CN104098685A - Polypeptide, and detection member and detection kit both containing same - Google Patents
Polypeptide, and detection member and detection kit both containing same Download PDFInfo
- Publication number
- CN104098685A CN104098685A CN201310116987.9A CN201310116987A CN104098685A CN 104098685 A CN104098685 A CN 104098685A CN 201310116987 A CN201310116987 A CN 201310116987A CN 104098685 A CN104098685 A CN 104098685A
- Authority
- CN
- China
- Prior art keywords
- polypeptide
- diabetes
- present
- detection
- detection means
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 89
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 73
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 71
- 238000001514 detection method Methods 0.000 title claims abstract description 56
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical class O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 claims description 33
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 claims description 27
- 239000007787 solid Substances 0.000 claims description 26
- 102000039446 nucleic acids Human genes 0.000 claims description 14
- 108020004707 nucleic acids Proteins 0.000 claims description 14
- 150000007523 nucleic acids Chemical class 0.000 claims description 14
- 239000013604 expression vector Substances 0.000 claims description 11
- 238000012360 testing method Methods 0.000 claims description 8
- 238000002360 preparation method Methods 0.000 claims description 6
- 206010012601 diabetes mellitus Diseases 0.000 abstract description 23
- 238000003745 diagnosis Methods 0.000 abstract description 6
- 210000002966 serum Anatomy 0.000 description 24
- 239000000243 solution Substances 0.000 description 22
- 238000000034 method Methods 0.000 description 14
- -1 polypropylene Polymers 0.000 description 14
- 239000000463 material Substances 0.000 description 13
- 238000002493 microarray Methods 0.000 description 12
- 238000006243 chemical reaction Methods 0.000 description 11
- 235000018102 proteins Nutrition 0.000 description 10
- 102000004169 proteins and genes Human genes 0.000 description 10
- 108090000623 proteins and genes Proteins 0.000 description 10
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 8
- 150000001413 amino acids Chemical group 0.000 description 8
- 210000004027 cell Anatomy 0.000 description 8
- 239000011324 bead Substances 0.000 description 7
- 238000010790 dilution Methods 0.000 description 7
- 239000012895 dilution Substances 0.000 description 7
- 239000000203 mixture Substances 0.000 description 7
- 229920000435 poly(dimethylsiloxane) Polymers 0.000 description 7
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 6
- 239000004205 dimethyl polysiloxane Substances 0.000 description 6
- 235000013870 dimethyl polysiloxane Nutrition 0.000 description 6
- 239000007788 liquid Substances 0.000 description 6
- 238000005406 washing Methods 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 5
- 235000001014 amino acid Nutrition 0.000 description 5
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 5
- 239000003999 initiator Substances 0.000 description 5
- 239000006210 lotion Substances 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 4
- 238000002474 experimental method Methods 0.000 description 4
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 4
- 238000004519 manufacturing process Methods 0.000 description 4
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 229920000642 polymer Polymers 0.000 description 4
- 230000008569 process Effects 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 238000005070 sampling Methods 0.000 description 4
- 239000000377 silicon dioxide Substances 0.000 description 4
- 229960001866 silicon dioxide Drugs 0.000 description 4
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 description 4
- 229920002554 vinyl polymer Polymers 0.000 description 4
- 108010016626 Dipeptides Proteins 0.000 description 3
- 108090000790 Enzymes Proteins 0.000 description 3
- 102000004190 Enzymes Human genes 0.000 description 3
- 102000004877 Insulin Human genes 0.000 description 3
- 108090001061 Insulin Proteins 0.000 description 3
- 102000003960 Ligases Human genes 0.000 description 3
- 108090000364 Ligases Proteins 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 229920002684 Sepharose Polymers 0.000 description 3
- 238000004140 cleaning Methods 0.000 description 3
- 238000013016 damping Methods 0.000 description 3
- 238000010586 diagram Methods 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 239000012530 fluid Substances 0.000 description 3
- HWYHZTIRURJOHG-UHFFFAOYSA-N luminol Chemical compound O=C1NNC(=O)C2=C1C(N)=CC=C2 HWYHZTIRURJOHG-UHFFFAOYSA-N 0.000 description 3
- 238000006116 polymerization reaction Methods 0.000 description 3
- 239000002243 precursor Substances 0.000 description 3
- 235000012239 silicon dioxide Nutrition 0.000 description 3
- 229920002379 silicone rubber Polymers 0.000 description 3
- 238000001179 sorption measurement Methods 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 239000000758 substrate Substances 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 229920002818 (Hydroxyethyl)methacrylate Polymers 0.000 description 2
- CVEPFOUZABPRMK-UHFFFAOYSA-N 2-methylprop-2-enoic acid;styrene Chemical compound CC(=C)C(O)=O.C=CC1=CC=CC=C1 CVEPFOUZABPRMK-UHFFFAOYSA-N 0.000 description 2
- 229920000936 Agarose Polymers 0.000 description 2
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 101000825079 Homo sapiens Transcription factor SOX-13 Proteins 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 239000004793 Polystyrene Substances 0.000 description 2
- 229910004298 SiO 2 Inorganic materials 0.000 description 2
- 102100022435 Transcription factor SOX-13 Human genes 0.000 description 2
- 230000003213 activating effect Effects 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000003431 cross linking reagent Substances 0.000 description 2
