CN103614394B - Including 4041C > T sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof - Google Patents
Including 4041C > T sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof Download PDFInfo
- Publication number
- CN103614394B CN103614394B CN201310404388.7A CN201310404388A CN103614394B CN 103614394 B CN103614394 B CN 103614394B CN 201310404388 A CN201310404388 A CN 201310404388A CN 103614394 B CN103614394 B CN 103614394B
- Authority
- CN
- China
- Prior art keywords
- seq
- nucleic acid
- cyp2d6
- acid fragment
- nucleotide
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Landscapes
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention belongs to field of biology, relate to the single base mutation of the 4041st, CYP2D6 allele, described site is sported T by C.In particular it relates to the nucleic acid fragment comprising this mutational site and the protein fragments of corresponding encoded thereof, identify the application in the reagent in described mutational site, detection method and this site, particularly identify the application in direction of medication usage of this site.
Description
Technical field
The invention belongs to field of biology, relate to the single base mutation of the 4041st, CYP2D6 allele.More specifically,
The present invention relates to comprise the nucleic acid fragment in this mutational site and the protein fragments of corresponding encoded thereof, identify described mutational site
The application in direction of medication usage of this site of reagent, detection method and qualification.
Background technology
Cytochrome P 4502 D 6 (CYP2D6) is one of important member of CYP enzyme family.Its gene is positioned at No. 22 dyeing
On body, including 9 exons, full length gene 9432bp(GenBank number of registration M33388, exon 1 is positioned at 1620-5909
Position).In human body, the amount of this cytochrome only accounts for the 2%~4% of liver enzyme total amount, but participates in the generation of 20%~30% medicine clinically
Thanking, such medicine includes antidepressants, anti-arrhythmic, psychosis, analgesic, antitussive, Bendectin, anti-diabetic
Medicine and Bextra etc., study its metabolic polymorphism and have highly important clinical value (seeing list of references 1).
CYP2D6 gene has height polymorphism.So far, NCBI snp database has been included more than 300
Mutational site.Also more than 150 are had by the allele of CYP450 Intemational Nomenclature committee member name, the most multiple newfound
Saltant type is not yet named (http://www.cypalleles.ki.se/cyp2d6.htm).The different journey of each allele
Degree relate to point mutation, lack, insert, rearrangement etc., thus affect the activity of CYP2D6, and then the metabolic activity that impact is to medicine,
Produce drug influence in various degree.Remove outside wild type CYP2D6*1, the sudden change that research is more and clinical meaning is bigger at present
Type mainly includes following 7 kinds: CYP2D6*2, * 3, * 4, * 5, * 10, * 17, * 41, wherein ethnic group distribution is the widest, most study, in
The abundantest saltant type of state's crowd's research data is CYP2D6*2(2850C > T;4180G > C) and CYP2D6*10(100C >
T;4180G > C) (seeing list of references 1,2,3).
According to current clinical studies show, this polymorphism of CYP2D6 gene is to cause CYP2D6 enzymatic activity at individuality
Between the main cause of significant difference, carry the huge difference that can cause curative effect of medication between the individuality of different CYP2D6 genotype,
Even produce serious poisonous side effect of medicine or treat insufficient.Therefore, research CYP2D6 gene pleiomorphism is to curative effect of medication
Impact will provide important scientific basis (seeing list of references 3,4) to clinical rational drug use.
Summary of the invention
It is an object of the invention to provide the new single base mutation site of CYP2D6 gene, comprise the nucleic acid in this mutational site
Fragment, its coding protein fragments and identify the application in medication guide of this mutational site.
The first aspect of the invention is to provide nucleic acid fragment, and described nucleic acid fragment comprises corresponding to SEQ ID NO.1's
The mutational site of the 4041st, and be at least 10 continuous nucleotides in the nucleotide sequence shown in SEQ ID NO.1, wherein
The nucleotide of the 4041st is T;Or described nucleic acid fragment comprises the sudden change position of the 1318th corresponding to SEQ ID NO.2
Point, and be at least 10 continuous nucleotides in the nucleotide sequence shown in SEQ ID NO.2, the wherein nucleotide of the 1318th
It is T;Or the reverse complementary sequence that described nucleic acid fragment is above-mentioned nucleic acid fragment.
The second aspect of the invention is to provide and contains the 4041st corresponding to SEQ ID NO.1 or corresponding to SEQ
The equipotential that the allele fragment in the mutational site of the 1318th of ID NO.2 or its reverse complementary sequence completely or partially hybridize
Gene specific oligonucleotides, the wherein mutational site of the 1318th of the 4041st or SEQ ID NO.2 of SEQ ID NO.1
Nucleotide be T;Described allele fragment be in the nucleotide sequence shown in SEQ ID NO.1 or SEQ ID NO.2 extremely
Few 10 continuous nucleotides or its reverse complementary sequence.
The third aspect of the invention is to provide the test kit of the single base mutation for detecting and/or analyze the present invention,
Described test kit comprises nucleic acid fragment or the allele specific oligonucleotide of the present invention, or comprise can be as primer amplification
Described single base mutation but do not comprise the nucleic acid fragment of this list base;Described single base is corresponding to the 4041st of SEQ ID NO.1 the
Position or the 1318th of SEQ ID NO.2.
The fourth aspect of the invention is to provide the nucleic acid fragment of the present invention or oligonucleotide and dashes forward at detection CYP2D6 gene
Application in change, wherein said nucleic acid fragment or oligonucleotide are used as probe or primer;Or the nucleic acid fragment of the present invention or widow
Nucleotide is for preparing the application of the medicine of detection CYP2D6 gene mutation;Or the nucleic acid fragment of the present invention or oligonucleotide are used
Make the application of the check mark thing of detection CYP2D6 gene mutation.
The fifth aspect of the invention is to provide a kind of medication guide, including CYP2D6 gene right in detection testing sample
Should be in the single base mutation of the 1318th of the 4041st of SEQ ID NO.1 or SEQ ID NO.2;Prominent according to detect
Become, adjust by the dosage of the medicine of CYP2D6 metabolism.
The sixth aspect of the invention is to provide the method analyzing nucleic acid, and described method includes analyzing the bag in testing sample
Containing corresponding to the nucleic acid of the sequence of SEQ ID NO.1 corresponding to the nucleotide of the 4041st or analyzing comprising in testing sample
Corresponding to the nucleic acid of the sequence of SEQ ID NO.2 corresponds to the nucleotide of the 1318th.
The seventh aspect of the invention is to provide CYP2D6 albumen or its fragment or variant, and described protein sequence is SEQ
Sequence shown in ID NO.3;Described fragment or variant comprise the cysteine of the 440th corresponding to SEQ ID NO.3, and
And at least 10 continuous amino acids of the aminoacid sequence shown in SEQ ID NO.3.
The invention provides the CYP2D6 gene and coded sequence comprising new single base mutation.This gene is corresponding to
1318th nucleotide of SEQ ID NO.2 is sported T(1318C by C > T), thus cause its aminoacid encoded by arginine
Sport cysteine, i.e. corresponding to the cysteine of the 440th of SEQ ID NO.3.CYP2D6 albumen (the name of this sudden change
For R440C) metabolic activity reduction compared with wild type to medicine.This single base mutation is to carrying the individual of this mutational site
Medication has directive significance.
