CN102168088B - T cell immunogen gene TI and applications thereof in foot-and-mouth disease protein subunit vaccine and inactivated vaccine - Google Patents
T cell immunogen gene TI and applications thereof in foot-and-mouth disease protein subunit vaccine and inactivated vaccine Download PDFInfo
- Publication number
- CN102168088B CN102168088B CN 201010601585 CN201010601585A CN102168088B CN 102168088 B CN102168088 B CN 102168088B CN 201010601585 CN201010601585 CN 201010601585 CN 201010601585 A CN201010601585 A CN 201010601585A CN 102168088 B CN102168088 B CN 102168088B
- Authority
- CN
- China
- Prior art keywords
- cell
- vaccine
- immune
- foot
- mouth disease
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Active
Links
Images
Landscapes
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
The invention discloses a T cell immunogen named TI, comprising multiple T cell epitopes and two general T cell epitopes on foot-and-mouth disease virus VP1, VP4, 3A and 3D proteins. The T cell immunogen has a nucleotide sequence as shown in SEQ ID NO: 1 and simultaneously expresses linking encoding genes of two O and Asia 1 serum type foot-and-mouth disease viruses VP1, wherein the expression product is named OA-VPI. The TI immunogen has good effects of specific liquid induction and cell immune response, is a good immune synergist, and can be used as an effective ingredient in the foot-and-mouth disease protein subunit vaccine and the inactivated vaccine so as to improve the immune effect of the vaccine.
Description
Technical field
The present invention relates to the veterinary drug field, especially a kind of T cellular immunization protogene TI and in fmd protein subunit vaccine and inactivated vaccine, using.
Background technology
Foot and mouth disease (Foot-and-Mouth Disease, FMD) be by foot and mouth disease virus (FMDV) cause a kind of acute, hot, the height contagiousness animal epidemic.Mainly infect artiodactyls such as pig, ox, sheep, classified as the deadly infectious disease that must circulate a notice of by International Office of Epizootics.This disease route of transmission is many, velocity of propagation is fast, once repeatedly is very popular at world wide.
FMDV is Picornaviridae (Picornaviridae); This virus of member of Hostis (Aphthovirus) has seven serotypes; Be respectively O, A, C, Asia 1, SAT1, SAT2, SAT3; Each serotype can produce a lot of gene hypotypes again, no cross protection reaction between the serotype.The nucleic acid of FMDV is the RNA molecule of sub-thread normal chain; About 8500 bases of genome total length; Only contain a big ORFs; The polyprotein that expression produces cracking step by step produces viral structural protein (VP1, VP2, VP3, VP4) and Nonstructural Protein (Lab, 2A, 2B, 2C, 3A, 3B, 3C, 3D), the capsid structure of structural protein assembling generation virus.Viral capsid proteins is to induce the main immunogens that produces neutralizing antibody, and structural protein and Nonstructural Protein all contain the T cell antigen epitope of inducing cell immunity.
Sequential analysis research through monoclonal antibody and immunologic escape mutant strain in early days shows; At least there is independently neutrality epitope of 5 functions at O type FMDV (O1BFS); The G-H ring that the section of forming antigen site mainly comprises VP1 with and the C terminal amino acid, VP2 last 31,70～73; 75 and 77 amino acids, 43 and 44 site amino acid on the B-C ring of VP1; 58 amino acids that VP3 is last, VP1149 amino acids (Crowther et al., 1993) etc. participate in constituting five neutralizing epitopes.These 5 neutralizing epitopes are that all the other are conformational epitope the linear epitope except site 1.Utilize the test of synthetic peptide immunization experiment animal and ox to prove that as if site 1 is the epitope of advantage, be higher than site 1 (Samuel, 1997) but the test-results that has shows the antibody response level that is directed against site 2 behind the vaccine immunity; Wherein the immunity to G-H ring site obviously is most important, because different serotypes is viral, near the variation amplitude the G-H ring is maximum, and the G-H ring is the position (Grubman and Baxt, 2004) that virus combines cell receptor.T cell epitope produces higher levels of neutralizing antibody for inducing, as early as possible removing virus has important effect; Cooke and Westover (2008) analysis-by-synthesis the difference of different serotypes virus antigen site areas; The result shows that B-cell and T-cell antigen site areas demonstrate serotype characteristic clearly; Have been found that on the structural protein of FMDV and Nonstructural Protein 3A and 3D and all have the T-cell epitope; Some T-cell epitope is more conservative between serotype, and some differs greatly between strain; VP4 wherein, VP1,3A all contains conservative t cell epitope in the 3D albumen, and these epi-positions possibly more be prone to by the MHC molecular recognition of host cell expression, thereby in the molecular vaccine design, receive more concern.