- 238000006911 enzymatic reaction Methods 0.000 description 2
- 230000005281 excited state Effects 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 229940125396 insulin Drugs 0.000 description 2
- 208000001921 latent autoimmune diabetes in adults Diseases 0.000 description 2
- 239000004816 latex Substances 0.000 description 2
- 229920000126 latex Polymers 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 244000005700 microbiome Species 0.000 description 2
- 239000013642 negative control Substances 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 229910052697 platinum Inorganic materials 0.000 description 2
- 229920002223 polystyrene Polymers 0.000 description 2
- 230000002000 scavenging effect Effects 0.000 description 2
- 238000007789 sealing Methods 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- WGLQHUKCXBXUDV-UHFFFAOYSA-N 3-aminophthalic acid Chemical compound NC1=CC=CC(C(O)=O)=C1C(O)=O WGLQHUKCXBXUDV-UHFFFAOYSA-N 0.000 description 1
- 102000009027 Albumins Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 1
- 229920001661 Chitosan Polymers 0.000 description 1
- RYGMFSIKBFXOCR-UHFFFAOYSA-N Copper Chemical compound [Cu] RYGMFSIKBFXOCR-UHFFFAOYSA-N 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 229920002307 Dextran Polymers 0.000 description 1
- MYMOFIZGZYHOMD-UHFFFAOYSA-N Dioxygen Chemical compound O=O MYMOFIZGZYHOMD-UHFFFAOYSA-N 0.000 description 1
- WOBHKFSMXKNTIM-UHFFFAOYSA-N Hydroxyethyl methacrylate Chemical compound CC(=C)C(=O)OCCO WOBHKFSMXKNTIM-UHFFFAOYSA-N 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 239000004677 Nylon Substances 0.000 description 1
- 241001482592 Oreamnos americanus Species 0.000 description 1
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 1
- 239000004698 Polyethylene Substances 0.000 description 1
- 239000004743 Polypropylene Substances 0.000 description 1
- 208000004880 Polyuria Diseases 0.000 description 1
- XUIMIQQOPSSXEZ-UHFFFAOYSA-N Silicon Chemical compound [Si] XUIMIQQOPSSXEZ-UHFFFAOYSA-N 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical class [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 1
- 239000004809 Teflon Substances 0.000 description 1
- 229920006362 Teflon® Polymers 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 230000023852 carbohydrate metabolic process Effects 0.000 description 1
- 235000021256 carbohydrate metabolism Nutrition 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- 235000011089 carbon dioxide Nutrition 0.000 description 1
- 239000002041 carbon nanotube Substances 0.000 description 1
- 229910021393 carbon nanotube Inorganic materials 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000035850 clinical syndrome Diseases 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 229910052802 copper Inorganic materials 0.000 description 1
- 239000010949 copper Substances 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 239000008367 deionised water Substances 0.000 description 1
- 229910021641 deionized water Inorganic materials 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 229910001882 dioxygen Inorganic materials 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- 230000035619 diuresis Effects 0.000 description 1
- 230000000694 effects Effects 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 208000004104 gestational diabetes Diseases 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- 239000003365 glass fiber Substances 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 230000005283 ground state Effects 0.000 description 1
- UQEAIHBTYFGYIE-UHFFFAOYSA-N hexamethyldisiloxane Polymers C[Si](C)(C)O[Si](C)(C)C UQEAIHBTYFGYIE-UHFFFAOYSA-N 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 230000005660 hydrophilic surface Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- 201000001421 hyperglycemia Diseases 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 239000002198 insoluble material Substances 0.000 description 1
- 238000004255 ion exchange chromatography Methods 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 208000030159 metabolic disease Diseases 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Substances 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000006011 modification reaction Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- HOGDNTQCSIKEEV-UHFFFAOYSA-N n'-hydroxybutanediamide Chemical compound NC(=O)CCC(=O)NO HOGDNTQCSIKEEV-UHFFFAOYSA-N 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 229920001778 nylon Polymers 0.000 description 1
- CXQXSVUQTKDNFP-UHFFFAOYSA-N octamethyltrisiloxane Chemical compound C[Si](C)(C)O[Si](C)(C)O[Si](C)(C)C CXQXSVUQTKDNFP-UHFFFAOYSA-N 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 238000004987 plasma desorption mass spectroscopy Methods 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 239000004417 polycarbonate Substances 0.000 description 1
- 229920000515 polycarbonate Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920000573 polyethylene Polymers 0.000 description 1
- 229920001155 polypropylene Polymers 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 238000002203 pretreatment Methods 0.000 description 1
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000008213 purified water Substances 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 230000002940 repellent Effects 0.000 description 1
- 239000005871 repellent Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 238000011896 sensitive detection Methods 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000000741 silica gel Substances 0.000 description 1
- 229910002027 silica gel Inorganic materials 0.000 description 1
- 229910052710 silicon Inorganic materials 0.000 description 1
- 239000010703 silicon Substances 0.000 description 1
- 239000004945 silicone rubber Substances 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 241000894007 species Species 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 229910001220 stainless steel Inorganic materials 0.000 description 1