Accompanying drawing explanation
Fig. 1 is heterozygous carriers's Sequencing chromatogram of the SEQ ID NO.1 sequence corresponding to the present invention in embodiment 1,
Wherein arrow indication is the 4041st nucleotide of CYP2D6 gene;
Fig. 2 is the structural representation collection of illustrative plates of the double gene expression vector pIRES-Gluc-2D6 that embodiment 2 builds;
Fig. 3 is the CYP2D6.1(wild type shown in embodiment 2), CYP2D6.2(deficient mutants), CYP2D6.10
The R440C albumen of (deficient mutants) and the present invention for the metabolic capacity testing result of dextromethorphan and bufuralol, its
Middle * represents p value < 0.05;
Fig. 4 is the CYP2D6.1(wild type shown in embodiment 2), CYP2D6.2(deficient mutants), CYP2D6.10
The R440C albumen of (deficient mutants) and the present invention detects collection of illustrative plates for the typical LC-MS/MS of dextromethorphan metabolism;Arrow
Substrates dextromethorphan (right) and the signal peak of metabolite demethyl dextromethorphan (left) thereof it is respectively at indication;Wherein abscissa
Representing retention time, the retention time of dextromethorphan and demethyl dextromethorphan is respectively 7.5 and 4.8 minutes, and vertical coordinate represents
Signal response value cps;
Fig. 5 is the CYP2D6.1(wild type shown in embodiment 2), CYP2D6.2(deficient mutants), CYP2D6.10
The R440C albumen of (deficient mutants) and the present invention detects collection of illustrative plates for the typical LC-MS/MS of bufuralol metabolism;Arrow
Substrate bufuralol (right) and the signal peak of metabolite 1 '-hydroxyl bufuralol (left) thereof it is respectively at indication;The most horizontal seat
Mark represents retention time, and the retention time of bufuralol and 1 '-hydroxyl bufuralol is respectively 6.9 and 5.1 minutes, vertical coordinate table
Show signal response value cps.
Detailed description of the invention
By following detailed description of the invention, the present invention is described, but present invention is not limited to this.
As without other illustrate, " nucleic acid fragment " of the present invention is made up of nucleotide or its analog, can be DNA, RNA or
The fragment of its analog;Can be strand or double-strand;Can be natural (such as genome) or synthesis.
In the present invention, " sudden change " refers to the gene in detection, i.e. exist and wild type CYP2D6 gene sequence in CYP2D6 gene
Arrange different nucleotide sites." mutational site " refers to the position that base is undergone mutation.In the present invention, described mutational site is right
Should be in the 1318th in sequence shown in the 4041st of sequence shown in SEQ ID NO.1 or SEQ ID NO.2.
World P450 allele NK specifies about in CYP2D6 allele naming rule: with CYP2D6 base
Because of in group DNA reference sequences (GenBank number of registration M33388) first base A of start codon ATG as CYP2D6 etc.
1st the 1620th of M33388 sequence (first base A of start codon be positioned at) of position gene, then present invention determine that
Catastrophe point is positioned at allelic 4041st of CYP2D6 (SEQ ID NO.1).
Present invention relates to the nonsynonymous mutation of CYP2D6 gene.Owing to this mutational site is positioned at the coded sequence of gene
In, therefore, skilled person will appreciate that, described mutational site both can show in genomic DNA, it is also possible at code sequence
Performance in row (i.e. CDS).Those skilled in the art, can be to this on genomic DNA or mRNA level in-site according to detected sample
Mutational site is detected.In the application, SEQ ID NO.1 is that the regulation according to world P450 allele NK is fixed
The CYP2D6 allelic sequences of the present invention of justice, wherein the 4041st is the mutational site that the present invention relates to.SEQ ID NO.2
Being the cDNA sequence of the CYP2D6 gene with described mutational site, wherein the 1318th is the mutational site that the present invention relates to.
Skilled person will appreciate that, in this article, corresponding to the 4041st site of SEQ ID NO.1 with corresponding to SEQ ID
1318th the site synonym of NO.2 is used mutually.
In the present invention, " allele-specific " refers to hybridize, as carried out under high stringency conditions with allele specifically
Hybridization so that identify the 1318th corresponding to sequence shown in the 4041st or SEQ ID NO.2 of sequence shown in SEQ ID NO.1
Position nucleotide is T.
In the present invention, nucleotide and amino acid whose abbreviation use abbreviation mode well known in the art, as in nucleotide, A represents
Adenine, G represents that guanine, C represent that cytosine, T represent thymus pyrimidine.In aminoacid, A represents that alanine, R represent essence ammonia
Acid, N represents that agedoite, D represent that aspartic acid, C represent that cysteine, Q represent that glutamine, E represent that glutamic acid, G represent
Glycine, H represents that histidine, I represent that isoleucine, L represent that leucine, K represent that lysine, M represent that methionine, F represent benzene
Alanine, P represents that proline, S represent that serine, T represent that threonine, W represent that tryptophan, Y represent that tyrosine, V represent figured silk fabrics ammonia
Acid.
Present disclosure is new single base mutation site based on CYP2D6 gene.Described mutational site is in
In the coding region of CYP2D6 gene, corresponding to the 1318th of SEQ ID NO.2, this site is sported T by the C of wild type;This
Outward, cysteine (R440C) is sported by the 440th of the albumen of the CYP2D6 gene code of this sudden change by arginine.
At first aspect, the present invention provides nucleic acid fragment, described nucleic acid fragment to comprise corresponding to SEQ ID NO.1
The mutational site of 4041, and be at least 10 continuous nucleotides in the nucleotide sequence shown in SEQ ID NO.1, Qi Zhong
The nucleotide of 4041 is T;Or described nucleic acid fragment comprises the mutational site of the 1318th corresponding to SEQ ID NO.2,
And be at least 10 continuous nucleotides in the nucleotide sequence shown in SEQ ID NO.2, wherein the nucleotide of the 1318th is
T;Or it is the reverse complementary sequence of above-mentioned nucleic acid fragment.
In one embodiment, the length of described nucleic acid fragment can be such as 10-100,101-200,201-500 or
501-1000 nucleotide.Preferably, the length of described nucleic acid fragment is 10-20,21-30,31-40,41-50,51-60,61-
100 or 101-300 nucleotide.
Described mutational site may be located at any position of described nucleic acid fragment.
In another embodiment, described nucleic acid fragment is the sequence shown in SEQ ID NO.1.
In another embodiment, described nucleic acid fragment is the sequence shown in SEQ ID NO.2.
In other embodiments, described nucleic acid fragment can be the sequence shown in SEQ ID NO.14-18.
The second aspect of the invention is to provide and contains the 4041st corresponding to SEQ ID NO.1 or corresponding to SEQ
The equipotential that the allele fragment in the mutational site of the 1318th of ID NO.2 or its reverse complementary sequence completely or partially hybridize
Gene specific oligonucleotides, the wherein mutational site of the 1318th of the 4041st or SEQ ID NO.2 of SEQ ID NO.1
Nucleotide be T;Described allele fragment be in the nucleotide sequence shown in SEQ ID NO.1 or SEQ ID NO.2 extremely
Few 10 continuous nucleotides or its reverse complementary sequence.
In one embodiment, described oligonucleotide is used as probe.Described probe can under high stringency conditions with bag
Target sequence specific hybrid containing mutational site.It is known to those skilled in the art that described probe need not the most mutual with target sequence
Mend, as long as can be with target sequence specific hybridization.In preferred embodiments, described hybridization conditions can meet and makes probe only
With target sequence specific hybrid.The length of described probe can be 5-100 nucleotide, such as 5,6,7,8,9,10,11,12,13,
14、15、16、17、18、19、20、21、22、23、24、25、26、27、28、29、30、31、32、33、34、35、40、50、60、
70,80,90 or 100 nucleotide.Described mutational site can occur in any position of probe.Preferred embodiment
In, described mutational site occurs in center or the about center of probe sequence.
In another embodiment, the described oligonucleotide primer of the DNA synthesis that coaches, survey as known in the art
Sequence primer or synthetic primer etc..Described primer need not and template complete complementary, but it should with template Complementary hybridization to instruct DNA
Synthesis.The length of described primer can be 15-40 length of nucleotides, it is therefore preferable to 18,19,20,21,22,23,24,25,
26,27,28,29 or 30 nucleotide.Described mutational site can occur in any position of described primer;Preferably, described
Mutational site occurs in 3 ' ends of described primer.
Some preferred embodiment in, described oligonucleotide is the sequence as shown in SEQ ID NO.19-23.
