CN104098673A - Polypeptide, and detection member and detection kit both containing same - Google Patents

Polypeptide, and detection member and detection kit both containing same Download PDF

Info

Publication number
CN104098673A
CN104098673A CN201310116438.1A CN201310116438A CN104098673A CN 104098673 A CN104098673 A CN 104098673A CN 201310116438 A CN201310116438 A CN 201310116438A CN 104098673 A CN104098673 A CN 104098673A
Authority
CN
China
Prior art keywords
polypeptide
diabetes
present
detection
detection means
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Pending
Application number
CN201310116438.1A
Other languages
Chinese (zh)
Inventor
马雄明
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
SUZHOU SIJU BIOMATERIALS CO Ltd
Original Assignee
SUZHOU SIJU BIOMATERIALS CO Ltd
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by SUZHOU SIJU BIOMATERIALS CO Ltd filed Critical SUZHOU SIJU BIOMATERIALS CO Ltd
Priority to CN201310116438.1A priority Critical patent/CN104098673A/en
Publication of CN104098673A publication Critical patent/CN104098673A/en
Pending legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/46Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates
    • C07K14/47Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from vertebrates from mammals
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2333/00Assays involving biological materials from specific organisms or of a specific nature
    • G01N2333/435Assays involving biological materials from specific organisms or of a specific nature from animals; from humans
    • G01N2333/46Assays involving biological materials from specific organisms or of a specific nature from animals; from humans from vertebrates
    • G01N2333/47Assays involving proteins of known structure or function as defined in the subgroups
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N2800/00Detection or diagnosis of diseases
    • G01N2800/04Endocrine or metabolic disorders
    • G01N2800/042Disorders of carbohydrate metabolism, e.g. diabetes, glucose metabolism

Abstract

The invention relates to a polypeptide, and a detection member and a detection kit both containing the same. The polypeptide is composed of the amino acid sequence shown as SEQ ID NO: 1. The polypeptide, and the detection member and the detection kit both containing the same are usable in diagnosis of diabetes mellitus.