Summary of the invention
Technical problem to be solved by this invention provides a kind of T cellular immunization protogene TI and in fmd protein subunit vaccine and inactivated vaccine, uses.
A kind of T cellular immunization protogene TI, it has the nucleotide sequence of SEQ ID NO:1.
Further, it has the aminoacid sequence of SEQ ID NO:2.
T cellular immunization protogene TI uses in fmd protein subunit vaccine and inactivated vaccine.
The result shows, compares with inactivated vaccine or the independent immune group of OA-VP1, and inactivated vaccine or OA-VP1 immune group mouse all can produce high-caliber specificity neutralizing antibody (P＜0.5) behind the interpolation TI antigen; And the CD4+T cell quantity significantly increases (P＜0.01), IFN-γ generation level significantly raise (P＜0.01).Explaining that TI antigen has the effect of good inducing specific humoral and cellular immune response, is a kind of good immunostimulant, can be used as a kind of effective ingredient in fmd protein subunit vaccine and the inactivated vaccine, to improve the immune effect of vaccine.
The present invention has designed and synthesized and has comprised two Universal T-cell epitopes and tandem expression gene from a plurality of cell epitopes of foot and mouth disease virus structural protein and Nonstructural Protein; Can be former in the hope of this expression product as a kind of T cellular immunization; Be used for protein subunit vaccine and inactivated vaccine, the level and the immune duration of protectiveness neutralizing antibody behind the raising vaccine immunity.
In the present invention, the VP1 structural protein that O and 1 two types of Asia have been expressed in the design parallel-series are verified the former immunopotentiation of expressed T cellular immunization as the blank of protein subunit vaccine.Intravital preliminary immunity test result shows mouse; Expressed T cellular immunization is former to have good immunopotentiation; Be expected to be used for to invent the fmd protein subunit vaccine or, improve the immune effect of traditional vaccine as the immunopotentiation composition of inactivated vaccine.The present invention also provides a kind of new thinking for the aftosa vaccine invention.
Description of drawings
Fig. 1 is the protein molecular quality standard for the SDS-PAGE detection .M of expressing protein TI, and 1 for not inducing the TI contrast, and 2 is to induce back TI expression product, and 3 is TI abduction delivering culture supernatant, and 4 is the deposition of TI abduction delivering product, and 5 and 6 is the TI expression product behind the purifying;
Fig. 2 is the protein molecular quality standard for the SDS-PAGE detection .M of expressing protein OA-VP1; 1 for not inducing the OA-VP1 contrast; 2 for inducing back OA-VP1 expression product; 3 is OA-VP1 abduction delivering culture supernatant, and 4 is the deposition of OA-VP1 abduction delivering product, and 5 is the OA-VP1 expression product after dialysis concentrates.;
Fig. 3 is that immune serum O type FMDV NAT is measured;
Fig. 4 is that immune serum Asia1 type FMDV NAT is measured;
Fig. 5 organizes mice spleen CD4+T cell for each and CD8+T cell subsets quantity streaming detected result .A～F is respectively 1～6 group, and G is that control group .Q2 district shows the CD4+T cell count, and the Q2-1 district shows the CD8+T cell count.
Embodiment
Below in conjunction with specific embodiment, the present invention is elaborated.
1 materials and methods
1.1 reagent
Ni-NTA His
Resins is available from Novagen company; LPS (LPS) is available from Sigma company; RPMI1640 nutrient solution, foetal calf serum are available from GIBCO company; Penicillium mould, Streptomycin sulphate mix two anti-available from crystalline substance U.S. company; Mouse lymphocyte parting liquid (EZ-SepTM Mouse1X) is a company available from reaching section; IgG2a-FITC, IgG1-PerCP, CD4-PE, IgG2a-PE, CD3-PerCP, CD8-FITC is available from U.S. company BD; Mo μ se IFN-γ ELISA Kit II detection kit is available from U.S. company BD.