Based on this, the third aspect of the invention is to provide the test kit for detecting and/or analyze single base mutation, institute
State nucleic acid fragment or allele specific oligonucleotide that test kit comprises the present invention, or comprise can be as primer amplification institute
State single base mutation but do not comprise the nucleic acid fragment of this list base;Described single base is corresponding to the 4041st of SEQ ID NO.1
Or the 1318th of SEQ ID NO.2.Preferably, described test kit comprise SEQ ID NO.6 and/or SEQ ID NO.7 and/
Or the sequence fragment shown in SEQ ID NO.13.
The fourth aspect of the invention is to provide the nucleic acid fragment of the present invention or oligonucleotide for detecting CYP2D6 gene
The application of sudden change, wherein said nucleic acid fragment or oligonucleotide are used as probe or primer;Or the nucleic acid fragment of the present invention or widow
Nucleotide is for preparing the application of the medicine of detection CYP2D6 gene mutation;Or the nucleic acid fragment of the present invention or oligonucleotide are used
Make the application of the check mark thing of detection CYP2D6 gene mutation.
The fifth aspect of the invention is to provide medication guide, including the corresponding to of CYP2D6 gene in detection testing sample
The 4041st of SEQ ID NO.1 or the base of the 1318th of SEQ ID NO.2.When the CYP2D6 gene detected is in correspondence
When the site of the 1318th of the 4041st or SEQ ID NO.2 of SEQ ID NO.1 is T, adjust warp accordingly
The dosage of the medicine of CYP2D6 metabolism.In the particular embodiment, when CYP2D6 gene is the 1318th of SEQ ID NO.2
Site when being T, the CYP2D6 proteinase activity of this gene code declines, therefore needs to adjust the giving of medicine through CYP2D6 metabolism
Dose, assigns dose as follows.
The heretofore described medicine through CYP2D6 metabolism includes: beta-blocker, Propranolol, metoprolol, alkene
Third Luo Er, bufuralol, timolol, bunitrolol, carvedilol, alprenolol, nebivolol;Anti-arrhythmic, English
Card amine, sparteine, flecainide, Propafenone, aprindine, mexiletine, encainide, procainamide;Antihypertensive, isoquinoline
Guanidine, indoramine;Antianginal, perhexiline, terodiline;Analgesic, tramadol;Anti-spirit medicine, chlorpromazine, perphenazine,
Haloperidol, risperidone, thioridazine, zuclopenthixol, Aripiprazole;Tricyclic antidepressant, amitriptyline, imipramine, chlorine
Imipramine, desipramine, nortriptyline;Other antidepressants, fluoxetine, paroxetine, venlafaxine, fluvoxamine, Ah rice
Husband's amine, mianserin, brofaromine, maprotiline, tomoxetine, amfetamine, citalopram, fluvoxamine, Minaprine, degree
Duloxetine, moclobemide;Medicine for the treatment of cough and asthma, dihydrocodeine, ethylmorphine, codeine, dextromethorphan;Antidiabetic drug, benzene
Second biguanide;Other, chlorphenamine, metoclopramide, atomoxetine, Isomeride, ondansetron, amphetamines, benefit card
Cause, ondansetron, phenacetin, triphen chloramines, dexfenfluramine, promethazine.
The sixth aspect of the invention is to provide the method analyzing nucleic acid, and described method includes analyzing the bag in testing sample
Containing corresponding to the nucleic acid of the sequence of SEQ ID NO.1 corresponding to the nucleotide of the 4041st or analyzing comprising in testing sample
Corresponding to the nucleic acid of the sequence of SEQ ID NO.2 corresponds to the nucleotide of the 1318th.
In one embodiment, described method can be restriction fragment length polymorphism analysis (RFLP).This area
Technical staff can be according to present invention contrived experiment with the 4041st 's in the nucleic acid of the sequence of analysis SEQ ID NO.1
Whether the nucleotide of the 1318th in the nucleic acid of the sequence of nucleotide or SEQ ID NO.2 is T.
In another embodiment, described method can be sequencing, including separating and measure from genomic DNA or
The nucleotide sequence of RNA, analyze wherein comprise in the nucleic acid of the sequence corresponding to SEQ ID NO.1 corresponding to the core of the 4041st
Thuja acid or in comprising the nucleic acid of the sequence corresponding to SEQ ID NO.2 whether be T corresponding to the nucleotide of the 1318th.Order-checking
Method can be any available sequence measurement known in the art.Sequencing primer can enter according to the general knowledge of those skilled in the art
Row design, as primer is designed in the upstream and downstream appropriate position in site to be detected, contains the fragment in this site to be measured with expanding packet, from
And judge the nucleotide in this site.The oligonucleotide of the present invention can also be used as primer sequence.
In another embodiment, described method is the method utilizing probe to hybridize, specifically identification and detection sample
In comprise in the nucleic acid of the sequence corresponding to SEQ ID NO.1 corresponding to the nucleotide of the 4041st or comprise corresponding to SEQ
In the nucleic acid of the sequence of ID NO.2, whether the nucleotide corresponding to the 1318th is T;The probe used in described method is this
Bright oligonucleotide.Such as, from testing sample, isolate nucleic acid, allow probe and specific target that may be present in nucleic acid
Probe is made to contact with nucleic acid under conditions of sequence hybridization;The hybridization that can be detected can be by using by detectable reagent labelling
The probe crossed realizes;Such as, maybe can be catalyzed with radiosiotope, fluorescent dye to be formed and can detect the enzyme of product and carry out labelling and visit
Pin.Label probe, it is all well known to those skilled in the art with whether label probe detection sample exists the method for target sequence
's.
In a kind of specific embodiment, it is provided that detect corresponding to SEQ ID NO.1 with Taqman probe SNP detection method
The method of nucleotide of the 4041st, including:
1) design primer comprises the PCR primer of corresponding to SEQ ID NO.1 the 4041st for specific amplification, simultaneously
Design two Taqman-MGB probes, be respectively directed to C and the T allele of corresponding to SEQ ID NO.1 the 4041st.
Design of primers principle is:
(1) choose should be at the conservative section of gene for sequence;
(2) avoid primer self or and primer between form 4 or more than 4 continuously pairings, it is to avoid primer self formation
Pili annulati card structure;
(3) primer length is at 18 to 24 nucleotide;
(4) Tm value is at 55-65 DEG C, and G/C content is at 40%-60%;
(5) the Tm value difference between primer avoids exceeding 2 DEG C;
(6) 3 ' ends of primer are avoided using base A, and 3 ' ends of primer avoid the occurrence of 3 or more than 3 consecutive identical alkali
Base;
(7) pcr amplified fragment length is at 50bp-150bp;
(8) last 5 nucleotide of prime end can not have more than G and C of 2.
Taqman MGB probe design principle is:
(1) 5 ' ends of probe avoid the occurrence of G;
(2) Tm value should be 65-67 DEG C;
(3) shorten Taqman MGB probe as far as possible, but probe length is no less than 13bp;
(4) avoid the occurrence of the base of repetition, especially G base, it is to avoid occur that the G of 4 or more than 4 repeats as far as possible
Existing;
(5) mutational site of probe is placed on as far as possible the place of middle 1/3.
Fluorophor can use FAM, VIC etc. to carry out two allele of labelling.
2) utilize above-mentioned primer and probe, sample to be tested is carried out real-time quantitative PCR.
PCR condition: 95 DEG C of denaturations enter 30 amplification cycles after 10 minutes: 92 DEG C of degeneration 12 seconds, 60 DEG C of annealing and prolonging
Stretch 1 minute (this stage detection fluorescence signal).
3) data analysis.
Analyzing experimental result, strong and weak according to two kinds of fluorescence of sample judges whether sample to be tested CYP2D6 gene exists
4041C > T suddenlys change.
In the present invention, described sample can be any sample comprising nucleic acid, such as blood;The most described sample comes from
People.Described nucleic acid can be DNA or coding RNA, preferably genomic DNA.The method analyzing nucleic acid of the present invention can be with DNA
Or RNA is object.Skilled person will appreciate that, when with DNA for detection object, comprising in analysis testing sample is right
Should be corresponding to the nucleotide of the 4041st in the nucleic acid of the sequence of SEQ ID NO.1, the probe used or primer are according to SEQ
The sequential design of ID NO.1;When with RNA for detection object, analyze comprising corresponding to SEQ ID NO.2 in testing sample
Sequence nucleic acid in corresponding to the nucleotide of the 1318th, the probe used or primer according to the sequence of SEQ ID NO.2
Design.
The seventh aspect of the invention is to provide CYP2D6 albumen or its fragment or variant, and described protein sequence is SEQ
Sequence shown in ID NO.3;Described fragment or variant comprise the cysteine of the 440th corresponding to SEQ ID NO.3, and
For at least 10 continuous amino acids of the aminoacid sequence shown in SEQ ID NO.3, such as 10-20,21-50 or 51-100 amino
Acid.
The present invention will be further illustrated by specific embodiment below, but embodiment in detail below will be merely for exemplary
Purpose.
Embodiment 1: the qualification in the mutational site that people's CYP2D6 gene is new
In the present embodiment, gathering Normal Occlusion of Han People healthy population blood sample, extract the genomic DNA in blood, design is surveyed
Sequence primer carries out sequence amplification, order-checking to 9 exons of CYP2D6 gene, analyzes whether its CYP2D6 gene exists sudden change position
Point.
1) DNA is extracted:
5ml vein EDTA anticoagulated blood sample is taked from measured;Then according to common salting out method and/or employing are special
DNA extraction kit (purchased from the DNA extraction kit of Omega company of the U.S.) extract the genomic DNA of blood sample to be measured.
2) PCR amplification:
9 exon sequences of CYP2D6 gene in the genome DNA sample obtained are expanded by design amplimer
Increase.Described amplimer is shown in Table 1 to sequence.
Use 30 μ L PCR reaction systems, including: 1 × GC PCR buffer, 1.5mM MgCl2, the genome of 100ng
DNA, upstream and downstream primer be 0.2 μM, dNTP be the LATaqDNA polymerase 1.5U of 0.2mM, TaKaRa company.Use the U.S.
The GeneAmp PCR System9700 amplification instrument amplification of ABI company.PCR amplification cycles parameter is as follows: 94 DEG C of denaturations 2 points
Clock, 94 DEG C of degeneration 30 seconds, anneal 30 seconds for 60 DEG C, 68 DEG C extend 3 minutes, re-extend 3 minutes after 35 circulations.Primer sequence information
It is shown in Table 1.
Table 1: amplimer is to sequence information
3) purification amplified production:
By the amplified production of acquisition according to MultiScreen HTSTMThe use of test kit (Millipore company of the U.S.) is said
Bright, the DNA carrying out purpose band reclaims purification.
4) order-checking:
With the product after recovery as template, use sequencing primer according to BigDye Terminator v3.1 sequencing kit
(American AB I company) operation instruction carries out PCR reaction of checking order, and reaction terminates rear purification amplified production, uses American AB I company
Prism3730XL type gene sequencer carries out separating with the sequence of interpretation amplified production.Sequencing primer sequence information is shown in Table 2.
Table 2: sequencing primer sequence information table
Region | Sequencing primer (5 '-3 ') |
Exons 1 | AGGAAGCAGGGGCAAGAAC(SEQ ID NO.8) |
Exon 2 | CGCCCTCTCTGCCCAGC(SEQ ID NO.9) |
Wai Xianzi3 &4 | TTGGAGTGGGTGGTGGA(SEQ ID NO.10) |
Exon 5&6 | AGGARGTYAGGCTTACAGGA(SEQ ID NO.11) |
Exon 7 | GCACAGGCTTGACCAGGAT(SEQ ID NO.12) |
Exon 8&9 | TGTTTGGTGGCAGGGGTCC(SEQ ID NO.13) |
5) data analysis:
The sequence recorded is compared with wild type CYP2D6*1 sequence (GenBank number of registration M33388).
Analyzed by comparison, find 2129 example experimenters have the CYP2D6 genomic DNA of 1 people carry a kind of brand-new dashing forward
Becoming type, the nucleotide of allelic 4041st corresponding of CYP2D6 is become T(from C as it is shown in figure 1, wherein Y represents C and T
Heterozygosis).This sudden change is positioned at the 9th exon of CYP2D6 gene, and catastrophe point is positioned at cDNA the 1318th, and inferring accordingly should
In the protein of CYP2D6 gene code, the 440th amino acids is sported cysteine (C) by arginine (R).
The present embodiment exemplarily gives the method identifying new mutation site.Those skilled in the art are according to foregoing
Can clearly learn and specifically detect the side comprising the 4041st nucleotide corresponding to SEQ ID NO.1 in testing sample
Method: separating the nucleic acid in sample, carry out amplified reaction under experiment condition corresponding in the present embodiment, primer uses primer pair
SEQ ID NO.6 and 7;With sequencing primer SEQ ID NO.13, the product of amplification is checked order;By sequencing result and wild type
Result comparison, analyzes the nucleotide in the 4041st site corresponding to SEQ ID NO.1.
Embodiment 2: vitro enzyme metabolic activity is analyzed
According to existing result of study, wild type (* 1 type) is the highest to the metabolic activity of various medicines, and * 2 types
Metabolic activity is decreased obviously than the metabolic activity of wild type, and the metabolic activity of * 10 types is lower than * 2 types (seeing document 6,7).
Therefore, the most such a is known together: the metabolic activity to specific substrate of the enzyme expressed by same genotype
The metabolic activity to other substrate medicine can be represented.Thus, according to the enzyme expressed by a certain genotype to specific substrate metabolism
Activity data can analogize the enzyme expressed by this genotype (e.g., can be by this genotype institute to the metabolic activity of other substrate medicine
The metabolic activity of the enzyme expressed compares with the metabolic activity of the enzyme expressed by wild type).
In the present embodiment, according to above-mentioned mutational site, with wild type CYP2D6(*1) gene as template, rite-directed mutagenesis
The nucleotide (being become T from C) of the 1318th of CYP2D6 gene coding region, construction expression saltant type CYP2D6 albumen
(R440C) expression vector, after transfection 293FT cell, adds CYP2D6 Specific probe dextromethorphan and fourth furan
Luo Er, after hatching, detects the In vitro metabolism activity of this saltant type CYP2D6 albumen by analysis substrate and metabolite amount,
To judge compared with wild type CYP2D6.1, whether its enzymatic metabolism activity changes.This experimental design be similar to we
The external medicine of CYP2C9 new mutant is for operating procedure during activity analysis, and its science is by International Pharmaceutical genomics field
The most authoritative magazine Pharmacogenomics J approves (see reference document 5).
1) vivoexpression of CYP2D6 variant
To comprise wild type CYP2D6(*1) plasmid vector of full-length cDNA (buy from Thermo Scientific company)
For template, side-directed mutagenesis is utilized to obtain the cDNA of R440C mutant of CYP2D6*2, CYP2D6*10 and the present invention respectively.
Side-directed mutagenesis is techniques well known, and those skilled in the art, can be beyond all doubt according to the template determined and target
Known how this step.By glimmering to each genes of interest correct for sequence after testing and reference gene Gluc(secreting type
Light element enzyme, its translation product can be secreted in culture medium, and fluorescence signal detected by particular agent box;Its skeleton carrier is
PIRES pGluc-Basic, purchased from NEB company, article No. N8082S) it is respectively connecting to double gene expression vector pIRES(and is purchased from
Clontech company, article No. 631605) A, B multiple clone site in, make a kind of genes of interest and reference gene be positioned at same CMV
Under promoter controls, Fig. 2 is shown in by the final double gene expression vector pIRES-Gluc-2D6(structural representation collection of illustrative plates that obtains).Build respectively
Including CYP2D6(*1) cDNA of the R440C mutant of cDNA, CYP2D6*2cDNA, CYP2D6*10cDNA and the present invention four
Plant CYP2D6 double gene expression vector.
By 5 × 105Individual 293FT cell (people's renal epithelial cell is originated, purchased from Invitrogen company) is uniformly laid on 6 holes
Plate;After incubated overnight, utilize liposome lip2000(Invitrogen company) transfect 2 μ g plasmid vector pIRES-Gluc-2D6,
To express various destination protein CYP2D6 and internal reference Protein G luc.Carry out western hybridization check after transfection 24h, determine above-mentioned
Four kinds of destination proteins are the most correctly expressed.
Cell is cultivated and liposome transfection is techniques well known, the illustration method provided with reference to Invitrogen company
Just can carry out.
2) living cells incubated in vitro probe medicament
Continue to cultivate after 24 hours, by single hole cell dissociation in 6 orifice plates and resuspended (use EP pipe to 300 μ l culture medium
Carry out).Two kinds of CYP2D6 classics probe medicine dextromethorphans (buying from Sigma Co., USA) and bufuralol is used (to buy certainly
Toronto Research Chemicals company of Canada) detect the activity of this enzyme, the final concentration of two kinds of medicines is respectively 20 μ
M and 10 μMs.At 37 DEG C, at 5%CO2In incubator, 3h is hatched in 300rpm concussion.From CO2Incubator takes out culture, adds
The 0.1MNaOH of 20 μ L also shakes vortex 1min(reason and is bufuralol and dextromethorphan is all weak base, and solution NaOH alkalizes
After will exist with molecular conformation, in next step extraction process, be easily accessible organic facies thus be extracted out).Add 800 μ L
Glacial acetic acid ethyl ester, concussion vortex 2min is placed on-40 DEG C of refrigerator 30min, until lower floor's frost.Take out sample, at 4 DEG C, with
12000g is centrifuged 10min.Upper strata ethyl acetate is transferred in new EP pipe, ethyl acetate is dried up by 37 DEG C of Nitrogen evaporators.
Add 200 μ L each initial flow phase solution to redissolve, after concussion vortex 1min, be centrifuged 5min with 12000g.Supernatant uses initial flow
Dynamic phase solution is transferred in sample injection bottle after diluting by 1:10.
3) LC-MS/MS detection
After abstraction purification, sample carries out LC-MS/MS detection on 1260-6410 type instrument (Agilent company of the U.S.),
HPLC uses ZORBAX SB-C18 post (150mm × 4.6mm, diameter 5 μm).
Dextromethorphan testing conditions:
Chromatographic condition
Column temperature: 30 DEG C
Chromatographic column: ZORBAX SB-C18 (Agilent, 5 μm, 4.6 × 150mm)
Sampling volume: 2 μ L
Flow velocity: 0.6mL/min
Operation time: 8min
Table 3: dextromethorphan mobile phase ratio
Time (min) | 10mM ammonium acetate (%, v/v) | Methanol (%, v/v) |
0.01 | 40 | 60 |
0.5 | 5 | 95 |
4 | 5 | 95 |
4.01 | 40 | 60 |
8 | 40 | 60 |
Mass Spectrometry Conditions:
Electron spray (ESI) ion source (cation), many reaction detection scanning (MRM) pattern;
Ionogenic temperature (TEM): 300 DEG C;
Curtain gas speed: 11L/min;
Capillary voltage: 4000V;
Dextromethorphan Q1/Q3:272.2/213.1;272.2/147.1;
Impact energy=30;
Parent ion fragmentation voltage=140;
Demethyl dextromethorphan Q1/Q3:258.2-157.1;258.2-133.1;
Impact energy=35;
Parent ion fragmentation voltage=135.
Bufuralol testing conditions:
Chromatographic condition:
Column temperature: 30 DEG C
Chromatographic column: ZORBAX SB-C18 (Agilent, 5 μm, 4.6 × 150mm)
Sampling volume: 1 μ L
Flow velocity: 0.6mL/min
Operation time: 10min
Table 4: bufuralol mobile phase ratio
Time (min) | 10mM ammonium acetate (%, v/v) | Methanol (%, v/v) |
0.01 | 30 | 70 |
0.8 | 5 | 95 |
3 | 5 | 95 |
4.01 | 30 | 70 |
10 | 30 | 70 |
Mass Spectrometry Conditions:
Electron spray (ESI) ion source (cation), many reaction detection scanning (MRM) pattern;
Ionogenic temperature (TEM): 350 DEG C;
Curtain gas speed: 11L/min;
Capillary voltage: 4000V;
Bufuralol Q1/Q3:262.2/188.1;268.2/186.1;
Impact energy=10;
Parent ion fragmentation voltage=110;
1 '-hydroxyl bufuralol Q1/Q3:278.2/186.1;278.2/159.1;
Impact energy=15;
Parent ion fragmentation voltage=90.
4) LC-MS/MS detects data analysis
The different dextromethorphan of gradient concentration of preparation, bufuralol and corresponding metabolite demethyl dextromethorphan, 1 '-hydroxyl
Base bufuralol (dextromethorphan: 2500,1250,500,250,100,20ng/mL;1500,750 demethyl dextromethorphan:,
300、150、50、25ng/mL;Bufuralol: 1000,500,250,100,50,25ng/mL;1 '-hydroxyl bufuralol: 800,
400,200,100,50,25ng/mL), generate standard curve after utilizing LC-MS detection, and in order to detect various CYP2D6 albumen
To dextromethorphan and the metabolic condition of bufuralol, then represent the metabolism of this probe medicine with [product/(product+substrate)]
Rate, after internal reference Gluc data calibration, represents saltant type egg with the ratio of the metabolic rate of saltant type Yu the metabolic rate of wild type
White enzymatic activity.Every kind of albumen is tested for the In vitro metabolism of different probe medicine and is repeated 4 times respectively, adds up after averaging
Result is shown in Table 5 respectively, table 6 and Fig. 3;The typical Mass Spectrometer Method result of dextromethorphan and bufuralol is shown in Fig. 4, figure by various albumen
5.The metabolic capacity of CYP2D6 variant is the strongest, and the peak area at substrate (dextromethorphan or bufuralol) peak will be the least, and produces
The peak area at thing (demethyl dextromethorphan or 1 '-hydroxyl bufuralol) peak will be the biggest, it can be seen that new variant
The metabolic capacity of R440C substantially relatively wild type reduces, again smaller than typical case mutant CYP2D6.2 and CYP2D6.10.
The enzymatic activity result of table 5:293FT cell incubation probe medicament dextromethorphan
* refer to and the relative value of wild type CYP2D6.1
* p value < 0.05
The enzymatic activity result of table 6:293FT cell incubation probe medicament bufuralol
* refer to and the relative value of wild type CYP2D6.1
* p value < 0.05
Testing result shows, relative to wild type CYP2D6.1 type, it is known that typical defect type mutant CYP2D6.2 is to the right side
The metabolic activity of dromethan declines inconspicuous (fall about 5%), but the generation to another probe medicament bufuralol
Thanking to activity to be decreased obviously, fall is about 16%;Another typical defect type mutant CYP2D6.10 is for two kinds of probes
The metabolic activity of medicine is all decreased obviously (reduction amplitude is about 90%), and this result is basically identical with existing document, shows us
Vitro detection system obtain data there is the highest credibility (seeing list of references 6,7).
Utilize this vitro detection system it can be seen that R440C mutant is to probe medicament dextromethorphan and bufuralol
Metabolic activity is respectively the 5.39% and 1.34% of wild type.Statistical analysis shows, compared with wild type, R440C mutant
Metabolic activity declines, and has significant difference, and the metabolic activity pointing out this sudden change can cause expressed enzyme substantially reduces.Cause
This, in practice, need to consider suitably to regulate the individuality carrying this genotype on dosage, as reduced medicine
Usage amount and the generation avoiding adverse effect.This medicine by gene targeting adjusts the medicine bigger for individual variation
Thing (such as imipramine, amitriptyline etc.) is even more important.
List of references
1.Zhou SF.Polymorphism of Human Cytochrome P450 2D6 and Its Clinical
Significance:Part I.Clinical Pharmacokinetics.2009,48(11):689-723.
2.Qin S,Shen L,Zhang A,et al.Systematic polymorphism analysis of the
CYP2D6gene in four different geographical Han populations in mainland
China.Genomics.2008,92(3):152-158.
3.ZHOU SF.Polymorphism of Human Cytochrome P4502D6and Its Clinical
Significance Part II.Clinical pharmacokinetics.2009,48(12):761-804.
4. Xu Yan spoils, and Gong Sen, Ji Hongyan wait .CYP2D6 gene pleiomorphism and clinical meaning thereof. medicine Leader .2012,31
(10):1337-1340.
5.Dai DP,Xu RA,Hu LM,Wang SH,Geng PW,Yang JF,et al.CYP2C9polymorphism
analysis in Han Chinese populations:building the largest allele frequency
database.Pharmacogenomics J.2013,DOI:10.1038/tpj.2013.2.
6.Wennerholm A,Johansson I,Hidestrand M,Bertilsson L,Gustafsson LL,
Ingelman-Sundberg M.Characterization of the CYP2D6*29allele commonly present
in a black Tanzanian population causing reduced catalytic
activity.Pharmacogenetics2001,11:417-427.
7.Sakuyama K,Sasaki T,Ujiie S,Obata K,Mizugaki M,Ishikawa M et
al.Functional characterization of17CYP2D6allelic variants(CYP2D6.2,10,14A-B,
18,27,36,39,47-51,53-55,and57).Drug Metab Dispos.2008,36:2460-2467.
Sequence:
SEQ ID NO.1: allelic sequences
ATGGGGCTAGAAGCACTGGTGCCCCTGGCCGTGATAGTGGCCATCTTCCTGCTCC
TGGTGGACCTGATGCACCGGCGCCAACGCTGGGCTGCACGCTACCCACCAGGCCCCCTGCCACTGCCCGGGCTGGGC
AACCTGCTGCATGTGGACTTCCAGAACACACCATACTGCTTCGACCAGGTGAGGGAGGAGGTCCTGGAGGGCGGCAG
AGGTGCTGAGGCTCCCCTACCAGAAGCAAACATGGATGGTGGGTGAAACCACAGGCTGGACCAGAAGCCAGGCTGAG
AAGGGGAAGCAGGTTTGGGGGACGTCCTGGAGAAGGGCATTTATACATGGCATGAAGGACTGGATTTTCCAAAGGCC
AAGGAAGAGTAGGGCAAGGGCCTGGAGGTGGAGCTGGACTTGGCAGTGGGCATGCAAGCCCATTGGGCAACATATGT
TATGGAGTACAAAGTCCCTTCTGCTGACACCAGAAGGAAAGGCCTTGGGAATGGAAGATGAGTTAGTCCTGAGTGCC
GTTTAAATCACGAAATCGAGGATGAAGGGGGTGCAGTGACCCGGTTCAAACCTTTTGCACTGTGGGTCCTCGGGCCT
CACTGCCTCACCGGCATGGACCATCATCTGGGAATGGGATGCTAACTGGGGCCTCTCGGCAATTTTGGTGACTCTTG
CAAGGTCATACCTGGGTGACGCATCCAAACTGAGTTCCTCCATCACAGAAGGTGTGACCCCCACCCCCGCCCCACGA
TCAGGAGGCTGGGTCTCCTCCTTCCACCTGCTCACTCCTGGTAGCCCCGGGGGTCGTCCAAGGTTCAAATAGGACTA
GGACCTGTAGTCTGGGGTGATCCTGGCTTGACAAGAGGCCCTGACCCTCCCTCTGCAGTTGCGGCGCCGCTTCGGGG
ACGTGTTCAGCCTGCAGCTGGCCTGGACGCCGGTGGTCGTGCTCAATGGGCTGGCGGCCGTGCGCGAGGCGCTGGTG
ACCCACGGCGAGGACACCGCCGACCGCCCGCCTGTGCCCATCACCCAGATCCTGGGTTTCGGGCCGCGTTCCCAAGG
CAAGCAGCGGTGGGGACAGAGACAGATTTCCGTGGGACCCGGGTGGGTGATGACCGTAGTCCGAGCTGGGCAGAGAG
GGCGCGGGGTCGTGGACATGAAACAGGCCAGCGAGTGGGGACAGCGGGCCAAGAAACCACCTGCACTAGGGAGGTGT
GAGCATGGGGACGAGGGCGGGGCTTGTGACGAGTGGGCGGGGCCACTGCCGAGACCTGGCAGGAGCCCAATGGGTGA
GCGTGGCGCATTTCCCAGCTGGAATCCGGTGTCGAAGTGGGGGCGGGGACCGCACCTGTGCTGTAAGCTCAGTGTGG
GTGGCGCGGGGCCCGCGGGGTCTTCCCTGAGTGCAAAGGCGGTCAGGGTGGGCAGAGACGAGGTGGGGCAAAGCCTG
CCCCAGCCAAGGGAGCAAGGTGGATGCACAAAGAGTGGGCCCTGTGACCAGCTGGACAGAGCCAGGGACTGCGGGAG
ACCAGGGGGAGCATAGGGTTGGAGTGGGTGGTGGATGGTGGGGCTAATGCCTTCATGGCCACGCGCACGTGCCCGTC
CCACCCCCAGGGGTGTTCCTGGCGCGCTATGGGCCCGCGTGGCGCGAGCAGAGGCGCTTCTCCGTGTCCACCTTGCG
CAACTTGGGCCTGGGCAAGAAGTCGCTGGAGCAGTGGGTGACCGAGGAGGCCGCCTGCCTTTGTGCCGCCTTCGCCA
ACCACTCCGGTGGGTGATGGGCAGAAGGGCACAAAGCGGGAACTGGGAAGGCGGGGGACGGGGAAGGCGACCCCTTA
CCCGCATCTCCCACCCCCAGGACGCCCCTTTCGCCCCAACGGTCTCTTGGACAAAGCCGTGAGCAACGTGATCGCCT
CCCTCACCTGCGGGCGCCGCTTCGAGTACGACGACCCTCGCTTCCTCAGGCTGCTGGACCTAGCTCAGGAGGGACTG
AAGGAGGAGTCGGGCTTTCTGCGCGAGGTGCGGAGCGAGAGACCGAGGAGTCTCTGCAGGGCGAGCTCCCGAGAGGT
GCCGGGGCTGGACTGGGGCCTCGGAAGAGCAGGATTTGCATAGA
TGGGTTTGGGAAAGGACATTCCAGGAGACCCCACTGTAAGAAGGGCCTGGAGGAGGAGGGGACATCTCAGACATGGT
CGTGGGAGAGGTGTGCCCGGGTCAGGGGGCACCAGGAGAGGCCAAGGACTCTGTACCTCCTATCCACGTCAGAGATT
TCGATTTTAGGTTTCTCCTCTGGGCAAGGAGAGAGGGTGGAGGCTGGCACTTGGGGAGGGACTTGGTGAGGTCAGTG
GTAAGGACAGGCAGGCCCTGGGTCTACCTGGAGATGGCTGGGGCCTGAGACTTGTCCAGGTGAACGCAGAGCACAGG
AGGGATTGAGACCCCGTTCTGTCTGGTGTAGGTGCTGAATGCTGTCCCCGTCCTCCTGCATATCCCAGCGCTGGCTG
GCAAGGTCCTACGCTTCCAAAAGGCTTTCCTGACCCAGCTGGATGAGCTGCTAACTGAGCACAGGATGACCTGGGAC
CCAGCCCAGCCCCCCCGAGACCTGACTGAGGCCTTCCTGGCAGAGATGGAGAAGGTGAGAGTGGCTGCCACGGTGGG
GGGCAAGGGTGGTGGGTTGAGCGTCCCAGGAGGAATGAGGGGAGGCTGGGCAAAAGGTTGGACCAGTGCATCACCCG
GCGAGCCGCATCTGGGCTGACAGGTGCAGAATTGGAGGTCATTTGGGGGCTACCCCGTTCTGTCCCGAGTATGCTCT
CGGCCCTGCTCAGGCCAAGGGGAACCCTGAGAGCAGCTTCAATGATGAGAACCTGCGCATAGTGGTGGCTGACCTGT
TCTCTGCCGGGATGGTGACCACCTCGACCACGCTGGCCTGGGGCCTCCTGCTCATGATCCTACATCCGGATGTGCAG
CGTGAGCCCATCTGGGAAACAGTGCAGGGGCCGAGGGAGGAAGGGTACAGGCGGGGGCCCATGAACTTTGCTGGGAC
ACCCGGGGCTCCAAGCACAGGCTTGACCAGGATCCTGTAAGCCTGACCTCCTCCAACATAGGAGGCAAGAAGGAGTG
TCAGGGCCGGACCCCCTGGGTGCTGACCCATTGTGGGGACGCATGTCTGTCCAGGCCGTGTCCAACAGGAGATCGAC
GACGTGATAGGGCAGGTGCGGCGACCAGAGATGGGTGACCAGGCTCACATGCCCTACACCACTGCCGTGATTCATGA
GGTGCAGCGCTTTGGGGACATCGTCCCCCTGGGTGTGACCCATATGACATCCCGTGACATCGAAGTACAGGGCTTCC
GCATCCCTAAGGTAGGCCTGGCGCCCTCCTCACCCCAGCTCAGCACCAGCACCTGGTGATAGCCCCAGCATGGCTAC
TGCCAGGTGGGCCCACTCTAGGAACCCTGGCCACCTAGTCCTCAATGCCACCACACTGACTGTCCCCACTTGGGTGG
GGGGTCCAGAGTATAGGCAGGGCTGGCCTGTCCATCCAGAGCCCCCGTCTAGTGGGGAGACAAACCAGGACCTGCCA
GAATGTTGGAGGACCCAACGCCTGCAGGGAGAGGGGGCAGTGTGGGTGCCTCTGAGAGGTGTGACTGCGCCCTGCTG
TGGGGTCGGAGAGGGTACTGTGGAGCTTCTCGGGCGCAGGACTAGTTGACAGAGTCCAGCTGTGTGCCAGGCAGTGT
GTGTCCCCCGTGTGTTTGGTGGCAGGGGTCCCAGCATCCTAGAGTCCAGTCCCCACTCTCACCCTGCATCTCCTGCC
CAGGGAACGACACTCATCACCAACCTGTCATCGGTGCTGAAGGATGAGGCCGTCTGGGAGAAGCCCTTCCGCTTCCA
CCCCGAACACTTCCTGGATGCCCAGGGCCACTTTGTGAAGCCGGAGGCCTTCCTGCCTTTCTCAGCAGGTGCCTGTG
GGGAGCCCGGCTCCCTGTCCCCTTCCGTGGAGTCTTGCAGGGGTATCACCCAGGAGCCAGGCTCACTGACGCCCCTC
CCCTCCCCACAGGCTGCCGTGCATGCCTCGGGGAGCCCCTGGCCCGCATGGAGCTCTTCCTCTTCTTCACCTCCCTG
CTGCAGCACTTCAGCTTCTCGGTGCCCACTGGACAGCCCCGGCCCAGCCACCATGGT
GTCTTTGCTTTCCTGGTGAGCCCATCCCCCTATGAGCTTTGTGCTGTGCCCCGCTAG
SEQ ID NO.2: coded sequence
ATGGGGCTAGAAGCACTGGTGCCCCTGGCCGTGATAGTGGCCATCTTCCTGCTCCTGGTGGACCTGATGCACCGGCG
CCAACGCTGGGCTGCACGCTACCCACCAGGCCCCCTGCCACTGCCCGGGCTGGGCAACCTGCTGCATGTGGACTTCC
AGAACACACCATACTGCTTCGACCAGTTGCGGCGCCGCTTCGGGGACGTGTTCAGCCTGCAGCTGGCCTGGACGCCG
GTGGTCGTGCTCAATGGGCTGGCGGCCGTGCGCGAGGCGCTGGTGACCCACGGCGAGGACACCGCCGACCGCCCGCC
TGTGCCCATCACCCAGATCCTGGGTTTCGGGCCGCGTTCCCAAGGGGTGTTCCTGGCGCGCTATGGGCCCGCGTGGC
GCGAGCAGAGGCGCTTCTCCGTGTCCACCTTGCGCAACTTGGGCCTGGGCAAGAAGTCGCTGGAGCAGTGGGTGACC
GAGGAGGCCGCCTGCCTTTGTGCCGCCTTCGCCAACCACTCCGGACGCCCCTTTCGCCCCAACGGTCTCTTGGACAA
AGCCGTGAGCAACGTGATCGCCTCCCTCACCTGCGGGCGCCGCTTCGAGTACGACGACCCTCGCTTCCTCAGGCTGC
TGGACCTAGCTCAGGAGGGACTGAAGGAGGAGTCGGGCTTTCTGCGCGAGGTGCTGAATGCTGTCCCCGTCCTCCTG
CATATCCCAGCGCTGGCTGGCAAGGTCCTACGCTTCCAAAAGGCTTTCCTGACCCAGCTGGATGAGCTGCTAACTGA
GCACAGGATGACCTGGGACCCAGCCCAGCCCCCCCGAGACCTGACTGAGGCCTTCCTGGCAGAGATGGAGAAGGCCA
AGGGGAACCCTGAGAGCAGCTTCAATGATGAGAACCTGCGCATAGTGGTGGCTGACCTGTTCTCTGCCGGGATGGTG
ACCACCTCGACCACGCTGGCCTGGGGCCTCCTGCTCATGATCCTACATCCGGATGTGCAGCGCCGTGTCCAACAGGA
GATCGACGACGTGATAGGGCAGGTGCGGCGACCAGAGATGGGTGACCAGGCTCACATGCCCTACACCACTGCCGTGA
TTCATGAGGTGCAGCGCTTTGGGGACATCGTCCCCCTGGGTGTGACCCATATGACATCCCGTGACATCGAAGTACAG
GGCTTCCGCATCCCTAAGGGAACGACACTCATCACCAACCTGTCATCGGTGCTGAAGGATGAGGCCGTCTGGGAGAA
GCCCTTCCGCTTCCACCCCGAACACTTCCTGGATGCCCAGGGCCACTTTGTGAAGCCGGAGGCCTTCCTGCCTTTCT
CAGCAGGCTGCCGTGCATGCCTCGGGGAGCCCCTGGCCCGCATGGAGCTCTTCCTCTTCTTCACCTCCCTGCTGCAG
CACTTCAGCTTCTCGGTGCCCACTGGACAGCCCCGGCCCAGCCACCATGGTGTCTTTGCTTTCCTGGTGAGCCCATC
CCCCTATGAGCTTTGTGCTGTGCCCCGCTAG
SEQ ID NO.3: protein sequence
MGLEALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTP
VVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGVFLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVT
EEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFEYDDPRFLRLLDLAQEGLKEESGFLREVLNAVPVLL
HIPALAGKVLRFQKAFLTQLDELLTEHRMTWDPAQPPRDLTEAFLAEMEKAKGNPESSFNDENLRIVVADLFSAGMV
TTSTTLAWGLLLMILHPDVQRRVQQEIDDVIGQVRRPEMGDQAHMPY
TTAVIHEVQRFGDIVPLGVTHMTSRDIEVQGFRIPKGTTLITNLSSVLKDEAVWEKPFRFHPEHFLDAQGHFVKPEA
FLPFSAGCRACLGEPLARMELFLFFTSLLQHFSFSVPTGQPRPSHHGVFAFLVSPSPYELCAVPR
SEQ ID NO.14: nucleic acid fragment
CCCACAGGCTGCCGTGCATG
SEQ ID NO.15: nucleic acid fragment
CCCTCCCCACAGGCTGCCGTGCATGCCTCG
SEQ ID NO.16: nucleic acid fragment
CCCTCCCCTCCCCACAGGCTGCCGTGCATGCCTCGGGGAG
SEQ ID NO.17: nucleic acid fragment
GACGCCCCTCCCCTCCCCACAGGCTGCCGTGCATGCCTCGGGGAGCCCCT
SEQ ID NO.18: nucleic acid fragment
CTCCCCACAGGCTGCCGTGC
SEQ ID NO.19: oligonucleotide fragment
CGAGGCATGCACGGCAG
SEQ ID NO.20: oligonucleotide fragment
CTCCCCGAGGCATGCACGGCAG
SEQ ID NO.21: oligonucleotide fragment
GCACGGCAGCCTGTG
SEQ ID NO.22: oligonucleotide fragment
ATGCACGGCAGCCTGTGGG
SEQ ID NO.23: oligonucleotide fragment
GGCATGCACGGCAGCCTGTGGGGAG
Claims (7)
1. nucleic acid fragment, described nucleic acid fragment comprises the mutational site of the 4041st corresponding to SEQ ID NO.1, and is SEQ
At least 10 continuous nucleotides in nucleotide sequence shown in ID NO.1 or its reverse complementary sequence, wherein the 4041st
Nucleotide is T;Or described nucleic acid fragment comprises the mutational site of the 1318th corresponding to SEQ ID NO.2, and is SEQ
At least 10 continuous nucleotides in nucleotide sequence shown in ID NO.2 or its reverse complementary sequence, wherein the 1318th
Nucleotide is T.