Description

Polypeptide, the detection means that comprises this polypeptide and detection kit
Technical field
Detection means and detection kit that the present invention relates generally to polypeptide, comprises this polypeptide, belong to biological technical field.
Background technology
Diabetes ( diabetes Mellitus, DM) be that a group of jointly being caused by h and E factor be take the clinical syndrome that carbohydrate metabolism disturbance is main manifestations.Insulin deficit and insulin action obstacle cause the metabolism disorder of carbohydrate, fat, protein, power and water medium etc. individually or simultaneously, clinically take chronic hyperglycemia as principal character.Can there is diuresis in model case, performance, i.e. " three-many-one-little " symptom such as drink more, eat more, become thin.
At European diabetes (the European Association forthe Study of Diabetes of association, EASD) in meeting in 2011, (the International Diabetes Federation of IDF, IDF) issue latest data showed: within 2011, whole world diabetes number of patients has reached 3.66 hundred million, compared with 2.85 hundred million increases nearly 30% of 2010.Have every year 4600000 people to die from diabetes, for the medical expense of diabetes up to 4,650 hundred million dollars.Chairman IDF Jean professor ClaudeManbaya says: " in 2011, just had 1 people because of Diabetes Death every 7 seconds, and alarm bell is beaten ".According to sound in the November, 2011 of China, diabetic subject's number that China has made a definite diagnosis, up to 9,240 ten thousand people, is the first in the world.In the 20 years old above adult in the whole nation, onset diabetes rate is up to 9.7%.
Diabetes can be divided into type 1 diabetes, diabetes B, gestational diabetes and specific type diabetes by its nosetiology classification.
The clinical manifestation of Hospitals at Present Main Basis is (as type 1 diabetes is mainly in adolescence, and there is typical " three-many-one-little " symptom, depend on Regular Insulin etc.) differentiation 1 type and diabetes B, to the indefinite diabetic subject of somatotype as adult's delayed autoimmune diabetes (latent autoimmune diabetes in adults, LADA) and make a definite diagnosis type 1 diabetes and need to detect type 1 diabetes autoantibody and carry out auxiliary diagnosis.
Summary of the invention
The object of the present invention is to provide a kind of to diabetes, the useful polypeptide of the diagnosis of type 1 diabetes particularly, the encode nucleic acid of this polypeptide, the expression vector that comprises this nucleic acid, imported the host cell of this expression vector, the antibody of anti-this polypeptide, the detection means that comprises this polypeptide, the detection kit that comprises this polypeptide or this detection means, and the purposes of this polypeptide in detecting type 1 diabetes, this polypeptide is in the test kit for the preparation of detection type 1 diabetes or the purposes in detection means.
That is, the present invention comprises following technical proposals:
1. a peptide species, its aminoacid sequence as shown in SEQ ID NO:1, that is: PVNKDQCPRERPEELESGGMYHCHSGSKPT.
Coding polypeptide claimed in claim 1 nucleic acid.
3. the expression vector that comprises nucleic acid claimed in claim 2.
4. imported the host cell of expression vector claimed in claim 3.
5. a detection means, it comprises:
Solid carrier, and
Be connected in the polypeptide claimed in claim 1 on this solid carrier.
6. detection means according to claim 5, wherein, described solid carrier is SJ modified silica-gel.
7. a detection kit, it comprises the detection means described in polypeptide claimed in claim 1 or claim 5 or 6.
8. resist the antibody of polypeptide claimed in claim 1.
9. polypeptide claimed in claim 1 is in the test kit for the preparation of detection type 1 diabetes or the purposes in detection means.
Polypeptide of the present invention is applied to the diagnosis of diabetes (particularly type 1 diabetes), can obtains gratifying effect.
Accompanying drawing explanation
Fig. 1 is fixed on polypeptide the schematic diagram on SJ modified silica-gel surface by chemical covalency.
The HPLC that Fig. 2 confirms the polypeptide of the present invention of chemosynthesis characterizes collection of illustrative plates.
The MS that Fig. 3 confirms the polypeptide of the present invention of chemosynthesis characterizes collection of illustrative plates.
The schematic diagram that Fig. 4 describes the making processes of SJ modified silica-gel (iPDMS film).
The figure that Fig. 5 describes polypeptide microarray chemistry fixation procedure.
Fig. 6 illustrates the schematic diagram of polypeptide microarray spot sample mode.
Fig. 7 ~ 8 show the photo of the result that different serum is detected.
Embodiment
polypeptide of the present invention
Polypeptide of the present invention is 30 peptides.30 peptides of the present invention consist of the aminoacid sequence shown in SEQ ID NO:1, that is: PVNKDQCPRERPEELESGGMYHCHSGSKPT.As shown in the Examples, its serum to type 1 diabetes patient is positive, and to healthy normal people or the non-type 1 diabetes patients serum reaction that is negative.Therefore, this 30 peptide is useful as the diagnostic tool of type 1 diabetes.
