---|---|
CN (1) | CN104211782B (en) |
HK (1) | HK1205147A1 (en) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106701798A (en) * | 2015-08-12 | 2017-05-24 | 北京康乐卫士生物技术股份有限公司 | Type-45 recombinant human papillomavirus virus-like particles and preparation method thereof |
CN106831958A (en) * | 2015-12-04 | 2017-06-13 | 厦门大学 | A kind of mutant of Human Papillomavirus Type 11 L1 albumen |
CN115960178A (en) * | 2022-12-28 | 2023-04-14 | 北京康乐卫士生物技术股份有限公司 | Expression of human papilloma virus HPV59L1 protein, virus-like particle and preparation method thereof |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1478790A (en) * | 2002-08-30 | 2004-03-03 | 马润林 | Pronucleus preparation of nipple tumour virus capsid protein and application |
CN1642571A (en) * | 2002-03-18 | 2005-07-20 | 葛兰素史密丝克莱恩生物有限公司 | Virus-like particles of human papillomavirus |
CN101570571A (en) * | 2007-04-29 | 2009-11-04 | 北京万泰生物药业股份有限公司 | Truncated human papilloma virus 18 type L1 protein |
CN102229660A (en) * | 2011-05-25 | 2011-11-02 | 厦门大学 | Truncated human papillomavirus 33 type L1 protein |
-
2013
- 2013-06-04 CN CN201310217863.XA patent/CN104211782B/en active Active
-
2015
- 2015-06-16 HK HK15105714.7A patent/HK1205147A1/en unknown
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1642571A (en) * | 2002-03-18 | 2005-07-20 | 葛兰素史密丝克莱恩生物有限公司 | Virus-like particles of human papillomavirus |
CN1478790A (en) * | 2002-08-30 | 2004-03-03 | 马润林 | Pronucleus preparation of nipple tumour virus capsid protein and application |
CN101570571A (en) * | 2007-04-29 | 2009-11-04 | 北京万泰生物药业股份有限公司 | Truncated human papilloma virus 18 type L1 protein |
CN102229660A (en) * | 2011-05-25 | 2011-11-02 | 厦门大学 | Truncated human papillomavirus 33 type L1 protein |
Non-Patent Citations (1)
Title |
---|
BUCK, C.B 等: "《Genbank》", 28 July 2006 * |
Cited By (6)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN106701798A (en) * | 2015-08-12 | 2017-05-24 | 北京康乐卫士生物技术股份有限公司 | Type-45 recombinant human papillomavirus virus-like particles and preparation method thereof |
CN106701798B (en) * | 2015-08-12 | 2021-09-17 | 北京康乐卫士生物技术股份有限公司 | 45 type recombinant human papilloma virus-like particle and preparation method thereof |
CN106831958A (en) * | 2015-12-04 | 2017-06-13 | 厦门大学 | A kind of mutant of Human Papillomavirus Type 11 L1 albumen |
CN106831958B (en) * | 2015-12-04 | 2020-12-29 | 厦门大学 | Mutant of human papilloma virus 11 type L1 protein |
CN115960178A (en) * | 2022-12-28 | 2023-04-14 | 北京康乐卫士生物技术股份有限公司 | Expression of human papilloma virus HPV59L1 protein, virus-like particle and preparation method thereof |
CN115960178B (en) * | 2022-12-28 | 2023-09-08 | 北京康乐卫士生物技术股份有限公司 | Expression of human papilloma virus HPV59L1 protein, viroid particle and preparation method thereof |
Also Published As
Publication number | Publication date |
---|---|
CN104211782B (en) | 2017-11-17 |
HK1205147A1 (en) | 2015-12-11 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN102229660B (en) | Truncated human papillomavirus 33 type L1 protein | |
CN101293918B (en) | Shorten human papilloma virus 16 type L1 protein | |
CN101343314B (en) | The Human Papillomavirus Type 11 L1 albumen of brachymemma | |
CN102747047B (en) | Human papillomaviruse type hybrid virus-like particle and preparation method thereof | |
CN101153280B (en) | The method of purifying human papilloma virus advanced protein L1 from prokaryotic organism | |
EP2589604B1 (en) | Truncated l1 protein of human papillomavirus type 52 | |
US9745351B2 (en) | Truncated L1 protein of human papillomavirus type 6 | |
CN104212818A (en) | Optimized gene sequence of human papillomavirus 31 type L1 protein | |
CN101570571B (en) | Truncated human papilloma virus 18 type L1 protein | |
US9738691B2 (en) | Truncated L1 protein of human papillomavirus type 58 | |
CN103936840B (en) | Human papillomavirus 33 type L 1 protein of recombination and application thereof | |
CN104211782A (en) | Truncated human papillomavirus 45 type L1 protein | |
WO2016026401A1 (en) | Method for enhancing hpv epitope peptide immunogenicity, viroid particle, particle preparation method and application | |
CN103992395A (en) | VLP vaccine of recombinant HPV-58 L1 and preparation method thereof | |
CN104045696A (en) | Recombinant human papilloma virus 16L1 protein and its use | |
CN103819543A (en) | Recombinant protein HPV6L1 (Human Papilloma Virus 6 L1) and application thereof | |
CN104045695B (en) | HPV 18 L1 albumen of recombination and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
REG | Reference to a national code |
Ref country code: HK Ref legal event code: DE Ref document number: 1205147 Country of ref document: HK |
|
GR01 | Patent grant | ||
GR01 | Patent grant | ||
REG | Reference to a national code |
Ref country code: HK Ref legal event code: GR Ref document number: 1205147 Country of ref document: HK |