1.2T design that cellular immunization is former and expression
Designed and synthesized T cellular immunization protogene TI: it is by foot and mouth disease virus VP1, VP4,3A, 3D albumen totally 11 t cell epitope genes; The general t cell epitope gene of Measles virus and from the tandem coding gene of the invasion genomic constitution of Yersinia; Link to each other with two glycocoll between each epi-position, nucleotides sequence is classified SEQ ID NO:1:CCATGGCCAAGTTCGTGGCTGCTTGGACCCTGAAAGCTGCTGCTGGCGGCT CCATCATCAACAACTACTACATGCAGCAGTACCAGAACAGCATGGGGGGCACACAG AACAACGATTGGTTCTCCAAGCTGGCCTCCAGCGCTTTCAGCGGACTGTTTGGAGG AGGAAGGACCCTGCCTACATCCTTCAACTACGGAGGAAGGAGGCAGCACACCGACG TGAGCTTTGGCGGAGCCGCCATCGAGTTCTTTGAAGGGATGGTGCACGATTCCATC AAAGGAGGAGTGGACGTGCTGCCAGTGGAGCACATCCTGTACACAAGGATGATGAT CGGCAGATTCTGCGGAGGGGTGGTGGCCAGCGACTACGATCTGGACTTCGAAGCCC TGAAGCCCCACTTTAAATCCCTGGGACAGACCATCACACCAGCCGACAAGAGCGGC GGAACCGCCAAATCCAAGAAATTCCCCAGCTACACCGCCACAIACCAGTTTTGA as;
Its protein sequence is SEQ ID NO:2:
AKFVAAWTLKAAA (Universal T-cell epitopes)-GG-VP4
(20-34)-GG-VP4
(62-81)-GG-VP1
(157-165)-GG-VP1
(26-34)-GG-3A
(21-35)-GG-3D
(182-201)-GG-3D
(342-371)-GG-TAKSKKFPSYTATYQF (Invasin), that is:
MAKFVAAWTLKAAAGGSIINNYYMQQYQNSMGGTQNNDWFSKLASSAFSGLFGGGRTLPTSFNYGGRRQHTDVSFGGAAIEFFEGMVHDSIKGGVDVLPVEHILYTRMMIGRFCGGVVASDYDLDFEALKPHFKSLGQTITPADKSGGTAKSKKFPSYTATYQF
Each constitutive protein sequence and function are seen table 1.
Sequence and the function of table 1 fusion rotein TI
The synthetic antigenic encoding sox of above-mentioned TI; And be inserted into expression vector pET30a; With this recombinant plasmid transformed e. coli bl21 (DE3) competent cell,, be transferred in the LB substratum that contains the 0.05mg/mL kalamycin by 1% then identifying male reorganization bacterium overnight cultures in the LB of kalamycin resistance liquid nutrient medium; 37 ℃ are cultured to logarithmic phase (OD600=0.6); Add IPTG to final concentration be 1mmol/L, behind 37 ℃ of shaking culture 5h, get expression product 1mL and carry out SDS-PAGE and analyze.
1.3O the tandem expression of type and Asia1 type VP1 gene
The VP1 gene of foot and mouth disease virus O/HN/93 and two representative strains of Asia 1/JS/05 increases respectively; And the series connection of the VP1 encoding sox of two serotypes inserted the pET28a expression vector; With recombinant expression vector transformed into escherichia coli BL21 (DE3) competent cell; Carry out abduction delivering, expression product called after OA-VP1 with reference to 1.2 methods.
1.4 proteic purifying and evaluation
The positive reorganization bacterium of correctly expressing target protein is cultivated and the abduction delivering target protein in a large number.Carry out purifying to expressing TI albumen application of nickel ion affinity chromatography post, purification process carries out according to Ni-NTAHis
Resins process specifications.The OA-VP1 that expresses forms inclusion body, and the purifying inclusion body is used for follow-up test, and purified product carries out SDS-PAGE and analyzes.
1.5 antigen prepd and animal immune
Adopt the concentration of quantification of protein kit measurement purifying protein, using PEG to be concentrated into final concentration then is 400 μ g/mL.Add equal-volume 206 oily adjuvants, aspirate repeatedly with the 10mL syringe and make it complete emulsification and process immunizing antigen.
