CN103451213B - CYP2D6 genetic fragment, coded protein fragments and application thereof including 1995 C disappearances - Google Patents
CYP2D6 genetic fragment, coded protein fragments and application thereof including 1995 C disappearances Download PDFInfo
- Publication number
- CN103451213B CN103451213B CN201310404385.3A CN201310404385A CN103451213B CN 103451213 B CN103451213 B CN 103451213B CN 201310404385 A CN201310404385 A CN 201310404385A CN 103451213 B CN103451213 B CN 103451213B
- Authority
- CN
- China
- Prior art keywords
- seq
- nucleic acid
- cyp2d6
- sequence
- acid fragment
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Landscapes
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The invention belongs to field of biology, relate to the single-base deletion mutation of the 1995th, CYP2D6 allele, the base C disappearance in described site.In particular it relates to the nucleic acid fragment comprising this mutational site and the protein fragments of corresponding encoded thereof, identify the application in the reagent in described mutational site, detection method and this site, particularly identify the application in direction of medication usage of this site.
Description
Technical field
The invention belongs to field of biology, relate to the single-base deletion mutation of the 1995th, CYP2D6 allele.More
Body ground, the present invention relates to comprise the nucleic acid fragment in this mutational site and the protein fragments of corresponding encoded thereof, identify described sudden change
The application in direction of medication usage of this site of the reagent in site, detection method and qualification.
Background technology
Cytochrome P 4502 D 6 (CYP2D6) is one of important member of CYP enzyme family.Its gene is positioned at No. 22 dyeing
On body, including 9 exons, full length gene 9432bp(GenBank number of registration M33388, exon 1 is positioned at 1620-5909
Position, SEQ ID NO.24;Gene coded sequence is shown in SEQ ID NO.25).It is total that the amount of human body this cytochrome interior only accounts for liver enzyme
Amount 2%~4%, but participate in the metabolism of 20%~30% medicine clinically, such medicine include antidepressants, anti-arrhythmic,
Psychosis, analgesic, antitussive, Bendectin, antidiabetic drug and Bextra etc., study its metabolic polymorphism tool
There is highly important clinical value (seeing list of references 1).
CYP2D6 gene has height polymorphism.So far, NCBI snp database has been included more than 300
Mutational site.Also more than 150 are had by the allele of CYP450 Intemational Nomenclature committee member name, the most multiple newfound
Saltant type is not yet named (http://www.cypalleles.ki.se/cyp2d6.htm).The different journey of each allele
Degree relate to point mutation, lack, insert, rearrangement etc., thus affect the activity of CYP2D6, and then the metabolic activity that impact is to medicine,
Produce drug influence in various degree.Remove outside wild type CYP2D6*1, the sudden change that research is more and clinical meaning is bigger at present
Type mainly includes following 7 kinds: CYP2D6*2, * 3, * 4, * 5, * 10, * 17, * 41, wherein ethnic group distribution is the widest, most study, in
The abundantest saltant type of state's crowd's research data is CYP2D6*2(2850C > T;4180G > C) and CYP2D6*10(100C >
T;4180G > C) (seeing list of references 1,2,3).
According to current clinical studies show, this polymorphism of CYP2D6 gene is to cause CYP2D6 enzymatic activity at individuality
Between the main cause of significant difference, carry the huge difference that can cause curative effect of medication between the individuality of different CYP2D6 genotype,
Even produce serious poisonous side effect of medicine or treat insufficient.Therefore, research CYP2D6 gene pleiomorphism is to curative effect of medication
Impact will provide important scientific basis (seeing list of references 3,4) to clinical rational drug use.
Summary of the invention
It is an object of the invention to provide the new single base mutation site of CYP2D6 gene, comprise the nucleic acid in this mutational site
Fragment, its coding protein fragments and identify the application in medication guide of this mutational site.
The first aspect of the invention is to provide nucleic acid fragment, and described nucleic acid fragment comprises corresponding to SEQ ID NO.1's
Two continuous nucleotides of the 1994th G and the 1995th T, and be in the nucleotide sequence shown in SEQ ID NO.1 at least
10 continuous nucleotides;The most relatively wild type (SEQ ID NO.24) the 1995th disappearance 1 base C, by detection corresponding to
Two continuous nucleotides of the 1994th G and the 1995th T of SEQ ID NO.1 can reflect this disappearance base C indirectly;Or institute
State nucleic acid fragment and comprise the 653rd G corresponding to SEQ ID NO.2 and two continuous nucleotides of the 654th T, and be SEQ
At least 10 continuous nucleotides in nucleotide sequence shown in ID NO.2;The most relatively wild type (SEQ ID NO. 25)
1 base C of 654 disappearances, by detecting the 653rd G corresponding to SEQ ID NO.2 and two continuous nucleoside of the 654th T
Acid can reflect this disappearance base C indirectly;Or the reverse complementary sequence that described nucleic acid fragment is above-mentioned nucleic acid fragment.
The second aspect of the invention is to provide and contains the 1994th G and the 1995th T corresponding to SEQ ID NO.1
Two continuous nucleotides or the equipotential of two continuous nucleotides of the 653rd G and the 654th T corresponding to SEQ ID NO.2
The allele specific oligonucleotide that genetic fragment or its reverse complementary sequence completely or partially hybridize, described allele sheet
Section is at least 10 continuous nucleotides in the nucleotide sequence shown in SEQ ID NO.1 or SEQ ID NO.2 or its reverse mutual
Complementary series.
The third aspect of the invention is to provide the reagent of the single-base deletion mutation for detecting and/or analyze the present invention
Box, described test kit comprises nucleic acid fragment or the allele specific oligonucleotide of the present invention, or comprise can be as primer
Expand the nucleotide of the 654th corresponding to the 1995th or SEQ ID NO.25 of SEQ ID NO.24 but do not comprise this nucleoside
The nucleic acid fragment of acid.
The fourth aspect of the invention is to provide the nucleic acid fragment of the present invention or oligonucleotide and dashes forward at detection CYP2D6 gene
Application in change, wherein said nucleic acid fragment or oligonucleotide are used as probe or primer;Or the nucleic acid fragment of the present invention or widow
Nucleotide is for preparing the application of the medicine of detection CYP2D6 gene mutation;Or the nucleic acid fragment of the present invention or oligonucleotide are used
Make the application of the check mark thing of detection CYP2D6 gene mutation.
The fifth aspect of the invention is to provide a kind of medication guide, including CYP2D6 gene right in detection testing sample
Whether should lack, according to detect in base C of the 654th of the 1995th of SEQ ID NO.24 or SEQ ID NO.25
Sudden change, adjusts by the dosage of the medicine of CYP2D6 metabolism.
The sixth aspect of the invention is to provide the method analyzing nucleic acid, and described method includes analyzing the bag in testing sample
Containing corresponding to the nucleic acid of the sequence of SEQ ID NO.24 corresponding to the nucleotide of the 1995th or analyzing the bag in testing sample
Containing the nucleotide corresponding to corresponding to the 654th in the nucleic acid of the sequence of SEQ ID NO.25.When this position base C disappearance,
Correspond respectively to the nucleotide in SEQ ID NO.1 and SEQ ID NO.2 sequence.
The seventh aspect of the invention is to provide CYP2D6 albumen or its fragment or variant, and described protein sequence is SEQ
Sequence shown in ID NO.3;Described fragment or variant comprise the 220th-223 amino acids corresponding to SEQ ID NO.3,
And at least 10 continuous amino acids for the aminoacid sequence shown in SEQ ID NO.3.
The invention provides the CYP2D6 gene and coded sequence comprising new single base mutation.This gene is corresponding to
The base C disappearance of the 1995th of SEQ ID NO.24 or the 654th of SEQ ID NO.25, from the 218th when causing translation
Codon starts frameshift mutation, causes the protein of coding to start formation sequence from the 220th compared with wild type complete
Different amino acid residues, and terminate when the 224th, i.e. the protein sequence of the gene code of this sudden change only comprises 223
Aminoacid (normal CYP2D6 albumen has 497 aminoacid).The CYP2D6 albumen of this sudden change (named 218FS or
CYP2D6.92) metabolic activity of medicine is substantially reduced compared with wild type, almost nil.This single base mutation is to carrying this
The individual medication in mutational site has great importance.
Accompanying drawing explanation
Fig. 1 is heterozygous carriers's Sequencing chromatogram of the SEQ ID NO.1 sequence corresponding to the present invention in embodiment 1,
Wherein arrow indication is the 1995th nucleotide of CYP2D6 gene;
Fig. 2 is the structural representation collection of illustrative plates of the double gene expression vector pIRES-Gluc-2D6 that embodiment 2 builds;
Fig. 3 is the CYP2D6.1(wild type shown in embodiment 2), CYP2D6.2(deficient mutants), CYP2D6.10
The CYP2D6.92 albumen of (deficient mutants) and the present invention detects knot for the metabolic capacity of dextromethorphan and bufuralol
Really, wherein * represents p value < 0.05;
Fig. 4 is the CYP2D6.1(wild type shown in embodiment 2), CYP2D6.2(deficient mutants), CYP2D6.10
The CYP2D6.92 albumen of (deficient mutants) and the present invention detects collection of illustrative plates for the typical LC-MS/MS of dextromethorphan metabolism;
Substrates dextromethorphan (right) and the signal peak of metabolite demethyl dextromethorphan (left) thereof it is respectively at arrow indication;Wherein horizontal
Coordinate representation retention time, the retention time of dextromethorphan and demethyl dextromethorphan is respectively 7.5 and 4.8 minutes, vertical coordinate
Represent signal response value cps;
Fig. 5 is the CYP2D6.1(wild type shown in embodiment 2), CYP2D6.2(deficient mutants), CYP2D6.10
The CYP2D6.92 albumen of (deficient mutants) and the present invention detects collection of illustrative plates for the typical LC-MS/MS of bufuralol metabolism;
Substrate bufuralol (right) and the signal peak of metabolite 1 '-hydroxyl bufuralol (left) thereof it is respectively at arrow indication;Wherein
Abscissa represents that retention time, the retention time of bufuralol and hydroxyl bufuralol are respectively 6.9 and 5.1 minutes, vertical coordinate
Represent signal response value cps.