- 239000010935 stainless steel Substances 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 238000012876 topography Methods 0.000 description 1
- 238000012546 transfer Methods 0.000 description 1
- 201000008827 tuberculosis Diseases 0.000 description 1
- 239000006200 vaporizer Substances 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 229910000859 α-Fe Inorganic materials 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/46—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
- C07K14/47—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2333/00—Assays involving biological materials from specific organisms or of a specific nature
- G01N2333/435—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
- G01N2333/46—Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
- G01N2333/47—Assays involving proteins of known structure or function as defined in the subgroups
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/04—Endocrine or metabolic disorders
- G01N2800/042—Disorders of carbohydrate metabolism, e.g. diabetes, glucose metabolism
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Engineering & Computer Science (AREA)
- Molecular Biology (AREA)
- Urology & Nephrology (AREA)
- Biomedical Technology (AREA)
- Immunology (AREA)
- General Health & Medical Sciences (AREA)
- Hematology (AREA)
- Medicinal Chemistry (AREA)
- Biochemistry (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Organic Chemistry (AREA)
- Biotechnology (AREA)
- Toxicology (AREA)
- Gastroenterology & Hepatology (AREA)
- Cell Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Microbiology (AREA)
- Zoology (AREA)
- Food Science & Technology (AREA)
- Physics & Mathematics (AREA)
- Analytical Chemistry (AREA)
- General Physics & Mathematics (AREA)
- Pathology (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention relates to a polypeptide, and a detection member and a detection kit both containing the same. The polypeptide is composed of the amino acid sequence shown as SEQ ID NO: 1. The polypeptide, and the detection member and the detection kit both containing the same are usable in diagnosis of diabetes mellitus.
Description
Technical field
Detection means and detection kit that the present invention relates generally to polypeptide, comprises this polypeptide, belong to biological technical field.
Background technology
Diabetes (
diabetes Mellitus, DM) be that a group of jointly being caused by h and E factor be take the clinical syndrome that carbohydrate metabolism disturbance is main manifestations.Insulin deficit and insulin action obstacle cause the metabolism disorder of carbohydrate, fat, protein, power and water medium etc. individually or simultaneously, clinically take chronic hyperglycemia as principal character.Can there is diuresis in model case, performance, i.e. " three-many-one-little " symptom such as drink more, eat more, become thin.
At European diabetes (the European Association forthe Study of Diabetes of association, EASD) in meeting in 2011, (the International Diabetes Federation of IDF, IDF) issue latest data showed: within 2011, whole world diabetes number of patients has reached 3.66 hundred million, compared with 2.85 hundred million increases nearly 30% of 2010.Have every year 4600000 people to die from diabetes, for the medical expense of diabetes up to 4,650 hundred million dollars.Chairman IDF Jean professor ClaudeManbaya says: " in 2011, just had 1 people because of Diabetes Death every 7 seconds, and alarm bell is beaten ".According to sound in the November, 2011 of China, diabetic subject's number that China has made a definite diagnosis, up to 9,240 ten thousand people, is the first in the world.In the 20 years old above adult in the whole nation, onset diabetes rate is up to 9.7%.
Diabetes can be divided into type 1 diabetes, diabetes B, gestational diabetes and specific type diabetes by its nosetiology classification.
The clinical manifestation of Hospitals at Present Main Basis is (as type 1 diabetes is mainly in adolescence, and there is typical " three-many-one-little " symptom, depend on Regular Insulin etc.) differentiation 1 type and diabetes B, to the indefinite diabetic subject of somatotype as adult's delayed autoimmune diabetes (latent autoimmune diabetes in adults, LADA) and make a definite diagnosis type 1 diabetes and need to detect type 1 diabetes autoantibody and carry out auxiliary diagnosis.
Summary of the invention
The object of the present invention is to provide a kind of to diabetes, the useful polypeptide of the diagnosis of type 1 diabetes particularly, the encode nucleic acid of this polypeptide, the expression vector that comprises this nucleic acid, imported the host cell of this expression vector, the antibody of anti-this polypeptide, the detection means that comprises this polypeptide, the detection kit that comprises this polypeptide or this detection means, and the purposes of this polypeptide in detecting type 1 diabetes, this polypeptide is in the test kit for the preparation of detection type 1 diabetes or the purposes in detection means.
That is, the present invention comprises following technical proposals:
1. a peptide species, its aminoacid sequence as shown in SEQ ID NO:1, that is: EVMKCIVEVIYDTLSKPSPMPVSKECFETL.
Coding polypeptide claimed in claim 1 nucleic acid.
3. the expression vector that comprises nucleic acid claimed in claim 2.
4. imported the host cell of expression vector claimed in claim 3.
5. a detection means, it comprises:
Solid carrier, and
Be connected in the polypeptide claimed in claim 1 on this solid carrier.
6. detection means according to claim 5, wherein, described solid carrier is SJ modified silica-gel.
7. a detection kit, it comprises the detection means described in polypeptide claimed in claim 1 or claim 5 or 6.
8. resist the antibody of polypeptide claimed in claim 1.