With totally 70 of the Balc/b mouse in age in 6-8 week; Be divided into 7 groups (10/group) at random, the 1st～7 group is respectively two independent immune group of valency seedling, two valency seedlings/1 * TI combined immunization group; Two valency seedlings/2 * TI combined immunization group; The independent immune group of OA-VP1, OA-VP1/1 * TI combined immunization group, OA-VP1/2 * TI combined immunization group and negative control group; Inject O-Asia 1 type FMDV inactivated vaccine (production of middle peasant Witter biotechnology company) 100 μ L respectively; O-Asia 1 type inactivated vaccine 100 μ L add TI immunogen 100 μ g; O-Asia 1 type inactivated vaccine 100 μ L add 200 μ g TI immunogens, and 100 μ g purifying protein OA-VP1,100 μ g OA-VP1 add 100 μ g TI antigens; 100 μ g OA-VP1 add TI antigen 200 μ g and 100 μ LPBS, see table 2 for details.Carry out the hindlimb muscle injection after inactivated vaccine and the OA-VP1 emulsification, and carry out abdominal injection after the emulsification of TI antigen, mouse is raised in clean isolation environment.
Table 2. antigenic kind of each group's mouse immune and dosage
1.6 serum antibody dynamic monitoring and NAT are measured.
14d, 28d, 35d, 45d extract the eyeball blood sampling to mouse after immunity, and separation of serum adopts microneutralization test to measure the neutralizing antibody level in the serum.Behind 56 ℃ of deactivation 30min of serum to be checked, get 2 times of serial dilutions of 25 μ L samples in DMEM/High Glucose substratum, each extent of dilution repeats 4 holes and adds in the 96 porocyte culture plates; Add the hoof-and-mouth disease venom (O/HN/93 or Asia1/JS/China/05) that 50 μ L contain 100TCID50 in every hole, act on 1h in 37 ℃ of cell culture incubators; It is the BHK-21 cell suspension of 1 * 105/mL that every then hole adds 50 μ L concentration, places 37 ℃ of 5%CO2 cell culture incubators to cultivate.Behind the 48h at the pathology situation and the record in the every hole of microscopic examination; 72h is with the fixing 30min of 4% Paraformaldehyde 96; With behind the 0.05% methylene blue dye liquor dyeing 30min of 10% formalin solution preparation with washing, the sick cell hole is not blue, pathology takes place and the cell detachment person is not painted.Set up positive during test and negative serum contrast, virus recurrence experimental control, the contrast of serum toxicity and normal cell contrast.Calculate according to the Karber method and can protect 50% cell hole not produce cytopathic highest serum extent of dilution, this extent of dilution is the NAT of this part serum.
1.7 mouse spleen T cell surface CD4, CD8, the detection of CD3
After just exempting from 45 days, mouse is extractd the eyeball bloodletting cause death, be soaked in 75% the alcohol; In super clean bench, take out mouse spleen, 300 order nylon wires grind, and add lymphocyte separation medium 5mL and press the process specifications operation; Separate the mouse spleen lymphocyte suspension, and be diluted to 2 * 106/mL with PBS after washing 2 times with the PBS that contains 3%FBS, adding is with the rat anti-mouse CD4 monoclonal antibody of PE mark, the hamster anti-mouse CD3 monoclonal antibody of PerCP mark and the rat anti-mouse CD8 monoclonal antibody of FITC mark; Establish the homotype control test pipe of respective markers thing simultaneously; The room temperature lucifuge is hatched 20min, washes twice with PBS, uses 500L PBS resuspended at last; Go up machine (FACSAria flow cytometer) in the 4h and detect, with the quantity of CellQuest software analysis total lymphocyte, CD4+ and CD8+ cell subsets.
1.8 the detection of mouse spleen lymphocyte secretion of gamma-IFN
Back 45 days of immunity; Get 5 mouse for every group; Get the spleen isolated lymphocytes, the SPL of fresh separated is placed 96 orifice plates, 37 ℃ of 5%CO2 constant incubators are cultivated; Draw 100mL cell culture fluid supernatant behind the 24h, detect the content of IFN-γ in the mouse spleen lymphocyte culture supernatant according to Mouse IFN-γ ELISA Kit II detection kit (available from U.S. company BD) specification sheets.The drafting of typical curve: the standard substance that Mouse IFN-γ ELISA Kit II detection kit is provided carry out doubling dilution; Making its concentration is 1000pg/mL; 500pg/mL, 250pg/mL, 125pg/mL; 62.5pg/mL and 31.3pg/mL, operate back drawing standard curve by process specifications.