Detailed description of the invention
By following detailed description of the invention, the present invention is described, but present invention is not limited to this.
As without other illustrate, " nucleic acid fragment " of the present invention is made up of nucleotide or its analog, can be DNA, RNA or
The fragment of its analog;Can be strand or double-strand;Can be natural (such as genome) or synthesis.
In the present invention, " sudden change " refers to the gene in detection, i.e. exist and wild type CYP2D6 gene sequence in CYP2D6 gene
Arrange different nucleotide sites." mutational site " refers to the position that base is undergone mutation.In the present invention, described mutational site is right
Should be in the 654th in sequence shown in the 1995th of sequence shown in SEQ ID NO.24 or SEQ ID NO.25, this site alkali
Base C lacks.
World P450 allele NK specifies about in CYP2D6 allele naming rule: with CYP2D6 base
Because of in group DNA reference sequences (GenBank number of registration M33388) first base A of start codon ATG as CYP2D6 etc.
1st the 1620th of M33388 sequence (first base A of start codon be positioned at) of position gene, then present invention determine that
Catastrophe point is positioned at allelic 1995th of CYP2D6.
Present invention relates to the nonsynonymous mutation of CYP2D6 gene.Owing to this mutational site is positioned at the coded sequence of gene
In, therefore, skilled person will appreciate that, described mutational site both can show in genomic DNA, it is also possible at code sequence
Performance in row (i.e. CDS).Those skilled in the art, can be to this on genomic DNA or mRNA level in-site according to detected sample
Mutational site is detected.In the application, the regulation of SEQ ID NO.24 Shi Yi world P450 allele NK is fixed
The CYP2D6 allelic sequences of justice, wherein the 1995th is the mutational site that the present invention relates to.SEQ ID NO.25 is
The cDNA sequence of CYP2D6 gene, wherein the 654th is the mutational site that the present invention relates to.SEQ ID NO.1 is SEQ ID
NO.24 has lacked the sequence after the 1995th bit base C, and SEQ ID NO.2 is that SEQ ID NO.25 has lacked the 654th bit base C
After cDNA sequence, its coded product SEQ ID NO.3 only comprises 223 aminoacid, this coded product be named as 218FS or
CYP2D6.92。
Skilled person will appreciate that, in this article, corresponding to the 1995th site of SEQ ID NO.24 with correspond to
654th the site synonym of SEQ ID NO.25 is used mutually.In like manner, corresponding to the 1994th site and the correspondence of SEQ ID NO.1
In the 653rd the site synonym use mutually of SEQ ID NO.2, corresponding to the 1995th site of SEQ ID NO.1 with corresponding to SEQ
654th the site synonym of ID NO.2 is used mutually.
In the present invention, " allele-specific " refers to hybridize, as carried out under high stringency conditions with allele specifically
Hybridization so that identify the corresponding to sequence shown in the 1995th or SEQ ID NO.25 of sequence shown in SEQ ID NO.24
654 bit base C disappearances.
In the present invention, nucleotide and amino acid whose abbreviation use abbreviation mode well known in the art, as in nucleotide, A represents
Adenine, G represents that guanine, C represent that cytosine, T represent thymus pyrimidine.In aminoacid, A represents that alanine, R represent essence ammonia
Acid, N represents that agedoite, D represent that aspartic acid, C represent that cysteine, Q represent that glutamine, E represent that glutamic acid, G represent
Glycine, H represents that histidine, I represent that isoleucine, L represent that leucine, K represent that lysine, M represent that methionine, F represent benzene
Alanine, P represents that proline, S represent that serine, T represent that threonine, W represent that tryptophan, Y represent that tyrosine, V represent figured silk fabrics ammonia
Acid.
Present disclosure is new single base mutation site based on CYP2D6 gene.Described mutational site is in
In the coding region of CYP2D6 gene, corresponding to the 654th of SEQ ID NO.25, base C in this site disappearance, causes from the
218 bit codons start frameshift mutation;Additionally, by the albumen of the CYP2D6 gene code of this sudden change compared with wild type from
220th starts to change, and only 223 aminoacid (named 218FS or CYP2D6.92).
At first aspect, the present invention provides nucleic acid fragment, described nucleic acid fragment to comprise corresponding to SEQ ID NO.1
Two continuous nucleotides of 1994 G and 1995 T, and be at least 10 in the nucleotide sequence shown in SEQ ID NO.1
Continuous nucleotide;The most relatively wild type (SEQ ID NO.24) the 1995th 1 base C of disappearance, by detection corresponding to SEQ
1994th G of ID NO.1 and two continuous nucleotides of the 1995th T, can reflect indirectly corresponding to SEQ ID NO.24's
The disappearance of the 1995th bit base C;Or described nucleic acid fragment comprises the 653rd G's and 654 T corresponding to SEQ ID NO.2
Two continuous nucleotides, and be at least 10 continuous nucleotides in the nucleotide sequence shown in SEQ ID NO.2;The wildest
Raw type (SEQ ID NO.25) 1 base C of the 654th disappearance, by detection corresponding to the 653rd G of SEQ ID NO.2 and the
Two continuous nucleotides of 654 T, can reflect the disappearance of the 654th bit base C corresponding to SEQ ID NO.25 indirectly;Or
Reverse complementary sequence for above-mentioned nucleic acid fragment.
In one embodiment, the length of described nucleic acid fragment can be such as 10-100,101-200,201-500 or
501-1000 nucleotide.Preferably, the length of described nucleic acid fragment is 10-20,21-30,31-40,41-50,51-60,61-
100 or 101-300 nucleotide.
Said two continuous nucleotide may be located at any position of described nucleic acid fragment.
In another embodiment, described nucleic acid fragment is the sequence shown in SEQ ID NO.1.
In another embodiment, described nucleic acid fragment is the sequence shown in SEQ ID NO.2.
In other embodiments, described nucleic acid fragment can be the sequence shown in SEQ ID NO.14-18.
The second aspect of the invention is to provide and contains the 1994th G's and 1995 T corresponding to SEQ ID NO.1
Two continuous nucleotides or the allele of two continuous nucleotides of the 653rd G and 654 T corresponding to SEQ ID NO.2
The allele specific oligonucleotide that fragment or its reverse complementary sequence completely or partially hybridize, described allele fragment is
At least 10 continuous nucleotides in nucleotide sequence shown in SEQ ID NO.1 or SEQ ID NO.2 or its reverse complemental sequence
Row.
In one embodiment, described oligonucleotide is used as probe.Described probe can under high stringency conditions with bag
Target sequence specific hybrid containing said two continuous nucleotide.It is known to those skilled in the art that described probe need not and target
Sequence complete complementary, as long as can be with target sequence specific hybridization.In preferred embodiments, described hybridization conditions can expire
Foot make probe only with target sequence specific hybrid.The length of described probe can be 5-100 nucleotide, such as 5,6,7,8,9,
10、11、12、13、14、15、16、17、18、19、20、21、22、23、24、25、26、27、28、29、30、31、32、33、34、
35,40,50,60,70,80,90 or 100 nucleotide.Said two continuous nucleotide correspondence site can occur in probe
Any position.In a preferred embodiment, said two continuous nucleotide correspondence site occur in probe sequence center or
About center.
In another embodiment, the described oligonucleotide primer of the DNA synthesis that coaches, survey as known in the art
Sequence primer or synthetic primer etc..Described primer need not and template complete complementary, but it should with template Complementary hybridization to instruct DNA
Synthesis.The length of described primer can be 15-40 length of nucleotides, it is therefore preferable to 18,19,20,21,22,23,24,25,
26,27,28,29 or 30 nucleotide.The corresponding site of said two continuous nucleotide can occur in any of described primer
Position;Preferably, 3 ' ends of described primer are occurred in.
Some preferred embodiment in, described oligonucleotide is the sequence as shown in SEQ ID NO.19-23.
Based on this, the third aspect of the invention is to provide the test kit for detecting and/or analyze base mutation, described
Test kit comprises nucleic acid fragment or the allele specific oligonucleotide of the present invention, or comprise can be corresponding as primer amplification
In the nucleotide of the 654th of the 1995th or SEQ ID NO.25 of SEQ ID NO.24 but do not comprise the nucleic acid of this nucleotide
Fragment.Preferably, described test kit comprises shown in SEQ ID NO.4 and/or SEQ ID NO.5 and/or SEQ ID NO.10
Sequence fragment.
The fourth aspect of the invention is to provide the nucleic acid fragment of the present invention or oligonucleotide for detecting CYP2D6 gene
The application of sudden change, wherein said nucleic acid fragment or oligonucleotide are used as probe or primer;Or the nucleic acid fragment of the present invention or widow
Nucleotide is for preparing the application of the medicine of detection CYP2D6 gene mutation;Or the nucleic acid fragment of the present invention or oligonucleotide are used
Make the application of the check mark thing of detection CYP2D6 gene mutation.
The fifth aspect of the invention is to provide medication guide, including the corresponding to of CYP2D6 gene in detection testing sample
The 1995th of SEQ ID NO.24 or the nucleotide of the 654th of SEQ ID NO.25.When base C described site being detected
During disappearance, adjust the dosage of medicine through CYP2D6 metabolism accordingly.In the particular embodiment, exist when CYP2D6 gene
When base C of the 654th of SEQ ID NO.25 lacks, the CYP2D6 proteinase activity of this gene code declines, therefore needs to adjust
The dosage of the medicine of warping CYP2D6 metabolism, assigns dose as follows.