Nucleic acid fragment the most according to claim 1, it is characterised in that the length of described nucleic acid fragment is 10-100,101-
200,201-500 or 501-1000 nucleotide.
Nucleic acid fragment the most according to claim 1, it is characterised in that the length of described nucleic acid fragment be 10-20,21-30,
31-40,41-50,51-60,61-100 or 101-300 nucleotide.
Nucleic acid fragment the most according to claim 1, it is characterised in that described nucleic acid fragment is SEQID NO.1,2 or 14-
Sequence shown in 18.
5. for detecting and/or analyze a test kit for single base mutation, including according to described in any one of claim 1-4
Nucleic acid fragment.
6. according to the answering in the medicine of preparation detection CYP2D6 gene mutation of the nucleic acid fragment described in any one of claim 1-4
With;Or the application in preparation is used as the check mark thing of detection CYP2D6 gene mutation.
7.CYP2D6 albumen, described protein sequence is the sequence shown in SEQ ID NO.3.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201310404388.7A CN103614394B (en) | 2013-09-06 | 2013-09-06 | Including 4041C > T sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201310404388.7A CN103614394B (en) | 2013-09-06 | 2013-09-06 | Including 4041C > T sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CN103614394A CN103614394A (en) | 2014-03-05 |
CN103614394B true CN103614394B (en) | 2016-08-24 |
Family
ID=50165109
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201310404388.7A Active CN103614394B (en) | 2013-09-06 | 2013-09-06 | Including 4041C > T sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN103614394B (en) |
Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102304572A (en) * | 2006-09-11 | 2012-01-04 | Inje大学校产学协力团 | Htsnps for determining a genotype of cytochrome p450 1a2, 2a6 and 2d6, pxr and udp-glucuronosyltransferase 1a gene and multiplex genotyping methods using thereof |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN103436545B (en) * | 2013-09-05 | 2015-07-22 | 蔡剑平 | CYP2D6 gene segment containing 4094C)A mutant, protein segment coded by same and application thereof |
-
2013
- 2013-09-06 CN CN201310404388.7A patent/CN103614394B/en active Active
Patent Citations (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN102304572A (en) * | 2006-09-11 | 2012-01-04 | Inje大学校产学协力团 | Htsnps for determining a genotype of cytochrome p450 1a2, 2a6 and 2d6, pxr and udp-glucuronosyltransferase 1a gene and multiplex genotyping methods using thereof |
Non-Patent Citations (3)
Title |
---|
Discovery of the nonfunctional CYP2D6*31 allele in Spanish,Puerto Rican,and US Hispanic populations;Andrea Gaedigk 等;《Eur J Clin Pharmacol》;20100516;第66卷;摘要 * |
Functional analysis of CYP2D6.31 variant:Homology modeling suggests possible disruption of redox partner interaction by Arg440His substitution;Allorge D.等;《Proteins》;20050222;第59卷(第2期);摘要,第340页左栏第1段,最后1段-右栏第1段 * |
中国少数民族基因组DNA样本库的建立和CYP2D6在维吾尔族人群的多态性分布;朱志慧;《中国优秀硕士学位论文全文数据库 医药卫生科技辑》;20120315(第3期);摘要,正文第22页最后1段-第29页,第58页第4段、表3-6 * |
Also Published As
Publication number | Publication date |
---|---|
CN103614394A (en) | 2014-03-05 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN108977531B (en) | A kind of human hypertension's risk genes polymorphic detection kit and its preparation method and application | |
CN108998517A (en) | A kind of mankind SLCO1B1 and ApoE genetic polymorphism detection kit and its preparation method and application | |
CN109055530A (en) | A kind of mankind's aspirin resistance genetic polymorphism detection kit and its preparation method and application | |
CN109055367B (en) | A kind of mankind ALDH2 genetic polymorphism detection kit and its preparation method and application | |
CN103614388B (en) | Comprise the CYP2D6 gene fragment of 1735G > C sudden change, coded protein fragments and application thereof | |
CN103436545B (en) | CYP2D6 gene segment containing 4094C)A mutant, protein segment coded by same and application thereof | |
CN103614390B (en) | Comprise the CYP2D6 gene fragment of 2519A > C sudden change, coded protein fragments and application thereof | |
CN103614394B (en) | Including 4041C > T sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof | |
CN103451212B (en) | Including 3195G > A sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof | |
CN103451210B (en) | Including 2943G > A sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof | |
CN103436543A (en) | CYP2D6 gene segment containing 3334G>A mutant, protein segment coded by same and application thereof | |
CN103525839B (en) | Comprise the CYP2D6 gene fragment of 74G > A sudden change, coded protein fragments and application thereof | |
CN103451213B (en) | CYP2D6 genetic fragment, coded protein fragments and application thereof including 1995 C disappearances | |
CN103451208B (en) | Comprise the CYP2D6 gene fragment of 1984G > A sudden change, coded protein fragments and application thereof | |
CN103451207B (en) | Comprise the CYP2D6 gene fragment of 3202G > A sudden change, coded protein fragments and application thereof | |
CN103451209B (en) | Comprise the CYP2D6 gene fragment of 3177G > A sudden change, coded protein fragments and application thereof | |
CN103451211B (en) | Comprise the CYP2D6 gene fragment of 14C > T sudden change, coded protein fragments and application thereof | |
CN103436546B (en) | Comprise the CYP2D6 gene fragment of 4110C > G sudden change, coded protein fragments and application thereof | |
CN103614392B (en) | Comprise the CYP2D6 gene fragment of 1693A > G sudden change, coded protein fragments and application thereof | |
CN103451206B (en) | Comprise the CYP2D6 gene fragment of 4212C > T sudden change, coded protein fragments and application thereof | |
CN103614391B (en) | Comprise the CYP2D6 gene fragment of 3181A > G sudden change, coded protein fragments and application thereof | |
CN106244688A (en) | A kind of mark assessing adenocarcinoma of colon risk | |
CN103614393B (en) | Comprise the CYP2D6 gene fragment of 1678T > C sudden change, coded protein fragments and application thereof | |
CN103627715B (en) | Comprise the CYP2D6 genetic fragment of 3895C > T sudden change, coded protein fragments and application thereof | |
CN103436544B (en) | Comprise the CYP2D6 genetic fragment of 1745C > G sudden change, coded protein fragments and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
PB01 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C14 | Grant of patent or utility model | ||
GR01 | Patent grant | ||
TR01 | Transfer of patent right | ||
TR01 | Transfer of patent right |
Effective date of registration: 20220622 Address after: 100730, 1 Dahua Road, Dongcheng District, Beijing, Dongdan Patentee after: BEIJING Hospital Address before: 100730 central laboratory, 9th floor, science and education building, No.1 Dahua Road, Dongdan, Dongcheng District, Beijing Patentee before: Cai Jianping |