1.9 data statistic analysis
Use Microsoft Excel software to carry out the different test of significance of two sample difference in means of different group data.Analyze the immunogenic immune-enhancing effect of TI.
2 results
2.1 the expression of target protein and purifying
Using SDS-PAGE detects the expression of target protein in the reorganization bacterium.Electrophoretogram shows that the reorganization bacterium efficiently expresses the OA-VP1 albumen that has produced about 21kDa TI albumen and 55kDa under the IPTG of 1mmol/L inductive condition, and size conforms to intended purposes albumen size.Application of nickel post affinity chromatography technology purifying is expressed the TI albumen that produces, and OA-VP1 albumen has then been carried out preliminary purification (Fig. 1,2) through the purifying inclusion body.Through the thin layer scanning analysis, the TI albumen behind the purifying and the purity of OA-VP1 inclusion body have reached respectively more than 90% and 60%.
2.2 the mensuration of serum NAT
The FMDV neutralizing antibody is the most important evaluation that produces protective immunity, through measure immune serum on cell in the ability of FMDV, the different vaccine antigens that react that can be indirect are induced the effect that produces protective immunity.The result shows, adopts the VP1 antigen immune mouse of two valency seedlings or two serotypes, and 14d begins just can detect neutralizing antibody after the immunity, and the level of neutralizing antibody constantly raises; The neutralizing antibody level of adding 1 times and 2 times TI antigen immune group is significantly higher than does not add TI antigen group (p＜0.05); Add 2 times of TI antigen group neutralizing antibodies and be higher than 1 times of TI antigen group of interpolation; But difference is significantly (p＞0.05) not, can significantly improve inactivated vaccine and protein subunit vaccine institute inductive neutralizing antibody level after interpolation TI immunogen be described.The OA-VP1 immune group can detect the neutralizing antibody (table 3 and table 4) to O type and two serotype FMDV of Asia1 separately; And its level is a little less than separately two valency seedling immune group; But difference is not remarkable, and explaining with OA-VP1 has immune effect (Fig. 3 and Fig. 4) preferably as the blank of protein subunit vaccine.
Table 3 immune serum FMDV NAT is measured (O type)
Table 4 immune serum FMDV NAT is measured (Asia 1 type)
2.3 mouse spleen T cell surface CD4, CD8, the detection of CD3
Isolating mouse spleen lymphocyte is used anti-CD4, and the fluorescence antibody of CD8 and CD3 dyes, and utilizes the FACSAria flow cytometer to detect the propagation result, obtains data with CellQuest software.In the two-dimentional scatter diagram of preceding scattered light (FSC) and offside scattered light (SSC), mark lymphocyte district P1, at 1 * 104 cell of P1 district inside counting.Utilize the lymphocytic kind of multiparameter flow cytometry.Gather CD3 through different fluorescence channels, the fluorescent signal of CD4 and CD8 positive mark cell and counting (Fig. 5) account for the total per-cent of selected P1 cellular regions inner cell with CellQuest software analysis CD4+T cell and CD8+T cell.Each organizes cell count and per-cent is seen table 5.Can know that by table 56 immune group mouse CD4+T and CD8+T cell number average have tangible rising, have compared very evident difference with negative control group; No matter be inactivated vaccine or OA-VP1 protein subunit vaccine; Mouse CD4+T cell proportion has tangible rising after adding the TI antigen immune; The ratio that TI antigen is added OA-VP1 protein subunit vaccine immune group CD8+T cell also raises to some extent, explains that adding TI antigen has obvious facilitation for cellular immunization.
Table 5. is respectively tested the mouse spleen CD4 of group
+T cell and CD8
+T cell count and per-cent
2.4 the detection of mouse spleen lymphocyte secretion of gamma-IFN
Typical curve according to setting up calculates the IFN-concentration of respectively organizing in the mouse spleen lymphocyte culture sample, and the result sees table 6.Visible by table 6, no matter be deactivation vaccine immune group or OA-VP1 protein subunit vaccine immune group, its γ is significantly higher than negative control group (P＜0.01) in disturbing plain generation level; After adding the TI antigen immune, the SPL of inactivated vaccine and OA-VP1 immune group mouse is after accepting the ConA stimulation, and the amount of secretion IFN-all is significantly higher than and does not add the antigenic immune group of TI, significant difference (P＜0.05); It is higher to add behind the TI antigen of 2 multiple doses the secretion level of IFN-, compares difference extremely significantly (P＜0.01) with deactivation vaccine or the independent immune group of OA-VP1.Through measuring the generation level of different immune group IFN-s, further illustrate and add the level that TI antigen can improve cellular immunization significantly.
