CN101585880A - Variable regions on heavy and light chains of antihuman IL-13R alpha 2 monoclonal antibodies - Google Patents
Variable regions on heavy and light chains of antihuman IL-13R alpha 2 monoclonal antibodies Download PDFInfo
- Publication number
- CN101585880A CN101585880A CNA2009100225663A CN200910022566A CN101585880A CN 101585880 A CN101585880 A CN 101585880A CN A2009100225663 A CNA2009100225663 A CN A2009100225663A CN 200910022566 A CN200910022566 A CN 200910022566A CN 101585880 A CN101585880 A CN 101585880A
- Authority
- CN
- China
- Prior art keywords
- alpha
- thr
- variable region
- antibody
- people
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
Images
Landscapes
- Peptides Or Proteins (AREA)
Abstract
The invention discloses variable regions on heavy and light chains of antihuman IL-13R alpha 2 monoclonal antibodies. Recombinant human IL-13R alpha 2 is used for immunizing a BALB/c mouse to prepare a group of mouse antihuman IL-13R alpha 2 monoclonal antibodies; and an IL-13R alpha 2 monoclonal antibody FMMU- IL-13R alpha 2-7 with high-affinity is selected. The genes in variable regions on heavy and light chains of the monoclonal antibody are cloned to obtain the gene sequences and the amino acid sequences of the variable regions on heavy and light chains of the monoclonal antibody; and the uniqueness of the gene sequences and protein sequences is confirmed. The amino acid sequences of the variable regions and the gene sequences encoding the variable regions have significant potential application values in the construction of IL-13R alpha 2-targeted single chain antibodies, chimeric antibodies, humanized antibodies or vaccines for treating malignant tumors.
Description
Technical field
The invention belongs to field of biomedicine technology, relate to a kind of monoclonal antibody, the heavy chain and the variable region of light chain of particularly a kind of anti-people IL-13R alpha 2 monoclonal antibodies (FMMU-IL-13R α 2-7) comprise its aminoacid sequence and nucleotide sequence thereof.
Background technology
Malignant tumour is the major disease of harm humans health, still is in research and exploratory stage at present at its treatment means.After traditional operative treatment, radiotherapy, chemotherapy and immunotherapy, to be the emerging research field that the targeting antibodies pharmacological agent of representative is just becoming the treatment tumour in conjunction with genetically engineered and protein engineering, be subjected to the extensive concern of preclinical medicine and clinic study field researcher.
People IL-13R α 2 is specificity overexpression tumour-specific marks in malignant cell surfaces such as human glioma, tumor of head and neck, ovarian cancer and kidneys, plays a significant role in the targeted therapy of malignant tumour.People IL-13R α 2 has caused the attention of U.S. FDA as the treatment target spot of malignant cells such as human glioma, tumor of head and neck, ovarian cancer and kidney as far back as 1988, this tissue has successively prepared at the medicine IL-13-PE38 of people IL-13R α 2 treatment target spots with at the single-chain antibody ScFv-PE fusion molecule of people IL-13R α 2.Although IL-13-PE38 has obtained curative effect and has been entered the clinical I/II phase by drugs approved by FDA and treated in the treatment of malignant cells such as neurospongioma, tumor of head and neck, ovarian cancer and kidney, but because in the treatment neoplastic process, IL-13-PE38 not only combines with the specific expressed people IL-13R α 2 of tumor cell surface, it can also combine with the IL-13R α 1 that is expressed in the normal tissue cell surface, damage healthy tissues and cell.Owing to lack strict target, limited the further application of IL-13-PE38.For solving selectively targeted problem at people IL-13R α 2, U.S. FDA is used the single-chain antibody of phage display storehouse technology acquisition at people IL-13R α 2, and then make up IL-13R α 2 (ScFv)-PE38 carrier for expression of eukaryon and express and obtained humanized IL-13R α 2 (ScFv)-PE38 antibody preparation, but it is lower that this molecule and people IL-13R α 2 avidity are found in follow-up study, needs heavy dose of effect that just can reach effective killing tumor cell of using.
The antibody monomer molecule is by two identical heavy chains (H chain) and two identical light chains (L chain), the tetrapeptide chain structure that is formed by connecting by interchain disulfide bond.H chain and L chain comprise amino (N) end and carboxyl (C) end, are made up of hypervariable region/complementary determining region (HVR/CDR) and skeleton district (FR) near the variable region (V district) of N end; Be constant region (C district) near the C end.The protein folding that variable region of heavy chain (VH) and variable region of light chain (VL) form is an antigen-binding site, and CDR/HVR wherein is antibody and the complementary bonded of epitope position, and the reaction after the antigen-antibody identification is caused in the C district.Antibody can divide for people source, mouse source etc. according to FR/C district difference, the mouse endogenous antibody has immunogenicity when using in human body, easily cause the immune response of human body, these immune responses can cause the removing of mouse endogenous antibody and immunocomplex mediated hypersensitivity.In order to overcome the defective of mouse endogenous antibody, need to make up specific chimeric antibody, single-chain antibody or the humanized antibody of high-affinity.
In making up the humanized antibody process, adopt the humanized antibody avidity of technology acquisitions such as phage antibody library not high, using dosage is big.For improving the avidity of antibody, of paramount importance is the mouse source property parental antibody that acquisition has good specificity and avidity, clone its light chain and heavy chain variable region gene, then variable region gene is cloned into respective carrier and makes up corresponding genetic engineering antibody recombinant DNA, the expressing gene engineered antibody is realized humanization.Therefore, filter out the hybridoma cell clone of specific secretion high-affinity mouse monoclonal antibody, therefrom clone the heavy chain and the chain variable region gene of high-affinity antibody, analyze its aminoacid sequence further structure high-affinity and specific humanized genetic engineering antibody are had decisive meaning.
Summary of the invention
The objective of the invention is to, a kind of heavy chain and variable region of light chain of anti-people IL-13R alpha 2 monoclonal antibodies of high-affinity are provided, comprise its gene and aminoacid sequence thereof, chimeric or humanized genetic engineering antibody provides support for the anti-people IL-13R α 2 that makes up high-affinity.
In order to realize the foregoing invention purpose, technical scheme of the present invention is:
(1) one group of mouse anti human IL-13R alpha 2 monoclonal antibodies of preparation therefrom filters out the anti-people IL-13R alpha 2 monoclonal antibodies FMMU-IL-13R α 2-7 with high-affinity; This monoclonal antibody of experiment confirm can be specifically in conjunction with people IL-13R α 2, and described validating experiment comprises that ELISA detects, flow cytometer detects and the pathological section immunohistochemistry detects;
(2) clone this monoclonal antibody light chain and heavy chain variable region gene; Described monoclonal antibody light chain and heavy chain variable region gene sequence are respectively shown in SEQ ID NO.3 and SEQ ID NO.4;
(3) obtain this monoclonal antibody light chain and heavy chain variable region gene sequence and aminoacid sequence, confirm the uniqueness of this gene order and corresponding protein sequence; Described variable region of mab aminoacid sequence and analyzes its CDR district shown in SEQ ID NO.1 and SEQ ID NO.2; 3 CDR sequences of light chain are respectively CDR1:Gln-Ser-Leu-Val-His-Ser-Asp-Gly-Asn-Thr-Tyr, CDR2:Thr-Val-Ser, CDR3:Ser-Gln-Cys-Thr-His-Val-Pro-Phe-Thr; 3 complementary determining regions (CDR) sequence of heavy chain is respectively CDR1:Gly-Tyr-Thr-Phe-Thr-Asn-Tyr-Trp, CDR2:Ile-Tyr-Pro-Gly-Asn-Asp-Asp-Ser, CDR3:Ala-Thr-Gly-Thr-Glu-Phe-Thr-Tyr.
(4) design construction is the genetic engineering antibody or the vaccine of target spot with people IL-13R α 2.
Technique effect of the present invention:
The present invention filters out the monoclonal antibody FMMU-IL-13R α 2-7 of the anti-people IL-13R of high-affinity α 2, and clone its light chain and variable region of heavy chain, obtain its unique nucleotide sequence after the order-checking, anti-people IL-13R α 2 chimeric antibodies, single-chain antibody or the humanized antibody that have good pharmaceutical use for structure are laid a good foundation.
Description of drawings
Fig. 1 is anti-people IL-13R alpha 2 monoclonal antibodies FMMU-IL-13R α 2-7 and glioma cell line U251 people from surface IL-13R α 2 bonded flow cytometer detected result figure (FITC: fluorescein isothiocyanate, transverse axis are cell count, and the longitudinal axis is a fluorescence intensity); Fig. 1 a is staphylococcus enterotoxin D (SED) monoclonal antibody contrast figure, and Fig. 1 b is FMMU-IL-13R α 2-7 monoclonal antibody figure as a result.
Fig. 2 is anti-people IL-13R alpha 2 monoclonal antibodies FMMU-IL-13R α 2-7 and glioma cell line U87 people from surface IL-13R α 2 bonded flow cytometer detected result figure; Fig. 2 a is SED contrast figure, and Fig. 2 b is FMMU-IL-13R α 2-7 monoclonal antibody figure as a result.
Fig. 3 is that anti-people IL-13R alpha 2 monoclonal antibodies (FMMU-IL-13R α 2-7) detects the immunohistochemical staining figure that people IL-13R α 2 expresses in the glioma paraffin section.
Embodiment
Below the present invention is elaborated.
The aminoacid sequence of nucleotide sequence of complete nucleotide sequence, especially its functional fragment of variable region gene (as CDR etc.) and antibody variable region is the basis that chimeric antibody, single-chain antibody or humanized antibody make up.For this reason, the applicant uses recombinant human IL-13R α 2 immune BALB/c mouse, prepared one group of mouse anti human IL-13R alpha 2 monoclonal antibodies, the clone also therefrom filters out the hybridoma cell strain that can secrete high affinity human IL-13R alpha 2 monoclonal antibodies FMMU-IL-13R α 2-7, and this strain of hybridoma has the ability of stably excreting antibody.
Clone this monoclonal antibody light chain and heavy chain variable region gene; Described variable region gene sequence of monoclonal antibody is shown in SEQ ID NO.3 and SEQ ID NO.4; Obtain this monoclonal antibody light chain and heavy chain variable region gene sequence and aminoacid sequence, confirm the uniqueness and the CDR sequence thereof of this gene order and corresponding protein sequence; Described variable region of mab aminoacid sequence is shown in SEQ ID NO.1 and SEQID NO.2.
The present invention specifically implements according to the following steps
The preparation of 1 mouse anti human IL-13R α, 2 high-affinity antibodies
1.1 MONOCLONAL ANTIBODIES SPECIFIC FOR, purifying
Recombinant human IL-13R α 2 molecules are entrusted Wuhan Sanying Bio-Technology Co., Ltd.'s preparation.
Press method for preparing monoclonal antibody (cell and molecular immunology experimental technique first version, P9-P17), with recombinant human IL-13R α 2 immune BALB/c mouse (available from The Fourth Military Medical University's Experimental Animal Center), prepare one group of mouse anti human IL-13R alpha 2 monoclonal antibodies, from hybridoma cell strain FMMU-IL-13R α 2-1~14, select to secrete the anti-people IL-13R alpha 2 monoclonal antibodies of high-affinity, find FMMU-IL-13R α 2-7 hybridoma cell strain excretory antibody have higher avidity and with the people IL-13R α 2 molecule bonded abilities of the natural expression of cell surface.
By the mouse ascites preparation method prepare ascites (cell and molecular immunology experimental technique first version, P9-P17).Ascites adopts Protein A affinity chromatography purifying behind ammonium sulfate precipitation.With the purity of SDS-PAGE purification Identification antibody, antibody purified FMMU-IL-13R α 2-7 purity reaches 95%.
1.2 anti-people IL-13R alpha 2 monoclonal antibodies titration experiment
Detect the IgG subclass of FMMU-IL-13R α 2-1~14 monoclonal antibodies of preparation respectively with IgG subclass detection kit (U.S. Sigma company), indirect elisa method (cell and molecular immunology experimental technique, first version, P44-46) ascites of detection FMMU-IL-13R α 2-1~14 hybridoma cell strains is tired.With recombinant human IL-13R α 2 is antigen, detects FMMU-IL-13R α 2-1~14 monoclonal antibodies in immunoblotting (molecular cloning experiment guide, second edition, P888-P897) ability of middle conjugated antigen.(cell and molecular immunology experimental technique, first version P78-P89) detect the ability that FMMU-IL-13R α 2-1~14 monoclonal antibodies are discerned natural IL-13R α 2 on the glioma cell line U251 cell of high expression level people IL-13R α 2 with flow cytometry.
The ascites experimental result of tiring is as shown in table 1, and the ascites that the 7th, 14 hybridoma cell strains produce is tired the highest, is 10
-7, show that itself and antigen avidity are very high; Above-mentioned two strain monoclonal antibodies are used for immunoblot experiment all obtain positive findings.But the 14th strain of hybridoma strain can not obtain positive findings in Flow cytometry, shows natural IL-13R α 2 molecules that it may not the recognizing cells surface.The 7th strain of hybridoma strain then can the recognizing cells surface natural IL-13R α 2 molecules, utilize the genetic engineering antibody of its variable region preparation more likely combine and further bring into play biological action with the natural IL-13R α 2 of cell surface.
The evaluation of tiring of table 1 people IL-13R α 2 monoclonal antibodies
Clone number | Subclass | Ascites is tired | Immunoblotting | Flow cytometry |
1 | IgM(κ) | 10 -4 | - | - |
2 | IgG 1(κ) | 10 -6 | + | ++ |
3 | IgG 1(κ) | 10 -6 | + | - |
4 | IgG 1(κ) | 10 -5 | + | - |
5 | IgG 1(κ) | 10 -6 | + | - |
6 | IgG 1(κ) | 10 -6 | + | - |
7 | IgG 1(κ) | 10 -7 | + | ++ |
8 | IgG 1(κ) | 10 -6 | - | + |
9 | IgG 1(κ) | 10 -5 | + | + |
10 | Ig2b(κ) | 10 -6 | - | + |
11 | IgG 1(κ) | 10 -5 | + | - |
12 | IgG 1(κ) | 10 -6 | - | ++ |
13 | IgG 1(κ) | 10 -5 | + | ++ |
14 | IgG 1(κ) | 10 -7 | + | - |
1.3 anti-people IL-13R alpha 2 monoclonal antibodies FMMU-IL-13R α 2-7 combines with glioma cell line U251 and U87 surface people IL-13R α 2
Adopt binding ability (cell and the molecular immunology experimental technique of indirect IF staining method in conjunction with Flow cytometry FMMU-IL-13R α 2-7 monoclonal antibody and natural IL-13R α 2 molecules of glioma cell line U251 and U87 surface, first version, P78-80), with FMMU-IL-13R α 2-7 is one anti-, FITC mark goat anti-mouse antibody is two anti-, flow cytometry analysis.As shown in Figure 1, 2, compare with the SED contrast, the glioma cell line binding ability of FMMU-IL-13R α 2-7 monoclonal antibody and high expression level people IL-13R α 2 obviously strengthens, and IL-13R α 2 molecules on FMMU-IL-13R α 2-7 monoclonal antibody specific recognition glioma cell surface are described.
1.4 anti-people IL-13R alpha 2 monoclonal antibodies FMMU-IL-13R α 2-7 detects the expression of people IL-13R α 2 in the glioma section
With FMMU-IL-13R α 2-7 monoclonal antibody is one anti-, and (pathological technique, first version P367-372) detect the ability of people IL-13R α 2 in the FMMU-IL-13R α 2-7 identification glioma paraffin section with immunohistochemical method.As shown in Figure 3, but people IL-13R α 2 molecules of visible FMMU-IL-13R α 2-7 monoclonal antibody specific recognition glioma tumor cell surface.
The clone of 2 people IL-13R α 2mAb light chains and heavy chain variable region gene
2.1FMMU-IL-13R the cultivation of α 2-7 hybridoma
(P88) FMMU-IL-13R α 2-7 cell is cultivated based on 37 ℃ 5%CO with the RPMI 1640 that contains 10% calf serum for cell cultures, first version in recovery according to a conventional method
2Cultivate in the incubator.
2.2 the extraction of total RNA and cDNA first chain is synthetic
With TRIZOL Reagent (available from U.S. GIBCO company), by specification extracts total RNA.The cDNA first chain synthetic agent box carries out synthetic cDNA first chain of reverse transcription available from Fermentas company (U.S.) by product description.
2.3PCR method amplification FMMU-IL-13R α 2-7V
LWith FMMU-IL-13R α 2-7V
HGene
PCR method amplification kit is that template is carried out PCR available from Takara company with cDNA first chain.Reaction volume 50 μ l, reaction conditions is: 95 ℃ of 30s, 58 ℃ of 1min circulate 35 times; V
L, V
HForward and reverse primer nucleotides sequence classify as:
V
LF:gggga tatcc accat gaagt tgcct gttag gctgt tg
V
LB:gcgcc gtcta gaatt aacac tcatt cctgt tgaa
V
HF:tgagg agacg gtgac cgtgg tccct tggcc ccag
V
HB:aggts marct gcags agtcw gg
(the IUB standard annexs base code: s:c/g; M:a/c; R:a/g; W:a/t)
2.4PCR the clone of amplified production and screening
The PCR product is through 1.5% agarose gel electrophoresis, reclaim test kit (available from U.S. Axygen company) with a small amount of glue and reclaim heavy chain of antibody and variable region of light chain fragment, (available from Japanese Takara company) inserts this fragment by specification in the pMD18T carrier with the pMD18T test kit.Transformed E .coliXL-10 (available from Beijing China common micro-organisms DSMZ) is with EcoR I and Sal I restriction endonuclease (available from Takara company) digestion method screening recombinant clone (enzyme is cut and obtained the 400bp fragment).Measure gene order with the terminal cessation method of two picodnas, AudioCodes biotechnology limited liability company finishes by Beijing, and measurement result is shown in SEQ ID NO.3 and SEQ ID NO.4.
The aminoacid sequence and the homology analysis of 3FMMU-IL-13R α 2-7 light chain and variable region of heavy chain
3.1 after determining that order-checking is errorless, in the GenBank+EMBL+DDBJ+PDB database, carry out nucleotide sequence homology analysis (Blastn).
Analytical results shows, FMMU-IL-13R α 2-7 monoclonal antibody chain variable region gene and mouse anti oxyphorase 3C4 monoclonal antibody immunity sphaeroprotein variable region of light chain homology are the highest, and homology is 319/336, and percent homology is 94%, (seeing BLASTN 1, the 13rd page in specification sheets); FMMU-IL-13R α 2-7 monoclonal antibody heavy chain variable region gene and mouse Ig μ chain B2 gene V-D-J1 district homology are the highest, and homology is 319/355, and percent homology is 89%, (seeing BLASTN 2, the 14th page in specification sheets).
3.2 variable region gene is translated into aminoacid sequence, shown in SEQ ID NO.1 and SEQ ID NO.2.
In non-redundant Genbank CDS translations+PDB+SwissProt+PIR+PRF Protein Data Bank, carry out amino acid sequence homology analysis (Blastp).
Analytical results shows, FMMU-IL-13R α 2-7 monoclonal antibody light-chain amino acid sequence and immunoglobulin light chain variable region (gb|AAA85498.1|) homology are the highest, and homology is 107/112, and percent homology is 95%, (seeing BLASTP 3, the 15th page in specification sheets); The unique heavy chain of antibody homology of FMMU-IL-13R α 2-7 monoclonal antibody heavy chain amino acid sequence and mouse anti is the highest, and homology is 105/117, and percent homology is 89% (seeing BLASTP 4, the 16th page in specification sheets).
The nucleotide sequence of the light chain of coding FMMU-IL-13R α 2-7mAb and the gene of variable region of heavy chain shows the not discovery gene order identical with the present invention with the amino acid sequence homology analytical results.
3.3 utilize IMGT/V-QUEST to analyze the variable region structure, determine the CDR district.
To check order gained FMMU-IL-13R α 2-7 light chain of antibody and weight chain variabl area sequence, (http://imgt.cines.fr/IMGT_vquest/vquest) analyzes in the IMGT/V-QUEST website, draws its CDR district.
FMMU-IL-13R α 2-7 light chain of antibody CDR district:
CDR1:Gln-Ser-Leu-Val-His-Ser-Asp-Gly-Asn-Thr-Tyr
CDR2:Thr-Val-Ser
CDR3:Ser-Gln-Cys-Thr-His-Val-Pro-Phe-Thr
FMMU-IL-13R α 2-7 heavy chain of antibody CDR district:
CDR1:Gly-Tyr-Thr-Phe-Thr-Asn-Tyr-Trp
CDR2:Ile-Tyr-Pro-Gly-Asn-Asp-Asp-Ser
CDR3:Ala-Thr-Gly-Thr-Glu-Phe-Thr-Tyr
4. genetic engineering antibody design
Based on expression, purifying and the sequential analysis of anti-people IL-13R alpha 2 monoclonal antibodies FMMU-IL-13R α 2-7, the following biological products of design construction
(1) structure of anti-people IL-13R α 2 single-chain antibodies
Light chain and the heavy chain variable region gene of monoclonal antibody FMMU-IL-13R α 2-7 of the present invention are inserted among the expression vector pCONTAB 5E, the single-chain antibody gene that obtains transforms expression strain, by inducing this expression of gene, preparation has the single-chain antibody of potential therapeutic action to malignant tumour.
(2) structure of humanized antibody
The CDR district of monoclonal antibody FMMU-IL-13R α 2-7 light chain of the present invention and variable region of heavy chain is transplanted among the FR of Ren Yuan variable region, forms CDR grafted antibody (CDR-grafted antibody) also weigh structure antibody (reshaping antibody) or humanized antibody (humanized antibody).Utilize CDR implantation technique engineered antibody, can obtain to keep the specificity of mouse source property parent mAb,, be used to prepare the humanized antibody that malignant tumour is had potential therapeutic action simultaneously more near the novel antibody of people's antibody.
(3) according to gene order of the present invention and amino acid sequence coded thereof, the preparation at people IL-13R α 2 functional epitopes as human mouse chimeric antibody, Fab antibody, vaccine or other biological goods.
Anti-people IL-13R alpha 2 monoclonal antibodies FMMU-IL-13R α 2-7 aminoacid sequence and gene order
<110〉The Fourth Military Medical University of P.L.A
<120〉a kind of variable region of anti-people IL-13R alpha 2 monoclonal antibodies
<160>4
<210>1
<211>112
<212>PRT
<213〉synthetic
<400>1
Asp Val Leu Met Thr Gln Thr Pro Leu Ser Leu Thr Val Ser Leu Gly Asp Gln Ala Ser
1 5 10 15 20
Ile Ser Cys Arg Ser Gly
Gln Ser Leu Val His Ser Asp Gly Asn Thr Tyr Leu His Trp
21 25 30 35 40
Phe Leu Gln Lys Pro Gly Leu Ser Pro Lys Leu Leu Ile Tyr
Thr Val Ser Asn Arg Phe
41 45 50 55 60
Ser Gly Val Pro Asp Arg Phe Ser Gly Ser Gly Ser Gly Thr Asp Phe Thr Leu Lys Ile
61 65 70 75 80
Ser Arg Val Glu Ala Glu Asp Leu Gly Ile Tyr Phe Cys
Ser Gln Cys Thr His Val Pro
81 85 90 95 100
Phe Thr Phe Gly Ala Gly Thr Lys Leu Glu Leu Lys
101 105 110
<210>1
<211>114
<212>PRT
<213〉synthetic
<400>2
Val Gln Leu Gln Glu Ser Gly Ala Glu Leu Ala Arg Pro Gly Ala Ser Val lys Leu Ser
1 5 10 15 20
Cys Lys Ala Ser
Gly Tyr Thr Phe Thr Asn Tyr Trp Leu Gln Trp Val Lys Gln Arg Pro
21 25 30 35 40
Gly Gln Gly Leu Glu Trp Ile Gly Ala
Ile Tyr Pro Gly Asn Asp Asp Ser Arg Tyr Ala
41 45 50 55 60
Gln Lys Phe Asn Val Lys Ala Thr Leu Thr Ala Asp Lys Ser Ser Ser Thr Ala Tyr Met
61 65 70 75 80
Gln Leu Ser Asn Leu Ala Ser Glu Asp Ser Ala Val Tyr Tyr Cys
Ala Thr Gly Thr Glu
81 85 90 95 100
Phe Thr Tys Trp Gly Gln Gly Thr Thr Val Thr Val Ser Ser
101 105 110
<210>3
<211>336
<212>DNA
<213〉synthetic
<400>3
gatgttctga tgacccaaac tccactctcc ctgactgtca gtcttgggga tcaagcctcc 60
atctcttgca gatctggtca gagccttgta cacagtgatg gaaacaccta tttacattgg 120
tttttgcaga agccaggcct gtctccaaag ctcctcatct acacagtttc caaccgattt 180
tctggggtcc cagacaggtt cagtggcagt ggatcaggga cagatttcac actcaagatc 240
agcagagtgg aggctgagga tctgggaatt tatttctgtt ctcaatgtac acatgttcct 300
ttcacgttcg gtgctgggac caagctggaa ctgaaa 336
<210>4
<211>342
<212>DNA
<213〉synthetic
<400>4
ggtgcaactg caggagtctg gggctgaact ggcaagacct ggggcttcag tgaagttgtc 60
ctgcaaggct tctggctaca cctttactaa ctactggttg cagtgggtaa aacagaggcc 120
tggacagggt ctggagtgga ttggggccat ttatcctgga aatgatgatt ctaggtacgc 180
tcaaaagttc aatgtcaagg ccacattgac tgcagataaa tcgtccagca cagccacatg 240
tcaactcagc aatttggcat ctgaggactc tgcggtctat tactgtgcaa ctgggacgga 300
gtttacttac tggggccaag ggaccacggt caccgtctcc tc 342
The gene order of FMMU-IL-13R α 2-7 light chain and variable region of heavy chain and amino acid sequence homology analysis
BLASTN 1
Query ID:1c1|28345
Database:All GenBank+EMBL+DDBJ+PDB sequences(but no EST,STS,GSS,environmental samples or phase 0,1 or 2 HTGS sequences)7,567,972 sequences;25,029,697,616 total letters
Length=336
gb|FJ265539.1|Mus musculus anti-hemoglobin 3C4 monoclonal antibodyimmunoglobulin light chain variable region mRNA,partial cds
Length=338
Score=527bits(285),Expect=1e-146
Identities=319/336(94%),Gaps=0/336(0%)
Strand=Plus/Plus
Query 1 GATGTTCTGATGACCCAAACTCCACTCTCCCTGACTGTCAGTCTTGGGGATCAAGCCTCC 60
|||||| |||||||||||||||||||||||||| ||||||||||||| ||||||||||||
Sbjct 1 GATGTTGTGATGACCCAAACTCCACTCTCCCTGCCTGTCAGTCTTGGAGATCAAGCCTCC 60
Query 61 ATCTCTTGCAGATCTGGTCAGAGCCTTGTACACAGTGATGGAAACACCTATTTACATTGG 120
||||||||||||||| |||||||||||||||||||| |||||||||||||||||||||||
Sbjct 61 ATCTCTTGCAGATCTAGTCAGAGCCTTGTACACAGTAATGGAAACACCTATTTACATTGG 120
Query 121 TTTTTGCAGAAGCCAGGCCTGTCTCCAAAGCTCCTCATCTACACAGTTTCCAACCGATTT 180
| ||||||||||||||| ||||||||||||||| ||||||| ||||||||||||||||
Sbjct 121 TACCTGCAGAAGCCAGGCCAGTCTCCAAAGCTCCTGATCTACAAAGTTTCCAACCGATTT 180
Query 181 TCTGGGGTCCCAGACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATC 240
||||||||||||||||||||||||||||||||||||||||||||||||||||||||||||
Sbjct 181 TCTGGGGTCCCAGACAGGTTCAGTGGCAGTGGATCAGGGACAGATTTCACACTCAAGATC 240
Query 241 AGCAGAGTGGAGGCTGAGGATCTGGGAATTTATTTCTGTTCTCAATGTACACATGTTCCT 300
||||||||||||||||||||||||||| |||||||||| |||||| ||||||||||||||
Sbjct 241 AGCAGAGTGGAGGCTGAGGATCTGGGAGTTTATTTCTGCTCTCAAAGTACACATGTTCCT 300
Query 301 TTCACGTTCGGTGCTGGGACCAAGCTGGAACTGAAA 336
||||||||||||||||||||||||||| ||||||
Sbjct 301 CCCACGTTCGGTGCTGGGACCAAGCTGGAGCTGAAA 336
BLASTN 2
RID:DP6ZPU5Z013
Database:All GenBank+EMBL+DDBJ+PDB sequences(but no EST,STS,GSS,environmental samples or phase 0,1 or 2 HTGS sequences)7,538,883 sequences;24,955,484,671 total letters
Length=342
gb|M25110.1|MUSIGHZZB Mouse Ig mu-chain B2 gene V-D-JH1 region,partial cds
Length=630
Score=444bits(240),Expect=1e-121
Identities=319/355(89%),Gaps=14/355(3%)
Strand=Plus/Plus
Query:1 GGTGCAACTGCAGGAGTCTGGGGCTGAACTGGCAAGACCTGGGGCTTCAGTGAAGTTGTC 60
||| || || ||| ||||||||||||| ||||||||||||||||||||||||||||||||
Sbjct:276GGTTCAGCTCCAGCAGTCTGGGGCTGAGCTGGCAAGACCTGGGGCTTCAGTGAAGTTGTC335
Query:61 CTGCAAGGCTTCTGGCTACACCTTTACTAACTACTGGTTGCAGTGGGTAAAACAGAGGCC 120
|||||||||||||||||||||||||||| ||||||| ||||||||||||||||||||||
Sbjct:336CTGCAAGGCTTCTGGCTACACCTTTACTAGCTACTGGATGCAGTGGGTAAAACAGAGGCC395
Query:121TGGACAGGGTCTGGAGTGGATTGGGGCCATTTATCCTGGAAATGATGATTCTAGGTACGC180
||||||||||||||| ||||||||||| |||||||||||| ||| ||| |||||||| |
Sbjct:396TGGACAGGGTCTGGAATGGATTGGGGCTATTTATCCTGGAGATGGTGATACTAGGTACAC455
Query:181TCAAAAGTTCAATGTCAAGGCCACATTGACTGCAGATAAATCGTCCAGCACAGCCTACAT240
||| |||||||| | ||||||||||||||||||||||||||| |||||||||||||||||
Sbjct:456TCAGAAGTTCAAGGGCAAGGCCACATTGACTGCAGATAAATCCTCCAGCACAGCCTACAT515
Query:241GCAACTCAGCAATTTGGCATCTGAGGACTCTGCGGTCTATTACTGTGCAAC-TGGG-ACG298
||||||||||| ||||||||||||||||||||||||||||||||||||| |||| | |
Sbjct:516GCAACTCAGCAGCTTGGCATCTGAGGACTCTGCGGTCTATTACTGTGCAAGATGGGGAAG575
Query:299GAG-T--T--TACTT--A---CTGGGGC-CAAGGGACCACGGTCACCGTCTCCTC 342
|| | | ||||| | ||||||| || |||||||||||||||||||||||
Sbjct:576TAGCTACTGGTACTTCGATGTCTGGGGCGCA-GGGACCACGGTCACCGTCTCCTC 629
BLASTP 3
Query ID 1c1|66680
Query Length 112
Description All non-redundant GenBank CDS translations+PDB+SwissProt+PIR+PRFexcluding environmental samples from WGS projects
gb|AAA85498.1|immunoglobulin light chain variable region
Length=112
Score=213bits(542),Expect=4e-54,Method:Compositional matrix adjust.
Identities=102/112(91%),Positiyes=107/112(95%),Gaps=0/112(0%)
Query 1 DVLMTQTPLSLTVSLGDQASISCRSGQSLVHSDGNTYLHWFLQKPGLSPKLLIYTVSNRF 60
DV+MTQTPLSL VSLGDQASISCRS QSLVHS+GNTYLHWFLQKPG SPKLLIY VSNRF
Sbjct 1 DVVMTQTPLSLPVSLGDQASISCRSSQSLVHSNGNTYLHWFLQKPGQSPKLLIYKVSNRF 60
Query 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGIYFCSQCTHVPFTFGAGTKLELK 112
SGVPDRFSGSGSGTDFTLKISRVEAEDLG+YFCSQ THVPFTFG+GTKLE+K
Sbjct 61 SGVPDRFSGSGSGTDFTLKISRVEAEDLGVYFCSQSTHVPFTFGSGTKLEIK 112
BLASTP 4
RID:DP6WW19901N
Length=113
Database:All non-redundant GenBank CDS
translations+PDB+SwissProt+PIR+PRF excluding environmental samplesfrom WGS projects
7,045,708 sequences;2,434,317,241 total letters
dbj|BAA19800.1| anti-idiotypic antibody heavy chain[Mus sp.]Length=119
Score=197bits(500),Expect=2e-49,Method:Compositional matrix adjust.
Identities=98/117(83%),Positives=105/117(89%),Gaps=4/117(3%)
Query:1VQLQESGAELARPGASVKLSCKASGYTFTNYWLQWVKQRPGQGLEWIGAIYPGNDDSRYA 60
VQLQ+SGAELARPGASVKLSCKASGYTFTNYW+QWVKQRPGQGL+WIGAIYPG+ ++RY
Sbjct:2VQLQQSGAELARPGASVKLSCKASGYTFTNYWMQWVKQRPGQGLDWIGAIYPGDGNTRYT 61
Query:61 QKFNVKATLTADKSSSTAYMQLSNLASEDSAVYYCATGTE----FTYWGQGTTVTVS 113
QKF KATLTADKSSSTAYMQLS+LASEDSAVYYCA G F YWGQGTTVTVS
Sbjct:62 QKFKGKATLTADKSSSTAYMQLSSLASEDSAVYYCARGEGNYAWFAYWGQGTTVTVS 118
Claims (4)
1, a kind of heavy chain of anti-people IL-13R alpha 2 monoclonal antibodies and the variable region of light chain, it is characterized in that, 3 complementary determining regions (CDR) sequence of light chain is respectively, CDR1:Gln-Ser-Leu-Val-His-Ser-Asp-Gly-Asn-Thr-Tyr, CDR2:Thr-Val-Ser, CDR3:Ser-Gln-Cys-Thr-His-Val-Pro-Phe-Thr; 3 complementary determining regions (CDR) sequence of heavy chain is respectively CDR1:Gly-Tyr-Thr-Phe-Thr-Asn-Tyr-Trp, CDR2:Ile-Tyr-Pro-Gly-Asn-Asp-Asp-Ser, CDR3:Ala-Thr-Gly-Thr-Glu-Phe-Thr-Tyr.
2, the heavy chain of anti-people IL-13R alpha 2 monoclonal antibodies as claimed in claim 1 and the variable region of light chain, it is characterized in that, described light chain variable region amino acid sequence is shown in SEQ ID NO.1, and described weight chain variable region amino acid sequence is shown in SEQ ID NO.2.
3, the heavy chain of the described anti-people IL-13R alpha 2 monoclonal antibodies of claim 1 and the variable region of light chain is characterized in that, the nucleotide sequence of variable region of light chain is shown in SEQ ID NO.3, and the weight chain variable region nucleotide sequence is shown in SEQ ID NO.4.
4, claim 1 or the heavy chain of 3 described anti-people IL-13R alpha 2 monoclonal antibodies and the variable region of light chain is characterized in that, being applied to make up with people IL-13R α 2 is the preparation of the genetic engineering antibody or the vaccine of target spot.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN2009100225663A CN101585880B (en) | 2009-05-15 | 2009-05-15 | Variable regions on heavy and light chains of antihuman IL-13R alpha 2 monoclonal antibodies |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
CN2009100225663A CN101585880B (en) | 2009-05-15 | 2009-05-15 | Variable regions on heavy and light chains of antihuman IL-13R alpha 2 monoclonal antibodies |
Publications (2)
Publication Number | Publication Date |
---|---|
CN101585880A true CN101585880A (en) | 2009-11-25 |
CN101585880B CN101585880B (en) | 2011-10-26 |
Family
ID=41370328
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CN2009100225663A Expired - Fee Related CN101585880B (en) | 2009-05-15 | 2009-05-15 | Variable regions on heavy and light chains of antihuman IL-13R alpha 2 monoclonal antibodies |
Country Status (1)
Country | Link |
---|---|
CN (1) | CN101585880B (en) |
Cited By (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN107505468A (en) * | 2017-08-19 | 2017-12-22 | 北京索莱宝科技有限公司 | A kind of detection reagent and its application for being used to detect Human interleukin-10 |
WO2022174808A1 (en) * | 2021-02-19 | 2022-08-25 | 上海齐鲁制药研究中心有限公司 | ANTIBODY AGAINST IL-13Rα2 AND USE THEREOF |
US11976122B2 (en) | 2020-07-31 | 2024-05-07 | Adc Therapeutics Sa | Anti-IL13Rα2 antibodies |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
ES2366962T3 (en) * | 2005-01-03 | 2011-10-27 | F. Hoffmann-La Roche Ag | ANTIBODIES AGAINST THE ALFA-1 RECEIVER OF IL-13 AND USES OF THE SAME. |
-
2009
- 2009-05-15 CN CN2009100225663A patent/CN101585880B/en not_active Expired - Fee Related
Cited By (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CN107505468A (en) * | 2017-08-19 | 2017-12-22 | 北京索莱宝科技有限公司 | A kind of detection reagent and its application for being used to detect Human interleukin-10 |
CN107505468B (en) * | 2017-08-19 | 2019-01-18 | 北京索莱宝科技有限公司 | It is a kind of for detecting the detection reagent and its application of Human interleukin-10 |
US11976122B2 (en) | 2020-07-31 | 2024-05-07 | Adc Therapeutics Sa | Anti-IL13Rα2 antibodies |
WO2022174808A1 (en) * | 2021-02-19 | 2022-08-25 | 上海齐鲁制药研究中心有限公司 | ANTIBODY AGAINST IL-13Rα2 AND USE THEREOF |
Also Published As
Publication number | Publication date |
---|---|
CN101585880B (en) | 2011-10-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN101440130B (en) | Variable regions of heavy chain and light chain of antihuman IL-13R alpha 2 monoclonal antibody | |
CN108779179B (en) | CD47 antibody, antigen binding fragment thereof and medical application thereof | |
CN109937212B (en) | B7-H3 antibody, antigen binding fragment thereof and medical application thereof | |
CN101851291B (en) | Heavy chain and light chain variable regions of anti-human BAFF monoclonal antibody | |
CN110914304B (en) | CD96 antibody, antigen binding fragment thereof and medical application | |
JP2022509930A (en) | Anti-CD73 antibody, its antigen-binding fragment and their use | |
CN110590952B (en) | High-affinity nano antibody for anti-CA 125 carbohydrate antigen and application thereof | |
WO2020114479A1 (en) | Multispecific protein molecule | |
KR20200012920A (en) | Anti-CD40 Antibody, Antigen Binding Fragment thereof and Medical Use thereof | |
WO2021098822A1 (en) | Bispecific antibodies | |
WO2020114478A1 (en) | Cd3 antibody and pharmaceutical use thereof | |
WO2023125888A1 (en) | Gprc5d antibody and application thereof | |
CN111808193B (en) | Nanobody capable of binding human CD38 and application thereof | |
JP2022539344A (en) | Anti-CEA antibody and its application | |
CN110922482B (en) | Polypeptide capable of binding CD19 and application thereof | |
CN109867723B (en) | Anti-human IL6 monoclonal antibody and preparation method and application thereof | |
CN101585880B (en) | Variable regions on heavy and light chains of antihuman IL-13R alpha 2 monoclonal antibodies | |
CN112538115B (en) | Anti-human BCMA nano antibody and preparation method and application thereof | |
CN112592405B (en) | Anti-human BCMA nano antibody and preparation method and application thereof | |
CN103265631B (en) | Heavy chain and light chain variable regions of anti-human CRT monoclonal antibody | |
WO2022247804A1 (en) | Anti-gprc5d antibody, preparation method therefor, and use thereof | |
CN110423273B (en) | Anti-pseudomonas aeruginosa exotoxin A nano antibody and application thereof | |
CN108148137A (en) | A kind of B7H4/1E10 monoclonal antibodies of high-affinity and its application | |
CN101899112B (en) | Light chain and heavy chain variable region of FMU-EPCAM-2D7 monoclonal antibody | |
CN101817882B (en) | Light-chain variable region and heavy-chain variable region of FMU-EPCAM-4E4 monoclonal antibody |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
C06 | Publication | ||
PB01 | Publication | ||
C10 | Entry into substantive examination | ||
SE01 | Entry into force of request for substantive examination | ||
C14 | Grant of patent or utility model | ||
GR01 | Patent grant | ||
CF01 | Termination of patent right due to non-payment of annual fee |
Granted publication date: 20111026 Termination date: 20210515 |
|
CF01 | Termination of patent right due to non-payment of annual fee |