9. polypeptide claimed in claim 1 is in the test kit for the preparation of detection type 1 diabetes or the purposes in detection means.
Polypeptide of the present invention is applied to the diagnosis of diabetes (particularly type 1 diabetes), can obtains gratifying effect.
Accompanying drawing explanation
Fig. 1 is fixed on polypeptide the schematic diagram on SJ modified silica-gel surface by chemical covalency.
The HPLC that Fig. 2 confirms the polypeptide of the present invention of chemosynthesis characterizes collection of illustrative plates.
The MS that Fig. 3 confirms the polypeptide of the present invention of chemosynthesis characterizes collection of illustrative plates.
The schematic diagram that Fig. 4 describes the making processes of SJ modified silica-gel (iPDMS film).
The figure that Fig. 5 describes polypeptide microarray chemistry fixation procedure.
Fig. 6 illustrates the schematic diagram of polypeptide microarray spot sample mode.
Fig. 7 ~ 8 show the photo of the result that different serum is detected.
Embodiment
polypeptide of the present invention
Polypeptide of the present invention is 30 peptides.30 peptides of the present invention consist of the aminoacid sequence shown in SEQ ID NO:1, that is: EVMKCIVEVIYDTLSKPSPMPVSKECFETL.As shown in the Examples, its serum to type 1 diabetes patient is positive, and to healthy normal people or the non-type 1 diabetes patients serum reaction that is negative.Therefore, this 30 peptide is useful as the diagnostic tool of type 1 diabetes.
Polypeptide of the present invention, having commercially available in the situation that, can be used commercially available product, in addition, can also suitable employing (1) chemical synthesis process or the known method such as (2) enzyme reaction synthetic method obtain, wherein chemosynthesis is more easy.In chemosynthesis polypeptide situation of the present invention, by or semi-synthetic this polypeptide synthetic with peptide synthesizer, undertaken.As chemical synthesis process, can list such as peptide solid-phase synthesis etc.Synthetic like this peptide can adopt conventional means such as ion-exchange chromatography, reversed phase high efficiency liquid color spectrum, affinity chromatography etc. to carry out purifying.Such peptide solid phase synthesis process with and subsequent peptide purification be all well-known in the art.
In addition,, in the situation that producing polypeptide of the present invention by enzyme reaction, can adopt the method described in No. WO2004/011653, International Publication brochure for example.; can produce like this: the esterified or amidation by the C-terminal of a side amino acid or dipeptides and the amino acid that obtains or dipeptides, the amino acid (for example amino acid of carboxy protective) with amino acid in unbound state react under the existence of peptide synthetase, the dipeptides of generation or tripeptides.As peptide synthetase, can list: there is the culture of the microorganism of the ability that generates peptide, by the microbial cells of this culture separation or the bacterial disposing thing of this microorganism or this microbe-derived peptide synthetase.
And except above-mentioned enzyme method, chemical synthesis process, in some cases, polypeptide of the present invention may be also natural existence (but not being separated).In naturally occurring situation, can also be separated.
nucleic acid of the present invention, expression vector host cell, and the antibody of anti-polypeptide of the present invention
The invention still further relates to the nucleic acid (nucleic acid of the present invention), the expression vector (expression vector of the present invention) that comprises this nucleic acid of this polypeptide of coding, the host cell (host cell of the present invention) that has imported this expression vector, they preferably can be used for producing polypeptide of the present invention.Nucleic acid of the present invention, expression vector, host cell can adopt the method for well known to a person skilled in the art to prepare.The antibody that the invention still further relates to anti-polypeptide of the present invention, it can be used for detecting antibody of the present invention.Antibody of the present invention can adopt the method for well known to a person skilled in the art to prepare.
detection means of the present invention
The invention still further relates to a kind of detection means (detection means of the present invention), it comprises solid carrier and is connected in the polypeptide of the present invention on this solid carrier.
In the present invention, solid carrier is not particularly limited, so long as solid or the insoluble material carrier of (such as being can be by the separated material from reaction mixture such as filtration, precipitation, magnetic resolution).
The material that forms solid carrier includes but not limited to: and silica gel (polydimethylsiloxane, PDMS), Mierocrystalline cellulose, teflon
tM, Nitrocellulose, agarose, dextran, chitosan, polystyrene, polyacrylamide, polyester, polycarbonate, polymeric amide, polypropylene, nylon, poly(vinylidene fluoride), latex, silicon-dioxide, glass, glass fibre, gold, platinum, silver, copper, iron, stainless steel, ferrite, silicon wafer, polyethylene, polymine, poly(lactic acid), resin, polyose, albumen (albumin etc.), carbon or their combination etc.
The shape of solid carrier comprises but is not limited to: pearl, magnetic bead, film, microcapillary, filter membrane, plate, micro plate, carbon nanotube, sensor chip etc.Pit, groove, filter membrane bottom etc. can be set on the solid carrier that just as known in the art, film or plate etc. are smooth.
In the present invention, magnetic bead can have the sphere diameter of about 25nm ~ about 1mm scope.In a preferred embodiment, magnetic bead has the diameter of about 50nm ~ approximately 10 μ m scope.The size of magnetic bead can be selected according to specific purposes.
In the present invention, the pearl of being made by the contour crosslinked spherical agarose of Sepharose has the diameter of approximately 24 μ m ~ approximately 165 μ m scope.Preferably, high crosslinked spherical sepharose 4B has the diameter of approximately 24 μ m ~ approximately 44 μ m scope.The size of high crosslinked spherical sepharose 4B can be selected according to specific purposes.
The example with the solid carrier of water repellent surface comprises can be from Polysciences, Warrington, PA or Spherotech, Liberville, the polystyrene latex beads such as goods that IL buys.
Silicon-dioxide (SiO
2)-process or silicon-dioxide (SiO
2) example of solid carrier of base comprises can be from Polysciences, Warrington, the extraordinary magnetic silica pearl that PA buys etc., it can for example, for catching nucleic acid (DNA).Or, can also use the M-280 that can buy from Dynal Biotech etc.
The magnetic bead with hydrophilic surface can be used for catching bacterial cell, nucleic acid and other composition of proliferation period.As the example of this magnetic bead, can list Polysciences, Warrington, pearl (title: Biomag (registered trademark) carboxyl) or Bangs Laboratory that PA sells, Inc., Fishers, the name of IN is called the pearl of MC02N/2928.Or, can use the M-270 of Dynal Biotech sale etc.
In a preferred embodiment of the present invention, described solid carrier is SJ modified silica-gel.The microarray solid support material (iPDMS film, referring to Chinese patent CN101265329A) of a kind of silicon rubber material of Suzhou Siju Biomaterials Co., Ltd.'s exploitation.This material is that to take the conventional PDMS of biological study be basis, add therein specific initiator composition (making this material realize surface-functionalized modification by surface initiated polymerization (SIP)), (poly (oligo (ethylene glycol) methacrylate), pOEGMA) finishing obtains to pass through polyethylene glycol methacrylate-styrene polymer again.SJ modified silica-gel has outstanding anti-protein non-specific adsorption (Nonspecific protein adsorption, NPA) ability, non-specific protein absorption in complicated protein immunization can being detected controls to " absolute 0 " level (being near or below the limit of detection of instrument) that approaches, the trouble that not only can exempt sealing and repeatedly clean, can also be by improving the susceptibility of protein microarray by stronger amplification of signal means.And the essence of its silicon rubber has been given mechanical property that this material is stronger and good operability.Suzhou YvonneJu company has successfully been applied to SJ modified silica-gel the combination assay microarray ELISA test kit that 11 tumor markerses form, realized high-throughput and high-sensitive detection, proved that this material is a kind of outstanding protein microarray solid support material.Meanwhile, this material also has the adjustable characteristic of surface properties, can adjust within the specific limits its surface topography by the controlled modification reaction times.
Polypeptide of the present invention can adopt the method for attachment that well known to a person skilled in the art polypeptide and solid carrier to carry out with being connected of solid carrier.For example, for being connected of protein/polypeptide and modified silica-gel surface, can pass through 1-ethyl-3-(3-dimethyl aminopropyl)-carbodiimide [1-ethyl-3-(3-dimethyl ami-nopropyl) carbodiimide, EDC] and N-hydroxy-succinamide (N-hydroxysuccinimide, NHS) reaction changes carboxyl (COOH) group on the macromolecular chain of modified silica-gel surface into activating group, this activating group can with on protein/polypeptide with amino (NH2) thus react realization is fixed on solid carrier surface (referring to Fig. 1) by protein/polypeptide.
In the sampling liquid using during for point sample, the concentration of polypeptide of the present invention is not particularly limited, and those skilled in the art can select according to conventional, are preferably 1 μ g ~ 1000 μ g/mL, more preferably 10 μ g ~ 500 μ g/mL.In addition, the density distributing on solid carrier for polypeptide of the present invention is not particularly limited, and those skilled in the art can select according to conventional, are preferably 1 ~ 100 points/10mm
2, more preferably 5 ~ 50 points/10mm
2.
Detection means of the present invention can be for detection of diabetes (particularly type 1 diabetes) or for the preparation of the test kit that detects diabetes (particularly type 1 diabetes).
detection kit of the present invention
The invention still further relates to a kind of detection kit (detection kit of the present invention), it comprises polypeptide of the present invention or detection means.This detection kit is preferred for detecting diabetes (particularly type 1 diabetes), more preferably for detection of the concurrent type 1 diabetes of tuberculosis.
Detection means of the present invention or polypeptide of the present invention are the important documents of detection kit of the present invention.Detection kit of the present invention can also comprise:
1. the serum dilution preparing or serum dilution component solution: serum dilution, such as having the sample diluent (production code member 070021-S2) of Sai Chi bio tech ltd, Beijing, the application of sample variable color sample diluent (production code member bwj010103) of Bo Weijia bio tech ltd, Zhengzhou etc.This serum dilution is used for dilute serum, and the serum that test kit detects will dilute suitable multiple, and for example 2 ~ 200 times, preferably 10 ~ 100 times.