Polypeptide of the present invention, having commercially available in the situation that, can be used commercially available product, in addition, can also suitable employing (1) chemical synthesis process or the known method such as (2) enzyme reaction synthetic method obtain, wherein chemosynthesis is more easy.In chemosynthesis polypeptide situation of the present invention, by or semi-synthetic this polypeptide synthetic with peptide synthesizer, undertaken.As chemical synthesis process, can list such as peptide solid-phase synthesis etc.Synthetic like this peptide can adopt conventional means such as ion-exchange chromatography, reversed phase high efficiency liquid color spectrum, affinity chromatography etc. to carry out purifying.Such peptide solid phase synthesis process with and subsequent peptide purification be all well-known in the art.
In addition,, in the situation that producing polypeptide of the present invention by enzyme reaction, can adopt the method described in No. WO2004/011653, International Publication brochure for example.; can produce like this: the esterified or amidation by the C-terminal of a side amino acid or dipeptides and the amino acid that obtains or dipeptides, the amino acid (for example amino acid of carboxy protective) with amino acid in unbound state react under the existence of peptide synthetase, the dipeptides of generation or tripeptides.As peptide synthetase, can list: there is the culture of the microorganism of the ability that generates peptide, by the microbial cells of this culture separation or the bacterial disposing thing of this microorganism or this microbe-derived peptide synthetase.
And except above-mentioned enzyme method, chemical synthesis process, in some cases, polypeptide of the present invention may be also natural existence (but not being separated).In naturally occurring situation, can also be separated.
nucleic acid of the present invention, expression vector host cell, and the antibody of anti-polypeptide of the present invention
The invention still further relates to the nucleic acid (nucleic acid of the present invention), the expression vector (expression vector of the present invention) that comprises this nucleic acid of this polypeptide of coding, the host cell (host cell of the present invention) that has imported this expression vector, they preferably can be used for producing polypeptide of the present invention.Nucleic acid of the present invention, expression vector, host cell can adopt the method for well known to a person skilled in the art to prepare.The antibody that the invention still further relates to anti-polypeptide of the present invention, it can be used for detecting antibody of the present invention.Antibody of the present invention can adopt the method for well known to a person skilled in the art to prepare.
detection means of the present invention
The invention still further relates to a kind of detection means (detection means of the present invention), it comprises solid carrier and is connected in the polypeptide of the present invention on this solid carrier.
In the present invention, solid carrier is not particularly limited, so long as solid or the insoluble material carrier of (such as being can be by the separated material from reaction mixture such as filtration, precipitation, magnetic resolution).
The material that forms solid carrier includes but not limited to: and silica gel (polydimethylsiloxane, PDMS), Mierocrystalline cellulose, teflon tM, Nitrocellulose, agarose, dextran, chitosan, polystyrene, polyacrylamide, polyester, polycarbonate, polymeric amide, polypropylene, nylon, poly(vinylidene fluoride), latex, silicon-dioxide, glass, glass fibre, gold, platinum, silver, copper, iron, stainless steel, ferrite, silicon wafer, polyethylene, polymine, poly(lactic acid), resin, polyose, albumen (albumin etc.), carbon or their combination etc.
The shape of solid carrier comprises but is not limited to: pearl, magnetic bead, film, microcapillary, filter membrane, plate, micro plate, carbon nanotube, sensor chip etc.Pit, groove, filter membrane bottom etc. can be set on the solid carrier that just as known in the art, film or plate etc. are smooth.
In the present invention, magnetic bead can have the sphere diameter of about 25nm ~ about 1mm scope.In a preferred embodiment, magnetic bead has the diameter of about 50nm ~ approximately 10 μ m scope.The size of magnetic bead can be selected according to specific purposes.
In the present invention, the pearl of being made by the contour crosslinked spherical agarose of Sepharose has the diameter of approximately 24 μ m ~ approximately 165 μ m scope.Preferably, high crosslinked spherical sepharose 4B has the diameter of approximately 24 μ m ~ approximately 44 μ m scope.The size of high crosslinked spherical sepharose 4B can be selected according to specific purposes.
The example with the solid carrier of water repellent surface comprises can be from Polysciences, Warrington, PA or Spherotech, Liberville, the polystyrene latex beads such as goods that IL buys.
Silicon-dioxide (SiO 2)-process or silicon-dioxide (SiO 2) example of solid carrier of base comprises can be from Polysciences, Warrington, the extraordinary magnetic silica pearl that PA buys etc., it can for example, for catching nucleic acid (DNA).Or, can also use the M-280 that can buy from Dynal Biotech etc.