The heretofore described medicine through CYP2D6 metabolism includes: beta-blocker, Propranolol, metoprolol, alkene
Third Luo Er, bufuralol, timolol, bunitrolol, carvedilol, alprenolol, nebivolol;Anti-arrhythmic, English
Card amine, sparteine, flecainide, Propafenone, aprindine, mexiletine, encainide, procainamide;Antihypertensive, isoquinoline
Guanidine, indoramine;Antianginal, perhexiline, terodiline;Analgesic, tramadol;Anti-spirit medicine, chlorpromazine, perphenazine,
Haloperidol, risperidone, thioridazine, zuclopenthixol, Aripiprazole;Tricyclic antidepressant, amitriptyline, imipramine, chlorine
Imipramine, desipramine, nortriptyline;Other antidepressants, fluoxetine, paroxetine, venlafaxine, fluvoxamine, Ah rice
Husband's amine, mianserin, brofaromine, maprotiline, tomoxetine, amfetamine, citalopram, fluvoxamine, Minaprine, degree
Duloxetine, moclobemide;Medicine for the treatment of cough and asthma, dihydrocodeine, ethylmorphine, codeine, dextromethorphan;Antidiabetic drug, benzene
Second biguanide;Other, chlorphenamine, metoclopramide, atomoxetine, Isomeride, ondansetron, amphetamines, benefit card
Cause, ondansetron, phenacetin, triphen chloramines, dexfenfluramine, promethazine.
The sixth aspect of the invention is to provide the method analyzing nucleic acid, and described method includes analyzing the bag in testing sample
Containing corresponding to the nucleic acid of the sequence of SEQ ID NO.24 corresponding to the nucleotide of the 1995th or analyzing the bag in testing sample
Containing the nucleotide corresponding to corresponding to the 654th in the nucleic acid of the sequence of SEQ ID NO.25.
In one embodiment, described method can be restriction fragment length polymorphism analysis (RFLP).This area
Technical staff can be according to present invention contrived experiment with the 1995th in the nucleic acid of the sequence of analysis SEQ ID NO.24
Base C or SEQ ID NO.25 sequence nucleic acid in base C of the 654th whether lack.
In another embodiment, described method can be sequencing, including separating and measure from genomic DNA or
The nucleotide sequence of RNA, analyze wherein comprise in the nucleic acid of the sequence corresponding to SEQ ID NO.24 corresponding to the 1995th
Nucleotide or whether lacking corresponding to base C of the 654th in comprising the nucleic acid of the sequence corresponding to SEQ ID NO.25.Survey
Sequence method can be any available sequence measurement known in the art.Sequencing primer can be according to the general knowledge of those skilled in the art
It is designed, as primer is designed in the upstream and downstream appropriate position in site to be detected, with the expanding packet fragment containing this site to be measured,
Thus judge the nucleotide in this site.The oligonucleotide of the present invention can also be used as primer sequence.
In another embodiment, described method is the method utilizing probe to hybridize, specifically identification and detection sample
In comprise in the nucleic acid of the sequence corresponding to SEQ ID NO.24 corresponding to base C of the 1995th or comprise corresponding to SEQ
In the nucleic acid of the sequence of ID NO.25, whether base C corresponding to the 654th lacks;The probe used in described method is this
Bright oligonucleotide.Such as, from testing sample, isolate nucleic acid, allow probe and specific target that may be present in nucleic acid
Probe is made to contact with nucleic acid under conditions of sequence hybridization;The hybridization that can be detected can be by using by detectable reagent labelling
The probe crossed realizes;Such as, maybe can be catalyzed with radiosiotope, fluorescent dye to be formed and can detect the enzyme of product and carry out labelling and visit
Pin.Label probe, it is all well known to those skilled in the art with whether label probe detection sample exists the method for target sequence
's.
In a kind of specific embodiment, it is provided that detect corresponding to SEQ ID with Taqman probe SNP detection method
The method of the nucleotide of the 1995th of NO.24, including:
1) design primer comprises the PCR primer of corresponding to SEQ ID NO.24 the 1995th for specific amplification, with
Time two Taqman-MGB probes of design, be respectively directed to the C of corresponding to SEQ ID NO.24 the 1995th and corresponding to SEQ
The deletion form allele of ID NO.1.
Design of primers principle is:
(1) choose should be at the conservative section of gene for sequence;
(2) avoid primer self or and primer between form 4 or more than 4 continuously pairings, it is to avoid primer self formation
Pili annulati card structure;
(3) primer length is at 18 to 24 nucleotide;
(4) Tm value is at 55-65 DEG C, and G/C content is at 40%-60%;
(5) the Tm value difference between primer avoids exceeding 2 DEG C;
(6) 3 ' ends of primer are avoided using base A, and 3 ' ends of primer avoid the occurrence of 3 or more than 3 consecutive identical alkali
Base;
(7) pcr amplified fragment length is at 50bp-150bp;
(8) last 5 nucleotide of prime end can not have more than G and C of 2.
Taqman MGB probe design principle is:
(1) 5 ' ends of probe avoid the occurrence of G;
(2) Tm value should be 65-67 DEG C;
(3) shorten Taqman MGB probe as far as possible, but probe length is no less than 13bp;
(4) avoid the occurrence of the base of repetition, especially G base, it is to avoid occur that the G of 4 or more than 4 repeats as far as possible
Existing;
(5) mutational site of probe is placed on as far as possible the place of middle 1/3.
Fluorophor can use FAM, VIC etc. to carry out two allele of labelling.
2) utilize above-mentioned primer and probe, sample to be tested is carried out real-time quantitative PCR.
PCR condition: 95 DEG C of denaturations enter 30 amplification cycles after 10 minutes: 92 DEG C of degeneration 12 seconds, 60 DEG C of annealing and prolonging
Stretch 1 minute (this stage detection fluorescence signal).
3) data analysis.
Analyzing experimental result, strong and weak according to two kinds of fluorescence of sample judges whether sample to be tested CYP2D6 gene exists 1995
Position C deletion mutation.
In the present invention, described sample can be any sample comprising nucleic acid, such as blood;The most described sample comes from
People.Described nucleic acid can be DNA or coding RNA, preferably genomic DNA.The method analyzing nucleic acid of the present invention can be with DNA
Or RNA is object.Skilled person will appreciate that, when with DNA for detection object, comprising in analysis testing sample is right
Should in the nucleic acid of the sequence of SEQ ID NO.24 corresponding to the nucleotide of the 1995th, the probe used or primer according to
The sequential design of SEQ ID NO.24;When with RNA for detection object, analyze comprising corresponding to SEQ ID in testing sample
Corresponding to the nucleotide of the 654th in the nucleic acid of the sequence of NO.25, the probe used or primer are according to SEQ ID NO.25's
Sequential design.
The seventh aspect of the invention is to provide CYP2D6 albumen or its fragment or variant, and described protein sequence is SEQ
Sequence shown in ID NO.3;Described fragment or variant comprise the 220-223 amino acids corresponding to SEQ ID NO.3, and
For at least 10 continuous amino acids of aminoacid sequence shown in SEQ ID NO.3, such as 10-20,21-50 or 51-100 amino
Acid.
The present invention will be further illustrated by specific embodiment below, but embodiment in detail below will be merely for exemplary
Purpose.
Embodiment 1: the qualification in the mutational site that people's CYP2D6 gene is new
In the present embodiment, gathering Normal Occlusion of Han People healthy population blood sample, extract the genomic DNA in blood, design is surveyed
Sequence primer carries out sequence amplification, order-checking to 9 exons of CYP2D6 gene, analyzes whether its CYP2D6 gene exists sudden change position
Point.
1) DNA is extracted:
5ml vein EDTA anticoagulated blood sample is taked from measured;Then according to common salting out method and/or use special
DNA extraction kit (purchased from the DNA extraction kit of Omega company of the U.S.) extracts the genomic DNA of blood sample to be measured.
2) PCR amplification:
9 exon sequences of CYP2D6 gene in the genome DNA sample obtained are expanded by design amplimer
Increase.Described amplimer is shown in Table 1 to sequence.
Use 30 μ L PCR reaction systems, including: 1 × GC PCR buffer, 1.5mM MgCl2, the genome of 100ng
DNA, upstream and downstream primer be 0.2 μM, dNTP be the LATaq archaeal dna polymerase 1.5U of 0.2mM, TaKaRa company.Use the U.S.
The GeneAmp PCR System9700 amplification instrument amplification of ABI company.PCR amplification cycles parameter is as follows: 94 DEG C of denaturations 2 points
Clock, 94 DEG C of degeneration 30 seconds, anneal 30 seconds for 60 DEG C, 68 DEG C extend 3 minutes, re-extend 3 minutes after 35 circulations.Primer sequence information
It is shown in Table 1.
Table 1: amplimer is to sequence information
3) purification amplified production:
By the amplified production of acquisition according to MultiScreen HTSTMThe use of test kit (Millipore company of the U.S.) is said
Bright, the DNA carrying out purpose band reclaims purification.
4) order-checking:
With the product after recovery as template, use sequencing primer according to BigDye Terminator v3.1 sequencing kit
(American AB I company) operation instruction carries out PCR reaction of checking order, and reaction terminates rear purification amplified production, uses American AB I company
Prism3730XL type gene sequencer carries out separating with the sequence of interpretation amplified production.Sequencing primer sequence information is shown in Table 2.
Table 2: sequencing primer sequence information table
Region | Sequencing primer (5 '-3 ') |
Exons 1 | AGGAAGCAGGGGCAAGAAC(SEQ ID NO.8) |
Exon 2 | CGCCCTCTCTGCCCAGC(SEQ ID NO.9) |
Wai Xianzi3 &4 | TTGGAGTGGGTGGTGGA(SEQ ID NO.10) |
Exon 5&6 | AGGARGTYAGGCTTACAGGA(SEQ ID NO.11) |
Exon 7 | GCACAGGCTTGACCAGGAT(SEQ ID NO.12) |
Exon 8&9 | TGTTTGGTGGCAGGGGTCC(SEQ ID NO.13) |
5) data analysis:
The sequence recorded is compared with wild type CYP2D6*1 sequence (GenBank number of registration M33388).
Analyzed by comparison, find 2129 example experimenters have the CYP2D6 genomic dna sequence of 1 people carry a kind of brand-new
Mutation type, base C of allelic 1995th corresponding of CYP2D6 lacks (as it is shown in figure 1, wherein arrow indication is
CYP2D6 allele the 1995th bit base, this equipotential gene carrier owing to detecting is heterozygote genotype, its gene
Sequencing result starts the overlapping for wild type He the mutant sequences having lacked base C from this site).This sudden change is positioned at CYP2D6
In 4th exon of gene, catastrophe point is positioned at cDNA the 654th, infers that the sudden change of this deletion form may result in CYP2D6 gene accordingly
Starting to occur frameshift mutation from the 218th bit codon during translation, the protein of coding only comprises 223 aminoacid
(218FS).This sudden change is by named neomorph CYP2D6*92 of P450 NK, but the most externally announces.
The present embodiment exemplarily gives the method identifying new mutation site.Those skilled in the art are according to foregoing
Can clearly learn specifically to detect in testing sample and comprise the 1995th nucleotide corresponding to SEQ ID NO.24
Method: separating the nucleic acid in sample, carry out amplified reaction under experiment condition corresponding in the present embodiment, primer uses primer
To SEQ ID NO.4 and 5;With sequencing primer SEQ ID NO.10, the product of amplification is checked order;By sequencing result with wild
Whether type result comparison, analyze base C corresponding to the 1995th site of SEQ ID NO.24 and lack.
Embodiment 2: vitro enzyme metabolic activity is analyzed
According to existing result of study, wild type (* 1 type) is the highest to the metabolic activity of various medicines, and * 2 types
Metabolic activity is decreased obviously than the metabolic activity of wild type, and the metabolic activity of * 10 types is lower than * 2 types (seeing document 6,7).
Therefore, the most such a is known together: the metabolic activity to specific substrate of the enzyme expressed by same genotype
The metabolic activity to other substrate medicine can be represented.Thus, according to the enzyme expressed by a certain genotype to specific substrate metabolism
Activity data can analogize the enzyme expressed by this genotype (e.g., can be by this genotype institute to the metabolic activity of other substrate medicine
The metabolic activity of the enzyme expressed compares with the metabolic activity of the enzyme expressed by wild type).
In the present embodiment, according to above-mentioned mutational site, with wild type CYP2D6(*1) gene as template, rite-directed mutagenesis
The nucleotide (making base C lack) of the 654th of CYP2D6 gene coding region, construction expression saltant type CYP2D6 albumen (life
Entitled CYP2D6.92 or 218FS) expression vector, transfection 293FT cell after, add CYP2D6 Specific probe
Dextromethorphan and bufuralol, after hatching, detect this saltant type CYP2D6 albumen by analyzing substrate and metabolite amount
In vitro metabolism activity, to judge compared with wild type CYP2D6.1, whether its enzymatic metabolism activity changes.This experiment sets
Meter is similar to our operating procedure when the external medicine of CYP2C9 new mutant is for activity analysis, and its science is by International Pharmaceutical
Magazine Pharmacogenomics J accreditation (see reference document 5) that genomics field is the most authoritative.
1) vivoexpression of CYP2D6 variant
To comprise wild type CYP2D6(*1) plasmid vector of full-length cDNA (buy from Thermo Scientific company)
For template, side-directed mutagenesis is utilized to obtain the CYP2D6.92 mutant of CYP2D6*2, CYP2D6*10 and the present invention respectively
cDNA.Side-directed mutagenesis is techniques well known, and those skilled in the art, according to the template determined and target, can have no
Know how to doubt this step.By each genes of interest correct for sequence after testing and reference gene Gluc(mono-kind secretion
Type luciferase, its translation product can be secreted in culture medium, and fluorescence signal detected by particular agent box;Its skeleton carries
Body is pIRES pGluc-Basic, purchased from NEB company, article No. N8082S) it is respectively connecting to double gene expression vector pIRES(and purchases
From Clontech company, article No. 631605) A, B multiple clone site in, make a kind of genes of interest and reference gene be positioned at same
Under CMV promoter controls, Fig. 2 is shown in by the final double gene expression vector pIRES-Gluc-2D6(structural representation collection of illustrative plates that obtains).Build
Include CYP2D6(*1 respectively) the CYP2D6.92 mutant of cDNA, CYP2D6*2cDNA, CYP2D6*10cDNA and the present invention
Four kinds of CYP2D6 double gene expression vectors of cDNA.
By 5 × 105Individual 293FT cell (people's renal epithelial cell is originated, purchased from Invitrogen company) is uniformly laid on 6 holes
Plate;After incubated overnight, utilize liposome lip2000(Invitrogen company) transfect 2 μ g plasmid vector pIRES-Gluc-2D6,
To express various destination protein CYP2D6 and internal reference Protein G luc.Carry out western hybridization check after transfection 24h, determine above-mentioned
Four kinds of destination proteins are the most correctly expressed.
Cell is cultivated and liposome transfection is techniques well known, the illustration method provided with reference to Invitrogen company
Just can carry out.
2) living cells incubated in vitro probe medicament
Continue to cultivate after 24 hours, by single hole cell dissociation in 6 orifice plates and resuspended (use EP pipe to 300 μ l culture medium
Carry out).Two kinds of CYP2D6 classics probe medicine dextromethorphans (buying from Sigma Co., USA) and bufuralol is used (to buy certainly
Toronto Research Chemicals company of Canada) detect the activity of this enzyme, the final concentration of two kinds of medicines is respectively 20 μ
M and 10 μMs.At 37 DEG C, at 5%CO2In incubator, 3h is hatched in 300rpm concussion.From CO2Incubator takes out culture, adds
The 0.1M NaOH of 20 μ L also shakes vortex 1min(reason and is bufuralol and dextromethorphan is all weak base, and solution NaOH alkalizes
After will exist with molecular conformation, in next step extraction process, be easily accessible organic facies thus be extracted out).Add 800 μ L
Glacial acetic acid ethyl ester, concussion vortex 2min is placed on-40 DEG C of refrigerator 30min, until lower floor's frost.Take out sample, at 4 DEG C, with
12000g is centrifuged 10min.Upper strata ethyl acetate is transferred in new EP pipe, ethyl acetate is dried up by 37 DEG C of Nitrogen evaporators.
Add 200 μ L each initial flow phase solution to redissolve, after concussion vortex 1min, be centrifuged 5min with 12000g.Supernatant uses initial flow
Dynamic phase solution is transferred in sample injection bottle after diluting by 1:10.
3) LC-MS/MS detection
After abstraction purification, sample carries out LC-MS/MS detection on 1260-6410 type instrument (Agilent company of the U.S.),
HPLC uses ZORBAX SB-C18 post (150mm × 4.6mm, diameter 5 μm).
Dextromethorphan testing conditions:
Chromatographic condition
Column temperature: 30 DEG C
Chromatographic column: ZORBAX SB-C18 (Agilent, 5 μm, 4.6 × 150mm)
Sampling volume: 2 μ L
Flow velocity: 0.6mL/min
Operation time: 8min
Table 3: dextromethorphan mobile phase ratio
Time (min) | 10mM ammonium acetate (%, v/v) | Methanol (%, v/v) |
0.01 | 40 | 60 |
0.5 | 5 | 95 |
4 | 5 | 95 |
4.01 | 40 | 60 |
8 | 40 | 60 |
Mass Spectrometry Conditions:
Electron spray (ESI) ion source (cation), many reaction detection scanning (MRM) pattern;
Ionogenic temperature (TEM): 300 DEG C;
Curtain gas speed: 11L/min;
Capillary voltage: 4000V;
Dextromethorphan Q1/Q3:272.2/213.1;272.2/147.1;
Impact energy=30;
Parent ion fragmentation voltage=140;
Demethyl dextromethorphan Q1/Q3:258.2-157.1;258.2-133.1;
Impact energy=35;
Parent ion fragmentation voltage=135.
Bufuralol testing conditions:
Chromatographic condition:
Column temperature: 30 DEG C
Chromatographic column: ZORBAX SB-C18 (Agilent, 5 μm, 4.6 × 150mm)
Sampling volume: 1 μ L
Flow velocity: 0.6mL/min
Operation time: 10min
Table 4: bufuralol mobile phase ratio
Time (min) | 10mM ammonium acetate (%, v/v) | Methanol (%, v/v) |
0.01 | 30 | 70 |
0.8 | 5 | 95 |
3 | 5 | 95 |
4.01 | 30 | 70 |
10 | 30 | 70 |
Mass Spectrometry Conditions:
Electron spray (ESI) ion source (cation), many reaction detection scanning (MRM) pattern;
Ionogenic temperature (TEM): 350 DEG C;
Curtain gas speed: 11L/min;
Capillary voltage: 4000V;
Bufuralol Q1/Q3:262.2/188.1;268.2/186.1;
Impact energy=10;
Parent ion fragmentation voltage=110;
1 '-hydroxyl bufuralol Q1/Q3:278.2/186.1;278.2/159.1;
Impact energy=15;
Parent ion fragmentation voltage=90.
4) LC-MS/MS detects data analysis
The different dextromethorphan of gradient concentration of preparation, bufuralol and corresponding metabolite demethyl dextromethorphan, 1 '-hydroxyl
Base bufuralol (dextromethorphan: 2500,1250,500,250,100,20ng/mL;1500,750 demethyl dextromethorphan:,
300、150、50、25ng/mL;Bufuralol: 1000,500,250,100,50,25ng/mL;1 '-hydroxyl bufuralol: 800,
400,200,100,50,25ng/mL), generate standard curve after utilizing LC-MS detection, and in order to detect various CYP2D6 albumen
To dextromethorphan and the metabolic condition of bufuralol, then represent the metabolism of this probe medicine with [product/(product+substrate)]
Rate, after internal reference Gluc data calibration, represents saltant type egg with the ratio of the metabolic rate of saltant type Yu the metabolic rate of wild type
White enzymatic activity.Every kind of albumen, for In vitro metabolism experiment repetition 3-4 time respectively of two kinds of probe medicaments, is added up after averaging
Result is shown in Table 5 respectively, table 6 and Fig. 3;Various albumen the typical Mass Spectrometer Method result of dextromethorphan and bufuralol is shown in Fig. 4,
Fig. 5.The metabolic capacity of CYP2D6 variant is the strongest, and the peak area at substrate (dextromethorphan or bufuralol) peak will be the least, and
The peak area at product (demethyl dextromethorphan or 1 '-hydroxyl bufuralol) peak will be the biggest.It can be seen that owing to sending out
Raw frameshift mutation, the aminoacid composition of CYP2D6.92 is only the first half of wild type CYP2D6 albumen, therefore new variant
The metabolic capacity of CYP2D6.92 is almost nil, hence it is evident that less than wild type, typical case mutant CYP2D6.2 and CYP2D6.10.
The enzymatic activity result of table 5:293FT cell incubation probe medicament dextromethorphan
* refer to and the relative value of wild type CYP2D6.1
* p value < 0.05
The enzymatic activity result of table 6:293FT cell incubation probe medicament bufuralol
* refer to and the relative value of wild type CYP2D6.1
* p value < 0.05
Testing result shows, relative to wild type CYP2D6.1 type, it is known that typical defect type mutant CYP2D6.2 is to the right side
The metabolic activity of dromethan declines inconspicuous (about 5%), but bright to the metabolic activity of another probe medicament bufuralol
Aobvious decline, fall is about 19%;Another typical defect type mutant CYP2D6.10 is for the generation of two kinds of probe medicaments
Thanking to activity to be all decreased obviously (reduction amplitude is about 90%), this result is basically identical with existing document, shows our external inspection
The data that survey system obtains have the highest credibility (seeing list of references 6,7).
Utilize this vitro detection system it can be seen that CYP2D6.92 mutant is to probe medicament dextromethorphan and fourth furan Lip river
Your metabolic activity is respectively the 0.17% and 0.45% of wild type.Statistical analysis shows, compared with wild type, and CYP2D6.92
The metabolic activity of mutant declines, and has significant difference, and the metabolic activity pointing out this sudden change can cause expressed enzyme is obvious
Reduce.Therefore, in practice, need to consider the individuality carrying this genotype suitably to be regulated on dosage, as subtracted
The usage amount of few medicine and the generation avoiding adverse effect.This medicine by gene targeting adjusts for individual diversity
Different bigger medicine (such as imipramine, amitriptyline etc.) is even more important.
List of references
1.Zhou SF.Polymorphism of Human Cytochrome P4502D6and Its Clinical
Significance:Part I.Clinical Pharmacokinetics.2009,48(11):689-723.
2.Qin S,Shen L,Zhang A,et al.Systematic polymorphism analysis of the
CYP2D6gene in four different geographical Han populations in mainland
China.Genomics.2008,92(3):152-158.
3.ZHOU SF.Polymorphism of Human Cytochrome P4502D6and Its Clinical
Significance Part II.Clinical pharmacokinetics.2009,48(12):761-804.
4. Xu Yan spoils, and Gong Sen, Ji Hongyan wait .CYP2D6 gene pleiomorphism and clinical meaning thereof. medicine Leader .2012,31
(10):1337-1340.
5.Dai DP,Xu RA,Hu LM,Wang SH,Geng PW,Yang JF,et al.CYP2C9polymorphism
analysis in Han Chinese populations:building the largest allele frequency
database.Pharmacogenomics J.2013,DOI:10.1038/tpj.2013.2.
6.Wennerholm A,Johansson I,Hidestrand M,Bertilsson L,Gustafsson LL,
Ingelman-Sundberg M.Characterization of the CYP2D6*29allele commonly present
in a black Tanzanian population causing reduced catalytic
activity.Pharmacogenetics2001,11:417-427.
7.Sakuyama K,Sasaki T,Ujiie S,Obata K,Mizugaki M,Ishikawa M et
al.Functional characterization of17CYP2D6allelic variants(CYP2D6.2,10,14A-B,
18,27,36,39,47-51,53-55,and57).Drug Metab Dispos.2008,36:2460-2467。
Sequence:
SEQ ID NO.1: allelic sequences
ATGGGGCTAGAAGCACTGGTGCCCCTGGCCGTGATAGTGGCCATCTTCCTGCTCCTGGTGGACCTGATGCACCGGCG
CCAACGCTGGGCTGCACGCTACCCACCAGGCCCCCTGCCACTGCCCGGGCTGGGCAACCTGCTGCATGTGGACTTCC
AGAACACACCATACTGCTTCGACCAGGTGAGGGAGGAGGTCCTGGAGGGCGGCAGAGGTGCTGAGGCTCCCCTACCA
GAAGCAAACATGGATGGTGGGTGAAACCACAGGCTGGACCAGAAGCCAGGCTGAGAAGGGGAAGCAGGTTTGGGGGA
CGTCCTGGAGAAGGGCATTTATACATGGCATGAAGGACTGGATTTTCCAAAGGCCAAGGAAGAGTAGGGCAAGGGCC
TGGAGGTGGAGCTGGACTTGGCAGTGGGCATGCAAGCCCATTGGGCAACATATGTTATGGAGTACAAAGTCCCTTCT
GCTGACACCAGAAGGAAAGGCCTTGGGAATGGAAGATGAGTTAGTCCTGAGTGCCGTTTAAATCACGAAATCGAGGA
TGAAGGGGGTGCAGTGACCCGGTTCAAACCTTTTGCACTGTGGGTCCTCGGGCCTCACTGCCTCACCGGCATGGACC
ATCATCTGGGAATGGGATGCTAACTGGGGCCTCTCGGCAATTTTGGTGACTCTTGCAAGGTCATACCTGGGTGACGC
ATCCAAACTGAGTTCCTCCATCACAGAAGGTGTGACCCCCACCCCCGCCCCACGATCAGGAG
GCTGGGTCTCCTCCTTCCACCTGCTCACTCCTGGTAGCCCCGGGGGTCGTCCAAGGTTCAAATAGGACTAGGACCTG
TAGTCTGGGGTGATCCTGGCTTGACAAGAGGCCCTGACCCTCCCTCTGCAGTTGCGGCGCCGCTTCGGGGACGTGTT
CAGCCTGCAGCTGGCCTGGACGCCGGTGGTCGTGCTCAATGGGCTGGCGGCCGTGCGCGAGGCGCTGGTGACCCACG
GCGAGGACACCGCCGACCGCCCGCCTGTGCCCATCACCCAGATCCTGGGTTTCGGGCCGCGTTCCCAAGGCAAGCAG
CGGTGGGGACAGAGACAGATTTCCGTGGGACCCGGGTGGGTGATGACCGTAGTCCGAGCTGGGCAGAGAGGGCGCGG
GGTCGTGGACATGAAACAGGCCAGCGAGTGGGGACAGCGGGCCAAGAAACCACCTGCACTAGGGAGGTGTGAGCATG
GGGACGAGGGCGGGGCTTGTGACGAGTGGGCGGGGCCACTGCCGAGACCTGGCAGGAGCCCAATGGGTGAGCGTGGC
GCATTTCCCAGCTGGAATCCGGTGTCGAAGTGGGGGCGGGGACCGCACCTGTGCTGTAAGCTCAGTGTGGGTGGCGC
GGGGCCCGCGGGGTCTTCCCTGAGTGCAAAGGCGGTCAGGGTGGGCAGAGACGAGGTGGGGCAAAGCCTGCCCCAGC
CAAGGGAGCAAGGTGGATGCACAAAGAGTGGGCCCTGTGACCAGCTGGACAGAGCCAGGGACTGCGGGAGACCAGGG
GGAGCATAGGGTTGGAGTGGGTGGTGGATGGTGGGGCTAATGCCTTCATGGCCACGCGCACGTGCCCGTCCCACCCC
CAGGGGTGTTCCTGGCGCGCTATGGGCCCGCGTGGCGCGAGCAGAGGCGCTTCTCCGTGTCCACCTTGCGCAACTTG
GGCCTGGGCAAGAAGTCGCTGGAGCAGTGGGTGACCGAGGAGGCCGCCTGCCTTTGTGCCGCCTTCGCCAACCACTC
CGGTGGGTGATGGGCAGAAGGGCACAAAGCGGGAACTGGGAAGGCGGGGGACGGGGAAGGCGACCCCTTACCCGCAT
CTCCCACCCCCAGGACGCCCCTTTCGCCCCAACGGTCTCTTGGACAAAGCCGTGAGCAACGTGATCGCCTCCCTCAC
CTGCGGGCGCCGCTTCGAGTACGACGACCCTCGCTTCCTCAGGCTGCTGGACCTAGCTCAGGAGGGACTGAAGGAGG
AGTCGGGTTTCTGCGCGAGGTGCGGAGCGAGAGACCGAGGAGTCTCTGCAGGGCGAGCTCCCGAGAGGTGCCGGGGC
TGGACTGGGGCCTCGGAAGAGCAGGATTTGCATAGATGGGTTTGGGAAAGGACATTCCAGGAGACCCCACTGTAAGA
AGGGCCTGGAGGAGGAGGGGACATCTCAGACATGGTCGTGGGAGAGGTGTGCCCGGGTCAGGGGGCACCAGGAGAGG
CCAAGGACTCTGTACCTCCTATCCACGTCAGAGATTTCGATTTTAGGTTTCTCCTCTGGGCAAGGAGAGAGGGTGGA
GGCTGGCACTTGGGGAGGGACTTGGTGAGGTCAGTGGTAAGGACAGGCAGGCCCTGGGTCTACCTGGAGATGGCTGG
GGCCTGAGACTTGTCCAGGTGAACGCAGAGCACAGGAGGGATTGAGACCCCGTTCTGTCTGGTGTAGGTGCTGAATG
CTGTCCCCGTCCTCCTGCATATCCCAGCGCTGGCTGGCAAGGTCCTACGCTTCCAAAAGGCTTTCCTGACCCAGCTG
GATGAGCTGCTAACTGAGCACAGGATGACCTGGGACCCAGCCCAGCCCCCCCGAGACCTGACTGAGGCCTTCCTGGC
AGAGATGGAGAAGGTGAGAGTGGCTGCCACGGTGGGGGGCAAGGGTGGTGGGTTGAGCGTCCCAGGAGGAATGAGGG
GAGGCTGGGCAAAAGGTTGGACCAGTGCATCACCCGGCGAGCCGCATCTGGGCTGACAGGTGCAGAATTGGAGGTCA
TTTGGGGGCTACCCCGTTCTGTCCCGAGTATGCTCTCGGCCCTGCTCAGGCCAAGGGGAACCCTGAGAGCAGCTTCA
ATGATGAGAACCTGCGCATAGTGGTGGCTGACCTGTTCTCTGCCGGGATGGTGACCACCTCGACCACGCTGGCCTGG
GGCCTCCTGCTCATGATCCTACATCCGGATGTGCAGCGTGAGCCCATCTGGGA
AACAGTGCAGGGGCCGAGGGAGGAAGGGTACAGGCGGGGGCCCATGAACTTTGCTGGGACACCCGGGGCTCCAAGCA
CAGGCTTGACCAGGATCCTGTAAGCCTGACCTCCTCCAACATAGGAGGCAAGAAGGAGTGTCAGGGCCGGACCCCCT
GGGTGCTGACCCATTGTGGGGACGCATGTCTGTCCAGGCCGTGTCCAACAGGAGATCGACGACGTGATAGGGCAGGT
GCGGCGACCAGAGATGGGTGACCAGGCTCACATGCCCTACACCACTGCCGTGATTCATGAGGTGCAGCGCTTTGGGG
ACATCGTCCCCCTGGGTGTGACCCATATGACATCCCGTGACATCGAAGTACAGGGCTTCCGCATCCCTAAGGTAGGC
CTGGCGCCCTCCTCACCCCAGCTCAGCACCAGCACCTGGTGATAGCCCCAGCATGGCTACTGCCAGGTGGGCCCACT
CTAGGAACCCTGGCCACCTAGTCCTCAATGCCACCACACTGACTGTCCCCACTTGGGTGGGGGGTCCAGAGTATAGG
CAGGGCTGGCCTGTCCATCCAGAGCCCCCGTCTAGTGGGGAGACAAACCAGGACCTGCCAGAATGTTGGAGGACCCA
ACGCCTGCAGGGAGAGGGGGCAGTGTGGGTGCCTCTGAGAGGTGTGACTGCGCCCTGCTGTGGGGTCGGAGAGGGTA
CTGTGGAGCTTCTCGGGCGCAGGACTAGTTGACAGAGTCCAGCTGTGTGCCAGGCAGTGTGTGTCCCCCGTGTGTTT
GGTGGCAGGGGTCCCAGCATCCTAGAGTCCAGTCCCCACTCTCACCCTGCATCTCCTGCCCAGGGAACGACACTCAT
CACCAACCTGTCATCGGTGCTGAAGGATGAGGCCGTCTGGGAGAAGCCCTTCCGCTTCCACCCCGAACACTTCCTGG
ATGCCCAGGGCCACTTTGTGAAGCCGGAGGCCTTCCTGCCTTTCTCAGCAGGTGCCTGTGGGGAGCCCGGCTCCCTG
TCCCCTTCCGTGGAGTCTTGCAGGGGTATCACCCAGGAGCCAGGCTCACTGACGCCCCTCCCCTCCCCACAGGCCGC
CGTGCATGCCTCGGGGAGCCCCTGGCCCGCATGGAGCTCTTCCTCTTCTTCACCTCCCTGCTGCAGCACTTCAGCTT
CTCGGTGCCCACTGGACAGCCCCGGCCCAGCCACCATGGTGTCTTTGCTTTCCTGGTGAGCCCATCCCCCTATGAGC
TTTGTGCTGTGCCCCGCTAG
SEQ ID NO.2: coded sequence
ATGGGGCTAGAAGCACTGGTGCCCCTGGCCGTGATAGTGGCCATCTTCCTGCTCCTGGTGGACCTGATGCACCGGCG
CCAACGCTGGGCTGCACGCTACCCACCAGGCCCCCTGCCACTGCCCGGGCTGGGCAACCTGCTGCATGTGGACTTCC
AGAACACACCATACTGCTTCGACCAGTTGCGGCGCCGCTTCGGGGACGTGTTCAGCCTGCAGCTGGCCTGGACGCCG
GTGGTCGTGCTCAATGGGCTGGCGGCCGTGCGCGAGGCGCTGGTGACCCACGGCGAGGACACCGCCGACCGCCCGCC
TGTGCCCATCACCCAGATCCTGGGTTTCGGGCCGCGTTCCCAAGGGGTGTTCCTGGCGCGCTATGGGCCCGCGTGGC
GCGAGCAGAGGCGCTTCTCCGTGTCCACCTTGCGCAACTTGGGCCTGGGCAAGAAGTCGCTGGAGCAGTGGGTGACC
GAGGAGGCCGCCTGCCTTTGTGCCGCCTTCGCCAACCACTCCGGACGCCCCTTTCGCCCCAACGGTCTCTTGGACAA
AGCCGTGAGCAACGTGATCGCCTCCCTCACCTGCGGGCGCCGCTTCGAGTACGACGACCCTCGCTTCCTCAGGCTGC
TGGACCTAGCTCAGGAGGGACTGAAGGAGGAGTCGGGTTTCTGCGCGAGGTGCTGA
SEQ ID NO.3: protein sequence
MGLEALVPLAVIVAIFLLLVDLMHRRQRWAARYPPGPLPLPGLGNLLHVDFQNTPYCFDQLRRRFGDVFSLQLAWTP
VVVLNGLAAVREALVTHGEDTADRPPVPITQILGFGPRSQGV
FLARYGPAWREQRRFSVSTLRNLGLGKKSLEQWVTEEAACLCAAFANHSGRPFRPNGLLDKAVSNVIASLTCGRRFE
YDDPRFLRLLDLAQEGLKEESGFCARC
SEQ ID NO.14: nucleic acid fragment
GGAGTCGGGTTTCTGCGCGA
SEQ ID NO.15: nucleic acid fragment
AAGGAGGAGTCGGGTTTCTGCGCGAGGTGC
SEQ ID NO.16: nucleic acid fragment
GACTGAAGGAGGAGTCGGGTTTCTGCGCGAGGTGCGGAGC
SEQ ID NO.17: nucleic acid fragment
GGAGGGACTGAAGGAGGAGTCGGGTTTCTGCGCGAGGTGCGGAGCGAGAG
SEQ ID NO.18: nucleic acid fragment
AGGAGGAGTCGGGTTTCTGCGCGAGGTGCTGA
SEQ ID NO.19: oligonucleotide fragment
CACCTCGCGCAGAAAC
SEQ ID NO.20: oligonucleotide fragment
TCAGCACCTCGCGCAGAAACC
SEQ ID NO.21: oligonucleotide fragment
CTCGCTCCGCACCTCGCGCAGAAAC
SEQ ID NO.22: oligonucleotide fragment
CTCGCGCAGAAACCCGACTCCTCC
SEQ ID NO.23: oligonucleotide fragment
CGCACCTCGCGCAGAAACCCGACTCCTCCTT
SEQ ID NO.24: wild type CYP2D6 allelic sequences
ATGGGGCTAGAAGCACTGGTGCCCCTGGCCGTGATAGTGGCCATCTTCCTGCTCCTGGTGGACCTGATGCACCGGCG
CCAACGCTGGGCTGCACGCTACCCACCAGGCCCCCTGCCACTGCCCGGGCTGGGCAACCTGCTGCATGTGGACTTCC
AGAACACACCATACTGCTTCGACCAGGTGAGGGAGGAGGTCCTGGAGGGCGGCAGAGGTGCTGAGGCTCCCCTACCA
GAAGCAAACATGGATGGTGGGTGAAACCACAGGCTGGACCAGAAGCCAGGCTGAGAAGGGGAAGCAGGTTTGGGGGA
CGTCCTGGAGAAGGGCATTTATACATGGCATGAAGGACTGGATTTTCCAAAGGCCAAGGAAGAGTAGGGCAAGGGCC
TGGAGGTGGAGCTGGACTTGGCAGTGGGCATGCAAGCCCATTGGGCAACATATGTTATGGAGTACAAAGTCCCTTCT
GCTGACACCAGAAGGAAAGGCCTTGGGAATGGAAGATGAGTTAGTCCTGAGTGCCGTTTAAATCACGAAATCGAGGA
TGAAGGGGGTGCAGTGACCCGGTTCAAACCTTTTGCACTGTGGGTCCTCGGGCCTCACTGCCTCACCGGCATGGACC
ATCATCTGGGAATGGGATGCTAACTGGGGCCTCTCGGCAATTTTGGTGACTCTTGCAAGGTCATACCTGGGTGACGC
ATCCAAACTGAGTTCCTCCATCACAGAAGGTGTGACCCCCACCCCCGCCCCACGATCAGGAGGCTGGGTCTCCTCCT
TCCACCTGCTCACTCCTGGTAGCCCCGGGGGTCGTCCAAGGTTCAAATAGGACTAGGACCTGTAGTCTGGGGTGATC
CTGGCTTGACAAGAGGCCCTGACCCT
CCCTCTGCAGTTGCGGCGCCGCTTCGGGGACGTGTTCAGCCTGCAGCTGGCCTGGACGCCGGTGGTCGTGCTCAATG
GGCTGGCGGCCGTGCGCGAGGCGCTGGTGACCCACGGCGAGGACACCGCCGACCGCCCGCCTGTGCCCATCACCCAG
ATCCTGGGTTTCGGGCCGCGTTCCCAAGGCAAGCAGCGGTGGGGACAGAGACAGATTTCCGTGGGACCCGGGTGGGT
GATGACCGTAGTCCGAGCTGGGCAGAGAGGGCGCGGGGTCGTGGACATGAAACAGGCCAGCGAGTGGGGACAGCGGG
CCAAGAAACCACCTGCACTAGGGAGGTGTGAGCATGGGGACGAGGGCGGGGCTTGTGACGAGTGGGCGGGGCCACTG
CCGAGACCTGGCAGGAGCCCAATGGGTGAGCGTGGCGCATTTCCCAGCTGGAATCCGGTGTCGAAGTGGGGGCGGGG
ACCGCACCTGTGCTGTAAGCTCAGTGTGGGTGGCGCGGGGCCCGCGGGGTCTTCCCTGAGTGCAAAGGCGGTCAGGG
TGGGCAGAGACGAGGTGGGGCAAAGCCTGCCCCAGCCAAGGGAGCAAGGTGGATGCACAAAGAGTGGGCCCTGTGAC
CAGCTGGACAGAGCCAGGGACTGCGGGAGACCAGGGGGAGCATAGGGTTGGAGTGGGTGGTGGATGGTGGGGCTAAT
GCCTTCATGGCCACGCGCACGTGCCCGTCCCACCCCCAGGGGTGTTCCTGGCGCGCTATGGGCCCGCGTGGCGCGAG
CAGAGGCGCTTCTCCGTGTCCACCTTGCGCAACTTGGGCCTGGGCAAGAAGTCGCTGGAGCAGTGGGTGACCGAGGA
GGCCGCCTGCCTTTGTGCCGCCTTCGCCAACCACTCCGGTGGGTGATGGGCAGAAGGGCACAAAGCGGGAACTGGGA
AGGCGGGGGACGGGGAAGGCGACCCCTTACCCGCATCTCCCACCCCCAGGACGCCCCTTTCGCCCCAACGGTCTCTT
GGACAAAGCCGTGAGCAACGTGATCGCCTCCCTCACCTGCGGGCGCCGCTTCGAGTACGACGACCCTCGCTTCCTCA
GGCTGCTGGACCTAGCTCAGGAGGGACTGAAGGAGGAGTCGGGCTTTCTGCGCGAGGTGCGGAGCGAGAGACCGAGG
AGTCTCTGCAGGGCGAGCTCCCGAGAGGTGCCGGGGCTGGACTGGGGCCTCGGAAGAGCAGGATTTGCATAGATGGG
TTTGGGAAAGGACATTCCAGGAGACCCCACTGTAAGAAGGGCCTGGAGGAGGAGGGGACATCTCAGACATGGTCGTG
GGAGAGGTGTGCCCGGGTCAGGGGGCACCAGGAGAGGCCAAGGACTCTGTACCTCCTATCCACGTCAGAGATTTCGA
TTTTAGGTTTCTCCTCTGGGCAAGGAGAGAGGGTGGAGGCTGGCACTTGGGGAGGGACTTGGTGAGGTCAGTGGTAA
GGACAGGCAGGCCCTGGGTCTACCTGGAGATGGCTGGGGCCTGAGACTTGTCCAGGTGAACGCAGAGCACAGGAGGG
ATTGAGACCCCGTTCTGTCTGGTGTAGGTGCTGAATGCTGTCCCCGTCCTCCTGCATATCCCAGCGCTGGCTGGCAA
GGTCCTACGCTTCCAAAAGGCTTTCCTGACCCAGCTGGATGAGCTGCTAACTGAGCACAGGATGACCTGGGACCCAG
CCCAGCCCCCCCGAGACCTGACTGAGGCCTTCCTGGCAGAGATGGAGAAGGTGAGAGTGGCTGCCACGGTGGGGGGC
AAGGGTGGTGGGTTGAGCGTCCCAGGAGGAATGAGGGGAGGCTGGGCAAAAGGTTGGACCAGTGCATCACCCGGCGA
GCCGCATCTGGGCTGACAGGTGCAGAATTGGAGGTCATTTGGGGGCTACCCCGTTCTGTCCCGAGTATGCTCTCGGC
CCTGCTCAGGCCAAGGGGAACCCTGAGAGCAGCTTCAATGATGAGAACCTGCGCATAGTGGTGGCTGACCTGTTCTC
TGCCGGGATGGTGACCACCTCGACCACGCTGGCCTGGGGCCTCCTGCTCATGATCCTACATCCGGATGTGCAGCGTG
AGCCCATCTGGGAAACAGTGCAGGGGCCGAGGGAGGAAGGGTACAGGCGGGGGCCCATGAACTTTGCTGGGACACCC
GGGGCTCCAAGCACAGGCTTGACCAGGATCCTGTAAGCCTGACCTCCTCCA
ACATAGGAGGCAAGAAGGAGTGTCAGGGCCGGACCCCCTGGGTGCTGACCCATTGTGGGGACGCATGTCTGTCCAGG
CCGTGTCCAACAGGAGATCGACGACGTGATAGGGCAGGTGCGGCGACCAGAGATGGGTGACCAGGCTCACATGCCCT
ACACCACTGCCGTGATTCATGAGGTGCAGCGCTTTGGGGACATCGTCCCCCTGGGTGTGACCCATATGACATCCCGT
GACATCGAAGTACAGGGCTTCCGCATCCCTAAGGTAGGCCTGGCGCCCTCCTCACCCCAGCTCAGCACCAGCACCTG
GTGATAGCCCCAGCATGGCTACTGCCAGGTGGGCCCACTCTAGGAACCCTGGCCACCTAGTCCTCAATGCCACCACA
CTGACTGTCCCCACTTGGGTGGGGGGTCCAGAGTATAGGCAGGGCTGGCCTGTCCATCCAGAGCCCCCGTCTAGTGG
GGAGACAAACCAGGACCTGCCAGAATGTTGGAGGACCCAACGCCTGCAGGGAGAGGGGGCAGTGTGGGTGCCTCTGA
GAGGTGTGACTGCGCCCTGCTGTGGGGTCGGAGAGGGTACTGTGGAGCTTCTCGGGCGCAGGACTAGTTGACAGAGT
CCAGCTGTGTGCCAGGCAGTGTGTGTCCCCCGTGTGTTTGGTGGCAGGGGTCCCAGCATCCTAGAGTCCAGTCCCCA
CTCTCACCCTGCATCTCCTGCCCAGGGAACGACACTCATCACCAACCTGTCATCGGTGCTGAAGGATGAGGCCGTCT
GGGAGAAGCCCTTCCGCTTCCACCCCGAACACTTCCTGGATGCCCAGGGCCACTTTGTGAAGCCGGAGGCCTTCCTG
CCTTTCTCAGCAGGTGCCTGTGGGGAGCCCGGCTCCCTGTCCCCTTCCGTGGAGTCTTGCAGGGGTATCACCCAGGA
GCCAGGCTCACTGACGCCCCTCCCCTCCCCACAGGCCGCCGTGCATGCCTCGGGGAGCCCCTGGCCCGCATGGAGCT
CTTCCTCTTCTTCACCTCCCTGCTGCAGCACTTCAGCTTCTCGGTGCCCACTGGACAGCCCCGGCCCAGCCACCATG
GTGTCTTTGCTTTCCTGGTGAGCCCATCCCCCTATGAGCTTTGTGCTGTGCCCCGCTAG
SEQ ID NO.25: wild type CYP2D6 coded sequence
ATGGGGCTAGAAGCACTGGTGCCCCTGGCCGTGATAGTGGCCATCTTCCTGCTCCTGGTGGACCTGATGCACCGGCG
CCAACGCTGGGCTGCACGCTACCCACCAGGCCCCCTGCCACTGCCCGGGCTGGGCAACCTGCTGCATGTGGACTTCC
AGAACACACCATACTGCTTCGACCAGTTGCGGCGCCGCTTCGGGGACGTGTTCAGCCTGCAGCTGGCCTGGACGCCG
GTGGTCGTGCTCAATGGGCTGGCGGCCGTGCGCGAGGCGCTGGTGACCCACGGCGAGGACACCGCCGACCGCCCGCC
TGTGCCCATCACCCAGATCCTGGGTTTCGGGCCGCGTTCCCAAGGGGTGTTCCTGGCGCGCTATGGGCCCGCGTGGC
GCGAGCAGAGGCGCTTCTCCGTGTCCACCTTGCGCAACTTGGGCCTGGGCAAGAAGTCGCTGGAGCAGTGGGTGACC
GAGGAGGCCGCCTGCCTTTGTGCCGCCTTCGCCAACCACTCCGGACGCCCCTTTCGCCCCAACGGTCTCTTGGACAA
AGCCGTGAGCAACGTGATCGCCTCCCTCACCTGCGGGCGCCGCTTCGAGTACGACGACCCTCGCTTCCTCAGGCTGC
TGGACCTAGCTCAGGAGGGACTGAAGGAGGAGTCGGGCTTTCTGCGCGAGGTGCTGAATGCTGTCCCCGTCCTCCTG
CATATCCCAGCGCTGGCTGGCAAGGTCCTACGCTTCCAAAAGGCTTTCCTGACCCAGCTGGATGAGCTGCTAACTGA
GCACAGGATGACCTGGGACCCAGCCCAGCCCCCCCGAGACCTGACTGAGGCCTTCCTGGCAGAGATGGAGAAGGCCA
AGGGGAACCCTGAGAGCAGCTTCAATGATGAGAACCTGCGCATAGTGGTGGCTGACCTGTTCTCTGCCGGGATGGTG
ACCACCTCGACCACGCTGGCCTGGGGCCTCCTGCTCATGATCCTACATCCGGATGTGCAGCGCCGTGTC
CAACAGGAGATCGACGACGTGATAGGGCAGGTGCGGCGACCAGAGATGGGTGACCAGGCTCACATGCCCTACACCAC
TGCCGTGATTCATGAGGTGCAGCGCTTTGGGGACATCGTCCCCCTGGGTGTGACCCATATGACATCCCGTGACATCG
AAGTACAGGGCTTCCGCATCCCTAAGGGAACGACACTCATCACCAACCTGTCATCGGTGCTGAAGGATGAGGCCGTC
TGGGAGAAGCCCTTCCGCTTCCACCCCGAACACTTCCTGGATGCCCAGGGCCACTTTGTGAAGCCGGAGGCCTTCCT
GCCTTTCTCAGCAGGCCGCCGTGCATGCCTCGGGGAGCCCCTGGCCCGCATGGAGCTCTTCCTCTTCTTCACCTCCC
TGCTGCAGCACTTCAGCTTCTCGGTGCCCACTGGACAGCCCCGGCCCAGCCACCATGGTGTCTTTGCTTTCCTGGTG
AGCCCATCCCCCTATGAGCTTTGTGCTGTGCCCCGCTAG 。
Claims (7)
1. nucleic acid fragment, described nucleic acid fragment comprises the 1994th G corresponding to SEQ ID NO.1 and two of the 1995th T
Continuous nucleotide, and be at least 10 continuous nucleotides in the nucleotide sequence shown in SEQ ID NO.1 or its reverse complemental
Sequence;Or described nucleic acid fragment comprises the 653rd G corresponding to SEQ ID NO.2 and two continuous nucleoside of the 654th T
Acid, and be at least 10 continuous nucleotides in the nucleotide sequence shown in SEQ ID NO.2 or its reverse complementary sequence.
Nucleic acid fragment the most according to claim 1, it is characterised in that the length of described nucleic acid fragment is 10-100,101-
200,201-500 or 501-1000 nucleotide.
Nucleic acid fragment the most according to claim 1, it is characterised in that the length of described nucleic acid fragment be 10-20,21-30,
31-40,41-50,51-60,61-100 or 101-300 nucleotide.
Nucleic acid fragment the most according to claim 1, it is characterised in that described nucleic acid fragment be SEQ ID NO.1,2,14-
Sequence shown in 18.
5. for detecting and/or analyze a test kit for single-base deletion mutation, including according to any one of claim 1-4 institute
The nucleic acid fragment stated.
6. according to the answering in the medicine of preparation detection CYP2D6 gene mutation of the nucleic acid fragment described in any one of claim 1-4
With;Or the application in preparation is used as the check mark thing of detection CYP2D6 gene mutation.
7.CYP2D6 albumen, described protein sequence is the sequence shown in SEQ ID NO.3.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201310404385.3A CN103451213B (en) | 2013-09-06 | 2013-09-06 | CYP2D6 genetic fragment, coded protein fragments and application thereof including 1995 C disappearances |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN201310404385.3A CN103451213B (en) | 2013-09-06 | 2013-09-06 | CYP2D6 genetic fragment, coded protein fragments and application thereof including 1995 C disappearances |
Publications (2)
Publication Number | Publication Date |
---|---|
CN103451213A CN103451213A (en) | 2013-12-18 |
CN103451213B true CN103451213B (en) | 2016-11-16 |
Family
ID=49734050
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN201310404385.3A Active CN103451213B (en) | 2013-09-06 | 2013-09-06 | CYP2D6 genetic fragment, coded protein fragments and application thereof including 1995 C disappearances |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN103451213B (en) |
Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN101109018A (en) * | 2007-06-07 | 2008-01-23 | 上海交通大学 | Method of detecting mononucleotide pleomorphism of CYP2D6 gene ninth exon |
WO2008032921A1 (en) * | 2006-09-11 | 2008-03-20 | Inje University Industry-Academic Cooperation Foundation | Htsnps for determining a genotype of cytochrome p450 1a2, 2a6 and 2d6, pxr and udp-glucuronosyltransferase 1a gene and multiplex genotyping methods using thereof |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN103614388B (en) * | 2013-09-04 | 2015-10-28 | 蔡剑平 | Comprise the CYP2D6 gene fragment of 1735G > C sudden change, coded protein fragments and application thereof |
-
2013
- 2013-09-06 CN CN201310404385.3A patent/CN103451213B/en active Active
Patent Citations (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2008032921A1 (en) * | 2006-09-11 | 2008-03-20 | Inje University Industry-Academic Cooperation Foundation | Htsnps for determining a genotype of cytochrome p450 1a2, 2a6 and 2d6, pxr and udp-glucuronosyltransferase 1a gene and multiplex genotyping methods using thereof |
CN101109018A (en) * | 2007-06-07 | 2008-01-23 | 上海交通大学 | Method of detecting mononucleotide pleomorphism of CYP2D6 gene ninth exon |
Non-Patent Citations (1)
Title |
---|
中国少数民族基因组DNA样本库的建立和CYP2D6在维吾尔族人群中的多态性分布规律;满序聪;《中国优秀硕士学位论文全文数据库医药卫生科技辑》;20121115(第11期);摘要、正文第1页以及表3-4 * |
Also Published As
Publication number | Publication date |
---|---|
CN103451213A (en) | 2013-12-18 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN108977531B (en) | A kind of human hypertension's risk genes polymorphic detection kit and its preparation method and application | |
Ramkissoon et al. | Nonisotopic detection of microRNA using digoxigenin labeled RNA probes | |
CN109055367B (en) | A kind of mankind ALDH2 genetic polymorphism detection kit and its preparation method and application | |
CN109182501A (en) | A kind of folic acid metabolism genetic polymorphism detection primer and kit | |
CN103436545B (en) | CYP2D6 gene segment containing 4094C)A mutant, protein segment coded by same and application thereof | |
CN103614388B (en) | Comprise the CYP2D6 gene fragment of 1735G > C sudden change, coded protein fragments and application thereof | |
CN103614390B (en) | Comprise the CYP2D6 gene fragment of 2519A > C sudden change, coded protein fragments and application thereof | |
CN103451213B (en) | CYP2D6 genetic fragment, coded protein fragments and application thereof including 1995 C disappearances | |
CN103436543A (en) | CYP2D6 gene segment containing 3334G>A mutant, protein segment coded by same and application thereof | |
CN103614394B (en) | Including 4041C > T sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof | |
CN103451210B (en) | Including 2943G > A sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof | |
CN103451212B (en) | Including 3195G > A sudden change CYP2D6 genetic fragment, coded protein fragments and application thereof | |
CN103525839B (en) | Comprise the CYP2D6 gene fragment of 74G > A sudden change, coded protein fragments and application thereof | |
CN106244688A (en) | A kind of mark assessing adenocarcinoma of colon risk | |
CN103451208B (en) | Comprise the CYP2D6 gene fragment of 1984G > A sudden change, coded protein fragments and application thereof | |
CN103451209B (en) | Comprise the CYP2D6 gene fragment of 3177G > A sudden change, coded protein fragments and application thereof | |
CN103451207B (en) | Comprise the CYP2D6 gene fragment of 3202G > A sudden change, coded protein fragments and application thereof | |
CN103451211B (en) | Comprise the CYP2D6 gene fragment of 14C > T sudden change, coded protein fragments and application thereof | |
CN103436546B (en) | Comprise the CYP2D6 gene fragment of 4110C > G sudden change, coded protein fragments and application thereof | |
CN103614392B (en) | Comprise the CYP2D6 gene fragment of 1693A > G sudden change, coded protein fragments and application thereof | |
CN103614391B (en) | Comprise the CYP2D6 gene fragment of 3181A > G sudden change, coded protein fragments and application thereof | |
CN103451206B (en) | Comprise the CYP2D6 gene fragment of 4212C > T sudden change, coded protein fragments and application thereof | |
CN103627715B (en) | Comprise the CYP2D6 genetic fragment of 3895C > T sudden change, coded protein fragments and application thereof | |
CN103614393B (en) | Comprise the CYP2D6 gene fragment of 1678T > C sudden change, coded protein fragments and application thereof | |
CN103436544B (en) | Comprise the CYP2D6 genetic fragment of 1745C > G sudden change, coded protein fragments and application thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C14 | Grant of patent or utility model | ||
GR01 | Patent grant | ||
TR01 | Transfer of patent right | ||
TR01 | Transfer of patent right |
Effective date of registration: 20220610 Address after: 100730, 1 Dahua Road, Dongcheng District, Beijing, Dongdan Patentee after: BEIJING Hospital Address before: 100730 central laboratory, 9th floor, science and education building, No.1 Dahua Road, Dongdan, Dongcheng District, Beijing Patentee before: Cai Jianping |