Table 6. is respectively tested IFN-γ content in group's mouse spleen lymphocyte culture supernatant
3 discuss
Vaccine inoculation is the reliable and effective means of specificity prevention FMD, and vaccine is a prerequisite of successfully preventing, control and even finally eliminate FMD safely and effectively.Conventional vaccines such as FMD less toxic vaccine and inactivated vaccine all have good immunogenicity; In the process of prevention and control FMD, bringing into play important effect; But, impel people to seek a kind of vaccine of FMD more safely and effectively because virus virulence returns by force, inactivation of virus is not thorough, viral escape goes out unsafe factors such as production of vaccine factory.
Utilize various expression systems to express the main immunogens albumen of FMDV, the development genetic engineering subunit vaccine is the focus of studying at present.Because subunit vaccine only contains the part of pathogenic agent, can not cause the animal morbidity, aspect biological safety, be superior to traditional vaccine.Research shows; Structural protein VP1 the 141st～160 amino acid and 200～213 amino acid sections are two advantage neutralizing epitopes of FMDV; The research of a lot of FMDV epiposition vaccines has all comprised above two main epitopes, and has obtained immune effect [7-9] preferably.Wherein, The formed G-H ring of VP1141-160 amino acids is exposed to the surface of virus particle; It is of paramount importance antigenic determinant; This section is widely different between the different pedigree strains of different serotypes and same serotype, is to cause different vaccine strains to lack the principal element of cross immunity protectiveness.Aspect the research of foot-and-mouth disease gene engineering subunit vaccine, how efficiently expressing the virus antigen albumen that spectrotype is wide, immunogenicity is strong is the crucial difficult problem that needs solve.
In this research Design Expression fusion VP1 albumen of the two serotypes of O type and Asia1 type; And Design Expression a kind of T cellular immunization of a plurality of t cell epitopes and two Universal T-cell epitopes that comprises in FMDV structural protein and the Nonstructural Protein former; Expectation is developed a kind of novel fmd protein subunit vaccine with the VP1 albumen and the former combination of this T cellular immunization of two serotypes.Through immunity test mouse; Preliminary proof; The VP1 albumen of two serotypes can stimulate mouse to produce the neutralizing antibody to two serotypes; And the T cellular immunization of add expressing former after further the immune stimulatory mouse produce higher levels of humoral and cellular immune response; Explain that cellular immunization and humoral immunization have synergetic property, also explanation employing T cellular immunization is former has good immune effect with the immunity of major antigen protein combination, should be the striving direction of fmd protein subunit vaccine research.
Used t cell epitope has comprised the conservative t cell epitope on structural protein VP4 and Nonstructural Protein 3A and the 3D in this research; And from two general t cell epitopes in the invasion (invasin) of Measles virus and Yersinia; Purpose is to induce most animal all can produce stronger cellullar immunologic response; Identification to t cell epitope is limited by the variety of host expresses MHC molecule, thereby when design T cellular immunization is former, selects to have used the t cell epitope of versatility.In addition; In this T cellular immunization is former, also introduce two cytotoxic T cell (Tc) epi-positions that are arranged in VP1 albumen; The Tc epi-position is relevant with the memory immunity, thereby the T cellular immunization that expectation is designed is former can induce the host to produce strong and persistent protective immunity; The streaming detected result proves that also the T cellular immunization that is designed is former in inducing CD8+T cell proliferation to have certain function.Used two general t cell epitopes comprise that this section has been proved to be a kind of strong immunostimulant [10] from one section plain 16 amino acid whose t cell epitope of bacteria attack.General t cell epitope (PADRE) belongs to Th cell epitope family, and be proved and can have induced multiple animal such as rat, cavy, pigs etc. produce stronger cellullar immunologic response [11-13].Produce strong cellullar immunologic response through inducing, to promote generation to FMDV specificity neutralizing antibody.The immunity of FMDV is typical Cell Dependent Humoral Immune; The immanoprotection action that simple B cell epitope antigen induction body produces is very limited, thereby the introducing of versatility t cell epitope has important effect [13] to the level that improves cellullar immunologic response.