The magnetic bead with hydrophilic surface can be used for catching bacterial cell, nucleic acid and other composition of proliferation period.As the example of this magnetic bead, can list Polysciences, Warrington, pearl (title: Biomag (registered trademark) carboxyl) or Bangs Laboratory that PA sells, Inc., Fishers, the name of IN is called the pearl of MC02N/2928.Or, can use the M-270 of Dynal Biotech sale etc.
In a preferred embodiment of the present invention, described solid carrier is SJ modified silica-gel.The microarray solid support material (iPDMS film, referring to Chinese patent CN101265329A) of a kind of silicon rubber material of Suzhou Siju Biomaterials Co., Ltd.'s exploitation.This material is that to take the conventional PDMS of biological study be basis, add therein specific initiator composition (making this material realize surface-functionalized modification by surface initiated polymerization (SIP)), (poly (oligo (ethylene glycol) methacrylate), pOEGMA) finishing obtains to pass through polyethylene glycol methacrylate-styrene polymer again.SJ modified silica-gel has outstanding anti-protein non-specific adsorption (Nonspecific protein adsorption, NPA) ability, non-specific protein absorption in complicated protein immunization can being detected controls to " absolute 0 " level (being near or below the limit of detection of instrument) that approaches, the trouble that not only can exempt sealing and repeatedly clean, can also be by improving the susceptibility of protein microarray by stronger amplification of signal means.And the essence of its silicon rubber has been given mechanical property that this material is stronger and good operability.Suzhou YvonneJu company has successfully been applied to SJ modified silica-gel the combination assay microarray ELISA test kit that 11 tumor markerses form, realized high-throughput and high-sensitive detection, proved that this material is a kind of outstanding protein microarray solid support material.Meanwhile, this material also has the adjustable characteristic of surface properties, can adjust within the specific limits its surface topography by the controlled modification reaction times.
Polypeptide of the present invention can adopt the method for attachment that well known to a person skilled in the art polypeptide and solid carrier to carry out with being connected of solid carrier.For example, for being connected of protein/polypeptide and modified silica-gel surface, can pass through 1-ethyl-3-(3-dimethyl aminopropyl)-carbodiimide [1-ethyl-3-(3-dimethyl ami-nopropyl) carbodiimide, EDC] and N-hydroxy-succinamide (N-hydroxysuccinimide, NHS) reaction changes carboxyl (COOH) group on the macromolecular chain of modified silica-gel surface into activating group, this activating group can with on protein/polypeptide with amino (NH2) thus react realization is fixed on solid carrier surface (referring to Fig. 1) by protein/polypeptide.
In the sampling liquid using during for point sample, the concentration of polypeptide of the present invention is not particularly limited, and those skilled in the art can select according to conventional, are preferably 1 μ g ~ 1000 μ g/mL, more preferably 10 μ g ~ 500 μ g/mL.In addition, the density distributing on solid carrier for polypeptide of the present invention is not particularly limited, and those skilled in the art can select according to conventional, are preferably 1 ~ 100 points/10mm 2, more preferably 5 ~ 50 points/10mm 2.
Detection means of the present invention can be for detection of diabetes (particularly type 1 diabetes) or for the preparation of the test kit that detects diabetes (particularly type 1 diabetes).
detection kit of the present invention
The invention still further relates to a kind of detection kit (detection kit of the present invention), it comprises polypeptide of the present invention or detection means.This detection kit is preferred for detecting diabetes (particularly type 1 diabetes), more preferably for detection of the concurrent type 1 diabetes of tuberculosis.
Detection means of the present invention or polypeptide of the present invention are the important documents of detection kit of the present invention.Detection kit of the present invention can also comprise:
1. the serum dilution preparing or serum dilution component solution: serum dilution, such as having the sample diluent (production code member 070021-S2) of Sai Chi bio tech ltd, Beijing, the application of sample variable color sample diluent (production code member bwj010103) of Bo Weijia bio tech ltd, Zhengzhou etc.This serum dilution is used for dilute serum, and the serum that test kit detects will dilute suitable multiple, and for example 2 ~ 200 times, preferably 10 ~ 100 times.
Detection kit of the present invention can also comprise:
2. concentrate washing lotion: solid carrier surface is hatched after serum and ELIAS secondary antibody, need wash the unconjugated antibody of solid carrier surface and ELIAS secondary antibody by washing lotion.Concentrated washing lotion is for example 1% the polysorbas20 aqueous solution, need dilute 2 ~ 40 times, preferably 5 ~ 20 times during use.
Detection kit of the present invention can also comprise:
3. ELIAS secondary antibody solution: the type 1 diabetes autoantibody in type 1 diabetes patients serum can be combined by for example, polypeptide of the present invention on solid carrier (SJ modified silica-gel), two anti-can with antibodies, and two markers that resist can react with luminous substrate, thereby send detectable light.ELIAS secondary antibody can be the goat anti-human igg of horseradish peroxidase-labeled for example.As ELIAS secondary antibody solution, can list the mountain goat anti-human igg (H+L) of the horseradish peroxidase-labeled of Beijing Bioisystech Co., Ltd of Zhong Shan Golden Bridge production, production code member ZB-2304.Concentration to ELIAS secondary antibody in ELIAS secondary antibody solution is not particularly limited, and can be 1ng ~ 1000ng/mL for example.
Detection kit of the present invention can also comprise:
4. luminescent solution component solution: luminescent solution can react with the horseradish peroxidases of two anti-upper marks, makes to react and sends the chemical light that instrument can detect.Luminescent solution is mixed by two kinds of solution, is respectively A liquid-superoxol, and B liquid-luminol solution.Luminol (luminol,3-aminophthalic acid cyclic hydrazide) only has that by oxidizer treatment, cross just can be luminous.Conventionally use the mixed aqueous solution of hydrogen peroxide and a kind of hydroxide bases as exciting agent.Under horseradish peroxidase enzyme catalytic, decomposing hydrogen dioxide solution is oxygen G&W:
2 H 2O 2 → O 2 + 2 H 2O
Luminol,3-aminophthalic acid cyclic hydrazide has generated a pairs of anion while reacting with oxyhydroxide, the dioxygen oxidation that it can be decomposited by hydrogen peroxide, and product is an organo-peroxide.This superoxide is very unstable, decomposites immediately nitrogen, generates the 3-aminophthalic acid of excited state.During excited state to ground state transforms, the energy of release exists with the form of photon, and wavelength is positioned at the blue light part of visible ray.The example of luminescent solution component solution is the SuperSignal ELISA Femto Maximum Sensitivity Substrate of Thermo Seientific company for example, article No. 37074.
Detection kit of the present invention can also comprise:
5. one or more reaction cavity (for example Chinese patent Granted publication CN202054829U).
Detection kit of the present invention can also comprise:
6. other detection molecules for detection of diabetes (particularly type 1 diabetes) (such as polypeptide, protein, nucleic acid etc.).
Detection kit of the present invention can also comprise:
7. working instructions.
Embodiment
Below, by embodiment, the present invention is carried out to more specific description, but be not the restriction to the technology of the present invention scope.By the record of this specification sheets, those skilled in the art can be easy to the present invention to modify/change, and these are included in technical scope of the present invention.
the preparation of 1.30 peptides and confirmation
30 peptides that use in embodiment have the aminoacid sequence shown in SEQ ID NO:1, and by Shanghai gill, biochemical company limited is synthetic, and Fig. 2 ~ 3 are shown in by the sign collection of illustrative plates of this polypeptide, can confirm to have synthesized described polypeptide.
2. the preparation of detection means
Detection chip is that to take SJ modified silica-gel (iPDMS film) be solid support material, is prepared from thereon by point sample immobilized polypeptide solution.Modified silica-gel is in traditional polydimethylsiloxane material, to add with initiator olefin-terminal, surface initiated polymerization, and be fixed in the three-dimensional structure of polydimethylsiloxane by heat cross-linking (si-h bond bonding), obtaining a kind of new material is SJ modified silica-gel.Its making processes as shown in Figure 4.
A wherein and B are two components of polydimethylsiloxane, polydimethylsiloxane (Poly (dimethylsiloxane), Sylgard 184) buy from Dow corning (DowCorning) company, comprise liquid composition A(composition and be metal platinum catalyzer and diformazan siloxanes polymer precursor mixture with vinyl) and two kinds of compositions of crosslinking agent B (composition is the dimethyl siloxane precursor with vinyl and Si-H group).C is the initiator of end band vinyl, is purchased from Hangzhou Dong Wei company.Polymer on finally modifying is that oligomeric ethylene glycol methacrylate monomer (Oligo (ethylene glycol) methacrylate, hereinafter to be referred as OEGMA, molecular weight Mw=526) is bought in Aldrich.Polydimethylsiloxane precursor A and crosslinking agent B are fully mixed with A:B:C=10:1:0.5 ratio with the initiator C with vinyl end.By curing reaction, make transparent elastic silicone rubber, then by SIP technology, carry out finishing and can obtain SJ modified silica-gel.Experiment shows, the surface of SJ modified silica-gel have enough highdensity, by the fixing initiator of covalent linkage, it can pass through surface initiated polymerization (SIP), and to realize surface macromolecule modified.Use poly (OEGMA) (polyethylene glycol methacrylate-styrene polymer) to react and obtain the surface that polyoxyethylene glycol (Polyethylene Glycol, PEG) is modified, realize the ability of stronger anti-albumen non-specific adsorption.
The SJ modified silica-gel film making need be kept in 4 ℃ of refrigerators.
Adopt brilliant core 16 people's point sample instruments of PersonalArrayerTM are prepared polypeptide microarray on modified silica-gel, and process is:
1) pre-treatment
By SJ modified silica-gel thin slice (15 * 15mm 2) be immersed in activation solution, after 30min, take out with deionized water drip washing 3 times, with nitrogen, dry up, at once for point sample.
2) point sample
Sampling liquid is diluted and gets well and transfer in the corresponding micropore of 384 orifice plate, 384 orifice plates with sample are placed on point sample instrument base station, pretreated modified silica-gel thin slice is placed on the base station of point sample instrument simultaneously, carry out point sample at once.Point sample envrionment conditions is room temperature (25 ℃), and humidity is set as 50%.On the polypeptide microarray of making, the point sample amount of each point is about 0.6nL, and sampling point radius is 200 μ m.
3) chemistry is fixing
The polypeptide microarray just having made will be placed on fixing at least 6h in climatic chamber (26 ℃, 60% humidity).Chemistry fixation procedure as shown in Figure 5.
First by point sample instrument by include catch peptide molecule damping fluid point on modified silica-gel film, follow damping fluid start vaporizer, catch peptide molecule and the surface intimate contact of SJ modified silica-gel and interact, by Chemical bond, the high molecular end-COOH of the ploy on modified silica-gel surface (OEGMA) and peptide molecule-NH 2form and stablize covalent linkage, and then will have chemically active peptide molecule to be fixed on SJ modified silica-gel surface.
5) assembling
Fixedly the polypeptide microarray of 6h must assemble in two days.First by gum, SJ modified silica-gel thin slice is attached on special reaction column, covers reaction cavity.A reactor is comprised of two reaction columns and a reaction cavity.
6) preserve
The polypeptide microarray assembling, need to vacuumize sealing, is kept in the refrigerator of 4 ℃, standby.
3. by detection means, detect
Checking procedure
1, before starting to detect, in the ratio of 1:10, add purified water or distilled water to dilute concentrated cleaning solutions, diluted rear direct use.Use liquid-transfering gun that 2mL scavenging solution is added to chip surface, soak chip 3 minutes, guarantee that chip surface is by complete wetting.
2, test serum sample is mixed according to 1:40 dilution with sample diluent.
3, discard the scavenging solution that soaks chip, under the completely moistening state of chip surface, the serum that each serum sample is drawn after 200 μ L dilutions joins in chip reactor.
4, chip reactor is put into chip permanent seat, be put on shaking table, open shaking table, 150 revs/min of frequencies, incubated at room 30 minutes.
5, discard the serum sample in chip reactor, use 15mL washing lotion cleaning reaction cavity and chip surface 3 times.
6, after having cleaned, each chip reactor adds respectively 200 μ L enzyme labelled antibody solution, and chip reactor is put into chip permanent seat, is put on shaking table, opens shaking table, 150 revs/min of frequencies, incubated at room 30 minutes.
7, discard the enzyme labelled antibody solution in chip reactor, use 15mL washing lotion cleaning reaction cavity and chip surface 3 times.
8, after having cleaned, take off reaction cavity, each chip surface adds respectively 15 μ L luminous substrate liquid, makes luminescent solution can be laid on uniformly chip surface.
9, the chip that has added luminescent solution is placed in to gel imaging instrument chemoluminescence imaging, and sentence read result.
Type 1 diabetes patients serum and other diseases patients serum sample are provided by chain hospital.Serum is transported or is handed to soon laboratory with parcels such as ice cube/dry ice by related personnel.
Negative control has the contrast of PBS damping fluid (hatch without test serum in the 3rd step, and hatch with PBS solution, all the other steps are identical), the contrast of serum dilution, and the contrast of patients with negative (referring to Healthy People and non-type 1 diabetes patient) serum.
The spot sample mode of polypeptide microarray as shown in Figure 6.Wherein, the sample of leg-of-mutton 20 points is human IgG, as the locating point of experiment; The sample of foursquare 4 points is PB sampling liquid, as the blank of experiment; The sample polypeptide of star point is polypeptide SEQ ID NO:1 of the present invention, and it is type 1 diabetes autoantigen protein polypeptide, can produce response to type 1 diabetes patients serum; Circular point sample be other type 1 diabetes autoantigen protein polypeptide, as the detection index (these polypeptide have response explanation to detect in serum and have type 1 diabetes autoantibody) of experiment.
Experimental result is as shown in Fig. 7 ~ 8.Wherein, Fig. 7 has shown the detected result of negative control, only has the sample of the point shown in trilateral to have response.Fig. 8 has shown type 1 diabetes patients serum's detected result, and trilateral, star point and/or circular sample have response.It should be noted that, instrument records signal value from low to high, and corresponding signaling point color is by black-white gradual change.
<110> Suzhou Siju Biomaterials Co., Ltd.
<120> polypeptide, the detection means that comprises this polypeptide and detection kit
<130> Sz-3
<160> 1
<170> PatentIn version 3.1
<210> 1
<211> 30
<212> PRT
<213> artificial sequence
<220>
<223> type 1 diabetes antigenic polypeptide
<400> 1
PVNKDQCPRERPEELESGMYHCHSGSKPT 30