Detection kit of the present invention can also comprise:
2. concentrate washing lotion: solid carrier surface is hatched after serum and ELIAS secondary antibody, need wash the unconjugated antibody of solid carrier surface and ELIAS secondary antibody by washing lotion.Concentrated washing lotion is for example 1% the polysorbas20 aqueous solution, need dilute 2 ~ 40 times, preferably 5 ~ 20 times during use.
Detection kit of the present invention can also comprise:
3. ELIAS secondary antibody solution: the type 1 diabetes autoantibody in type 1 diabetes patients serum can be combined by for example, polypeptide of the present invention on solid carrier (SJ modified silica-gel), two anti-can with antibodies, and two markers that resist can react with luminous substrate, thereby send detectable light.ELIAS secondary antibody can be the goat anti-human igg of horseradish peroxidase-labeled for example.As ELIAS secondary antibody solution, can list the mountain goat anti-human igg (H+L) of the horseradish peroxidase-labeled of Beijing Bioisystech Co., Ltd of Zhong Shan Golden Bridge production, production code member ZB-2304.Concentration to ELIAS secondary antibody in ELIAS secondary antibody solution is not particularly limited, and can be 1ng ~ 1000ng/mL for example.
Detection kit of the present invention can also comprise:
4. luminescent solution component solution: luminescent solution can react with the horseradish peroxidases of two anti-upper marks, makes to react and sends the chemical light that instrument can detect.Luminescent solution is mixed by two kinds of solution, is respectively A liquid-superoxol, and B liquid-luminol solution.Luminol (luminol,3-aminophthalic acid cyclic hydrazide) only has that by oxidizer treatment, cross just can be luminous.Conventionally use the mixed aqueous solution of hydrogen peroxide and a kind of hydroxide bases as exciting agent.Under horseradish peroxidase enzyme catalytic, decomposing hydrogen dioxide solution is oxygen G&W:
2 H
2O
2 → O
2 + 2 H
2O
Luminol,3-aminophthalic acid cyclic hydrazide has generated a pairs of anion while reacting with oxyhydroxide, the dioxygen oxidation that it can be decomposited by hydrogen peroxide, and product is an organo-peroxide.This superoxide is very unstable, decomposites immediately nitrogen, generates the 3-aminophthalic acid of excited state.During excited state to ground state transforms, the energy of release exists with the form of photon, and wavelength is positioned at the blue light part of visible ray.The example of luminescent solution component solution is the SuperSignal ELISA Femto Maximum Sensitivity Substrate of Thermo Seientific company for example, article No. 37074.
Detection kit of the present invention can also comprise:
5. one or more reaction cavity (for example Chinese patent Granted publication CN202054829U).
Detection kit of the present invention can also comprise:
6. other detection molecules for detection of diabetes (particularly type 1 diabetes) (such as polypeptide, protein, nucleic acid etc.).
Detection kit of the present invention can also comprise:
7. working instructions.
Embodiment
Below, by embodiment, the present invention is carried out to more specific description, but be not the restriction to the technology of the present invention scope.By the record of this specification sheets, those skilled in the art can be easy to the present invention to modify/change, and these are included in technical scope of the present invention.
the preparation of 1.30 peptides and confirmation
30 peptides that use in embodiment have the aminoacid sequence shown in SEQ ID NO:1, and by Shanghai gill, biochemical company limited is synthetic, and Fig. 2 ~ 3 are shown in by the sign collection of illustrative plates of this polypeptide, can confirm to have synthesized described polypeptide.
2. the preparation of detection means
Detection chip is that to take SJ modified silica-gel (iPDMS film) be solid support material, is prepared from thereon by point sample immobilized polypeptide solution.Modified silica-gel is in traditional polydimethylsiloxane material, to add with initiator olefin-terminal, surface initiated polymerization, and be fixed in the three-dimensional structure of polydimethylsiloxane by heat cross-linking (si-h bond bonding), obtaining a kind of new material is SJ modified silica-gel.Its making processes as shown in Figure 4.
A wherein and B are two components of polydimethylsiloxane, polydimethylsiloxane (Poly (dimethylsiloxane), Sylgard 184) buy from Dow corning (DowCorning) company, comprise liquid composition A(composition and be metal platinum catalyzer and diformazan siloxanes polymer precursor mixture with vinyl) and two kinds of compositions of crosslinking agent B (composition is the dimethyl siloxane precursor with vinyl and Si-H group).C is the initiator of end band vinyl, is purchased from Hangzhou Dong Wei company.Polymer on finally modifying is that oligomeric ethylene glycol methacrylate monomer (Oligo (ethylene glycol) methacrylate, hereinafter to be referred as OEGMA, molecular weight Mw=526) is bought in Aldrich.Polydimethylsiloxane precursor A and crosslinking agent B are fully mixed with A:B:C=10:1:0.5 ratio with the initiator C with vinyl end.By curing reaction, make transparent elastic silicone rubber, then by SIP technology, carry out finishing and can obtain SJ modified silica-gel.Experiment shows, the surface of SJ modified silica-gel have enough highdensity, by the fixing initiator of covalent linkage, it can pass through surface initiated polymerization (SIP), and to realize surface macromolecule modified.Use poly (OEGMA) (polyethylene glycol methacrylate-styrene polymer) to react and obtain the surface that polyoxyethylene glycol (Polyethylene Glycol, PEG) is modified, realize the ability of stronger anti-albumen non-specific adsorption.
The SJ modified silica-gel film making need be kept in 4 ℃ of refrigerators.
Adopt brilliant core
16 people's point sample instruments of PersonalArrayerTM are prepared polypeptide microarray on modified silica-gel, and process is:
1) pre-treatment
By SJ modified silica-gel thin slice (15 * 15mm
2) be immersed in activation solution, after 30min, take out with deionized water drip washing 3 times, with nitrogen, dry up, at once for point sample.
2) point sample
Sampling liquid is diluted and gets well and transfer in the corresponding micropore of 384 orifice plate, 384 orifice plates with sample are placed on point sample instrument base station, pretreated modified silica-gel thin slice is placed on the base station of point sample instrument simultaneously, carry out point sample at once.Point sample envrionment conditions is room temperature (25 ℃), and humidity is set as 50%.On the polypeptide microarray of making, the point sample amount of each point is about 0.6nL, and sampling point radius is 200 μ m.
3) chemistry is fixing
The polypeptide microarray just having made will be placed on fixing at least 6h in climatic chamber (26 ℃, 60% humidity).Chemistry fixation procedure as shown in Figure 5.
First by point sample instrument by include catch peptide molecule damping fluid point on modified silica-gel film, follow damping fluid start vaporizer, catch peptide molecule and the surface intimate contact of SJ modified silica-gel and interact, by Chemical bond, the high molecular end-COOH of the ploy on modified silica-gel surface (OEGMA) and peptide molecule-NH
2form and stablize covalent linkage, and then will have chemically active peptide molecule to be fixed on SJ modified silica-gel surface.
5) assembling
Fixedly the polypeptide microarray of 6h must assemble in two days.First by gum, SJ modified silica-gel thin slice is attached on special reaction column, covers reaction cavity.A reactor is comprised of two reaction columns and a reaction cavity.
6) preserve
The polypeptide microarray assembling, need to vacuumize sealing, is kept in the refrigerator of 4 ℃, standby.
3. by detection means, detect
Checking procedure
1, before starting to detect, in the ratio of 1:10, add purified water or distilled water to dilute concentrated cleaning solutions, diluted rear direct use.Use liquid-transfering gun that 2mL scavenging solution is added to chip surface, soak chip 3 minutes, guarantee that chip surface is by complete wetting.
2, test serum sample is mixed according to 1:40 dilution with sample diluent.
3, discard the scavenging solution that soaks chip, under the completely moistening state of chip surface, the serum that each serum sample is drawn after 200 μ L dilutions joins in chip reactor.
4, chip reactor is put into chip permanent seat, be put on shaking table, open shaking table, 150 revs/min of frequencies, incubated at room 30 minutes.
5, discard the serum sample in chip reactor, use 15mL washing lotion cleaning reaction cavity and chip surface 3 times.
6, after having cleaned, each chip reactor adds respectively 200 μ L enzyme labelled antibody solution, and chip reactor is put into chip permanent seat, is put on shaking table, opens shaking table, 150 revs/min of frequencies, incubated at room 30 minutes.
7, discard the enzyme labelled antibody solution in chip reactor, use 15mL washing lotion cleaning reaction cavity and chip surface 3 times.
8, after having cleaned, take off reaction cavity, each chip surface adds respectively 15 μ L luminous substrate liquid, makes luminescent solution can be laid on uniformly chip surface.
9, the chip that has added luminescent solution is placed in to gel imaging instrument chemoluminescence imaging, and sentence read result.
Type 1 diabetes patients serum and other diseases patients serum sample are provided by chain hospital.Serum is transported or is handed to soon laboratory with parcels such as ice cube/dry ice by related personnel.
Negative control has the contrast of PBS damping fluid (hatch without test serum in the 3rd step, and hatch with PBS solution, all the other steps are identical), the contrast of serum dilution, and the contrast of patients with negative (referring to Healthy People and non-type 1 diabetes patient) serum.
The spot sample mode of polypeptide microarray as shown in Figure 6.Wherein, the sample of leg-of-mutton 20 points is human IgG, as the locating point of experiment; The sample of foursquare 4 points is PB sampling liquid, as the blank of experiment; The sample polypeptide of star point is polypeptide SEQ ID NO:1 of the present invention, and it is type 1 diabetes autoantigen protein polypeptide, can produce response to type 1 diabetes patients serum; Circular point sample be other type 1 diabetes autoantigen protein polypeptide, as the detection index (these polypeptide have response explanation to detect in serum and have type 1 diabetes autoantibody) of experiment.
Experimental result is as shown in Fig. 7 ~ 8.Wherein, Fig. 7 has shown the detected result of negative control, only has the sample of the point shown in trilateral to have response.Fig. 8 has shown type 1 diabetes patients serum's detected result, and trilateral, star point and/or circular sample have response.It should be noted that, instrument records signal value from low to high, and corresponding signaling point color is by black-white gradual change.
<110> Suzhou Siju Biomaterials Co., Ltd.
<120> polypeptide, the detection means that comprises this polypeptide and detection kit
<130> Sz-14
<160> 1
<170> PatentIn version 3.1
<210> 1
<211> 30
<212> PRT
<213> artificial sequence
<220>
<223> type 1 diabetes antigenic polypeptide
<400> 1
EVMKCIVEVIYDTLSKPSPMPVSKECFETL 30
Claims (9)
1. a peptide species, its aminoacid sequence as shown in SEQ ID NO:1, that is: EVMKCIVEVIYDTLSKPSPMPVSKECFETL.
Coding polypeptide claimed in claim 1 nucleic acid.
3. the expression vector that comprises nucleic acid claimed in claim 2.
4. imported the host cell of expression vector claimed in claim 3.
5. a detection means, it comprises:
Solid carrier, and
Be connected in the polypeptide claimed in claim 1 on this solid carrier.
6. detection means according to claim 5, wherein, described solid carrier is SJ modified silica-gel.
7. a detection kit, it comprises the detection means described in polypeptide claimed in claim 1 or claim 5 or 6.
8. resist the antibody of polypeptide claimed in claim 1.
9. polypeptide claimed in claim 1 is in the test kit for the preparation of detection type 1 diabetes or the purposes in detection means.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201310116987.9A CN104098685B (en) | 2013-04-03 | 2013-04-03 | Polypeptide, the detection means comprising this polypeptide and detection kit |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201310116987.9A CN104098685B (en) | 2013-04-03 | 2013-04-03 | Polypeptide, the detection means comprising this polypeptide and detection kit |
Publications (2)
Publication Number | Publication Date |
---|---|
CN104098685A true CN104098685A (en) | 2014-10-15 |
CN104098685B CN104098685B (en) | 2016-03-23 |
Family
ID=51667261
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201310116987.9A Expired - Fee Related CN104098685B (en) | 2013-04-03 | 2013-04-03 | Polypeptide, the detection means comprising this polypeptide and detection kit |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN104098685B (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN104098671A (en) * | 2013-04-03 | 2014-10-15 | 苏州偲聚生物材料有限公司 | Polypeptide, and detection member and detection kit both containing same |
Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1781936A (en) * | 2004-12-03 | 2006-06-07 | 中国人民解放军第三军医大学 | B lymphocyte stimulus factor inhibiting peptide and its screening and preparing method |
CN1979165A (en) * | 2006-12-12 | 2007-06-13 | 中国科学院广州生物医药与健康研究院 | Alpha-fodrin antigen epi-position polypeptide mixture and its use |
WO2012056251A1 (en) * | 2010-10-29 | 2012-05-03 | Biocopea Limited | Inflammatory disease |
US20120128699A1 (en) * | 2010-11-19 | 2012-05-24 | Idera Pharmaceuticals, Inc. | Immune regulatory oligonucleotide (iro) compounds to modulate toll-like receptor based immune response |
-
2013
- 2013-04-03 CN CN201310116987.9A patent/CN104098685B/en not_active Expired - Fee Related
Patent Citations (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN1781936A (en) * | 2004-12-03 | 2006-06-07 | 中国人民解放军第三军医大学 | B lymphocyte stimulus factor inhibiting peptide and its screening and preparing method |
CN1979165A (en) * | 2006-12-12 | 2007-06-13 | 中国科学院广州生物医药与健康研究院 | Alpha-fodrin antigen epi-position polypeptide mixture and its use |
WO2012056251A1 (en) * | 2010-10-29 | 2012-05-03 | Biocopea Limited | Inflammatory disease |
US20120128699A1 (en) * | 2010-11-19 | 2012-05-24 | Idera Pharmaceuticals, Inc. | Immune regulatory oligonucleotide (iro) compounds to modulate toll-like receptor based immune response |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN104098671A (en) * | 2013-04-03 | 2014-10-15 | 苏州偲聚生物材料有限公司 | Polypeptide, and detection member and detection kit both containing same |
Also Published As
Publication number | Publication date |
---|---|
CN104098685B (en) | 2016-03-23 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN103665138B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN104098677A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098685B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN104098674B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN103788199B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN103788195B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN104098667A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN103788183B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN104098686B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN103788200B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN104098680B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN104098684B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN103788194B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN103788198B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN103788201B (en) | Polypeptide, the detection means comprising this polypeptide and detection kit | |
CN104098670A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098672A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098673A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098679A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098681A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098682A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098668A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098683A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098654A (en) | Polypeptide, and detection member and detection kit both containing same | |
CN104098649A (en) | Polypeptide, and detection member and detection kit both containing same |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C14 | Grant of patent or utility model | ||
GR01 | Patent grant | ||
C56 | Change in the name or address of the patentee | ||
CP02 | Change in the address of a patent holder |
Address after: Xinghu Street Industrial Park of Suzhou city in Jiangsu province 215123 BioBAY No. 218 building C20 Room 201 Patentee after: SUZHOU SJ BIOMATERIALS Co.,Ltd. Address before: Xinghu Street Industrial Park of Suzhou city in Jiangsu province 215123 BioBAY No. 218 building A4 room 209 Patentee before: SUZHOU SJ BIOMATERIALS Co.,Ltd. |
|
CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20160323 |
|
CF01 | Termination of patent right due to non-payment of annual fee |