This result of study shows; Former foot and mouth disease conventional vaccine and the protein subunit vaccine immune mouse of can further promoting of the T cellular immunization that is designed produces higher levels of neutralizing antibody; This effect induces the high-level cellular immunization of generation to be proportionate with it; Explain and add the former immune effect that can effectively improve aftosa vaccine of T cellular immunization, be expected to be used for the research of hoof-and-mouth disease subunit vaccine and efficient inactivation vaccine, improve the immune effect of recombinant vaccine and inactivated vaccine.
Should be understood that, concerning those of ordinary skills, can improve or conversion, and all these improvement and conversion all should belong to the protection domain of accompanying claims of the present invention according to above-mentioned explanation.
Claims (3)
1. a T cellular immunization protogene TI is characterized in that its nucleotide sequence is shown in SEQ ID NO:1.
2. the former TI of T cellular immunization is characterized in that, its aminoacid sequence is shown in SEQ ID NO:2.
3. T cellular immunization protogene TI according to claim 1 uses in preparation foot and mouth disease O type and the two serotype virus VP 1 protein subunit vaccines of Asia 1 type or its inactivated vaccine.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN 201010601585 CN102168088B (en) | 2010-12-23 | 2010-12-23 | T cell immunogen gene TI and applications thereof in foot-and-mouth disease protein subunit vaccine and inactivated vaccine |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN 201010601585 CN102168088B (en) | 2010-12-23 | 2010-12-23 | T cell immunogen gene TI and applications thereof in foot-and-mouth disease protein subunit vaccine and inactivated vaccine |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN102168088A CN102168088A (en) | 2011-08-31 |
| CN102168088B true CN102168088B (en) | 2012-12-26 |
Family
ID=44489406
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN 201010601585 Active CN102168088B (en) | 2010-12-23 | 2010-12-23 | T cell immunogen gene TI and applications thereof in foot-and-mouth disease protein subunit vaccine and inactivated vaccine |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN102168088B (en) |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3443097A4 (en) * | 2016-04-11 | 2020-04-22 | Biogénesis Bagó Uruguay S.A. | Universal vaccine for viral diseases |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP2647390A1 (en) * | 2012-04-02 | 2013-10-09 | Universitat Pompeu-Fabra | Peptide vaccines for the prevention of foot-and-mouth disease |
| CN103007273B (en) * | 2012-11-16 | 2015-07-29 | 中国农业科学院兰州兽医研究所 | A kind of foot-and-mouth disease gene engineering mixing epiposition vaccine and preparation method thereof |
| CN104244973B (en) * | 2012-11-16 | 2017-10-20 | 美国联合生物医学公司 | For the urgent vaccine based on synthetic peptide of aftosa (FMD) |
| CN103305542B (en) * | 2013-06-25 | 2015-03-11 | 江苏省农业科学院 | Recombinant phage double expression vector and application |
| CN105622762B (en) * | 2016-03-03 | 2020-04-03 | 中国农业科学院兰州兽医研究所 | Chemotactic factor-mediated O-type foot-and-mouth disease targeting compound epitope protein for cattle and vaccine |
| CN117264026B (en) * | 2023-08-15 | 2024-04-12 | 中国农业科学院兰州兽医研究所 | O-type foot-and-mouth disease virus VP1 protein T cell epitope polypeptide and application thereof |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1470285A (en) * | 2003-06-13 | 2004-01-28 | 复旦大学 | Polypeptide vaccine of anti Asiatic I virus of foot-and-mouth disease and its preparing method |
| CN1557486A (en) * | 2004-01-13 | 2004-12-29 | 厦门大学 | Bivalent DNA vaccine of type A and type O foot-and-mouth disease virus and its preparing process |
| CN101724605A (en) * | 2008-10-30 | 2010-06-09 | 中国农业科学院哈尔滨兽医研究所 | Foot-and-mouth disease virus (FMDV) resistant monoclonal antibody and identified epitope and application thereof |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US7323546B2 (en) * | 2003-05-29 | 2008-01-29 | Academia Sinica | Apoptosis-inducing polypeptides |
-
2010
- 2010-12-23 CN CN 201010601585 patent/CN102168088B/en active Active
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN1470285A (en) * | 2003-06-13 | 2004-01-28 | 复旦大学 | Polypeptide vaccine of anti Asiatic I virus of foot-and-mouth disease and its preparing method |