Claims (9)

1. a peptide species, its aminoacid sequence as shown in SEQ ID NO:1, that is: PVNKDQCPRERPEELESGGMYHCHSGSKPT.
Coding polypeptide claimed in claim 1 nucleic acid.
3. the expression vector that comprises nucleic acid claimed in claim 2.
4. imported the host cell of expression vector claimed in claim 3.
5. a detection means, it comprises:
Solid carrier, and
Be connected in the polypeptide claimed in claim 1 on this solid carrier.
6. detection means according to claim 5, wherein, described solid carrier is SJ modified silica-gel.
7. a detection kit, it comprises the detection means described in polypeptide claimed in claim 1 or claim 5 or 6.
8. resist the antibody of polypeptide claimed in claim 1.
9. polypeptide claimed in claim 1 is in the test kit for the preparation of detection type 1 diabetes or the purposes in detection means.
CN201310116438.1A 2013-04-03 2013-04-03 Polypeptide, and detection member and detection kit both containing same Pending CN104098673A (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
CN201310116438.1A CN104098673A (en) 2013-04-03 2013-04-03 Polypeptide, and detection member and detection kit both containing same

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
CN201310116438.1A CN104098673A (en) 2013-04-03 2013-04-03 Polypeptide, and detection member and detection kit both containing same

Publications (1)

Publication Number Publication Date
CN104098673A true CN104098673A (en) 2014-10-15

Family

ID=51667249

Family Applications (1)

Application Number Title Priority Date Filing Date
CN201310116438.1A Pending CN104098673A (en) 2013-04-03 2013-04-03 Polypeptide, and detection member and detection kit both containing same

Country Status (1)

Country Link
CN (1) CN104098673A (en)

Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102250242A (en) * 2002-11-18 2011-11-23 原子能委员会 Protein specific to pancreatic beta cells in islets of langerhans and applications thereof

Patent Citations (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
CN102250242A (en) * 2002-11-18 2011-11-23 原子能委员会 Protein specific to pancreatic beta cells in islets of langerhans and applications thereof

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DELLI,A.J.ET AL.,: "GenBank:NP_776250.2", 《GENBANK》, 30 December 2012 (2012-12-30) *
李树法等: "人锌转运蛋白8的HLA-A*0201限制性CTL表位的预测及初步验证", 《免疫学杂志》, 31 October 2012 (2012-10-31) *

Similar Documents

Publication Publication Date Title
CN103665138B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN104098677A (en) Polypeptide, and detection member and detection kit both containing same
CN104098685B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN104098674B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN103788199B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN103788195B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN104098667A (en) Polypeptide, and detection member and detection kit both containing same
CN103788183B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN104098686B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN103788200B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN104098684B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN104098680B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN103788198B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN103788194B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN103788201B (en) Polypeptide, the detection means comprising this polypeptide and detection kit
CN104098682A (en) Polypeptide, and detection member and detection kit both containing same
CN104098681A (en) Polypeptide, and detection member and detection kit both containing same
CN104098679A (en) Polypeptide, and detection member and detection kit both containing same
CN104098673A (en) Polypeptide, and detection member and detection kit both containing same
CN104098672A (en) Polypeptide, and detection member and detection kit both containing same
CN104098670A (en) Polypeptide, and detection member and detection kit both containing same
CN104098683A (en) Polypeptide, and detection member and detection kit both containing same
CN104098668A (en) Polypeptide, and detection member and detection kit both containing same
CN104098654A (en) Polypeptide, and detection member and detection kit both containing same
CN104098649A (en) Polypeptide, and detection member and detection kit both containing same

Legal Events

Date Code Title Description
C06 Publication
PB01 Publication
C10 Entry into substantive examination
SE01 Entry into force of request for substantive examination
WD01 Invention patent application deemed withdrawn after publication

Application publication date: 20141015

WD01 Invention patent application deemed withdrawn after publication