CN101633928A - Recombinant expression of aldehyde reductase and application thereof in bioconversion of glycerol into 1,3-propylene glycol - Google Patents
Recombinant expression of aldehyde reductase and application thereof in bioconversion of glycerol into 1,3-propylene glycol Download PDFInfo
- Publication number
- CN101633928A CN101633928A CN200810228268A CN200810228268A CN101633928A CN 101633928 A CN101633928 A CN 101633928A CN 200810228268 A CN200810228268 A CN 200810228268A CN 200810228268 A CN200810228268 A CN 200810228268A CN 101633928 A CN101633928 A CN 101633928A
- Authority
- CN
- China
- Prior art keywords
- fermentation
- ammediol
- aldehyde reductase
- seq
- promotor
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 title claims abstract description 43
- 108010053754 Aldehyde reductase Proteins 0.000 title claims abstract description 26
- 102100027265 Aldo-keto reductase family 1 member B1 Human genes 0.000 title claims abstract description 18
- 238000003259 recombinant expression Methods 0.000 title claims abstract description 8
- YPFDHNVEDLHUCE-UHFFFAOYSA-N propane-1,3-diol Chemical compound OCCCO YPFDHNVEDLHUCE-UHFFFAOYSA-N 0.000 title abstract 12
- 238000000855 fermentation Methods 0.000 claims abstract description 32
- 230000004151 fermentation Effects 0.000 claims abstract description 31
- 102000004190 Enzymes Human genes 0.000 claims abstract description 27
- 108090000790 Enzymes Proteins 0.000 claims abstract description 27
- 241000588748 Klebsiella Species 0.000 claims abstract description 27
- 239000013604 expression vector Substances 0.000 claims abstract description 7
- UXFQFBNBSPQBJW-UHFFFAOYSA-N 2-amino-2-methylpropane-1,3-diol Chemical compound OCC(N)(C)CO UXFQFBNBSPQBJW-UHFFFAOYSA-N 0.000 claims description 57
- 238000000034 method Methods 0.000 claims description 19
- 235000011187 glycerol Nutrition 0.000 claims description 17
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 claims description 12
- 241000894006 Bacteria Species 0.000 claims description 10
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 claims description 8
- 108090000623 proteins and genes Proteins 0.000 claims description 8
- 230000000813 microbial effect Effects 0.000 claims description 6
- 230000008569 process Effects 0.000 claims description 6
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 claims description 4
- 241000605909 Fusobacterium Species 0.000 claims description 4
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 claims description 4
- 241000589516 Pseudomonas Species 0.000 claims description 4
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 4
- 125000000539 amino acid group Chemical group 0.000 claims description 4
- 230000036983 biotransformation Effects 0.000 claims description 4
- 230000000968 intestinal effect Effects 0.000 claims description 4
- 239000008101 lactose Substances 0.000 claims description 4
- 229910052757 nitrogen Inorganic materials 0.000 claims description 4
- 239000002773 nucleotide Substances 0.000 claims description 4
- 125000003729 nucleotide group Chemical group 0.000 claims description 4
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 claims description 3
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 claims description 3
- 241000607142 Salmonella Species 0.000 claims description 3
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 claims description 3
- 239000006035 Tryptophane Substances 0.000 claims description 3
- 229910052799 carbon Inorganic materials 0.000 claims description 3
- RXKJFZQQPQGTFL-UHFFFAOYSA-N dihydroxyacetone Chemical compound OCC(=O)CO RXKJFZQQPQGTFL-UHFFFAOYSA-N 0.000 claims description 3
- 238000011534 incubation Methods 0.000 claims description 3
- 230000001939 inductive effect Effects 0.000 claims description 3
- 239000002054 inoculum Substances 0.000 claims description 3
- 229960004799 tryptophan Drugs 0.000 claims description 3
- 102000001253 Protein Kinase Human genes 0.000 claims description 2
- 238000010564 aerobic fermentation Methods 0.000 claims description 2
- 230000005587 bubbling Effects 0.000 claims description 2
- 208000001848 dysentery Diseases 0.000 claims description 2
- 229910017053 inorganic salt Inorganic materials 0.000 claims description 2
- 238000002156 mixing Methods 0.000 claims description 2
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 claims description 2
- 108060006633 protein kinase Proteins 0.000 claims description 2
- 239000011782 vitamin Substances 0.000 claims description 2
- 235000013343 vitamin Nutrition 0.000 claims description 2
- 229930003231 vitamin Natural products 0.000 claims description 2
- 229940088594 vitamin Drugs 0.000 claims description 2
- 150000003722 vitamin derivatives Chemical class 0.000 claims description 2
- 230000008034 disappearance Effects 0.000 claims 1
- 238000003780 insertion Methods 0.000 claims 1
- 230000037431 insertion Effects 0.000 claims 1
- 239000000758 substrate Substances 0.000 abstract description 6
- 244000005700 microbiome Species 0.000 abstract description 5
- 230000008901 benefit Effects 0.000 abstract description 3
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 abstract 4
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 abstract 2
- 230000009286 beneficial effect Effects 0.000 abstract 1
- 229930027945 nicotinamide-adenine dinucleotide Natural products 0.000 description 16
- 230000001580 bacterial effect Effects 0.000 description 15
- 239000013612 plasmid Substances 0.000 description 11
- 238000004519 manufacturing process Methods 0.000 description 10
- BOPGDPNILDQYTO-NNYOXOHSSA-N nicotinamide-adenine dinucleotide Chemical compound C1=CCC(C(=O)N)=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](COP(O)(=O)OP(O)(=O)OC[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C3=NC=NC(N)=C3N=C2)O)O1 BOPGDPNILDQYTO-NNYOXOHSSA-N 0.000 description 10
- AKXKFZDCRYJKTF-UHFFFAOYSA-N 3-Hydroxypropionaldehyde Chemical compound OCCC=O AKXKFZDCRYJKTF-UHFFFAOYSA-N 0.000 description 9
- 239000007788 liquid Substances 0.000 description 9
- 241000588724 Escherichia coli Species 0.000 description 8
- 238000011160 research Methods 0.000 description 8
- XJLXINKUBYWONI-DQQFMEOOSA-N [[(2r,3r,4r,5r)-5-(6-aminopurin-9-yl)-3-hydroxy-4-phosphonooxyoxolan-2-yl]methoxy-hydroxyphosphoryl] [(2s,3r,4s,5s)-5-(3-carbamoylpyridin-1-ium-1-yl)-3,4-dihydroxyoxolan-2-yl]methyl phosphate Chemical compound NC(=O)C1=CC=C[N+]([C@@H]2[C@H]([C@@H](O)[C@H](COP([O-])(=O)OP(O)(=O)OC[C@@H]3[C@H]([C@@H](OP(O)(O)=O)[C@@H](O3)N3C4=NC=NC(N)=C4N=C3)O)O2)O)=C1 XJLXINKUBYWONI-DQQFMEOOSA-N 0.000 description 7
- 238000006243 chemical reaction Methods 0.000 description 7
- 230000000694 effects Effects 0.000 description 7
- 230000037361 pathway Effects 0.000 description 7
- 239000000047 product Substances 0.000 description 7
- FRXSZNDVFUDTIR-UHFFFAOYSA-N 6-methoxy-1,2,3,4-tetrahydroquinoline Chemical compound N1CCCC2=CC(OC)=CC=C21 FRXSZNDVFUDTIR-UHFFFAOYSA-N 0.000 description 6
- 241000588747 Klebsiella pneumoniae Species 0.000 description 6
- 238000005516 engineering process Methods 0.000 description 6
- 229940045505 klebsiella pneumoniae Drugs 0.000 description 6
- 101710157860 Oxydoreductase Proteins 0.000 description 5
- 230000029087 digestion Effects 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 230000001590 oxidative effect Effects 0.000 description 5
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 229920002215 polytrimethylene terephthalate Polymers 0.000 description 4
- 230000009467 reduction Effects 0.000 description 4
- 238000011218 seed culture Methods 0.000 description 4
- 230000035939 shock Effects 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 3
- 101100098786 Bacillus subtilis (strain 168) tapA gene Proteins 0.000 description 3
- 241000588923 Citrobacter Species 0.000 description 3
- 241000193403 Clostridium Species 0.000 description 3
- 101100321116 Escherichia coli (strain K12) yqhD gene Proteins 0.000 description 3
- -1 Poly(Trimethylene Terephthalate) Polymers 0.000 description 3
- 230000003197 catalytic effect Effects 0.000 description 3
- 238000013016 damping Methods 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- 239000012530 fluid Substances 0.000 description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 230000004060 metabolic process Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 235000018102 proteins Nutrition 0.000 description 3
- 102000004169 proteins and genes Human genes 0.000 description 3
- 108091008146 restriction endonucleases Proteins 0.000 description 3
- GVJHHUAWPYXKBD-UHFFFAOYSA-N (±)-α-Tocopherol Chemical compound OC1=C(C)C(C)=C2OC(CCCC(C)CCCC(C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-UHFFFAOYSA-N 0.000 description 2
- ALRHLSYJTWAHJZ-UHFFFAOYSA-N 3-hydroxypropionic acid Chemical compound OCCC(O)=O ALRHLSYJTWAHJZ-UHFFFAOYSA-N 0.000 description 2
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 2
- 108010025885 Glycerol dehydratase Proteins 0.000 description 2
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical class Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 2
- LCTONWCANYUPML-UHFFFAOYSA-N Pyruvic acid Chemical compound CC(=O)C(O)=O LCTONWCANYUPML-UHFFFAOYSA-N 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- KLOHDWPABZXLGI-YWUHCJSESA-M ampicillin sodium Chemical compound [Na+].C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C([O-])=O)(C)C)=CC=CC=C1 KLOHDWPABZXLGI-YWUHCJSESA-M 0.000 description 2
- 239000006227 byproduct Substances 0.000 description 2
- 238000006555 catalytic reaction Methods 0.000 description 2
- 230000008859 change Effects 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 239000005515 coenzyme Substances 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 230000012010 growth Effects 0.000 description 2
- 238000004255 ion exchange chromatography Methods 0.000 description 2
- 239000000203 mixture Substances 0.000 description 2
- 238000005457 optimization Methods 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000006798 recombination Effects 0.000 description 2
- 238000005215 recombination Methods 0.000 description 2
- 238000011084 recovery Methods 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 239000006228 supernatant Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- AXAVXPMQTGXXJZ-UHFFFAOYSA-N 2-aminoacetic acid;2-amino-2-(hydroxymethyl)propane-1,3-diol Chemical compound NCC(O)=O.OCC(N)(CO)CO AXAVXPMQTGXXJZ-UHFFFAOYSA-N 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 241000193830 Bacillus <bacterium> Species 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 229910021591 Copper(I) chloride Inorganic materials 0.000 description 1
- 102000016928 DNA-directed DNA polymerase Human genes 0.000 description 1
- 108010014303 DNA-directed DNA polymerase Proteins 0.000 description 1
- 101000955144 Drosophila melanogaster WASH complex subunit 1 Proteins 0.000 description 1
- JOYRKODLDBILNP-UHFFFAOYSA-N Ethyl urethane Chemical compound CCOC(N)=O JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 1
- 101000892220 Geobacillus thermodenitrificans (strain NG80-2) Long-chain-alcohol dehydrogenase 1 Proteins 0.000 description 1
- 108010044467 Isoenzymes Proteins 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- 102000002067 Protein Subunits Human genes 0.000 description 1
- 108010001267 Protein Subunits Proteins 0.000 description 1
- 239000012564 Q sepharose fast flow resin Substances 0.000 description 1
- 239000012506 Sephacryl® Substances 0.000 description 1
- 241000607762 Shigella flexneri Species 0.000 description 1
- 239000004433 Thermoplastic polyurethane Substances 0.000 description 1
- 229930003779 Vitamin B12 Natural products 0.000 description 1
- 229930003427 Vitamin E Natural products 0.000 description 1
- YVNQAIFQFWTPLQ-UHFFFAOYSA-O [4-[[4-(4-ethoxyanilino)phenyl]-[4-[ethyl-[(3-sulfophenyl)methyl]amino]-2-methylphenyl]methylidene]-3-methylcyclohexa-2,5-dien-1-ylidene]-ethyl-[(3-sulfophenyl)methyl]azanium Chemical compound C1=CC(OCC)=CC=C1NC1=CC=C(C(=C2C(=CC(C=C2)=[N+](CC)CC=2C=C(C=CC=2)S(O)(=O)=O)C)C=2C(=CC(=CC=2)N(CC)CC=2C=C(C=CC=2)S(O)(=O)=O)C)C=C1 YVNQAIFQFWTPLQ-UHFFFAOYSA-O 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 239000012295 chemical reaction liquid Substances 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000004087 circulation Effects 0.000 description 1
- AGVAZMGAQJOSFJ-WZHZPDAFSA-M cobalt(2+);[(2r,3s,4r,5s)-5-(5,6-dimethylbenzimidazol-1-yl)-4-hydroxy-2-(hydroxymethyl)oxolan-3-yl] [(2r)-1-[3-[(1r,2r,3r,4z,7s,9z,12s,13s,14z,17s,18s,19r)-2,13,18-tris(2-amino-2-oxoethyl)-7,12,17-tris(3-amino-3-oxopropyl)-3,5,8,8,13,15,18,19-octamethyl-2 Chemical compound [Co+2].N#[C-].[N-]([C@@H]1[C@H](CC(N)=O)[C@@]2(C)CCC(=O)NC[C@@H](C)OP(O)(=O)O[C@H]3[C@H]([C@H](O[C@@H]3CO)N3C4=CC(C)=C(C)C=C4N=C3)O)\C2=C(C)/C([C@H](C\2(C)C)CCC(N)=O)=N/C/2=C\C([C@H]([C@@]/2(CC(N)=O)C)CCC(N)=O)=N\C\2=C(C)/C2=N[C@]1(C)[C@@](C)(CC(N)=O)[C@@H]2CCC(N)=O AGVAZMGAQJOSFJ-WZHZPDAFSA-M 0.000 description 1
- OXBLHERUFWYNTN-UHFFFAOYSA-M copper(I) chloride Chemical compound [Cu]Cl OXBLHERUFWYNTN-UHFFFAOYSA-M 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000000287 crude extract Substances 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 238000006356 dehydrogenation reaction Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 238000002845 discoloration Methods 0.000 description 1
- 238000007323 disproportionation reaction Methods 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 230000005611 electricity Effects 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 229920006351 engineering plastic Polymers 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- HCPOCMMGKBZWSJ-UHFFFAOYSA-N ethyl 3-hydrazinyl-3-oxopropanoate Chemical compound CCOC(=O)CC(=O)NN HCPOCMMGKBZWSJ-UHFFFAOYSA-N 0.000 description 1
- 230000003631 expected effect Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 238000012262 fermentative production Methods 0.000 description 1
- 239000010408 film Substances 0.000 description 1
- 238000001914 filtration Methods 0.000 description 1
- 239000012847 fine chemical Substances 0.000 description 1
- 238000013467 fragmentation Methods 0.000 description 1
- 238000006062 fragmentation reaction Methods 0.000 description 1
- 235000011087 fumaric acid Nutrition 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- WIGCFUFOHFEKBI-UHFFFAOYSA-N gamma-tocopherol Natural products CC(C)CCCC(C)CCCC(C)CCCC1CCC2C(C)C(O)C(C)C(C)C2O1 WIGCFUFOHFEKBI-UHFFFAOYSA-N 0.000 description 1
- 238000005227 gel permeation chromatography Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 150000002334 glycols Chemical group 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 239000003262 industrial enzyme Substances 0.000 description 1
- 239000003317 industrial substance Substances 0.000 description 1
- 238000011031 large-scale manufacturing process Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000012982 microporous membrane Substances 0.000 description 1
- 230000003020 moisturizing effect Effects 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 239000000178 monomer Substances 0.000 description 1
- SLCVBVWXLSEKPL-UHFFFAOYSA-N neopentyl glycol Chemical compound OCC(C)(C)CO SLCVBVWXLSEKPL-UHFFFAOYSA-N 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 238000011020 pilot scale process Methods 0.000 description 1
- 239000004014 plasticizer Substances 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229920005906 polyester polyol Polymers 0.000 description 1
- 229920002635 polyurethane Polymers 0.000 description 1
- 239000004814 polyurethane Substances 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 229940107700 pyruvic acid Drugs 0.000 description 1
- 239000010453 quartz Substances 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 230000008521 reorganization Effects 0.000 description 1
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N silicon dioxide Inorganic materials O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- 230000003068 static effect Effects 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 230000009967 tasteless effect Effects 0.000 description 1
- 239000004753 textile Substances 0.000 description 1
- 229920002803 thermoplastic polyurethane Polymers 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 239000011573 trace mineral Substances 0.000 description 1
- 235000013619 trace mineral Nutrition 0.000 description 1
- 238000012549 training Methods 0.000 description 1
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 1
- 238000002525 ultrasonication Methods 0.000 description 1
- 235000019163 vitamin B12 Nutrition 0.000 description 1
- 239000011715 vitamin B12 Substances 0.000 description 1
- 235000019154 vitamin C Nutrition 0.000 description 1
- 239000011718 vitamin C Substances 0.000 description 1
- 235000019165 vitamin E Nutrition 0.000 description 1
- 239000011709 vitamin E Substances 0.000 description 1
- 229940046009 vitamin E Drugs 0.000 description 1
- 239000002912 waste gas Substances 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 101150113187 yqhD gene Proteins 0.000 description 1
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02P—CLIMATE CHANGE MITIGATION TECHNOLOGIES IN THE PRODUCTION OR PROCESSING OF GOODS
- Y02P20/00—Technologies relating to chemical industry
- Y02P20/50—Improvements relating to the production of bulk chemicals
- Y02P20/52—Improvements relating to the production of bulk chemicals using catalysts, e.g. selective catalysts
Landscapes
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
Abstract
The invention discloses recombinant expression of aldehyde reductase and an application thereof in bioconversion of glycerol into 1, 3-propylene glycol, belonging to the technical field of biological engineering. The invention is characterized in that a recombinant expression vector containing aldehyde reductase gene sequence is used to express the enzyme to a host cell for preparing 1, 3-propylene glycol. The beneficial effects and benefits of the invention are that recombinant Klebsiella (Pdk-yqhD) takes glycol as substrate to ferment for 30h, and the concentration of 1, 3-propylene glycol in the fermentation liquor is improved by 17.1% in comparison with a comparison strain; compared with the original strain, by using the recombinant restrain in the invention for fermentation, the yield of 1, 3-propylene glycol is improved by 10-50%, which lays a foundation on constructing genetically engineered microorganism of the high yield of the 1, 3-propylene glycol taking glycol as substrate.
Description
Technical field
The invention belongs to technical field of bioengineering, relate to the recombinant expression vector that contains the aldehyde reductase gene, and with its transformed host cells ferment glycerin high yield 1, the application of ammediol.
Background technology
1; ammediol (1; 3-propanediol; be called for short 1; 3-PD) be colourless, tasteless thick liquid; be a kind of important chemical material, can be used as solvent, antifreezing agent or protective material, fine chemical material and new polyester---the monomer of Poly(Trimethylene Terephthalate) (PTT) and urethane.PTT is a kind of new polyester material, can be used for the dress materials of carpet, engineering plastics, film and textile industry etc., and PTT have excellent rebound resilience, dyeability, pollution resistance, preferably the uvioresistant discoloration and be difficult for static, the characteristics such as less that absorb water, be cited as one of the U.S.'s six big petrochemical industry product innovations in 1998.1, the polymerized plasticizer that ammediol also can be used for producing thermoplastic polyurethane and is used as PVC.As dibasic alcohol, it can also replace 1, and 4-butyleneglycol and neopentyl glycol are as intermediate.U.S. Chem Systems company discovers, 1, and the functionalized with glycols group of ammediol makes it be used for production of polyurethane and has a lot of potentiality, as is used for the production of polyester polyol and as chain propagation agent.In the synthetic field of medicine, 1, oneself is applied ammediol, and some new purposes are also developed in this field.In recent years, with 1, ammediol is more and more paid attention to as the organic synthesis raw material, and as 1, ammediol can synthesize 3-hydroxy-propionic acid and propanedioic acid through atmospheric oxidation, but with the urea reaction synthesizing annular carbonate.1, ammediol is considered to the industrial chemicals that have broad prospect of application this century most.
In view of 1, the extensive market outlook of ammediol, its production method is subjected to the extensive concern of domestic and international large-lot producer and scientific research institution for many years.World-renowned chemical industrial company of several families, for example Dutch Shell company, German Degussa company drops into large-scale production 1 in succession, and ammediol has also stepped up applied research and exploitation.It produces 1, and the method for ammediol mainly is a chemical synthesis.Synthesize 1 with chemical method, ammediol need and use valuable catalyzer could realize that cost is higher at high temperature, high pressure, facility investment is big, technical difficulty height, separation and purification of products difficulty, particularly Preparation of catalysts is difficult, and produces the waste gas of contaminate environment such as CO.Along with the development of modern biotechnology, people begin to attempt with Production by Microorganism Fermentation 1, the research of ammediol.Microbe fermentation method has mild condition, simple to operate, advantages such as by product is few, environmental protection, and the research of this respect becomes the focus of current domestic and international research.
The microbial method ferment glycerin produces 1, and the bacterial classification of ammediol comprises Klebsiella (Klebsiella), citric acid Pseudomonas (Citrobacter), fusobacterium (Clostridium) etc.Klebsiella (Klebsiellapneumoniae) has higher glycerine tolerance, higher transformation efficiency and 1, and therefore ammediol throughput be subjected to more concern.And the Klebsiella amphimicrobe, its biochemical characteristic and intestinal bacteria (E.coli) are very close, and this just is the improvement of genes of bacterial classification and utilizes genetically engineered to make up new bacterial classification and provide convenience.Klebsiella is that the pathways metabolism of substrate through anaerobic fermentation relates to two parallel routes of oxidative pathway and reduction approach with glycerine.By oxidative pathway, glycerine quilt and NAD
+Glycerol dehydrogenase (GDH) catalytic dehydrogenation that links to each other generates otan (DHA), and further metabolism is a pyruvic acid then, generates energy ATP and reducing equivalent NAD
+By products such as/NADH and acetate, ethanol, and be accompanied by the growth of microorganism cells; And by the reduction approach, glycerine is then generated 3-hydroxy propanal (3-HPA) by the glycerol dehydratase that is associated with vitamin B12 (GDHt) catalytic dehydration, again further by link to each other with NADH 1, ammediol oxydo-reductase (PDOR) is reduced to product 1, ammediol has consumed the excessive DPNH (NADH) that generates in the oxidative pathway simultaneously.Oxidative pathway and reduction approach are by reducing equivalent NAD
+/ NADH is connected, and makes glycerine disproportionation and the coupling of cell growth phase.
In recent years, existing many companies and scientific research institution produce 1 at biotransformation method, and ammediol is researched and developed.Biotransformation method produces 1, and the strategy a kind of commonly used of ammediol is to utilize original strain, improves 1 by the optimization for fermentation technology condition, the output of ammediol.Adopt little oxygen condition bottom fermentation to produce 1 as Dalian University of Technology, ammediol is also finished pilot scale and is amplified (Chinese patent ZL 01117282.7); Tsing-Hua University adopts external source interpolation vitamins C, vitamin-E or FUMARIC ACID TECH GRADE to promote 1, ammediol production (Chinese patent ZL03121946.2; Chinese patent ZL 200510011917.2); Southeast China University adopts the method for adding nonionogenic tenside in fermented liquid to change the permeability of cytolemma, thereby improves 1, the output of ammediol (Chinese patent CN 200810020203.1).Though can improve 1 to a certain extent by the optimization for fermentation technology condition, the output of ammediol, owing to be subjected to many effects limit such as throughput of original strain self, and 1, the fermentation yield of ammediol can't obtain to increase considerably.In order to break the restriction of original strain self throughput, people turn to another kind of strategy gradually, promptly adopt recombinant bacterial strain fermentative production 1, ammediol.Adopting aspect the recombinant bacterial strain, U.S. Dupont company and second-biggest-in-the-world industrial enzyme manufacturer Genencor international corporation have applied for the fermentable carbon source being substrate usefulness genetic engineering bacterium direct production 1, and (USPatent 7067300 for the patent of ammediol; US Patent 6514733), 1, the ammediol production peak can reach 135g/L.Domestic each scientific research institutions also actively develop the research of recombinant bacterial strain structure aspect, made up a strain recombination bacillus coli as Southern Yangtze University, this bacterial strain is 50g/L at initial glycerol concentration, in the single batch fermentation maturing fermentation liquid 1, the ultimate density of ammediol can reach 35～42g/L (Chinese patent ZL 200610039670.X).Beijing University of Chemical Technology's high expression level glycerol dehydratase and from colibacillary aldehyde reductase simultaneously in Cray Bai Shi bacillus makes 1, the output of ammediol be improved (Chinese patent CN 200710176065.1).Aspect the key enzyme transformation, Shanghai University of Science and Technology adopts the fallibility round pcr to obtain 1, ammediol oxidoreductase isozyme variant enzyme (Chinese patent CN 200710171758.1; Chinese patent CN 200710171759.6).Remove Dupont company and adopt recombination bacillus coli to produce 1, outside ammediol output is greatly improved, adopt recombinant bacterial strain to produce 1 at present, still there are problems such as production concentration is low, glycerol conversion yield is low, production intensity is low in ammediol.
Discover that in the anaerobism batch fermentation when initial glycerol concentration reached 44.2g/L, the 3-hydroxy propanal accumulated in cell, cause cell to stop growing, (Barbirato, F.et al. are stagnated in glycerine consumption, Appl.Environ.Microbiol.1996,62 (4): 1448-1451).Also reflect simultaneously in thalline this moment 1, the relative shortage of ammediol oxydo-reductase.Even but in thalline high expression level 1, the ammediol oxydo-reductase still can't obtain expected effect (Zheng, P.et al., Process Biochem.2006,41 (10): 2160-2169).1, the ammediol oxydo-reductase is a two-way enzyme, can be converted into l by catalysis 3-hydroxy propanal, and ammediol again can be with 1 of generation, and ammediol is converted into the 3-hydroxy propanal, and like this to 1, the accumulation of ammediol is disadvantageous.And the aldehyde reductase among the klebsiella DSM 2026 (German national microbial strains preservation center, numbering 2026) has converse zero the character that should be, the 3-hydroxy propanal can be converted into 1, ammediol, thereby the toxic action of releasing 3-hydroxy propanal, help 1, ammediol synthetic.
By producing 1, the microorganism glycerine pathways metabolism of ammediol as seen, the amount of NADH is restriction 1 in the thalline, the important factor that ammediol generates.Consider and have a large amount of NADPH in the thalline, and certain micro-organisms, such as the bacterial classification in Klebsiella (Klebsiella), citric acid Pseudomonas (Citrobacter), the fusobacterium (Clostridium) etc., wherein 1, the ammediol oxydo-reductase can not effectively utilize NADPH to synthesize 1, ammediol.And aldehyde reductase be the natural NADPH that can utilize as coenzyme, the aldehyde reductase that obtains of we clone both can utilize NADPH simultaneously, can utilize NADH again, thereby strengthen the catalytic capability of aldehyde reductase.If use aldehyde reductase in these microbies, to realize efficiently expressing, the balance of oxidative pathway and reduction approach not only can be maintained like this, and reducing power in the thalline can be effectively utilized, help 1, the concentration of ammediol and the raising of production intensity.
Summary of the invention
The technical problem to be solved in the present invention provide a kind of can high yield 1, the recombinant bacterial strain of ammediol improves 1, the output of ammediol.
Technical scheme of the present invention is as follows:
The first step: the gene of aldehyde reductase of the present invention comes from Klebsiella (Klebsiella), intestinal bacteria (Escherichia coli), subtilis (Bacillus subtilis), dysentery bacterium (Shigellaflexneri) or salmonella (Salmonella).Described aldehyde reductase have shown in SEQ ID NO:1 aminoacid sequence or because of replace, lack, insert and/or add one or the several amino acid residue different with the sequence of SEQ ID NO:1, but still have the aminoacid sequence of the active enzyme of same enzyme.Described aldehyde reductase gene has the nucleotide sequence shown in SEQ ID NO:2, its degeneracy sequence or coding because of replace, lack, insert and/or add one or the several amino acid residue different with the coded sequence of SEQ ID NO:2, but still have the nucleotide sequence of the active enzyme of same enzyme.
Second step: the invention provides a kind of recombinant expression vector, wherein comprise the aldehyde reductase gene under promotor control of one or more copies.
What described promotor was well known to those skilled in the art can be applied to the suitable promotor that prokaryotic gene is expressed.Described promotor is selected from the constitutive promoter among pk (protein kinase) promotor, nif (fixed nitrogen) promotor or dha (Protosol) promotor, or is selected from lac (lactose) promotor, T7 (phage) promotor, tac promotor (hybrid promoter of lactose and tryptophane) or trp (tryptophane) but inducible promoter among the promotor.
Described recombinant vectors has any suitable carriers skeleton, for example can be selected from pBR322, pUC series, pET series or pDK serial carrier.
The 3rd step: the invention provides a kind of host cell that contains aforementioned recombinant expression vector.
Described host cell is selected from Klebsiella (Klebsiella), citric acid Pseudomonas (Citrobacter) or fusobacterium (Clostridium) etc.
The 4th step: the invention provides above-mentioned recombinant bacterial strain in preparation 1, the application in the ammediol.
Fermentation mode adopts batch fermentation, batch formula stream to add fermentation or continuously ferments etc.
Wherein said fermentation is aerobic fermentation, the micro-aerobe fermentation that bubbling air carries out in microbial cultivation process or feeds the anaerobically fermenting that nitrogen carries out in microbial cultivation process.
Contain other required various compositions of carbon source, nitrogenous source, inorganic salt, VITAMIN and strain growth in seed and the fermention medium.
Fermentation inoculum size 1～12%, 20～50 ℃ of culture temperature, air flow is 0.1～1vvm during fermentation, regulates pH and maintains 5.0～9.0, mixing speed is 80～350rpm, incubation time 10～50h.
Effect of the present invention with benefit is: compares with original strain, utilizes recombinant bacterial strain provided by the invention to ferment, and 1, the output of ammediol improves 10～50%.
Embodiment
Be described in detail specific embodiments of the invention below in conjunction with technical scheme.
Embodiment:
(1) clone of aldehyde reductase gene yqhD:
According to the aldehyde reductase gene order of disclosed klebsiella among the GenBank (Klebsiella pneumoniae) AS 1.1736 (yqhD, ID:EU012494) the design primer is as follows:
P1：5’-ATGAATAATTTCGACCTGCATACCC-3’(SEQ?ID?NO：3)
P2：5’-TTAGCGTGCAGCCTCGTAAATAC-3’(SEQ?ID?NO：4)
(preparation method sees works such as F. Ao Sibai with klebsiella (Klebsiellapneumoniae) DSM 2026 genomes, " fine works molecular biology experiment guide ", Science Press, 1998) for template finish the PCR reaction (referring to Sambrook, J., Russel, D.W., Molecular Cloning:A Laboratory Maunal3rd ed., Cold Spring Harbor, New York:Cold Spring Harbor Laboratory Press, 2001).In the PCR reaction tubes, add following composition: genomic dna 1 μ l, dNTPs 4 μ l, each 1 μ l of primer P1 and P2 (synthetic), 5 μ l, 10 * Ex Taq buffer by precious biotechnology (Dalian) company limited, 1U Ex Taq archaeal dna polymerase, moisturizing to 50 μ l; Reaction conditions: 95 ℃ of sex change 60s, through 95 ℃ of 30s, 58 ℃ of 1min, 30 circulations of 72 ℃ of 2min.The PCR product that obtains confirms that through electrophoretic analysis after gel reclaimed the test kit purifying, the product after the recovery was connected into carrier pMD 18-T, obtains recombinant plasmid pMD18-T-yqhD.Thermal shock method Transformed E .coli DH5 α screens positive recombinant chou containing on the resistant panel of penbritin, and the picking mono-clonal extracts plasmid then, and double digestion is identified correct recombinant plasmid, the sample presentation order-checking.
(2) subclone of aldehyde reductase gene yqhD:
Utilize the correct recombinant vectors pMD 18-T-yqhD of order-checking to be template, introduce restriction enzyme site by PCR, the design primer is as follows:
P3：5’-CCTGCAGGTCGACG
CATATGAATAATT-3’(SEQ?ID?NO：5)
P4：5’-ACCCGG
GGATCCTCTAGAGATTTTAGCGTG-3’(SEQ?ID?NO：6)
The primer two ends are introduced Nde I and BamH I restriction enzyme site respectively.With recombinant plasmid pMD 18-T-yqhD is template, is primer with P3 and P4, and amplification obtains having the yqhD gene of restriction enzyme site.The PCR product that obtains confirms that through electrophoretic analysis double digestion after gel reclaims the test kit purifying, the enzyme after the recovery are cut product and be connected into the carrier pET23a (+) that cuts through same enzyme, obtains recombinant plasmid pET23a (+)-yqhD.Thermal shock method Transformed E .coli DH5 α screens positive recombinant chou containing on the resistant panel of penbritin, and the picking mono-clonal extracts plasmid then, and double digestion is identified correct recombinant plasmid, the sample presentation order-checking.
(3) expression of aldehyde reductase in intestinal bacteria:
Recombinant plasmid pET23a (+)-yqhD thermal shock Transformed E .coli BL21 (DE3) that order-checking is correct, the picking mono-clonal is connected to the LB substratum, and 37 ℃ of following 170r/min cultivated 12 hours, and switching is cultured to OD
600Be 0.6, add IPTG to final concentration 1mM, 20 ℃ of following 150r/min induced 12 hours.Get 4ml bacterium liquid, 4 ℃, the centrifugal 15min of 12000r/min collects thalline, and is resuspended, ultrasonication, and 4 ℃, the centrifugal 20min of 8000r/min gets supernatant and carries out enzyme activity determination and SDS-PAGE.Concentrated gum concentration is 4%, and resolving gel concentration is 12%, and electrophoretic buffer adopts Tris-glycine system.
(4) purifying of aldehyde reductase and enzyme activity determination:
The purifying of aldehyde reductase at first adopts ion exchange chromatography (Q-Sepharose FF).Sample is the cell crude extract that cytoclasis is obtained, and needs before the last sample to handle with the filtering with microporous membrane of 0.45 μ m.50mM Tris-HCl damping fluid with pH 7.4 (contains 0.1mM Mn
2+, 2mM DTT) go up sample, the protein that flow velocity 1ml/min, flush away do not combine closely carries out linear gradient elution with the above-mentioned Tris-HCl damping fluid that contains 1M KCl, flow velocity is 5ml/min.Adopt Fraction Collector to collect elutriant continuously, every pipe is collected 3ml.Judge protein wash-out situation by absorbancy under the observation 280nm in the chromatography process, selecting has the part of absorption peak to carry out enzyme activity determination.Protein concn need adopt the Xylene Brilliant Cyanine G method quantitative measurement.
Measure the collected elutriant of ion exchange chromatography, get its enzyme comparatively significant part alive and merge, with the further separation and purification of gel permeation chromatography (Sephacryl S-300).(contain 0.1mM Mn with the 50mMTris-HCl damping fluid that contains pH 7.4
2+, 2mM DTT) carry out wash-out, flow velocity is 0.5ml/min, substep is collected every pipe 1ml.
Through behind the purifying, obtain the single pure enzyme of electrophoretic band.With the 3-hydroxy propanal is substrate, and the ratio vigor of this enzyme that records is 3.8U/mg; And with 1, when ammediol is substrate, detect less than enzyme activity.Simultaneously, find that this enzyme has handiness in the utilization of coenzyme, can utilize NADPH, can utilize NADH again.
Initial velocity method is measured enzyme activity: in the quartz colorimetric utensil of optical path 0.5cm, and 1.5mL reaction solution (27mM3-hydroxy propanal, 0.37mM NADH or NADPH, 1 μ M ZnCl
2, 100mM Tris-HCl buffer, pH 7.4), the enzyme liquid that adds 0.1ml starts reaction, the absorbancy changing value of timing assaying reaction liquid immediately.Enzyme work is defined as: under 37 ℃, catalysis 3-hydroxy propanal is converted into 1, during ammediol, and micromole's number that per minute NADH of 340nm place or NADPH consume.
(5) structure of recombinant klebsiella (Klebsiella pneumoniae):
1) structure of recombinant expression vector:
Recombinant plasmid pET23a (+)-yqhD is cloned among the expression vector pDK after same enzyme is cut after Xba I enzyme is cut, thermal shock method Transformed E .coli DH5 α.The picking mono-clonal extracts plasmid pDK-yqhD, carries out double digestion and identifies.
2) electricity transforms klebsiella:
Double digestion is identified that correct recombinant plasmid pDK-yqhD electric shock transforms klebsiella (Klebsiellapneumoniae) DSM 2026.
3) expression of recombinant klebsiella:
The picking mono-clonal is connected to the LB substratum, and 37 ℃ of following 170r/min are cultured to 12 hours, and switching once is cultured to OD
600Be 0.6, add IPTG to final concentration 1mM, 37 ℃ of following 120r/min induced 5 hours.Respectively the supernatant liquor after whole-cell protein after inducing and the fragmentation is carried out SDS-PAGE.After electrophoresis finishes, there is the band of 42.3kD protein protomer to occur, illustrates that aldehyde reductase realized expression in klebsiella.
(6) reorganization bacterium ferment glycerin produces 1, ammediol:
1) bacterial classification: klebsiella (Klesiella pneumoniae) DSM 2026, recombinant klebsiella (Klebsiella pneumoniae) (pDK-yqhD).
2) substratum:
Seed culture medium (/l): glycerine 20g, K
2HPO
43H
2O 4.454g, KH
2PO
41.3g, (NH
4)
2SO
42.0g, MgSO
47H
2O 0.2g, yeast powder 1.0g, CaCO
32g, Fe
2+Solution 1ml, Ca
2+Solution 1ml, micro-A 2ml.
Fermention medium (/l): glycerine 50g, K
2HPO
43H
2O 4.454g, KH
2PO
41.3g, (NH
4)
2SO
42.0g, MgSO
47H
2O 0.2g, yeast powder 1.0g, CaCO
32g, Fe
2+Solution 1ml, Ca
2+Solution 1ml, micro-A 2ml.
Fe
2+Solution (/l): FeSO
47H
2O 5g, saturated hydrochloric acid 4ml.
Ca
2+Solution (/l): CaCl
220g.
Trace element A solution (/l): ZnCl
20.07g, MnCl
24H
2O 0.1g, CoCl
26H
2O 0.2g, NiCl
26H
2O 0.025g, CuCl
22H
2O 0.02g, NaMoO
42H
2O 0.035g, H
3BO
30.06g, saturated hydrochloric acid 0.9ml.
3) training method:
A. seed culture
Picking mono-clonal from the solid medium, 37 ℃ are used the seed culture mediums activation down.Seed culture is used 50ml triangular flask, liquid amount 10ml.37 ℃ of culture temperature, shaking speed 170rpm, incubation time 12 hours.
B. fermentation culture
Control group uses klebsiella as bacterial classification, and experimental group uses recombinant klebsiella (pDK-yqhD) as bacterial classification.250ml triangular flask, liquid amount 100ml, inoculum size 2%, 37 ℃ of culture temperature, shaking speed 120rpm are used in fermentation.The fermentation beginning is experimental group adding IPTG abduction delivering after 2 hours.
4) fermentation result:
Fermentation was carried out 30 hours altogether, and in the control group fermented liquid 1, ammediol concentration is 16.89g/l during fermentation ends, and in the experimental group fermented liquid 1, ammediol concentration is 19.77g/l.This shows, use recombinant klebsiella to ferment as fermented bacterium, 1, the contrast of ammediol concentration ratio improves 17.1%.
Sequence table
SEQ?ID?NO：1
MNNFDLHTPTRILFGKGAIEKLREQIPAEARVLITYGGGSVKKTGVLDQVLTA
LNGLDVLEFGGIEPNPSYETLMNAVKLAREEKVTFLLAVGGGSVLDGTKFIA
AAAHYDADIDPWEILETYGSKIASAIPMGSVLTLPATGSESNKGAVISRKTTG
DKRAFMSSHVQPQFAILDPVYTYTLPPRQVANGVVDAFVHTVEQYVTYPVD
GKIQDRFAEGILLTLIEDGPKALQEPENYNVRANIMWAATQALNGLIGAGVP
QDWATHMLGHELTAMHGLDHAQTLAIVLPALWNEKRDAKREKLLQYAER
VWNITEGSDDQRIDAAIAATRQFFEQMGVPTRLSDYGLDGSSIPALLAKLEEH
GMTKLGEHQDITLDVSRRIYEAAR
SEQ?ID?NO：2
5’-atgaataatttcgacctgcataccccaacccgcattctgtttggcaaaggcgcgattgaaaagctgcgtgaacagatcc
cggcggaagcccgcgtactgatcacctacggcggcggcagcgtcaaaaaaacaggcgtcctggatcaggtcctcaccg
ctctgaatggcctggatgtccttgaatttggcggcatcgagccgaatccgtcttacgaaaccctgatgaatgcggtgaaact
cgcccgggaagagaaagtgaccttcctgctggcggtcggcggcggttcggtgctggatggcaccaagtttatcgctgca
gcagcccactacgacgcggatatcgatccgtgggaaattctggaaacctatggcagcaaaattgccagcgccattccaat
gggctcggtactgactctgccggcgaccggttctgaatccaacaaaggcgcggtcatatcgcggaaaaccaccggcga
caaacgcgcgtttatgtcttcgcacgtccagccgcagttcgcgatcctcgatccggtttatacctataccctgccgccgcgc
caggtcgcgaacggcgtggttgacgccttcgtccataccgtcgagcagtacgtgacctacccggttgacggcaaaatcca
ggaccgcttcgccgaaggcattctcctgaccctgatcgaggatggcccgaaagccctgcaggaaccggagaactataac
gtgcgcgccaatattatgtgggcggcgacgcaggcgctgaacggcctgatcggcgcaggcgtgccacaggactgggc
gacgcatatgctcggccacgagctgacggcgatgcacggcctggatcacgcccagacgctggctatcgtgctgccggc
gctgtggaatgagaaacgcgatgccaagcgcgagaagctgctgcagtatgccgagcgcgtgtggaatattaccgaagg
ctctgacgaccaacgtatcgatgccgccatcgccgcaacgcgtcagttcttcgagcagatgggcgtgccgacccgccttt
ccgattacggtctcgacggtagctccatcccggcgctgctggcgaaactggaagagcacggcatgactaaacttggcga
acatcaggatatcaccctggacgtcagccgccgtatttacgaggctgcacgctaa-3’
SEQ?ID?NO：3
5’-ATGAATAATTTCGACCTGCATACCC-3’
SEQ?ID?NO：4
5’-TTAGCGTGCAGCCTCGTAAATAC-3’
SEQ?ID?NO：5
5’-CCTGCAGGTCGACGCATATGAATAATT-3’
SEQ?ID?NO：6
5’-ACCCGGGGATCCTCTAGAGATTTTAGCGTG-3’
Claims (1)
1, a kind of aldehyde reductase recombinant expressed and be 1 in the glycerine bio-transformation, the application in the ammediol is characterized in that following steps:
The first step: described aldehyde reductase, its gene comes from Klebsiella, intestinal bacteria, subtilis, dysentery bacterium or salmonella, have SEQ ID NO:1 aminoacid sequence or because of replace, lack, insert and/or add one or the several amino acid residue different with the sequence of SEQ ID NO:1, but still have the aminoacid sequence of the active enzyme of same enzyme;
The gene of aldehyde reductase has the nucleotide sequence of SEQ ID NO:2, the perhaps degeneracy sequence of SEQ ID NO:2, perhaps because of replacement, disappearance, the insertion of coding and/or add one or the several amino acid residue different with the coded sequence of SEQ ID NO:2, but still have the nucleotide sequence of the active enzyme of same enzyme;
Second step: described recombinant expression vector is characterized in that containing the above-mentioned aldehyde reductase gene order under promotor control of one or more copies; Constitutive promoter is selected from protein kinase promotor, fixed nitrogen promotor or Protosol promotor, but inducible promoter is selected from the hybrid promoter or the trp promoter of lactose promotor, phage promoter, lactose and tryptophane; The skeleton of its carrier is selected from pBR322, pUC series, pET series or pDK serial carrier;
The 3rd step: described host cell is characterized in that being selected from Klebsiella, citric acid Pseudomonas or fusobacterium etc.;
The 4th step: fermentation mode adopts batch fermentation, batch formula stream to add fermentation or continuously ferments; Fermentation is aerobic fermentation, the micro-aerobe fermentation that bubbling air carries out in microbial cultivation process or feeds the anaerobically fermenting that nitrogen carries out in microbial cultivation process; Contain carbon source, nitrogenous source, inorganic salt and VITAMIN in seed and the fermention medium; Fermentation inoculum size 1～12%, 20～50 ℃ of culture temperature, air flow is 0.1～1.0vvm during fermentation, regulates pH and maintains 5.0～9.0, mixing speed is 80～350rpm, incubation time 10～50h.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN2008102282685A CN101633928B (en) | 2008-10-22 | 2008-10-22 | Recombinant expression of aldehyde reductase and application thereof in bioconversion of glycerol into 1,3-propylene glycol |
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| CN2008102282685A CN101633928B (en) | 2008-10-22 | 2008-10-22 | Recombinant expression of aldehyde reductase and application thereof in bioconversion of glycerol into 1,3-propylene glycol |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| CN101633928A true CN101633928A (en) | 2010-01-27 |
| CN101633928B CN101633928B (en) | 2011-09-14 |
Family
ID=41593268
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| CN2008102282685A Expired - Fee Related CN101633928B (en) | 2008-10-22 | 2008-10-22 | Recombinant expression of aldehyde reductase and application thereof in bioconversion of glycerol into 1,3-propylene glycol |
Country Status (1)
| Country | Link |
|---|---|
| CN (1) | CN101633928B (en) |
Cited By (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101851642A (en) * | 2010-06-04 | 2010-10-06 | 大连理工大学 | Method for producing 1,3-propylene glycol by micro aerobic-anaerobic continuous flowing glycerol adding multi-tank series fermentation |
| CN104164397A (en) * | 2013-05-17 | 2014-11-26 | 武汉臻智生物科技有限公司 | Recombinant microbe and application thereof |
| CN104450808A (en) * | 2013-09-16 | 2015-03-25 | 元智大学 | Method for producing biodegradable polymer and biomass fuel through carbon source conversion by genetic recombination microbe |
| CN112111534A (en) * | 2020-09-09 | 2020-12-22 | 大连理工大学 | Method for preparing 1, 3-propanediol coupled phage through microbial fermentation production |
Family Cites Families (1)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CA2733616C (en) * | 1999-08-18 | 2016-09-27 | E.I. Du Pont De Nemours And Company | Process for the biological production of 1,3-propanediol with high titer |
-
2008
- 2008-10-22 CN CN2008102282685A patent/CN101633928B/en not_active Expired - Fee Related
Cited By (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN101851642A (en) * | 2010-06-04 | 2010-10-06 | 大连理工大学 | Method for producing 1,3-propylene glycol by micro aerobic-anaerobic continuous flowing glycerol adding multi-tank series fermentation |
| CN101851642B (en) * | 2010-06-04 | 2012-03-07 | 大连理工大学 | Method for producing 1,3-propylene glycol by micro aerobic-anaerobic continuous flowing glycerol-adding multi-tank series fermentation |
| CN104164397A (en) * | 2013-05-17 | 2014-11-26 | 武汉臻智生物科技有限公司 | Recombinant microbe and application thereof |
| CN104164397B (en) * | 2013-05-17 | 2018-09-07 | 武汉臻智生物科技有限公司 | Recombinant microorganism and application thereof |
| CN104450808A (en) * | 2013-09-16 | 2015-03-25 | 元智大学 | Method for producing biodegradable polymer and biomass fuel through carbon source conversion by genetic recombination microbe |
| CN112111534A (en) * | 2020-09-09 | 2020-12-22 | 大连理工大学 | Method for preparing 1, 3-propanediol coupled phage through microbial fermentation production |
Also Published As
| Publication number | Publication date |
|---|---|
| CN101633928B (en) | 2011-09-14 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10494600B2 (en) | Bacteria and methods of use thereof | |
| Das et al. | Recent developments in biological hydrogen production processes | |
| Kothari et al. | A critical review on factors influencing fermentative hydrogen production | |
| Zhang et al. | Bioengineering of the Enterobacter aerogenes strain for biohydrogen production | |
| Nandi et al. | Microbial production of hydrogen: an overview | |
| CN103502435B (en) | Recombinant microorganism and application thereof | |
| Liu et al. | Recent advances in fermentative biohydrogen production | |
| Sarma et al. | Homologous overexpression of hydrogenase and glycerol dehydrogenase in Clostridium pasteurianum to enhance hydrogen production from crude glycerol | |
| KR101076042B1 (en) | Enhanced Ethanol and Butanol Producing Microorganisms and Method for Preparing Ethanol and Butanol Using the Same | |
| Karthic et al. | Comparison and limitations of biohydrogen production processes | |
| US10570424B2 (en) | Recombinant methanotrophic bacterium and a method of production of succinic acid from methane or biogas thereof | |
| Xu et al. | Cell growth and hydrogen production on the mixture of xylose and glucose using a novel strain of Clostridium sp. HR-1 isolated from cow dung compost | |
| Debabov | Acetogens: biochemistry, bioenergetics, genetics, and biotechnological potential | |
| Sun et al. | Fermentation performance and mechanism of a novel microbial consortium DUT08 for 1, 3-propandiol production from biodiesel-derived crude glycerol under non-strictly anaerobic conditions | |
| US10190101B2 (en) | Production of lactic acid from organic waste or biogas or methane using recombinant methanotrophic bacteria | |
| CN101633928B (en) | Recombinant expression of aldehyde reductase and application thereof in bioconversion of glycerol into 1,3-propylene glycol | |
| CN101205541B (en) | Recombinant expression carrier and method for high-yield of 1,3-propanediol by fermenting glycerin using host cell converted thereby | |
| Sarma et al. | Advancements in Bio‐hydrogen Production from Waste Biomass | |
| CN111394396B (en) | Method for producing 1, 3-propylene glycol by using glycerol fermentation by microorganisms | |
| CN101643739B (en) | Recombined bacterial strain for modifying specificity of 1,3-propanediol redoxase coenzyme and application thereof | |
| CN101633690B (en) | Hydrogen production associated protein, coding genes thereof and application thereof | |
| CN101265474A (en) | Method for producing clostridium perfringens glycerin anhydrase incitant gene and 1,3-propanediol thereof | |
| Balachandar et al. | Production process via fermentation | |
| CN104498523A (en) | Engineering bacteria for knocking out pyruvate formate-lyase genes and application of engineering bacteria | |
| CN103484490B (en) | For the production of recombinant plasmid, genetic engineering bacterium, the Preparation Method And The Use of hexanodioic acid |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| C06 | Publication | ||
| PB01 | Publication | ||
| C10 | Entry into substantive examination | ||
| SE01 | Entry into force of request for substantive examination | ||
| C14 | Grant of patent or utility model | ||
| GR01 | Patent grant | ||
| CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20110914 Termination date: 20141022 |
|
| EXPY | Termination of patent right or utility model |