| CN1557486A (en) * | 2004-01-13 | 2004-12-29 | 厦门大学 | Bivalent DNA vaccine of type A and type O foot-and-mouth disease virus and its preparing process |
| CN101724605A (en) * | 2008-10-30 | 2010-06-09 | 中国农业科学院哈尔滨兽医研究所 | Foot-and-mouth disease virus (FMDV) resistant monoclonal antibody and identified epitope and application thereof |
Non-Patent Citations (2)
| Title |
|---|
| Esther Blanco等.Identification of T-cell epitopes in nonstructural proteins of foot-and-mouth disease virus.《Journal of virology》.2001,第75卷(第7期),3164-3174. * |
| Wilhelm Gerner等.Identification of novel foot-and-mouth disease virus specific T-cell epitopes in c/c and d/d haplotype miniature swine.《Virus research》.2006,第121卷223-228. * |
Cited By (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3443097A4 (en) * | 2016-04-11 | 2020-04-22 | Biogénesis Bagó Uruguay S.A. | Universal vaccine for viral diseases |
Also Published As
| Publication number | Publication date |
|---|---|
| CN102168088A (en) | 2011-08-31 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| CN102168088B (en) | T cell immunogen gene TI and applications thereof in foot-and-mouth disease protein subunit vaccine and inactivated vaccine | |
| Crawford et al. | Baculovirus-derived hemagglutinin vaccines protect against lethal influenza infections by avian H5 and H7 subtypes | |
| Rodriguez et al. | A synthetic peptide containing the consensus sequence of the G–H loop region of foot-and-mouth disease virus type-O VP1 and a promiscuous T-helper epitope induces peptide-specific antibodies but fails to protect cattle against viral challenge | |
| Jones et al. | Protection of goats against peste des petits ruminants with a vaccinia virus double recombinant expressing the F and H genes of rinderpest virus | |
| Oxford et al. | The specificity of the anti-haemagglutinin antibody response induced in man by inactivated influenza vaccines and by natural infection | |
| CN103007273B (en) | A kind of foot-and-mouth disease gene engineering mixing epiposition vaccine and preparation method thereof | |
| Morgan et al. | Protection of cattle and swine against foot-and-mouth disease, using biosynthetic peptide vaccines | |
| CN104271594B (en) | For just exempting from the vesicular stomatitis virus of booster vaccine | |
| CN105331636A (en) | Recombination cell line for stable expression of classical swine fever virus E2 and application thereof | |
| CN101489589A (en) | Immunogenic compositions | |
| CN102399757A (en) | Immunogenic compositions and uses thereof | |
| Wang et al. | Intranasal administration with recombinant Bacillus subtilis induces strong mucosal immune responses against pseudorabies | |
| CN102221618A (en) | Method for establishing hog cholera lapinized virus labeled vaccine strain and preparing vaccine | |
| Martrenchar et al. | Experimental study of a mixed vaccine against peste des petits ruminants and capripox infection in goats in northern Cameroon | |
| CN101591379B (en) | Constructed anti-HIV vaccine based on amino acid mutation of EIAV attenuated live vaccine | |
| Francis | Peptide vaccines for viral diseases | |
| CN110606875A (en) | Intramolecular adjuvant for preparing foot-and-mouth disease vaccine, application thereof and foot-and-mouth disease vaccine | |
| CN107961371A (en) | Season influenza-RSV combined vaccine and its preparation method and application | |
| CN102512671A (en) | Anti-foot-and-mouth disease type O virus-like particle vaccine and preparation method thereof | |
| Osinubi et al. | Enhancing comparative rabies DNA vaccine effectiveness through glycoprotein gene modifications | |
| CN105175549A (en) | Hi (Haemophilus influenza) fusion protein as well as construction method and application thereof | |
| RU2699671C1 (en) | Vaccine for early protection against foot-and-mouth disease of type o inactivated emulsion | |
| CN102533629B (en) | Preparation method of avian encephalomyelitis virus VP1 protein subunit vaccine | |
| CN102058881A (en) | Gene recombinant vaccine for preventing enterovirus 71 infection and preparation method thereof | |
| CN101948510A (en) | Molecular mimic peptide of type O foot and mouth disease virus VP2 epitope and applications thereof |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant |