CN101365416A

CN101365416A - Chimeric keratin-binding effector proteins

Info

Publication number: CN101365416A
Application number: CNA2006800516625A
Authority: CN
Inventors: H·巴尔格; B·利布曼; H·里恩茨; A·普托克
Original assignee: BASF SE
Current assignee: BASF SE
Priority date: 2005-11-24
Filing date: 2006-11-15
Publication date: 2009-02-11

Abstract

The invention relates to chimeric keratin-binding effector proteins and to the use thereof in dermocosmetics.

Description

The effect protein of chimeric keratin-binding

The present invention relates to the effect protein of chimeric keratin-binding and the purposes in cosmetics for skin thereof.

Vertebrate cells comprises filament (filament), and a class wherein is made of keratin.Particular proteins such as desmoplakin or close speckle albumen 1 are by being called special sequence motif (the Fontao L of keratin binding structural domain, Favre B, Riou S, Geerts D, Jaunin F, Saurat JH, GreenKJ, Sonnenberg A, Borradori L., bullous pemphigoid antigen 1 (BP230) and desmoplakin and intermediate filament's interaction is by the mediation of visibly different sequence in its c-terminus, Mol BiolCell.2003 May; 14 (5): the 1978-92. electronic form is open, on January 26th, 2003; HopkinsonSB, Jones JC., the aminoterminal domain interaction of the aminoterminal of transmembrane protein BP180 and BP230, thereby mediation is at the angle albuminous cell skeleton grappling effect on the pair cell surface at hemi desmosome position, MolBiol Cell.2000 Jan; 11 (1): 277-86; Smith E.A., Fuchs E. limits the interaction between intermediate filament and desmosome, The Journal of Cell Biology, the 141st volume, 1998) combine with same these keratin that exist in hair, skin and fingernail and toenail.

Application on human skin experiences some ageing process, and some of them are attributed to intrinsic procedure (aging due to the time), and some then are attributed to extrinsic factor (environment sexual factor, for example photoaging).In addition, the interim and permanent change on the skin appearance can occur, as acne, greasy or dry skin, keratosis, rosacea, photosensitivity, inflammatory, erythema, anaphylaxis or autoimmune response, as dermatosis and photodermatosis.

Free radical or ionic compound that extrinsic factor especially comprises sunlight or has comparable spectrographic artificial radioactive source and can produce because of radiation.These factors also comprise smoke from cigarette and the reactive compound that is present in wherein, as ozone, free radical, singlet oxygen (singlet oxygen) and the natural physiology of destruction skin or other active oxygen or the nitrogen compound of form.

For avoiding and treat above-mentioned damage, disease, and nurse ornamental processing and beautify skin, hair, fingernail and toenail, cosmetic that kind is numerous and medicinal products are produced by cosmetics industry and pharmaceuticals industry.Protein is known for a long time as the purposes of component in these goods.Because their special characteristics, protein and enzyme not only have the extensive use field in the generation of this based composition, and because of enzymatic activity or give the characteristic of structure, they produce positive physiology and change in skin and hair.

Yet protein can not form stable keys with the surface texture of animal organism usually, has promptly only determined for for example combination of skin, hair of some protein.Therefore, although use protein, yet can not guarantee that this protein arrives at its site of action and stops physiology or the needed long enough of decoration function time to wanting there with some physiology or decorating feature.

German patent application with application number DE 102005011988.3 has been described the purposes of keratin binding structural domain in cosmetic product.International patent application with application number PCT/EP/05/005599 disclose the keratin binding structural domain also can with the effector molecule coupling.

Therefore target of the present invention provides the novel protein that can be used for to the skin cosmetic skin, hair, fingernail and toenail application.Advantageously, evaluation is had the keratin binding characteristic, show skin cosmetic effect and be applicable to protein or the polypeptide that produces cosmetic and/or skin cosmetic preparation or goods.

Summary of the invention

The present invention at first provides the polypeptide (i) that comprises (a) at least a keratin-binding and (b) effect protein of at least a further effect polypeptide chimeric keratin-binding (ii).

In particularly preferred embodiments, these are the polypeptide (i) that have the keratin-binding of application on human skin keratin, hair-keratin or the keratic binding affinity of first.Preferably, the polypeptide of keratin-binding used according to the invention (i) comprises

(a) at least one is according to SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215 sequence, or

B) with at least one according to SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, same and the polypeptide that can keratin-binding of 213 or 215 sequence at least 40%.

The polypeptide of keratin-binding (i) preferably can be by such nucleic acid molecule encoding, and described nucleic acid molecules comprises and is selected from least one following nucleic acid molecules:

C) nucleic acid molecules, coding comprises SEQ ID NO:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, polypeptide of sequence shown in 213 or 215;

D) nucleic acid molecules comprises SEQ ID NO:1,3,5,7,9,11,13,15,17,19,21,23,25,27,29,31,33,35,37,39,41,43,45,47,49,51,53,55,57,59,61,63,65,67,69,71,73,75,77,79,81,83,85,87,89,91,93,95,97,99,101,103,105,107,109,111,113,115,117,119,121,123,125,127,129,131,133,135,137,139,145,149,152,159,161,163,165, at least one polynucleotide of sequence shown in 212 or 214;

E) nucleic acid molecules, coding is according to sequence SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215 polypeptide;

F) have with at least one according to SEQ ID No:1,3,5,7,9,11,13,15,17,19,21,23,25,27,29,31,33,35,37,39,41,43,45,47,49,51,53,55,57,59,61,63,65,67,69,71,73,75,77,79,81,83,85,87,89,91,93,95,97,99,101,103,105,107,109,111,113,115,117,119,121,123,125,127,129,131,133,135,137,139,145,149,152,159,161,163,165, the nucleic acid molecules of 212 or 214 the corresponding nucleotide sequence of sequence, or because of replacing, disappearance or insert and from its deutero-nucleic acid encoding molecule, wherein said polypeptide and at least one are according to SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215 sequence at least 40% is same and can be bonded to keratin;

G) the coding sign indicating number is by the nucleic acid molecules of the polypeptide of monoclonal antibody identification, and wherein said monoclonal antibody is at the nucleic acid molecules encoded polypeptide according to (c) to (e);

H) the proteinic nucleic acid molecules of coding keratin-binding, its under stringent condition with according to the making nucleic acid molecular hybridization of (c) to (e);

I) the proteinic nucleic acid molecules of coding keratin-binding, described nucleic acid molecules can by use according to the nucleic acid molecules of (c) to (e) or its part fragment that comprises at least 15 nucleotide, preferred 20 nucleotide, 30 nucleotide, 50 nucleotide, 100 nucleotide, 200 nucleotide or 500 nucleotide as probe under stringent hybridization condition, separate from dna library and

J) nucleic acid molecules, it can pass through reverse translation sequence SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,166, one of aminoacid sequence shown in 213 or 215 and producing.

The present invention preferably provides the effect protein of keratin-binding, wherein the effect polypeptide be selected from (ii) that enzyme, antibody, effector are conjugated protein, fluorescin, antimicrobial peptide and assembly protein automatically.

The present invention particularly preferably provides in conjunction with keratic effect protein, and it comprises and is selected from oxidase, peroxidase, protease, tryrosinase, lactoperoxidase, lysozyme, amyloglucosidase, glucoseoxidase, superoxide dismutase, photolyase and catalatic enzyme action effect polypeptide (ii).

In addition, the effect protein that preferably comprises fibroin action effect polypeptide keratin-binding (ii), wherein said fibroin particularly preferably is such fibroin, its comprise at least one according to SEQ IDNo:151,201,202,203,204,205,206,207,208,209 or 210 sequence or corresponding to at least one polypeptide same according to SEQ ID No:151,201,202,203,204,205,206,207,208,209 or 210 sequence at least 40%.

In addition, the present invention relates to comprise the effect protein by those keratin-bindings of the fibroin of nucleic acid molecule encoding like this, wherein said nucleic acid molecules comprises and is selected from least one following nucleic acid molecules:

K) nucleic acid molecules, coding comprises polypeptide of sequence shown in the SEQ ID NO:151,201,202,203,204,205,206,207,208,209 or 210;

L) nucleic acid molecules comprises the polynucleotide of sequence shown at least one SEQ ID NO:150;

M) nucleic acid molecules, coding is according to sequence SEQ ID No:151,201,202,203,204,205,206,207,208,209 or 210 polypeptide;

N) have nucleic acid molecules according to the nucleotide sequence of SEQ ID No:150, or because of replace, disappearance or insert from its deutero-nucleic acid encoding molecule, wherein said polypeptide is with same according to the sequence at least 40% of SEQ ID No:151;

O) coding is by the nucleic acid molecules of the polypeptide of monoclonal antibody identification, and wherein said monoclonal antibody is at the nucleic acid molecules encoded polypeptide according to (k) to (m);

P) the proteinic nucleic acid molecules of coding keratin-binding, its under stringent condition with according to the making nucleic acid molecular hybridization of (k) to (m);

Q) the proteinic nucleic acid molecules of coding keratin-binding, described nucleic acid molecules can separate under stringent hybridization condition from dna library as probe by using according to the nucleic acid molecules of (k) to (m) or the part fragment that it comprises at least 15 nucleotide; With

R) nucleic acid molecules, it can produce by one of aminoacid sequence shown in the reverse translation sequence SEQ ID No:151,201,202,203,204,205,206,207,208,209 or 210.

In a preferred embodiment of the invention, the effect protein of chimeric keratin-binding of the present invention is wherein above-mentioned polypeptide (i) and (ii) merges the protein that couples together by translation.

The present invention also preferably provides wherein above-mentioned polypeptide (i) and (ii) reacts the effect protein of the keratin-binding that couples together by chemical coupling.Preferred in this article wherein effect polypeptide (ii) covalently is bonded to the effect protein of side chain, c-terminus or N-terminal those keratin-bindings of internal amino acid of the polypeptide (i) of keratin-binding.

In addition, the invention provides the effect protein of the above-mentioned keratin-binding that effect polypeptide wherein (ii) couples together by spacer element with the polypeptide (i) of keratin-binding.The effect protein of these keratin-bindings preferably is the effect protein of the keratin-binding that couples together of the spacer element of cross-linking agent by spacer element wherein.

The effect protein that also preferably comprises the keratin-binding of spacer element, wherein spacer element is the joint of difunctionality at least, described joint by being bonded to keratin-binding polypeptide (i) and side chain, c-terminus or the aminoterminal of the internal amino acid of effect polypeptide and with described polypeptid covalence couple together.Except the effect protein of the keratin-binding described, also preferably wherein connect (i) and (ii) the spacer element of polypeptide be polypeptide.

The present invention also provides the purposes of effect protein in cosmetics for skin of above-mentioned keratin-binding, and wherein said cosmetics for skin is the product of skin protection composition, skin care compositions and methods, skin cleansing compositions, hair protection compositions, hair care composition, hair Cleasing compositions, hair dye or decorative cosmetic product having preferably.

The present invention also provides the above-mentioned cosmetics for skin of one of effector molecule of comprising above-mentioned keratin-binding.

In addition, the invention provides protein according to aminoacid sequence shown in the SEQ ID No:168,176,182,188,194 and 200.

The present invention provides the nucleic acid molecules according to sequence shown among the SEQ ID No:167,175,181,187,193 or 199 equally.

In addition, the invention provides the DNA expression cassette that comprises nucleic acid molecules, it comprises the nucleic acid molecules that has according to nucleotide sequence shown in the SEQID No:167,175,181,187,193 or 199.

The present invention provides the carrier that comprises the DNA expression cassette equally, and wherein said DNA expression cassette comprises the nucleic acid molecules that has according to nucleotide sequence shown in the SEQ ID No:167,175,181,187,193 or 199.

In addition, the invention provides transgenic cell, comprise

S) at least a above-mentioned carrier, or

T) at least a above-mentioned expression cassette, or

U) at least a above-mentioned nucleic acid encoding molecule, wherein said polypeptide comprise by at least a polypeptide according to the nucleic acid molecule encoding of sequence shown in the SEQ ID No:167,175,181,187,193 or 199.

Definition

Be purpose of the present invention, " antibody " is the people and has the jaw vertebrates to produce the protein that plays a protective role with at antigen (pathogen infection or do not belong to the biomaterial of health).Antibody is the immune core component of higher eucaryote and is B emiocytosis by a class leukocyte.They are present in the extracellular fluid of blood and tissue.

Be purpose of the present invention, " reverse translation " means protein sequence translated into this nucleic acid sequences to proteins of coding.Therefore reverse translation is the process that aminoacid sequence is decoded into corresponding with it nucleotide sequence.Common method is used for certain biological codon usage frequency table based on generation, and wherein said codon usage frequency table produces by the comparison of area of computer aided sequence.Utilize this codon usage frequency table, might determine the most frequent certain amino acid whose codon that is used for for concrete biology.The protein reverse translation can be used those skilled in the art known and computerized algorithm (Andr é s Moreira and Alejandro Maass.TIP: by the protein reverse translation .Bioinformatics of genetic algorithm that produce for this purpose and specially, the 20th volume, the 13rd phase, 2148-2149 page or leaf (2004); G Pesole, M Attimonelli and S Liuni. are based on the reverse translation method .Nucleic Acids Res.1988 March 11 of codon usage policy; 16 (5Pt A): 1715-1728.) carry out.

Be purpose of the present invention, " effect protein of chimeric keratin-binding " means polypeptide, protein or protein domain (i) and effect polypeptide, effect protein or the effect protein domain protein (ii) that comprises keratin-binding, and wherein said polypeptide, protein or protein domain artificially link together.The artificial connection means the connection of using biotechnology or chemical technology method and producing thereby can't realize in living world (for example wherein said polypeptide, protein or the naturally occurring biology of protein domain).For producing the effect protein of chimeric keratin-binding, under the situation of biological technique method, preferably translation is merged, and under the situation of chemical technology method, preferably in the following method that is adopted of term " chemical coupling reaction ".

" translation is merged " is interpreted as to mean and produces such chimeric nucleic acid molecule, to such an extent as to wherein the connection of at least two kinds of nucleic acid molecules of coded polypeptide, protein or protein domain realizes can forming successive polypeptide chain because of the translation incident of this chimeric nucleic acid molecule in such a manner.

" decorative cosmetic product having " means and mainly is not used for nursing and is used to beautify or improves the cosmetic supplement of skin, hair and/or fingernail and toenail outward appearance.Such supplement is suitably for well known by persons skilled in the art and for example comprise eyelet writing brush, mascara, eye shadow, toning day cream (tinted daycream), end powder, hide flaw pen, rouge, lip pomade, lip liner, cosmetics (make-up), nail polish, bright gel (glamour gel) etc.Also comprise and being suitable for skin or chromotrichial compositions.

" cosmetics for skin " is also referred to as " dosing cosmetics (cosmeceutical) " or " cutization composition for cosmetics " or " skin cosmetic product ", be that (i) is used for protection to skin, the damage of hair and/or fingernail and toenail, (ii) be used for the treatment of skin, the existing damage of hair and/or fingernail or toenail and (iii) be used for nursing skin, the compositions of hair and/or fingernail or toenail or goods comprise the skin cosmetic, the first cosmetic, the hair cosmetic, dermatological is used, health or Pharmaceutical composition, goods and preparation and be used to improve dermal sensation (organoleptic attribute).Comprise the compositions that is used for decorative cosmetic product having clearly.Consider cosmetic, also comprise the compositions that is used for skin nursing, realized the desired use of medicinal dermatological by this compositions.Compositions of the type or goods are used to assist, prevent and treat skin disorder, and except cosmetic effect, also produce biological action.For the purpose of given definition above, " cosmetics for skin " is included in that those skilled in the art in the cosmetic compatible media know and can be at cosmetics handbook Schrader for example, the key element and the preparation of Grundlagen and Rezepturen der Kosmetika[cosmetics], H ü thig Verlag, Heidelberg, 1989, ISBN 3-7785-1491-1, or Umbach, Kosmetik:Entwicklung, Herstellung und Anwendungkosmetischer Mittel[cosmetics: the exploitation of cosmetic compositions, make and use], the augmentation second edition, 1995, Georg Thieme Verlag, proper auxiliary agent of finding among the ISBN 3 13 712,602 9 and additive.

Be purpose of the present invention, " skin cosmetic effective ingredient " or " skin cosmetic effective ingredient " is the effective ingredient that the participation that exists in the cosmetics for skin according to given definition above realizes the various mechanism of action of cosmetics for skin.Therefore they be that (i) causes protecting skin, hair and/or fingernail or toenail to avoid damaging, (ii) can be used for the treatment of the existing damage of skin, hair and/or fingernail and toenail, (iii) have skin, a hair and/or fingernail or toenail nursing characteristic and (iv) be used for the ornamental effective ingredient that beautifies or improve skin, hair and/or fingernail and toenail outward appearance.Consider cosmetic, also comprise the skin care compositions and methods of realizing the desired use of medicinal dermatological by it.The effective ingredient of the type is used to assist, prevents and treats skin disorder, and except cosmetic effect, also produces biological action.The effective ingredient of the type for example is selected from natural or synthetic polymer, pigment, wetting agent, oil, wax, protein, enzyme, mineral, vitamin, sunscreen, dyestuff, spice, antioxidant, peroxide decomposer and antiseptic and such effective medicinal components, the biological action that it is used to assist, avoid and treat dermatosis and has healing, pre-antisitic defect, regeneration or improve the skin overall state.

Be purpose of the present invention, " expression cassette " means such nucleic acid molecules, and it comprises with functional mode and the nucleic acid molecules of guaranteeing to be connected at cell or biology, at least a genetic control element (for example promoter) of preferably expressing in prokaryotic cell, yeast or eukaryotic cell culture.

" functional connection " means promoter for example and waits to express the nucleic acid molecules of (effect protein of the keratin-binding of for example encoding) and other regulating element such as terminator as required is arranged in order in such a manner, to such an extent as to every kind of regulating element can be given full play to its function during the transgene expression of this nucleic acid molecules.For this reason, direct connection that in fact need be on chemical sense.Genetic control sequence such as enhancer sequence can be also from farther position or even from other dna molecular, target sequence is brought into play its effect.Preferred such arrangement treats that wherein the nucleic acid molecules of transgene expression has been positioned at after the sequence of promoter effect, and therefore two kinds of sequences covalently combine.Preferably, promoter sequence and treat between the nucleic acid molecules of transgene expression distance in this article less than 200 base pairs, particularly preferably less than 100 base pairs, very particularly preferably less than 50 base pairs.

Produce functional connection and produce expression cassette in addition and can use for example at Maniatis T, Fritsch EF and Sambrook J (1989) Molecular Cloning:A LaboratoryManual, Cold Spring Harbor Laboratory, Cold Spring Harbor (NY), at Silhavy TJ, Berman ML and Enquist LW (1984) Experiments with GeneFusions, Cold Spring Harbor Laboratory, Cold Spring Harbor (NY), at (1987) Current Protocols in Molecular Biology such as Ausubel FM, GreenePublishing Assoc.And Wiley Interscience and in (1990) such as Gelvin in habitual reorganization of describing among the PlantMolecular Biology Manual and clone technology and realize.Yet, also might between these two kinds of sequences, exist other sequence, wherein said other sequence to have and for example contain the joint in some Restriction Enzyme cutting site or the function of signal peptide.The insertion of sequence also can cause expressed fusion protein.Preferably, can in carrier, exist and for example by transform inserting Plant Genome in the integration mode by promoter and the expression cassette that connects and composes for the treatment of the express nucleic acid sequence.

Term " cell " refers to individual cells.The colony of term " cell mass (cells) " phalangeal cell.This colony exists with synchronization or asynchronization mode." cell " or " cell mass " comprises unicellular organism and as the cell of component in many cells complex or the biology.

" transgenic " means with regard to nucleic acid molecules when getting in touch with cell or biology, encoded polypeptides, the expression cassette that comprises described nucleic acid molecules or carrier or with described nucleic acid molecules, expression cassette or carrier cell transformed or biology from this nucleic acid molecules, by whole such cell or the biology that gene engineering method realized, the nucleic acid molecules of the following object of wherein encoding:

A) polypeptide of keratin-binding (i), or

B) effect protein, or

C) (a) and (b)

All be not arranged in its natural genotypic environment or all modified by gene engineering method, modify in the case can for example be one or more nucleotide groups displacement, interpolation, lack and put or insert.Natural genotypic environment means natural dyeing position point or be present in the genomic library in the origin biology.Under the situation of genomic library, the natural genotypic environment of nucleotide sequence preferably keeps at least in part.This environment flank is distributed at least one side of nucleotide sequence and has 50bp, preferred 500bp at least, preferred especially 1000bp at least, the most preferred sequence length of 5000bp at least at least.The natural existence combination of the polypeptide promoter of the keratin-binding of natural existence expression cassette-for example and the corresponding gene of the polypeptide of coding keratin-binding-the latter by non-natural, synthesize (manually) method and become transgene expression cassette when for example mutagenesis is modified.Suitable method describe (US 5,565,350; WO00/15815) describe in.

Be purpose of the present invention, " effect polypeptide " means certain the predictable effect that has skin, hair and/or fingernail or toenail, the protein skin cosmetic effective ingredient of preferred biology or physiology's property, protection, prevention and/or the effect of nursing property.Effector molecule is protein chemical compound such as polypeptide, protein or enzyme preferably.Preferred especially assembly protein automatically and fibroin very particularly preferably.

" keratin " means the intermediate filament (intermediatefilaments) who constitutes from the strand protein complex.The intermediate filament is parallel to each other from the position with protein (monomer) formation of the numerous same types that produce the pipe spline structure.The intermediate filament combines to produce big relatively bundle (tonofibril).The intermediate filament forms the cytoskeleton of cell with microtubule and actin filament.Between five kinds of intermediate filaments, make differentiation: acid keratin and alkaline keratin, desmosome albumen, neurofilament and lamin.Particularly preferably be acid keratin and the alkaline keratin that is present in the epithelium (covering the monolayer or the cell rich zone of whole outer body surfaces of multicellular animals biology) for purpose of the present invention." keratin " or " keratin class " (claiming again: keratose, scleroprotein), mean the protein of being responsible for cell stability and shape.This protein is the component of mammal skin, hair and first.Keratic intensity increases because of fiber forms: each amino acid chain forms right hand α spiral, and per three the spiralization left hand superhelixs (=protofibril) in these spirals.Article 11, protofibril merges so that the generation microfibril-these make up and produce bundle subsequently and form the macrofibril that for example surrounds hair cell.

" polypeptide of keratin-binding " means polypeptide or the protein with the keratin binding characteristic in the meaning scope of above given definition.Therefore the polypeptide of keratin-binding also is intermediate filament's Rapsyn.The polypeptide of these keratin-bindings has the macrostructure that constitutes at keratin or by keratin such as the binding affinity of protofibril, microfibril or macrofibril.In addition, the polypeptide of keratin-binding is interpreted as means the those polypeptides that has the binding affinity of mammal skin, hair and/or fingernail or toenail.

" polypeptide of keratin-binding " still has in mammalian biological and keratin, cutin fiber, skin or the hair polypeptide in conjunction with relevant biological function.The polypeptide of keratin-binding means equally to actual needed binding motif of keratin, cutin fiber, skin or hair or the protein domain of being bonded to.The polypeptide of keratin-binding (ii) can be tested under the condition described in embodiment 8,9 and 10 keratic combination.The polypeptide of keratin-binding is such polypeptide, its above-mentioned quantitative property keratin have in conjunction with test desmoplakin (SEQ ID No:2), preferred desmoplakin keratin binding structural domain B (SEQ ID No:4) about 10%, 20%, 30%, 40% or 50%, preferred 50%, 60%, 70%, 80% or 90%, preferred especially 100%, 125%, 150%, very particularly preferably 200%, 300% or 400%, most preferably 500%, 600%, 700% or 1000% or higher keratin binding ability.

" cosmetic compatible media " will be understood in a broad sense and mean and be suitable for material that produces cosmetic or skin cosmetic product and composition thereof.They are the protein media compatibility preferably.

When contacting with people and/or animal skin tissue or hair, " cosmetic compatible substances " do not cause stimulation or damage and with other material compatibility.In addition, these materials have slight anaphylactogen potentiality and are used for cosmetic product by the approval of the national registration organs of state power.These materials be that those skilled in the art are familiar with and can be for example at cosmetics handbook Schrader for example, the key element and the preparation of Grundlagen and Rezepturen der Kosmetika[cosmetics], H ü thig Verlag, Heidelberg, 1989, find among the ISBN 3-7785-1491-1.

" nucleic acid " or " nucleic acid molecules " means and is in strand or double chain form, is in deoxyribonucleotide, ribonucleotide or polymer or its crossbred that justice or antisense orientation are arranged.Term nucleic acid or nucleic acid molecules can make describes gene, DNA, cDNA, mRNA, oligonucleotide or polynucleotide.

" nucleotide sequence " mean according to the nucleic acid molecules of given definition above continuously and the deoxyribonucleotide or the ribonucleotide acid sequence that link together, it can use obtainable DNA/RNA sequencing technologies to be determined and describe or demonstration with abbreviation, letter or the word of a string representative nucleotide.

Be purpose of the present invention, " polypeptide " means the macromole that is made of amino acid molecular, and aminoacid couples together linearly by peptide bond in described macromole.Polypeptide can be made up of some (about 10 to 100) aminoacid, but also comprises the protein that is made of at least 100 aminoacid usually, but can also comprise several thousand aminoacid.Preferably, polypeptide comprises at least 20,30,40 or 50, especially preferably at least 60,70,80 or 90, very particularly preferably at least 100,125,150,175 or 200, most preferably surpasses 200 aminoacid at least, and the upper limit might be several thousand aminoacid.

" homology " or " homogeneity " between two nucleotide sequences is interpreted as and means the homogeneity of nucleotide sequence in discussion full sequence length range, this is by programmed algorithm (winconsin software kit the 10.0th edition, winconsin university, Genetics Computer Group (GCG), Madison, USA; Altschul etc. (1997) Nucleic Acids Res.25:3389ff) with following parameter setting by relatively calculating:

Breach weight: 50 length weights: 3

Average coupling: 10 average mispairing: 0

Mode by way of example has with the sequence of 80% homology of sequence SEQ ID NO:1 based on nucleic acid to be interpreted as to mean the having sequence of at least 80% homology when comparing with sequence SEQ IDNO:1 with above parameter setting according to above programmed algorithm at least.

" homology " or " homogeneity " between two polypeptide be interpreted as mean aminoacid sequence in discussion full sequence length range homogeneity, this is by programmed algorithm (winconsin software kit the 10.0th edition, winconsin university, Genetics Computer Group (GCG), Madison, USA; Altschul etc. (1997) Nucleic Acids Res.25:3389ff) with following parameter setting by relatively calculating:

Breach weight: 8 length weights: 2

Average coupling: 2.912 average mispairing :-2.003

Mode by way of example has with the sequence of 80% homology of sequence SEQ ID NO:2 based on polypeptide to be interpreted as to mean the having sequence of at least 80% homology when comparing with sequence SEQ IDNO:2 with above parameter setting according to above programmed algorithm at least.

" hybridization conditions " will be understood in a broad sense and depend on application, mean strictness or low strict hybridization conditions.This type of hybridization conditions is especially at Sambrook J, Fritsch EF, Maniatis T etc., at Molecular Cloning (A Laboratory Manual), second edition, Cold Spring HarborLaboratory Press, 1989, the 9.31-9.57 page or leaf) or at Current Protocols inMolecular Biology, John Wiley ﹠amp; Sons, N.Y. (1989) describes among the 6.3.1-6.3.6. and those skilled in the art will select to allow to distinguish the hybridization conditions of specific hybrid and non-specific hybridization.For example, condition during washing step can be selected from condition with low strict (with about 2 * SSC at 50 ℃) and have high strict (with about 0.2 * SSC 50 ℃, preferably at 65 ℃) (20 * SSC:0.3M sodium citrate, 3M NaCl, pH 7.0) condition.In addition, the temperature during washing step can increase at about 65 ℃ higher stringent condition for about 22 ℃ in room temperature from low stringency condition.Two kinds of parameters are that salinity and temperature all can change or under any circumstance keep another parameter constant down simultaneously, change independently.During hybridizing, also might use denaturant such as Methanamide or SDS.In the presence of 50% Methanamide, hybridization is preferably carried out at 42 ℃.Some are used to hybridize following the providing of schematic condition with washing step:

1. hybridization conditions can be selected from for example following condition:

A) 4 * SSC, at 65 ℃,

B) 6 * SSC, at 45 ℃,

C) 6 * SSC, the fragmentation milt DNA of 100 μ g/ml degeneration, at 68 ℃,

D) 6 * SSC, 0.5%SDS, the salmon sperm DNA of 100 μ g/ml degeneration, at 68 ℃,

E) 6 * SSC, 0.5%SDS, the salmon sperm DNA of 100 μ g/ml degeneration fragmentations, 50% Methanamide, at 42 ℃,

F) 50% Methanamide, 4 * SSC, at 42 ℃, or

G) 50% (volume/volume) Methanamide, 0.1% bovine serum albumin, 0.1% phenanthrene can, 0.1% polyvinylpyrrolidone, 50mM sodium phosphate buffer pH 6.5,750mMNaCI, the 75mM sodium citrate, at 42 ℃, or

H) 2 * or 4 * SSC at 50 ℃ (low stringency conditions),

I) 30-40% Methanamide, 2 * or 4 * SSC at 42 ℃ (low stringency conditions).

500mN sodium phosphate buffer pH 7.2,7%SDS (g/V), 1mM EDTA, 10 μ g/ml single stranded DNAs, 0.5%BSA (g/V) (Church and Gilbert, GenomicSEquenceing.Proc.Natl.Acad.Sci.U.S.A.81:1991.1984)

2. washing step can be selected from for example following condition:

A) 0.015M NaCl/0.0015 M sodium citrate/0.1%SDS is at 50 ℃.

B) 0.1 * SSC is at 65 ℃.

C) 0.1 * SSC, 0.5%SDS is at 68 ℃.

D) 0.1 * SSC, 0.5%SDS, 50% Methanamide is at 42 ℃.

E) 0.2 * SSC, 0.1%SDS is at 42 ℃.

F) 2 * SSC is at 65 ℃ (low stringency conditions).

In one embodiment, the following selection of stringent hybridization condition:

Selection comprises the hybridization buffer of Methanamide, NaCl and PEG 6000.The existence of Methanamide in hybridization buffer makes double chain acid molecule go to stablize, so hybridization temperature can be reduced to 42 ℃ and do not reduce strictness.The purposes of salt in hybridization buffer is the reassociation rate that increases duplex, or increases hybridization efficiency.Though PEG increases the viscosity of solution, reassociation rate is produced detrimental effect, thereby when having this polymer in solution, the concentration of probe in all the other media should raise, this increases hybridization speed.Described buffer composed as follows:

Hybridization buffer
Hybridization buffer	250mM sodium phosphate buffer pH 7.21mM EDTA 7%SDS (g/v) 250mM NaCl
10 μ g/ml ssDNA 5% Polyethylene Glycol (PEG), 600040% Methanamide

Table 1: hybridization buffer

Hybridization is spent the night at 42 ℃ and is carried out.Filter membrane washed 3 times with 2 * SSC+0.1%SDS in morning next day, each about 10 minutes.

When relating to description and " carrying the effector molecule of hydroxy functional group ", " hydroxy functional group " means free OH maybe can make these molecules of carrying the OH base and other molecule through esterification and covalently bound hydroxyl.Be purpose of the present invention, " hydroxy functional group " still can chemically be changed into those functional groups of OH functional group, as derivant such as methoxyl group, ethyoxyl.Therefore, effector molecule of the present invention has at least one hydroxyl.Yet, also might use effector molecule with 2,3 or more a plurality of hydroxy functional groups.

When relating to description and " carrying the effector molecule of amido functional group ", " amido functional group " means and allows to carry the molecule of amido functional group through amido link and the covalently bound amino of other molecule.Be purpose of the present invention, " amido functional group " still can chemically change into those functional groups of amido functional group.Therefore, effector molecule of the present invention has at least one amido functional group.Yet, also might use effector molecule with 2,3 or more a plurality of amido functional group and/or secondary amino group.

Relate to that linkers combines with effector molecule or during with the protein bound of keratin-binding " coupling " mean the covalently bound of described molecule.

" coupling degree of functionality " is the functional group that can form covalent bond in the linkers with the proteinic functional group of effector molecule or keratin-binding.The limiting examples that can mention is: hydroxyl, carboxyl, sulfydryl and amino." coupling degree of functionality " and " anchoring group " use convertibly.

Automatic assembly protein

Automatically assembly protein be can be under appropraite condition spontaneous protein or the peptide that is gathered into high molecular, high stage structure (especially ball, film, filament).They can be synthetic property, biosimulation or natural origin protein and peptide.Limiting examples is structural protein, abundant albumen and the amphipathic and helicity peptide of βZhe Die.

Be purpose of the present invention, " spacer element " means physically molecule or the macromole that the polypeptide (i) of keratin-binding and effect polypeptide are (ii) separated.

Spacer element comprise the linkers of the following stated and protein element as, oligopeptide, polypeptide or protein domain.

Carrier is the dna molecular that can stably set up and duplicate in host cell.Carrier for example is plasmid, cosmid.In addition, carrier also can be understood as and means such dna molecular, and they can transport from a kind of DNA element of cell to another kind of cell, and wherein cell need not to belong to a kind of biology (for example phage, virus and Agrobacterium (agrobacteria)).In advantageous embodiment, insert the expression cassette that comprises genes of interest and realize by plasmid vector.Those carriers of preferably can the chromosome other places in cell or biology, setting up.Expression cassette/carrier stable integration is possible to host genome equally.

Term " expression vector " refers to comprise with the functional purpose of connecting dna molecular of regulating element and can therefore guarantee the carrier that the target DNA molecule is expressed in the target biology.

Detailed Description Of The Invention

The invention provides the polypeptide (i) that comprises (a) at least a keratin-binding and (b) effect protein of at least a further effect polypeptide chimeric keratin-binding (ii).

In particularly preferred embodiments, they are to have the application on human skin keratin, the polypeptide (i) of the keratin-binding of hair-keratin or the keratic binding affinity of first.

The polypeptide (i) of preferred especially such keratin-binding, its

A) comprise at least one according to SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215 sequence, or

B) corresponding to at least one according to SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215 sequence at least 40%, 45% or 50%, preferably at least 55%, 60%, 65% or 70%, especially preferably at least 75%, 80%, 85%, 90%, 91%, 92%, 93% or 94%, at least 95% or 96% same and polypeptide that can keratin-binding very particularly preferably.

In a preferred embodiment of the invention, the polypeptide of the keratin-binding of use (i) is by such nucleic acid molecule encoding, and described nucleic acid molecules comprises and is selected from least one following nucleic acid molecules:

C) nucleic acid molecules, coding comprises SEQ ID NO:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, polypeptide of sequence shown in 213 or 215;

F) have with at least one according to SEQ ID No:1,3,5,7,9,11,13,15,17,19,21,23,25,27,29,31,33,35,37,39,41,43,45,47,49,51,53,55,57,59,61,63,65,67,69,71,73,75,77,79,81,83,85,87,89,91,93,95,97,99,101,103,105,107,109,111,113,115,117,119,121,123,125,127,129,131,133,135,137,139,145,149,152,159,161,163,165, the nucleic acid molecules of 212 or 214 the corresponding nucleotide sequence of sequence, or because of replacing, disappearance or insert and from its deutero-nucleic acid encoding molecule wherein said polypeptide at least 40%, 45% or 50%, preferably at least 55%, 60%, 65% or 70%, especially preferably at least 75%, 80%, 85%, 90%, 91%, 92%, 93% or 94%, very particularly preferably at least 95% or 96% and at least one is according to SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215 sequence is same and can be bonded to keratin;

G) coding is by the nucleic acid molecules of the polypeptide of monoclonal antibody identification, and wherein said monoclonal antibody is at the nucleic acid molecules encoded polypeptide according to (c) to (e);

J) nucleic acid molecules, it can pass through reverse translation sequence SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, one of aminoacid sequence shown in 213 or 215 and producing.

According to the present invention the polypeptide structure territory of suitable keratin-binding desmoplakin, close speckle albumen, plakoglobin, plectin, speckle peripheral proteins, outside exist in by speckle albumen, trichohyalin, epidermis speckle albumen or the proteinic peptide sequence of hair follicle.

In a preferred embodiment of the invention, will be according to sequence SEQ ID No:No.:2,42,44,46,48,146,150,153,156,157,158,160,162,164 or 166 desmoplakin or its partial sequence, and/or according to sequence SEQ ID No:18,20,26,28,32,34,36,213,215 close speckle albumen or its partial sequence and/or according to sequence SEQ ID No:50,52,54,56,58,60,62,64,66,68,70 plakoglobin or its partial sequence and/or according to the speckle peripheral proteins of sequence SEQ ID No:86 and/or according to sequence SEQ ID No:90,92,94,96,98,102,104,105 outer by speckle albumen or its partial sequence and/or according to the sequence of SEQ IDNo:138 and 140 polypeptide as keratin-binding.Preferred keratin binding structural domain is desmoplakin polypeptide and the functional equivalents thereof shown in the sequence SEQ ID NOs:4,6,8,10,12,14,146,150,153,156,157,158,160,162,164,166,213 or 215.In the present invention's embodiment very particularly preferably, use in the methods of the invention in the polypeptide of the keratin-binding shown in sequence 156,157,158,160,162,164,166,213 and/or 215.In highly preferred embodiment of the present invention, use the protein of the keratin-binding that in sequence SEQ ID No:213, shows.Self-explantory in this article this protein that uses when being the histidine anchor that can in having or do not have SEQ ID No:213, exist.Therefore, histidine anchor (or the purification/detection system that will use similarly) also can exist at c-terminus.In proteinic actual use of described keratin-binding (for example in cosmetic product), histidine anchor (or the purification/detection system that will use similarly) is optional.Therefore use that not have the described protein of extra aminoacid sequence be preferred.

Same is " functional equivalents " and their purposes in the methods of the invention of the polypeptide (i) of concrete disclosed keratin-binding according to what the present invention includes.

Within the scope of the present invention, " functional equivalents " of the polypeptide of those concrete disclosed keratin-bindings (i) or analog be also have required biologic activity as the keratin combination with as described in the different polypeptide of polypeptide (i) of keratin-binding.Therefore, for example, " functional equivalents " of the polypeptide of keratin-binding is interpreted as and means these polypeptide that the quantitative property keratin that they are described in an embodiment is in conjunction with having about 10% in the test under comparable condition (unless otherwise indicated), 20%, 30%, 40% or 50%, preferably 60%, 70%, 80% or 90%, particularly preferably 100%, 125%, 150%, very particularly preferably 200%, 300% or 400%, most preferably 500%, 600%, 700% or 1000% or more at SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, the keratin binding ability of polypeptide shown in 213 or 215 times.

According to the present invention, " functional equivalents " especially is interpreted as and also means mutein, it has the aminoacid different with the aminoacid that specifically provides at least one sequence location of above mentioned aminoacid sequence, but but has one of above-mentioned biologic activity." functional equivalents " therefore comprises that by the obtainable mutein that suddenlys change wherein said change can produce in any sequence location, as long as these changes have produced the mutein that has according to characteristic spectra of the present invention.

Be purpose of the present invention, " sudden change " mean in plasmid or the biological gene group in the nucleotide sequence of genetic mutation in change.Sudden change can be for example because of the mistake between replicative phase produces, or is caused by mutagenic agent.Spontaneous mutation rate is extremely low in the cellular genome of biology, although numerous biological, chemical or the physical property mutagenic agenies of kind is that this area is acquainted known to the skilled.

Sudden change comprises replacement, insertion, the disappearance of one or more nucleic acid groups.Replacement is interpreted as to mean replaces one nucleic acid base, distinguishes between conversion (purine base is to the replacement to pyrimidine base of purine base or pyrimidine base) and transversion (purine base is to the replacement (or backward-substitition) of pyrimidine base) herein.

Add or insert being interpreted as that the nucleic acid group that means extra incorporates DNA into, might cause reading the position of frameing shift.Frame shift with regard to the position with regard to such reading, between " meeting the frame formula " insertions/interpolation and " frame dislocation type " insertion, distinguish.Under the situation of " meeting the frame formula " insertion/interpolation, read frame reservation and polypeptide and enlarge because of the coded amino acid whose number of nucleic acid that inserts.Under the situation of " frame dislocation type " insertion/interpolation, original reading frame forfeiture and no longer may form complete and the polypeptide of function is arranged.

Disappearance has been described losing of one or more base pairs, and this causes reading " meeting the frame formula " and " frame dislocation type " displacement and so relevant consequence of generation and formation whole protein aspect of frame equally.

It is well known by persons skilled in the art can being used to produce the mutagenic agent (mutagenic agent) of random mutation or orthomutation and available method and technology.These class methods and mutagenic agent are for example at A.M.vanHarten[(1998), " Mutation breeding:theory and practical applications ", Cambridge University Press, Cambridge, UK], E Friedberg, G Walker, W Siede[(1995), " DNA Repair and Mutagenesis ", Blackwell Publishing] or K.Sankaranarayanan, J.M.Gentile, L.R.Ferguson[(2000) " Protocolsin Mutagenesis ", Elsevier Health Sciences] the middle description.

For importing orthomutation, can use habitual molecular biology method and means, (Takara Shuzo is Kyoto) or from the QuikChange of Stratagene as in vitro mutagenesis test kit, LA PCR in vitro mutagenesis test kit

Test kit or use the PCR mutagenesis of suitable primer.

As discussed above, there are numerous chemical, physical property and biological mutagenic agent.

Hereinafter listed mutagenic agent mode by way of example provides, but is nonrestrictive.

Chemical mutagen can be according to its mechanism of action grouping.Therefore, there are base analogue (for example 5-bromouracil, 2-aminopurine), simple function and difunctionality alkylating agent (for example simple function alkylating agent such as ethylmethane sulfonate, dimethyl sulfate, or difunctionality alkylating agent such as sulfurous acid dichloro ethyl ester, mitomycin, nitrosoguanidine-dialkyl group nitrosamine, N-nitrosoguanidine derivant) or embed material (for example acridine, ethidium bromide).

Therefore, for the inventive method, for example also might use as to according to the present invention for example according to SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 and/or 215 polypeptide results of mutation and the those polypeptides that obtains.

The example that suitable aminoacid is replaced provides in following table:

The example that original group is replaced

Ala Ser

Arg Lys

Asn Gln；His

Asp Glu

Cys Ser or Ala

Gln Asn

Glu Asp

Gly Pro

His Asn；Gln

Ile Leu；Val

Leu Ile；Val

Lys Arg；Gln；Glu

Met Leu；Ile

Phe Met；Leu；Tyr

Ser Thr

Thr Ser

Trp Tyr

Tyr Trp；Phe

Val Ile；Leu

Table 2: suitable aminoacid is replaced

Known in SEQ ID NO:2, the natural serine that is present in 2849 places, position for example can be replaced to avoid phosphorylation on this position (Fontao L, Favre B, Riou S by glycine, GeertsD, Jaunin F, Saurat JH, Green KJ, Sonnenberg A, Borradori L., bullous pemphigoid antigen 1 (BP230) and desmoplakin and intermediate filament's interaction is by the mediation of visibly different sequence in its c-terminus, Mol Biol Cell.2003 May; 14 (5): the 1978-92. electronic form is open, on January 26th, 2003).

Under above situation, " functional equivalents " also is that " precursor " of described polypeptide and " functional derivatives " of this polypeptide reach " salt ".

Here, " precursor " is natural precursor of polypeptide or the synthetic precursor that has or do not have required biologic activity.

Statement language " salt " is interpreted as salt or the amino acid-addition salts that means protein molecule carboxyl of the present invention.Carboxylic salts can prepare and comprise inorganic salt according to known mode itself, as sodium, calcium, ammonium, ferrum and zinc salt, and the present invention provides and organic base such as the amine salt of triethylamine, arginine, lysine, piperidines etc. for example equally, acid-addition salts as with mineral acid such as hydrochloric acid or vitriolic salt and with the salt of organic acid such as acetic acid and oxalic acid.

" functional equivalents " also comprises certainly from other biological available polypeptide and naturally occurring variant (allele variant).For example, by sequence relatively, can determine the position of homologous sequence area or conservative region.Use these sequences, can use the bioinformatics comparison program to retrieve equivalent enzyme DNA data base (for example genome or cDNA data base).Available suitable computer program of the public and data base are that those skilled in the art are known fully.

These comparisons to known protein matter sequence can for example have been used from the computer program of InforMax Inc such as Vector NTI 8 (from the version of JIUYUE in 2002 since 25 days) and carry out.

In addition, " functional equivalents " is such fusion rotein, and it has above-mentioned peptide sequence or from one of deutero-functional equivalents wherein and have and different with described peptide sequence function be in functional aminoterminal or c-terminus connects at least one other heterologous sequence of (the mutual serious functional destruction that does not promptly have the fusion rotein part).The limiting examples of this type of heterologous sequence for example is signal peptide or enzyme.

According to " functional equivalents " that the present invention includes is to concrete disclosed proteinic congener (homologs).Use is disclosed computer program and computerized algorithm calculating in definition, one of these congeners and concrete disclosed aminoacid sequence have at least 40%, 45% or 50%, preferably at least 55%, 60%, 65% or 70%, especially preferably at least 75%, 80%, 85%, 90%, 91%, 92%, 93% or 94%, at least 95% or 96% homology very particularly preferably.

Under the situation of possible protein glycosylation, " functional equivalents " of the present invention comprise mentioned above be in deglycosylation or glycosylation form and by changing glycosylation pattern the protein type of obtainable modified forms.

Under the situation of possible protein phosphorylation, " functional equivalents " of the present invention comprise mentioned above be in dephosphorylation or phosphorylation form and by change the phosphorylation pattern and the protein type of obtainable modified forms.

The congener of polypeptide of the present invention can be identified by screening mutant (as shortening mutant) library.For example, the storehouse of protein variants can produce as the mixture that connects synthetic property oligonucleotide by enzyme by the combinatorial mutagenesis in nucleic acid level.There is the numerous method that can be used for producing potential congener storehouse of kind from the degeneracy oligonucleotide sequence.The chemosynthesis of degeneracy gene order can be carried out in automatic dna synthesizer, and synthetic gene can be connected in the suitable expression vector subsequently.The utilization of the complete gene of degeneracy causes provides the full sequence of the required complete potential protein sequence of coding to become possibility in a kind of mixture.The method that is used for synthetic degeneracy oligonucleotide is (Narang for example, S.A. (1983) Tetrahedron 39:3 well known by persons skilled in the art; Itakura etc. (1984) Annu.Rev.Biochem.53:323; Itakura etc., (1984) Science 198:1056; Ike etc. (1983) Nucleic Acids Res.11:477).

In the prior art, it is known being used to screen the combinatorial library gene outcome that produces by point mutation or truncate and being used for has a gene outcome of selected characteristics to the cDNA library screening numerous technology.The technology that is used to screen the most frequent use of the large-scale gene library that is subjected to high throughput analysis comprises gene library is cloned into reproducible expression vector, transforms suitable cell and express the associativity gene detecting under the condition that required activity helps to separate carrier like this with the vector library that produces, wherein said vector encoded detect the gene of its product.The overall mutation of recurrence (REM) is a kind of technology that improves the frequency of functional mutants in the library, can use in combination to identify congener (Arkin and Yourvan (1992) PNAS 89:7811-7815 with screening test; Delgrave etc. (1993) Protein Engineering 6 (3): 327-331).

Use is at SEQ ID NO:1,3,5,7,9,11,13,15,17,19,21,23,25,27,29,31,33,35,37,39,41,43,45,47,49,51,53,55,57,59,61,63,65,67,69,71,73,75,77,79,81,83,85,87,89,91,93,95,97,99,101,103,105,107,109,111,113,115,117,119,121,123,125,127,129,131,133,135,137,139,145,149,152,159,161,163,165,212 and/or 214, preferred especially 165,212 and 214, most preferably the nucleotide sequence of describing for 214 times or its part are the method that those skilled in the art become known for otherwise identifying congener as probe to the inspection of other biological physics availability cDNA or genome dna library.Herein, from according to SEQ ID NO:1,3,5,7,9,11,13,15,17,19,21,23,25,27,29,31,33,35,37,39,41,43,45,47,49,51,53,55,57,59,61,63,65,67,69,71,73,75,77,79,81,83,85,87,89,91,93,95,97,99,101,103,105,107,109,111,113,115,117,119,121,123,125,127,129,131,133,135,137,139,145,149,152,159,161,163,165,212 and/or 214, preferred especially 165,212 and 214, most preferably deutero-probe has length 20bp at least in 214 the nucleotide sequence, preferred 50bp at least, especially preferred 100bp at least, 200bp at least very particularly preferably, 400bp at least most preferably.This probe also can be that 1 kilobase or thousands of base are long, for example 1Kb, 1.5Kb or 3Kb.In order to check the library, also can use NO:1 at SEQ ID, 3,5,7,9,11,13,15,17,19,21,23,25,27,29,31,33,35,37,39,41,43,45,47,49,51,53,55,57,59,61,63,65,67,69,71,73,75,77,79,81,83,85,87,89,91,93,95,97,99,101,103,105,107,109,111,113,115,117,119,121,123,125,127,129,131,133,135,137,139,145,149,152,159,161,163,165,212 and/or 214, preferred especially 165,212 and 214, complementary dna chain or the fragments sequence of its length between 20bp and thousands of base of describing for 214 times most preferably.Hybridization conditions to be used is described as mentioned.

In the method for the invention, also might use such dna molecular, they are under standard conditions and at SEQ ID No:1,3,5,7,9,11,13,15,17,19,21,23,25,27,29,31,33,35,37,39,41,43,45,47,49,51,53,55,57,59,61,63,65,67,69,71,73,75,77,79,81,83,85,87,89,91,93,95,97,99,101,103,105,107,109,111,113,115,117,119,121,123,125,127,129,131,133,135,137,139,145,149,152,159,161,163,165,212 and/or 214, preferred especially 165,212 and 214, most preferably describe and encode the making nucleic acid molecular hybridization of the polypeptide of keratin-binding 214 times, with be complementary to above-mentioned nucleic acid molecules or the complementary making nucleic acid molecular hybridization of its part, and encode as complete sequence and to have as at SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, the polypeptide of 213 or 215 times identical characteristics that described polypeptide is such.

The particularly advantageous embodiment of the present invention be comprise at least a as at SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, the polypeptide of the keratin-binding of peptide sequence shown in 213 or 215 (i), condition is when measuring in the test according to embodiment 9 or 10, and the keratin combination of described polypeptide is as at SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, shown in 213 or 215 at least 10% of the value of corresponding peptide sequence, 20%, 30%, 40% or 50%, preferred 60%, 70%, 80% or 90%, preferred especially 100%.

The preferred polypeptide (i) of keratin-binding that required biology is had the affinity of high special that uses.Therefore, in order to be used for cosmetics for skin, the preferred polypeptide (i) that the application on human skin keratin is had the keratin-binding of extra high affinity that uses.In order to be used for hair cosmetic composition, the preferred use has the those polypeptides sequence of extra high affinity to people's hair-keratin.

For in the house pet Application for Field, except described peptide sequence (SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215, preferably at SEQ ID NO:2,4,6,8,10,12,14,40,42,44,46,48,146,150,153,156,157,158,160,164,166,213 or 215, preferred especially 166 and 213, most preferably 213) outside, to respective corners albumen for example polypeptide (i) with those keratin-bindings of extra high affinity of dog keratin or cat keratin be preferred therefore.

Yet, also might use more than a kind of and polypeptide (i) the link coupled keratin-binding of effector molecule of the present invention (i), for example the polypeptide (i) that the application on human skin keratin is had a keratin-binding of high binding affinity can make up with effector molecule, wherein said effector molecule and polypeptide (i) combination that people's hair-keratin is had the another kind of keratin-binding of high-affinity.Also might use the polypeptide (i) of identical (with the different) keratin-binding that comprises 2 or more a plurality of copies or the chimeric polyeptides of its keratin binding structural domain.For example, therefore might realize especially effectively keratin combination.

The polypeptide of suitable keratin-binding (i) is known.For example, desmoplakin and plectin comprise keratin binding structural domain (Fontao L, Favre B, Riou S, Geerts D, Jaunin F, Saurat JH, Green KJ, Sonnenberg A, Borradori L., bullous pemphigoid antigen 1 (BP230) and desmoplakin and intermediate filament's interaction is by the mediation of visibly different sequence in its c-terminus, Mol Biol Cell.2003 May; 14 (5): the 1978-92 electronic form is open, on January 26th, 2003; The aminoterminal of Hopkinson SB, Jones JC., transmembrane protein BP180 and the aminoterminal domain interaction of BP230 thereby mediation are at the angle albuminous cell skeleton grappling effect on the pair cell surface at hemi desmosome position, Mol Biol Cell.2000 Jan; 11 (1): 277-86).

The polypeptide of keratin-binding of the present invention (i) also can-separate with keratin easily as required-once more.For this reason, for example can use and contain keratic rinsing liquid (rinse), thus the polypeptide of keratin-binding (i) from its with keratic existing the combination replacedly get off and saturated with keratin from rinsing liquid.Perhaps, the rinsing liquid with high-load detergent (for example SDS) may be used for this flush away.

That the present invention also preferably provides wherein is conjugated protein from enzyme, antibody, effector, fluorescin, antimicrobial peptide and the effect protein of selection effect polypeptide above-mentioned keratin-binding (ii) the assembly protein automatically.

Enzyme:

The enzyme of mentioning preferably is selected from oxidase, peroxidase, protease, tryrosinase, lactoperoxidase, lysozyme, amyloglucosidase, glucoseoxidase, superoxide dismutase, photolyase and catalatic those enzymes.

Antibody

The antibody of mentioning preferably can be brought those antibody of positive cosmetic benefit with them, as antibody at skin pathogens.

With the conjugated protein preferably carotenoid of the effector molecule of mentioning binding proteins (hereinafter being called CBP again), vitamin associativity, chromophore-associativity, flavour enhancer associativity, sugared associativity and melts combine albumen.In the carotenoid binding proteins, especially preferably from the carotenoid binding proteins (accession number SWISS-PROT:Q8MYA9) of silkworm (Bombyxmori).This proteinic separation and this proteinic carotenoid binding characteristic be characterized in Tabunoki etc. (2002; Separation, sign and cDNA sequence from the carotenoid binding proteins of silkworm larva sericterium; J Biol Chem 277:32133-32140) describes in.In melts combine albumen, especially preferably from colibacillary " lead, cadmium, zinc and hydrargyrum transportation ATP enzyme " ZntA (SWISS-PROT:P37617).Proteinic separation of ZntA and sign, especially Sofia etc. (1994; Escherichia coli (Escherichia coli) genome analysis .V. is from the DNA sequence in 76.0 to 81.5 minutes zones; Nucleic Acids Res 22:2576-2586), Rensing etc. (1997; Escherichia coli zntA gene code Zn (II) transposition type P type ATP enzyme; Proc Natl Acad Sci 94:14326-14331) and Sharma etc. (2000; A kind of ATP hydrolysing activity of purification from colibacillary Pb (II)/Cd (II)/Zn (II) transposition ATP enzyme ZntA; J Biol Chem 275:3873-3878) in middle description.

Fluorescin:

With the fluorescin mentioned preferably from being selected from green fluorescent protein (GFP), enhanced green fluorescent protein (eGFP), red fluorescent protein (RFP), monomeric red fluorescent protein (mRFP), dsRED, blue fluorescent protein (BFP), yellow fluorescence protein (YFP) and cyan fluorescent protein (CFP).Preferred especially enhanced green fluorescent protein (eGFP).

GFP albumen is the protein that sends fluorescence green when shining with blue light that is produced by animal.The example of a GFP albumen carrier is Victoria's multitube Jellyfish (Aequorea victoria).This Jellyfish that great majority have the characteristic green emitted existed in the U.S. and Canadian North Pacific seashore in each month in summer.Improvement " enhancing " form of wild type GFP described in prefix letter " e ".EGFP is characterised in that fluorescence intensity is high 35 times.

This type of fluorescin is for example described and is sold by HHMI (Howard Hughes Medical Institute) laboratory.

The effect protein that use comprises the keratin-binding of fluorescin is realized the skin color of more healthy and transparent appearance and is used for brightening skin (" skin albefaction ") optically after being intended to be applied to skin.

In addition, these effect proteins that comprise the keratin-binding of fluorescin also can be used for the brightening hair or be used for producing special reflecting or flash of light on hair.In addition, the effect protein that comprises the keratin-binding of fluorescin can use in decorative cosmetic product having so that produce the effect of tatooing during for example with irradiation under ultraviolet ray.

AMP

The antimicrobial peptide of mentioning preferably is selected from the those polypeptides that suppresses microorganism (as antibacterial, fungus or protozoon) growth.Preferred especially polypeptide according to SEQ ID No:211.

Automatic assembly protein:

With the automatic assembly protein mentioned preferably from the fibroin of a plurality of species, as Aranea (for example cross epeira (Araneus diadematus)), silkworm (for example silkworm), mussel (for example Mytilus edulis (Mytilusedulis)).In fibroin, preferred especially C16 spider silk fibroin, it is 16 repetitions from the C-structure body (module) of the a-protein DF4 of cross epeira.The structure of C16 spider silk fibroin and be characterized in Huemmerich etc. (2004; The primary structure element of Aranea traction fiber and to the contribution of protein solubility; Biochemistry 43:13604-13612) describes in.Preferential especially following fibroin: from the fibroin of network bride spider (Nephila clavipes) accession number AY855102 and U37520, cat face spider (Araneus gemmoides) accession number AY855101 and accession number AY855100, golden spider (Argiope aurantia) accession number AY855099 and AY855098, synthetic spider silk fibroin (accession number DQ001900 and accession number DQ186903).

Other most suitable effect protein (ii) is a naturally occurring polypeptide in escherichia coli or the bacillus subtilis especially in the microorganism.The example of this type of fusion partner is sequence YaaD (accession number BG10075) (SEQ ID NO:197 and 198) and thioredoxin (accession number EG11031) (SEQ IDNO:185 and 186).

More than mention the fragment of protein and polypeptide and the also suitable in principle action effect albumen of functional equivalents (according to above given definition) (ii).

The particularly preferred theme of the present invention relates to the effect protein of such keratin-binding, it comprises action effect polypeptide fibroin (ii), particularly preferably be to comprise at least one according to SEQ ID No:151,201,202,203,204,205,206,207,208,209 or 210 sequence or corresponding to like this fibroin of polypeptide, wherein said polypeptide at least 40%, 45% or 50%, preferably at least 55%, 60%, 65% or 70%, especially preferably at least 75%, 80%, 85%, 90%, 91%, 92%, 93% or 94%, very particularly preferably at least 95% or 96% and at least one is according to SEQ ID No:151,201,202,203,204,205,206,207,208,209 or 210 sequence is same.

In addition, the invention provides the effect protein that comprises by those keratin-bindings of the fibroin of nucleic acid molecule encoding, wherein said nucleic acid molecules comprises and is selected from least one following nucleic acid molecules:

Q) nucleic acid molecules that the proteinic nucleic acid molecules of coding keratin-binding, described nucleic acid molecules can be by using basis (k) to (m) or the part fragment that it comprises at least 15 nucleotide as probe under stringent hybridization condition, separate from dna library and

Except above-mentioned effect protein (ii), in a form of the present invention, also might use from 3-10 at least, preferably at least 11-50, especially preferably at least 51-100 and especially preferably make up more than 100 aminoacid (hereinafter being called fusion partner (fusion partner) again) at least and not with the natural those polypeptides that is connected of polypeptide (i) of aforesaid keratin-binding.

Effect protein (ii) can be selected from numerous protein or polypeptide.Also possible is a plurality of effect proteins (ii) for example are connected at the aminoterminal of the polypeptide portion of this keratin-binding or at its c-terminus with the polypeptide (i) of a keratin-binding.

The polypeptide (i) and the effect protein of the effect protein of keratin-binding of the present invention and the keratin-binding that exists therein (ii) can for example pass through according to Merrifield (2005 by known peptide synthetic method, Kimmerlin T, SEebach D., 100 years of ' method of peptide synthesis ': the peptide by using the beta-peptide assembling and the method for attachment of protein synthesis, J Pept Res.2005 February; 65 (2): solid phase synthesis 229-260) is sent out and is chemically carried out.

Yet particularly suitable is gene engineering method, the nucleic acid molecules of polypeptide (i) of keratin-binding of wherein encoding functionally is connected each other with coded actions albumen nucleic acid molecules (ii), to such an extent as to form single common translation product (translation is merged) because of the translation of nucleic acid molecule used therefor.

Be suitable for producing the polypeptide (i) of above-mentioned keratin-binding, effect protein (ii) or the host living beings of (comprising polypeptide (i) and aminoacid sequence (ii)) fusion rotein (producing biological) be prokaryote (comprising archeobacteria (Archaea)) and eukaryote, preferably comprise the antibacterial of halophilic bacteria (halobacteria) and methane coccus guiding principle (methanococci), fungus, insect cell, plant cell and mammalian cell, particularly preferably be escherichia coli, bacillus subtilis, bacillus megaterium (Bacillus.megaterium), aspergillus oryzae (Aspergillus oryzea), aspergillus nidulans (Aspergillusnidulans), aspergillus niger (Aspergillus niger), finish red saccharomyces pastorianus (Pichia pastoris), pseudomonas (Pseudomonas spec.), lactobacillus (Lactobacillae), multiple-shaped nuohan inferior yeast (Hansenula polymorpha), trichoderma reesei (Trichoderma reesei) and SF9 (or relevant cell).

Chemical coupling

The present invention also preferably provides aforementioned polypeptides (i) wherein and the effect protein of the keratin-binding that (ii) couples together by the chemical coupling reaction.During these coupling reactions, can the closed key of from the covalent bond that constitutes by thioester bond, ester bond, thioether bond, ehter bond, amido link, sulfonic acid ester bond and sulfonamides key (sulfonamide bond), selecting.Described herein key can be closed between side chain, aminoterminal or the c-terminus of the internal amino acid of side chain, aminoterminal or the c-terminus of the internal amino acid of the polypeptide (i) of keratin-binding and effect protein.

Perhaps, can for example pass through carbodiimide, glutaraldehyde or other cross-linking agent well known by persons skilled in the art and implement effector molecule (ii) and the direct coupling between the keratin binding structural domain.This type of coupling reaction is chosen in 2005, Kimmerlin T, SEebach D., 100 years of ' method of peptide synthesis ': the peptide by using the beta-peptide assembling and the method for attachment of protein synthesis, J Pept Res., 65 (2): 229-260, with 2004, David R etc., expressed protein interconnect function, Eur.J.Biochem.271 provides among the 663-677.

The present invention also provides the effect protein of the keratin-binding that effect polypeptide wherein (ii) couples together by spacer element with the polypeptide (i) of keratin-binding.But spacer element can be the light cutting but or enzyme cleavable (especially by lipase, esterase, protease, phosphatase, the hydrolytic enzyme etc.) of stable thermal cutting.Corresponding chemical constitution be well known by persons skilled in the art and be incorporated into molecular moiety (i) and (ii) between.But the example of the enzyme action cutover head that can use in molecule of the present invention for example provides in WO98/01406, quotes reference in addition especially in the full content literary composition of the document.

Spacer element can be the known in principle cross-linking agent of those skilled in the art, preferably carbodiimide or glutaraldehyde.For this connection, guaranteed directly to be connected in conjunction with actual between keratic polypeptide and the effect protein.With the carbodiimide mentioned dicyclohexylcarbodiimide (DCC) preferably, DIC (DIC), N '-(3-dimethyl aminopropyl)-N-ethyl-carbodiimide hydrochloride (EDC) is to use DIC or EDC for preferred especially.

Another preferred theme of the present invention is wherein to connect polypeptide (i) and spacer element (ii) is the effect protein of the keratin-binding of polypeptide.

For example, the nucleic acid molecules of the effect protein of coding keratin-binding can be modified in such a manner by suitable biotechnology cloning process, to such an extent as to the translation fusions also comprises the peptide sequence of performance spacer element effect.These polypeptide spacer elements can have cleavage site that is used for protease (for example skin protein enzyme-cathepsin D), lipase, esterase, phosphatase or hydrolytic enzyme or the peptide sequence that allows to simplify the fusion rotein purification, for example so-called His label, i.e. oligo-histidine group.

In addition, also might be at polypeptide (i) and the connecting portion place (ii) insert extra aminoacid by suitable gene engineering method.This for example also can be because of new that produce or produced by the restriction endonuclease recognition site of inactivation on nucleic acid level.In addition, extra aminoacid can insert at the connecting portion place of two fusion partners so that produce joint sequence, produces the functional polypeptide part to such an extent as to these two fusion partners can fold independently of each other.Protein of the present invention also can carry out post translational modification, promptly for example modifies by glycosylation, phosphorylation or acylation after translation.This modification also can for example take place with glutaraldehyde cross-linking by chemistry route.

In particularly preferred embodiments, the invention provides the effect protein of the keratin-binding that couples together indirectly by spacer element, wherein spacer element is the joint of difunctionality at least, described joint by being bonded to keratin-binding polypeptide (i) and side chain, c-terminus or the aminoterminal of the internal amino acid of effect polypeptide and with described polypeptid covalence couple together.

The polypeptide (i) that the effect protein of keratin-binding of the present invention can (iii) (ii) be coupled to effect protein keratin-binding by the linkers that use has at least two coupling degrees of functionality is gone up and is produced, wherein said at least two coupling degrees of functionality can enter the key that is selected from thioester bond, ester bond, thioether bond, ehter bond, amido link, sulfonic acid ester bond and sulfonamides key, and

(a) in first coupling step, at first with the effect polypeptide (ii) through one of described key be bonded to linkers (iii) and

(b) in another coupling step, from the product of (a) through linkers (iii) in still free coupling degree of functionality be coupled to the polypeptide (i) of keratin-binding.

In preferred embodiments, coupling degree of functionality is at least two different functional groups.

The combination (ii) of linkers pairing effect polypeptide is carried out through the chemical coupling reaction.This can be for example by c-terminus or the N-terminal degree of functionality or the side chain of effect polypeptide, especially amido functional group, hydroxy functional group, carboxyl functional group or mercapto functional group carry out.Preferably through one or more carboxyls of one or more hydroxyls, aspartic acid or the glutamic acid group of one or more sulfydryls, serine, threonine or the tyrosine group of the amido functional group of one or more lysine groups, cysteine group or by the effect polypeptide aminoterminal (ii) or the connection of c-terminus functional group.

This type of chemical coupling reaction is well known by persons skilled in the art and for example at Becker, H.G.O., Organikum[Organics], the 20 edition, 1996, Johann Ambrosius BarthVerlag Heidelberg or Hermanson, G.T.:Bioconjugate Techniques, 1996, Academic Press describes among the San Diego.

The amino acid functional group who in effect polypeptide primary sequence (ii), exists, aminoacid (for example cysteine, lysine, aspartic acid, glutamic acid) with appropriate functional group also can be connected with this sequence, or the aminoacid of this peptide sequence thus amino acid functional group substitute.The method that is used for mutation or operation nucleic acid molecules is that those skilled in the art are fully known.Several selected methods are described hereinafter.

The product that produces because of above-mentioned steps (a) and the polypeptide (i) of keratin-binding combine that still free second anchoring group carries out in linkers.Except above-mentioned coupling reaction; the suitable anchoring group of this type particularly the sulfydryl reactive group (for example maleimide, dithio pyridine radicals (pydridyldisulfide), alpha-halogen acetyl group (haloacetyl), vinyl sulfone(Remzaol, sulfato alkyl sulfone (the preferably sulfuric acid root closes ethyl sulfone and thio-alcohol), its center tap can be by the cysteine group formation covalent bond of described anchoring group with the polypeptide (i) of keratin-binding.

Preferred linkers is (iii) covalently bound with the polypeptide (i) of keratin-binding.This can be for example by the side chain of the polypeptide (i) of keratin-binding, especially amido functional group, hydroxy functional group, carboxyl functional group or mercapto functional group carry out.Preferably through one or more carboxyls of one or more hydroxyls, aspartic acid or the glutamic acid group of one or more sulfydryls, serine, threonine or the tyrosine group of the amido functional group of one or more lysine groups, cysteine group or the polypeptide aminoterminal (ii) or the connection of c-terminus functional group by keratin-binding.Except the polypeptide of keratin-binding (ii), outside the amino acid functional group who exists in the primary sequence, aminoacid (for example cysteine, lysine, aspartic acid, glutamic acid) with appropriate functional group also can be added in this sequence, or the aminoacid of this peptide sequence thus amino acid functional group substitute.The method that is used for mutation or operation nucleic acid molecules is that those skilled in the art are fully known.Several selected methods are described hereinafter.

The link coupled success of effector molecule can be monitored by three kinds of different tests:

(i) Elman (Ellmann) test, wherein the free Cys-SH radix order in the protein can be measured before or after the effector molecule coupling.Good reaction process (seeing embodiment 17) is represented in the free obvious minimizing of SH base after coupling.

(ii) activity test wherein can be measured the combination (see embodiment 16) of the polypeptide of the keratin-binding that has and do not have link coupled joint effector molecule to hair.

(iii) measure link coupled proteinic molal weight.

The polypeptide of keratin-binding of the present invention (i) has the cosmetics the people, especially skin nursing, first nursing and hair-care, and at animal care, the widely-used field in leather nursing and the leather processing.

Preferably, the polypeptide of keratin-binding of the present invention (i) is used for cosmetics for skin and hair cosmetic composition.They allow the high concentration and the permanent action time of nursing property or protectiveness effector molecule.

In particularly preferred embodiment of the present invention, use the polypeptide that application on human skin, hair or first keratin is had the keratin-binding of binding affinity.

The present invention particularly preferably provides the effect protein of keratin-binding, wherein

S) polypeptide of the keratin-binding of Shi Yonging is included in SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215, preferably at SEQ IDNO:2,4,6,8,10,12,14,40,42,44,46,48,146,150,153,156,157,158,160,164,166,213 or 215, preferred especially 166 and 213, one of sequence shown in 213 most preferably, and

T) the effect polypeptide (ii) is selected from fibroin, preferred C16 spider silk fibroin, and wherein said C16 spider silk fibroin is 16 repetitions from the C-structure body (module) of the a-protein DF4 of cross epeira, randomly

U) at s) and t) down described protein also can get up by the linkers coupling.The present invention also provides the purposes of effector molecule in the skin cosmetic product of the keratin-binding that produces according to the present invention.Preferably, the effector molecule of keratin-binding of the present invention uses in skin and hair cosmetic composition.They allow the high concentration and the permanent action time of skin nursing or skin-protectiveness effector substance.

In a preferred embodiment of the invention, the effect protein of keratin-binding of the present invention uses at skin protection composition, skin care compositions and methods, skin cleansing compositions, hair protection compositions, hair care composition, hair Cleasing compositions or at the product that is used for decorative cosmetic product having.

In a preferred embodiment of the invention, gross weight based on compositions, the effect protein of keratin-binding of the present invention is with 0.001-1 weight %, preferred 0.01-0.9 weight %, preferred especially 0.01-0.8 weight % or 0.01-0.7 weight %, very particularly preferably 0.01-0.6 weight % or 0.01-0.5 weight %, most preferably the concentration of 0.01-0.4 weight % or 0.01-0.3 weight % is added in the cosmetics for skin.In another embodiment, based on the gross weight of compositions, said composition comprises the effect protein of keratin-binding of the present invention with the concentration of 1-10 weight %, preferred 2-8 weight %, 3-7 weight %, 4-6 weight %.In same embodiment preferred, based on the gross weight of compositions, said composition is with the effect protein of the concentration keratin-binding of the present invention of 10-20 weight %, preferred 11-19 weight %, 12-18 weight %, 13-17 weight %, 14-16 weight %.In a more preferred embodiment, based on the gross weight of compositions, said composition comprises the effect protein of keratin-binding of the present invention with the concentration of 20-30 weight %, preferred 21-29 weight %, 22-28 weight %, 23-27 weight %, 24-26 weight %.

In a further preferred embodiment, the effector molecule of above-mentioned keratin-binding of the present invention is in cosmetics for skin and (i) from the cosmetic supplement in decorative cosmetic product having field, (ii) skin cosmetic effective ingredient and (iii) suitable auxiliary agents and additive combination use.Preferably, they are to be used for protecting skin, hair and/or fingernail or toenail to avoid effective ingredient and auxiliary agent and the additive that damages, is used for the treatment of the existing damage of skin, hair and/or fingernail or toenail and be used for nursing skin, hair and/or fingernail or toenail.These effective ingredient preferably are selected from natural or synthetic polymer, pigment, wetting agent, oil, wax, enzyme, mineral, vitamin, sunscreen, dyestuff, aromatic, antioxidant, antiseptic and/or effective medicinal components.

Be used to produce the suitable auxiliary agents of hair cosmetic or skin cosmetic product and additive and be that those skilled in the art are familiar with and can be at cosmetics handbook Schrader for example, the key element and the preparation of Grundlagen and Rezepturen der Kosmetika[cosmetics], H ü thig Verlag, Heidelberg, 1989, ISBN 3-7785-1491-1 or Umbach, Kosmetik:Entwicklung, Herstellung und Anwendung kosmetischer Mittel[cosmetics: the exploitation of cosmetic compositions, make and use], the second edition of augmentation, 1995, Georg ThiemeVerlag finds among the ISBN 3 13 712,602 9.

Preferably, the effector molecule of keratin-binding of the present invention uses with at least a combination of components of the effector molecule that is different from described keratin-binding in cosmetics for skin or compositions, and wherein said component is selected from: the cosmetic effective ingredient, emulsifying agent, surfactant, antiseptic, aromatic oil, thickening agent, polymeric hair (hair polymer), hair and skin conditioning agent, graft polymers, water solublity or the dispersible polymer that contains siloxanes, light protective agent, bleach, gellant, nursing agent, coloring agent, toner, tanning agent, dyestuff, pigment, the denseness instrumentality, wetting agent, fatting agent, collagen, protolysate, lipid, antioxidant, defoamer, antistatic additive, lubricant and softening agent.Effective ingredient also can exist with encapsulated form in cosmetic product, and as at patent/patent application EP 00974775 B1, DE 2,311 712, EP 0,278 878, described in DE 1,999 47147, EP 0706822B1 and the WO 98/16621, wherein said ground document thereby reference especially in addition.

Advantageously; antioxidant is selected from aminoacid (glycine for example; histidine; tyrosine; tryptophan) and derivant; imidazoles (for example urocanic acid) and derivant thereof; peptide such as D; the L-carnosine; the D-carnosine; L-carnosine and derivant thereof (for example serine); carotenoid; carotene (beta-carotene for example; lycopene) and derivant; chlorogenic acid and derivant thereof; thioctic acid and derivant thereof (for example dihydrolipoic acid); aurothioglucose; propylthiouracil (PTU) and other mercaptan (thioredoxin for example; glutathione; cysteine; cystine; cystamine and glycosyl thereof; the N-acetyl group; methyl; ethyl; propyl group; amyl group; butyl and lauryl; palmityl; oil base; γ-Ya oil base; cholesteryl and glyceryl ester) and salt; thio-2 acid two lauryl alcohol esters; thio-2 acid 2 stearyl ester; thio-2 acid and derivant (ester thereof; ether; peptide; lipid; nucleotide; nucleoside and salt); with sulphoxide imine chemical compound on extremely low tolerance dose (for example pmol to μ mol/kg) (fourth methyllanthionine sulphoxide imine for example; the homocysteine sulphoxide imine; fourth methyllanthionine sulfone; five-; six-; seven thionine sulphoxide imines); also has (metal) chelating agen (alpha-hydroxy fatty acid for example; Palmic acid; phytic acid; lactoferrin); 'alpha '-hydroxy acids (citric acid for example; lactic acid; malic acid); humic acid; bile acid; bile extract; bilirubin; biliverdin; EDTA and derivant thereof; unsaturated fatty acid and derivant thereof (gamma-Linolenic acid for example; linoleic acid; oleic acid); folic acid and derivant thereof; ubiquinone and ubiquinol and derivant thereof; vitamin C and derivant thereof (sodium ascorbate for example; ascorbic palmitate; Ascorbic acid 2-phosphate Mg; the acetic acid acid ascorbyl ester); tocopherol and derivant (Vitamin E acetate for example; tocotrienol); vitamin A and derivant (vitamin A palmitate), and benzoic acid resin; the coniferyl benzoate of rutinic acid and derivant thereof; the alpha-glycosyl rutin; ferulic acid; the furfurylidene glucitol; carnosine; butylated hydroxytoluene; Butylated hydroxyanisole; nor-dihydro traumatic acid (nordihydroguaiacic acid); nordihydroguaiaretic acid; trihydroxybutyrophenone; uric acid and derivant thereof; mannose and derivant thereof; zinc and derivant thereof (ZnO for example; ZnSO ₄), selenium and derivant (for example selenomethionine), stilbene and derivant thereof (for example oxidation pyrrole alkene, anti--oxidation pyrrole alkene).

The vitamin of vitamin B complex or derivatives thereof, provitamin or previtamin and treat that according to the present invention the derivant of the preferred 2-furanone that uses especially comprises:

Vitamin B ₁, common name thiamine, chemical name 3-[(4 '-amino-2 '-methyl-5 '-pyrimidine radicals) and methyl]-5-(2-ethoxy)-4-methylthiazol chloride.

Vitamin B ₂, common name riboflavin, chemical name 7,8-dimethyl-10-(1-D-ribosyl)-benzo [g] pteridine-2,4 (3H, 10H)-diketone.Under free form, riboflavin for example is present in the milk surum, and other riboflavin derivative can be from antibacterial and yeast separation.The stereoisomer of same suitable riboflavin is a lyxoflavin according to the present invention, and it can separate and carry D-arabinose alcohol radical group but not D-ribosyl group from the flesh of fish or liver.

Vitamin B ₃Chemical compound nicotinic acid and nicotiamide (niacin amide) often have this title.According to the present invention, preferred nicotiamide.

Vitamin B ₅(pantothenic acid and pantothenylol).The preferred pantothenylol that uses.Pantothenylol derivant that can be used according to the invention is ester and the ether and the cation derivatization pantothenylol of pantothenylol particularly.In another embodiment preferred of the present invention, except that pantothenic acid or pantothenylol, also can use the derivant of 2-furanone.Particularly preferred derivant is also can the commercial material that obtains, promptly has common name pantoyl internal ester (pantholactone) dihydro-3-hydroxyl-4 (Merck), 4-dimethyl-2 (3H)-furanone, 4-methylol-gamma-butyrolacton (Merck), 3,3-dimethyl-2-hydroxyl-gamma-butyrolacton (Aldrich) and 2,5-dihydro-5-methoxyl group-2-furanone (Merck) is particularly including whole stereoisomers.

These chemical compounds are advantageously given cosmetics for skin humectant properties of the present invention and the stable characteristic of skin.

Vitamin B ₆, it is not understood to mean the material of homogeneous in this article, and means the derivant of known 5-methylol-2-picoline-3-alcohol under common name pyridoxin, pyridoxamine and 2-methyl-3-hydroxy-4-formyl-5-hydroxymethylpyridine..

Vitamin B ₇(biotin), be also referred to as biotin or " the skin vitamin ".Biotin be (3aS, 4S, 6aR)-2-oxo six hydrogen thienos [3,4-d] imidazoles-4-valeric acid

According to the present invention very particularly preferably pantothenylol, pantoyl internal ester (pantholactone), nicotiamide and biotin.

Dyestuff

Operable dyestuff is the material through the approval and the purpose that is suitable for making up, as for example 1984 by Verlag Chemie, Weinheim publish from dyestuff committee of Farbstoffkommission der DeutschenForschungsgemeinschaft[German Research association] publication ＂ Kosmetische

" listed in [cosmetics coloring agent].These dyestuffs use with the concentration of 0.001-0.1 weight % based on total mixture usually.

Pigment

In a preferred embodiment, compositions of the present invention comprises at least a pigment.Pigment is present in the product material with dissolved form not and can be with 0.01-25 weight %, and the amount of preferred especially 5-15 weight % exists.Preferred particle diameter is 1-200 μ m, especially 3-150 μ m, especially preferably 10-100 μ m.Pigment is in fact to be insoluble to the coloring agent in the applicating medium and can is inorganic or organic.Inorganic-organic hybrid pigment also is possible.Preferred inorganic pigments.The advantage of inorganic pigment is light stability, weather stability and the heat stability of their excellences.Inorganic pigment can be a natural origin, for example prepares from Chalk, Haematitum, umber, terre verte, burnt sienna or graphite.Pigment can Chinese white such as titanium dioxide or zinc oxide, black pigment such as iron oxide black, color pigment such as ultramarine or iron oxide red, pearlescent pigment, metal effect pigments, pearlescent pigment and fluorescence or phosphorescent pigment, and wherein preferred at least a pigment is colored non-Chinese white.Metal-oxide, hydroxide and hydrous oxide, mixed dyes of Fe, sulfur-bearing silicate, metal sulfide, complexing metal cyanide, metal sulfate, chromate and molybdate and metal itself (bronze pigments) are suitable.What the spy was fit to fully is titanium dioxide (CI 77891), black iron oxide (CI 77499), yellow iron oxide (CI 77492), redness and brown iron oxide (CI 77491), manganese violet (CI 77742), ultramarine (thiosilicic acid salt aluminum sodium, CI77007, alizarol saphirol 29), hydrated chromium oxide (CI 77289), barba hispanica (ferric ferrocyanide, CI 77510), carmine (cochineal).Be preferably based on micaceous pearlescent pigment and color pigment especially, wherein said pigment is with metal-oxide or metal oxychloride such as titanium dioxide or bismuth oxychloride and give peplos such as the material of color such as ferrum oxide, barba hispanica, ultramarine, carmine as required with other, and wherein color can be determined by the change layer thickness.The pigment of the type is for example in trade (brand) name

With

(Merck) sell down.Organic pigment for example is natural pigment, sepia, Resina garciniae, Vandyke brown, indigo, chlorophyll and other vegetable pigment.Synthetic organic pigment for example is AZOpigments, anthraquinone class, indigo class, dioxazine, quinacridone, the phthalein mountain valley with clumps of trees and bamboo, isoindolinone, pyrene and purple cyclic ketones, metal complex, alkali blue and diketopyrrolo-pyrrole pigment.

In one embodiment, meet the present invention and/or use with at least a particulate material according to the effector molecule of the keratin-binding that the inventive method produced, wherein said particulate material exists in compositions with the amount of 0.01-10, preferred 0.05-5 weight %.Suitable material for example is to be solid and the material that is in particulate forms under room temperature (25 ℃).For example, silicon dioxide, silicate, aluminate, clay, Muscovitum, salt, especially for example titanium dioxide, mineral and polymer particle are suitable for inorganic metal salt, metal-oxide.This particle with undissolved, preferably the form with stable dispersion exists in compositions, and after being in application to application surface and solvent evaporation, can deposit with solid form.Preferred particulate material is Silicon stone (silica gel, silicon dioxide) and slaine, inorganic metal salt especially, wherein preferred especially silicon dioxide.Slaine for example is alkali metal or alkaline earth metal chloride, as sodium chloride or potassium chloride; Alkali metal or alkali earth metal sulfate such as sodium sulfate or magnesium sulfate.

Pearling agent

Suitable pearling agent for example is: alkylene glycol ester, particularly diglycol stearate; Marlamid, particularly fatty acid distribution of coconut oil diglycollic amide; Partial glyceride, particularly stearic acid monoglyceride; The ester of polybase randomly is the carboxylic acid and the ester with aliphatic alcohol of 6-22 carbon atom, particularly tartaric long-chain ester that hydroxyl replaces; Lipid matter, as have aliphatic alcohol, aliphatic ketone, fatty aldehyde, aliphatic ether and aliphatic carbonate ester, particularly laurone and the distearyl ether of at least 24 carbon atoms of total; Fatty acid, as the open-loop products of stearic acid, hydroxystearic acid Huo behenic acid, epoxidation of olefins with 12-22 carbon atom and aliphatic alcohol and/or have the polyol of 2-15 carbon atom and 2-10 hydroxyl with 12-22 carbon atom, and composition thereof.

Habitual thickening agent in this type of preparation is cross-linking type polyacrylic acid and derivant, polysaccharide and derivant thereof such as Xanthan gum, agar, alginate or tylose, cellulose derivative for example carboxymethyl cellulose or hydroxyl carboxymethyl cellulose, aliphatic alcohol, monoglyceride and fatty acid, polyvinyl alcohol and polyvinylpyrrolidone.The preferred non-ionic thickening agent that uses.

Suitable cosmetic and/or skin cosmetic effective ingredient for example are painted effective ingredient, skin and hair dyestuff form agent, toner, tanning agent, bleach, the keratin hardening material, the antimicrobial effective ingredient, the optical filtering effective ingredient, the expellent effective ingredient, congested material, cutin decomposes and cutin forms working substance, the anti-dandruff effective ingredient, the antibiotic medicine, the keratinization material, antioxidation effective ingredient and/or play free radical scavenger, the effective ingredient of the skin moisture-keeping or the material effect of preserving moisture, the stuffing effective ingredient, anti-erythema or antiallergic effective ingredient, branched chain fatty acid such as 18-methyl arachic acid, and composition thereof.

Be suitable for need not be ultraviolet natural or man-made radiation and the tanned effective ingredient of the artificial skin of tanning for example is dihydroxy acetone, alloxan and Endocarpium Juglandis extract.Suitable keratin hardening material normally as also is used for the effective ingredient of antiperspirant, as aluminium potassium sulfate, polymeric aluminum chloride, aluctyl. etc.

Use antimicrobial effective ingredient destroys microorganism or suppresses their growth and therefore play antiseptic and the effect of the deodorize material of formation of minimizing body odor or intensity.They comprise habitual antiseptic for example well known by persons skilled in the art, as p-Hydroxybenzoate, imidazolidinyl urea, formaldehyde, sorbic acid, benzoic acid, salicylic acid etc.This type of deodorize material for example is zinc ricinate, triclosan, 9-undecylenic acid alkylolamides, triethyl citrate, chlorhexidine etc.

The suitable preservatives for the treatment of favourable use according to the present invention is:

E 200	Sorbic acid	E 227	Calcium bisulfite
E 200	Sorbic acid	E 227	Calcium bisulfite	E 201	Sodium sorbate	E 228	Potassium acid sulfite
E 202	Potassium sorbate	E 230	Biphenyl (diphenyl)	E 201	Sodium sorbate	E 228	Potassium acid sulfite
E 202	Potassium sorbate	E 230	Biphenyl (diphenyl)	E 203	Calcium sorbate	E 231	O-phenyl phenol
E 210	Benzoic acid	E 232	O-Phenylphenol Sodium salt tetrahydrate	E 203	Calcium sorbate	E 231	O-phenyl phenol
E 210	Benzoic acid	E 232	O-Phenylphenol Sodium salt tetrahydrate	E 211	Sodium benzoate	E 233	Thiabendazole
E 212	Potassium Benzoate	E 235	Natamycin	E 211	Sodium benzoate	E 233	Thiabendazole
E 212	Potassium Benzoate	E 235	Natamycin	E 213	Calcium benzoate	E 236	Formic acid
E 214	Ethylparaben	E 237	Sodium formate	E 213	Calcium benzoate	E 236	Formic acid
E 214	Ethylparaben	E 237	Sodium formate	E 215	Ethylparaben Na salt	E 238	Calcium formate
E 216	The P-hydroxybenzoic acid n-propyl	E 239	Hexamethylenetetramine	E 215	Ethylparaben Na salt	E 238	Calcium formate
E 216	The P-hydroxybenzoic acid n-propyl	E 239	Hexamethylenetetramine	E 217	P-hydroxybenzoic acid n-propyl Na salt	E 249	Potassium nitrite

E 218	Methyl parahydroxybenzoate	E 250	Sodium nitrite
E 218	Methyl parahydroxybenzoate	E 250	Sodium nitrite	E 219	Methyl parahydroxybenzoate Na salt	E 251	Chile saltpeter
E 220	Sulfur dioxide	E 252	Potassium nitrate	E 219	Methyl parahydroxybenzoate Na salt	E 251	Chile saltpeter
E 220	Sulfur dioxide	E 252	Potassium nitrate	E 221	Sodium sulfite	E 280	Propanoic acid
E 222	Sodium sulfite	E 281	Sodium propionate	E 221	Sodium sulfite	E 280	Propanoic acid
E 222	Sodium sulfite	E 281	Sodium propionate	E 223	Sodium disulfide	E 282	Calcium propionate
E 224	Curing potassium	E 283	Potassium propionate	E 223	Sodium disulfide	E 282	Calcium propionate
E 224	Curing potassium	E 283	Potassium propionate	E 226	Calcium sulfite	E 290	Carbon dioxide

Table 3: suitable antiseptic.E numbering listed in the last table is the name of using among the guide 95/2/EEC.

Also suitable according to the present invention is antiseptic or anticorrosion auxiliary agent habitual in cosmetics: dibromo dicyanobutane (2-bromo-2-bromomethyl glutaronitrile), 3-iodo-2-propynyl-butyl carbamate, 2-bromo-2-nitropropane-1, the 3-glycol, imidazolidinyl urea, 5-chloro-2-methyl-4-isothiazoline-3-ketone, 2-chloroacetamide, Benzalkonii Chloridum and benzylalcohol.Also suitable as antiseptic be the phenyl hydroxyalkyl ether, especially numerous microorganisms are killed antibacterial and fungicidal action with title phenoxyethanol compound known because of it.

Other antimicrobial is suitable for incorporating in the goods of the present invention equally.Favourable material for example is 2,4,4 '-three chloro-2 '-dihydroxy diphenyl ether (irgasan), 1,6-two (4-chlorphenyl biguanide base) hexane (chlorhexidine), 3,4,4 '-trichloro-symmetrical diphenyl urea, quaternary ammonium compound, Oleum Caryophylli, Oleum menthae, Oleum thymi vulgaris, triethyl citrate, farnesol (3,7,11-trimethyl-2,6,10-dodecane triolefin-1-alcohol) and at patent disclosure description DE-37 40 186, DE-39 38 140, DE-42 04 321, DE-42 29 707, DE-43 09372, DE-44 11 664, DE-195 41 967, DE-195 43 695, DE-195 43 696, DE-19547 160, DE-196 02 108, DE-196 02 110, DE-196 02 111, DE-196 31 003, DE-196 31 004 and DE-196 34 019 and patent specification DE-42 29 737, DE-42 37 081, DE-43 24 219, DE-44 29 467, effective ingredient or the combination of active principles described among DE-44 23 410 and the DE-195 16 705.Sodium bicarbonate also will advantageously use.Also can use the microorganism polypeptide equally.

Aromatic oil

As required, cosmetic compositions can comprise aromatic oil.The aromatic oil that can mention for example is the mixture of natural aromatic agent and synthetic aromatising agent.The natural aromatic agent is from flower (Bulbus Lilii, lavandula angustifolia, Flos Rosae Rugosae, jasmine, orange blossom, Yi Lan), stem and leaf (Flos Pelargonii, Herba Pogostemonis, Petitgrain), fruit (Fructus Anisi Stellati XIANGZI, coriander, Fructus cari carvi, Strobilus Juniperi Rigidae), peel (Fructus Citri Sarcodactylis, Fructus Citri Limoniae, orange), root (Semen Myristicae, the Radix Angelicae Dahuricae, Herba Apii graveolentis, Fructus Amomi Rotundus, Costus speciosus, Rhizoma Iridis Tectori, Rhizoma Acori Graminei), timber (Masson Pine, sandalwood, guaiaci lignum, Cupressus funebris Endl., rosewood), medical herbs and grass (tarragon, lemon grass (Cymbopogon citratus), Salvia japonica Thunb., Herba thymi vulgaris), needle and branch (PiceameyeriRehd. Et Wils., fir, pine, Pinus mugo), resin and face cream (galbanum, Canarium luzonicum Elemi, benzoic acid, Myrrha, Olibanum, opopanax) extract that extracts in.Also suitable is animal material, as Zibethum and castoreum.Common synthesizing fragrant chemical compound is ester type, ether type, aldehyde type, ketone type, pure type and hydrocarbon type product.The aromatic of ester type for example is that ester, dimethyl benzyl carbinyl acetate, ethyl phenyl acetate, linalyl benzoate, benzyl formate, aminomethyl phenyl ethyl aminoacetate, allyl cyclohexylpropionate, styralyl propionate and a benzyl salicylate in benzyl acetate, isopropylformic acid. ethyl phenoxy, acetic acid 4-tert-butyl group cyclohexyl, the acetic acid.Ether comprises for example benzylisoeugenol, aldehyde comprises alkanal, citral, citronellal, citronellyl oxyacetaldehyde, cyclamen aldehyde, hydroxycitronellal, lilestralis and the bougeonal (bourgeonal) that for example has 8-18 carbon atom, ketone comprises for example ionone, α-Yi Jiajiziluolantong and cedramber, alcohol comprises anethole, citronellol, acetaminol, isoeugenol, Mang geraniol, linalool, phenethanol and terpenol, and hydrocarbon mainly comprises terpene and face cream.But, the preferred mixture that uses the distinct fragrance agent of the common happy odor type of generation (scene note).The most frequently used low relatively quintessence oil of volatility of making perfume composition also is suitable as aromatic oil, for example sage oil, chamomile oil, Oleum Caryophylli, melissa oil, Oleum menthae, Cortex Cinnamomi leaf oil, linden flower oil, juniper berry oil, vetiver oil, Olibanum oil, galbanum oil, labdanum oil and lavandin oil.Preferably, be used alone or as a mixture oleum bergamottae, dihydromyrcenol, lilestralis, LYRAL, citronellol, phenethanol, jasmonal H, Mang geraniol, benzylacetone, cyclamen aldehyde, linalool,

Forte, imperial saliva furan, indole, MDJ, Sandelice, Fructus Citri Limoniae oil, mandarin oil, orange oil, allyl amyl glycolate, Cyclovertal, lavandin oil, sage oil, β-damascone, geranium oil Bourbon, salicylic acid cyclohexyl,

Coeur,

NP, synthetic oak moss, γ methyl ionone, phenylacetic acid, geranyl acetate, benzyl acetate, rose oxide, Romillate, Irotyl and Floramate.

Oil, fat and wax

Preferably, compositions of the present invention comprises oil, fat and/or wax.The component of the oil phase of the present composition and/or fat phase advantageously is selected from lecithin and fatty acid triglyceride, i.e. chain length 8-24, especially saturated and/or unsaturated, the side chain of 12-18 carbon atom and/or the triglyceride of straight chain alkane carboxylic acid.Fatty acid triglyceride can for example advantageously be selected from synthetic, semi-synthetic and natural oil, as olive oil, sunflower oil, soybean oil, Oleum Arachidis hypogaeae semen, Oleum Brassicae campestris, almond oil, Petiolus Trachycarpi oil, Oleum Cocois, Oleum Ricini, wheat germ oil, Oleum Vitis viniferae, Ji oil, Radix Oenotherae erythrosepalae oil, macadimia nut (macadamia nut) wet goods.Other polar oil ingredient can be selected from saturated and/or unsaturated, the side chain of saturated and/or unsaturated, the side chain of a chain length 3-30 carbon atom and/or a straight chain alkane carboxylic acid and a chain length 3-30 carbon atom and/or the ester of straight chain alcohol, and is selected from saturated and/or unsaturated, the side chain of an aromatic carboxylic acid and a chain length 3-30 carbon atom and/or the ester of straight chain alcohol.This type of ester oil can advantageously be selected from isopropyl myristate subsequently, isopropyl palmitate, isopropyl stearate, acid isopropyl, the n-butyl stearate lauric acid is ester just, oleic acid ester in the positive last of the ten Heavenly stems, the different monooctyl ester of stearic acid, stearic acid ester in the different ninth of the ten Heavenly Stems, isononyl isononanoate, Palmic acid-2-Octyl Nitrite, lauric acid-2-Octyl Nitrite, stearic acid-2-hexyl ester in the last of the ten Heavenly stems, Palmic acid-2-octyl group dodecane ester, oleic acid oleic alcohol ester, the erucic acid oil alcohol ester, wooden dipper heart dish base oil acid esters, wooden dipper heart dish base eruciate, dicaprylyl carbonate (cetiol CC) and glyceryl cocoate class (myritol 331), butanediol two sad/dicaprate and dibutyl adipates, and this type of ester is synthetic, semi-synthetic and natural mixture is as Jojoba oil.

In addition, one or more oil ingredients can advantageously be selected from the hydrocarbon of side chain and straight chain and chloroflo, silicone oil, dialkyl ether, are selected from the alcohol of saturated or unsaturated, side chain or straight chain.Any mixture of this type of oil and wax component also will advantageously be used for the object of the invention.As required, also maybe advantageously use wax, cetyl cetylate for example is as the monoester class component of oil phase.According to the present invention, oil ingredient advantageously is selected from isostearic acid-2-Octyl Nitrite, octyldodecanol, different n-nonanoic acid isotridecyl ester, Isoeicosane, coconut oil 2-ethyl hexyl ester, benzoic acid C12-15 Arrcostab, glycerol three (caprylic/capric) ester, dicaprylyl ether.According to the present invention, the mixture of the mixture of the mixture of benzoic acid C12-15 Arrcostab and isostearic acid-2-Octyl Nitrite, benzoic acid C12-15 Arrcostab and different n-nonanoic acid isotridecyl ester and benzoic acid C12-15 Arrcostab, isostearic acid-2-Octyl Nitrite and different n-nonanoic acid isotridecyl ester is favourable.According to the present invention, preferred especially use to have the polar oil of 5-50mN/m be fatty acid triglyceride, especially soybean oil and/or almond oil.With regard to hydrocarbon, paraffin oil, squalane and Squalene will advantageously use for the object of the invention.

In addition, oil phase can advantageously be selected from the Guerbet alcohols.The Guerbet alcohols is to describe horse Se Ergeer Bert (Marcel Guerbert) name of its preparation first.The Guerbet alcohols is according to following reaction equation

By make pure oxidation with produce aldehyde, by the aldol condensation of aldehyde, from aldol elimination of water and acrylic aldehyde hydrogenation is formed.Even if the Guerbet alcohols is still liquid at low temperatures and does not in fact cause skin irritation.They can be advantageously used for the stuffing in the cosmetic compositions, rich fat and stuffing component again.

The purposes of Guerbet alcohols in cosmetics is that itself is known.Yet the obvious characteristic of this type of substance classes is following structure:

Wherein, R ₁And R ₂The alkyl group of straight chain normally.

According to the present invention, Guerbet alcohol or alcohols advantageously are selected from such group, wherein

R ₁=propyl group, butyl, amyl group, hexyl, heptyl or octyl group and

R ₂=hexyl, heptyl, octyl group, nonyl, decyl, undecyl, dodecyl, tridecyl or myristyl.

Preferred Guerbet alcohols is that 2-butyl capryl alcohol is (for example as Isofol according to the present invention

12 (Condea) can commercial obtain) and the 2-hexyldecanol (for example as lsofol

16 (Condea) can commercially obtain).Also will advantageously use Guerbet alcohols mixture of the present invention according to the present invention, for example the mixture of 2-butyl capryl alcohol and 2-hexyldecanol is (for example as lsofol

14 (Condea) can commercially obtain).

Any mixture of this type of oil and wax component also will advantageously be used for the object of the invention.In the middle of polyolefin, poly decene is preferred material.

Oil ingredient also can advantageously have the composition of ring-type or linear silicone oil or be made of this class oil fully, but preferably uses other oil phase component of the extra content except that silicone oil or silicone oil.Low-molecular-weight siloxane or silicone oil are usually by following general formula definition:

High molecular weight silicone or silicone oil are usually by following general formula definition:

Wherein silicon atom can be replaced by identical or different alkyl group and/or aromatic yl group, wherein said group at this paper generally by radicals R ₁-R ₄Show.Yet in fact not isoplastic number is not necessarily limited at the most to 4.M can adopt the value of 2-200000 in this article.

The annular siloxane for the treatment of favourable use according to the present invention is usually by following general formula definition:

Wherein silicon atom can be replaced by identical or different alkyl group and/or aromatic yl group, wherein said group at this paper generally by radicals R ₁-R ₄Show.Yet in fact not isoplastic number is not necessarily limited at the most to 4." n " can adopt 3/2 to 20 value in this article.The fractional value of n has considered that the odd number siloxy can exist in this ring.

Advantageously, select Silicone DC 556 as silicone oil.Other silicone oil, for example polydimethylsiloxane, hexamethyl cyclotrisiloxane, poly dimethyl phenyl siloxane, annular dimethyl polysiloxane (prestox ring-type four polysiloxanes), hexamethyl cyclotrisiloxane, poly-polydimethylsiloxane, poly-(methyl phenyl siloxane), cetyl polydimethylsiloxane, docosyl oxygen base polydimethylsiloxane also will advantageously use for the object of the invention.The also mixture of annular dimethyl polysiloxane and different n-nonanoic acid isotridecyl ester advantageously, and those mixture of annular dimethyl polysiloxane and isostearic acid-2-Octyl Nitrite.Yet its organic side chain generation derivatization of selecting also advantageously to have a similar formation with above-mentioned chemical compound is polyethoxylated and/or gather propenoxylated silicone oil for example.These silicone oil comprise for example polysiloxanes-poly-alkyl-copolyether, as the cetyl dimethicone copolyol.Advantageously use annular dimethyl polysiloxane (prestox ring-type four polysiloxanes) as the silicone oil that will be used according to the present invention.Fat and/or the wax component for the treatment of favourable use according to the present invention can be selected from vegetable wax, animal wax, mineral tallow and petrochemistry wax.For example, candelilla wax, Brazil wax, Japan wax, esparto wax, cork wax, melon Shandong horse wax (guaruma wax), rice germ oil wax, sugarcane wax, berry wax, ouricury wax, montan wax, Jojoba haze tallow, Adeps Bovis seu Bubali resin, Cera Flava, shellac wax, spermaceti, lanoline (lanocerin), tail fat, ceresin, ceresine (ozlkerite) (ceresine (earth wax)), paraffin and microwax are favourable.

Fat that other is favourable and/or wax component are chemical modification wax and synthetic wax, as

HRC (glycerol tri-docosanoic acid ester) and

AW 1 C (C _18-36Fatty acid) and montanic acid ester type waxes, husky rope wax, hydrogenation Jojoba haze tallow, synthetic or modification Cera Flava (for example dimethicone copolyol Cera Flava and/or C _30-50-alkyl Cera Flava), the cetyl ricinoleate as

CR, polyalkylene wax, polyethylene glycol wax, also has chemical modification fat, as hydrogenated vegetable oil (for example castor oil hydrogenated and/or hydrogenation coconut oil fat acid glyceride), triglyceride such as hydrogenated soybean glyceride, trihydroxy stearin, fatty acid, fatty acid ester and glycol ester such as stearic acid C _20-40Arrcostab, C _20-40Alkyl hydroxy stearoyl stearate and/or ethylene glycol montanate.In addition, some organo-silicon compound that has a similar physical characteristic to described fat and/or wax component also are favourable as stearoxyl trimethyl silane.

According to the present invention, fat and/or wax component can be used in compositions individually or as mixture.Any mixture of this type of oil and wax component also will advantageously be used for the object of the invention.Advantageously, oil phase is selected from isostearic acid-2-Octyl Nitrite, octyldodecanol, different n-nonanoic acid isotridecyl ester, butanediol two sad/dicaprates, coconut oil-2-Octyl Nitrite, benzoic acid C _12-15Arrcostab, glycerol three (caprylic/capric) ester, dicaprylyl ether.The mixture or the benzoic acid C of octyldodecanol, glycerol three (caprylic/capric) ester, dicaprylyl ether, dicaprylyl carbonate, cocoyl glyceride (cocoyl glyceride) _12-15The mixture of Arrcostab and isostearic acid-2-Octyl Nitrite, benzoic acid C _12-15The mixture of Arrcostab and butanediol two sad/dicaprates and benzoic acid C _12-15The mixture of Arrcostab, isostearic acid-2-Octyl Nitrite and different n-nonanoic acid isotridecyl ester is particularly advantageous.With regard to hydrocarbon, paraffin oil, cyclic hydrocarbon, squalane, Squalene, Parleam and poly decene will advantageously use for the object of the invention.

Component also advantageously is selected from phospholipid.Phospholipid is the phosphate ester of acidylate glycerol.In phosphatidylcholine, the most important thing is for example lecithin, it is characterized in that following formula:

Wherein R ' and R ＂ have 15 or 17 carbon atoms and usually at the most to the linear aliphatic group of 4 cis-double bondss.

According to the present invention, from the Merkur Weissoel Pharma 40 of Merkur Vaseline, from Shell ﹠amp; The Shell of DEA Oil

917, Shell 927, ShellOil 4222, Shell

93,

6301,

2071 (Hansen ﹠amp; Rosenthal) can be advantageously used for paraffin oil according to the present invention.Suitable cosmetics tolerability oil ﹠ fat component is at Karl-Heinz Schrader, the key element and the preparation of Grundlagen and Rezepturen derKosmetika[cosmetics], second edition, Verlag H ü thig, Heidelberg, describe in the 319-355 page or leaf, quote as a reference in the full content literary composition of the document.

Solvent

If meet the present invention and/or using in goods as the cosmetic of solution or Emulsion or dispersion or dermatological according to the effector molecule of the keratin-binding that the inventive method produced, then operable solvent is:

Water or aqueous solution; Oil, as capric acid or sad triglyceride, but preferred Oleum Ricini; Fat, wax and other natural and synthetic lipid matter, preferably the alcohol of fatty acid and low carbon number for example with the ester of isopropyl alcohol, propylene glycol or glycerol, the alkanoic acid of aliphatic alcohol and low carbon number or with the ester of fatty acid; The alcohol of low carbon number, glycol or polyol and ether thereof, preferably ethanol, isopropyl alcohol, propylene glycol, glycerol, ethylene glycol, glycol monomethyl ethyl or single-butyl ether, propylene glycol monomethyl, single ethyl or single-butyl ether, diglycol monotertiary methyl ether or single ethylether and similar product.Especially, mention the mixture of solvent more than the use.Under the situation of alcoholic solvent, water can be further component.

Surfactant

According to the present invention, except meeting the present invention and/or the effector molecule according to the keratin-binding that the inventive method produced, compositions can also comprise surfactant.This type of surfactant for example is:

-phosphate ester and salt, as oleth-10 phosphate ester DEA salt (DEA-oleth-10phosphate) and dilauryl polyoxyethylene (4) ether phosphate (dilaureth-4 phosphate),

-alkylsulfonate, for example sulphuric acid cocos nucifera oil monoglyceride sodium, C12-14 alkene sulfonic acid sodium, lauryl sulfoacetate sodium and PEG-3 coconut oleoyl amine magnesium sulfate,

-carboxylic acid and derivant, as lauric acid, aluminium stearate, alkane alcoholization magnesium and Zinc Undecylenate, ester carboxylic acid, for example stearoyl dilactic acid calcium, lauryl polyoxyethylene (6) ether citrate and PEG-4 lauramide carboxylic acid sodium,

-the ester that forms by carboxylic acid and oxirane, glycerol, sorbitan or other pure esterification,

-ether, for example ethoxylated alcohol, ethoxylation lanoline, ethoxylation polysiloxanes, propoxylation POE ether and alkyl poly glucoside are as lauryl glucoside, decyl glucosides and cocoyl glucosides.

Polysorbate

According to the present invention, except meeting the present invention and/or the effector molecule according to the keratin-binding that the inventive method produced, compositions also can comprise polysorbate.

The polysorbate favourable to the object of the invention is

-anhydrous sorbitol polyoxyethylene (20) ether monolaurate (polysorbas20, CAS numbers 9005-64-5)

-anhydrous sorbitol polyoxyethylene (4) ether monolaurate (tween 21, CAS numbers 9005-64-5)

-anhydrous sorbitol polyoxyethylene (4) ether monostearate (tween 61, CAS numbers 9005-67-8)

-anhydrous sorbitol polyoxyethylene (20) ether tristearate (polysorbate65, CAS numbers 9005-71-4)

-anhydrous sorbitol polyoxyethylene (20) ether monoleate (Tween 80, CAS numbers 9005-65-6)

-anhydrous sorbitol polyoxyethylene (5) ether monoleate (sorbimacrogol oleate100, CAS numbers 9005-65-5)

-anhydrous sorbitol polyoxyethylene (20) ether trioleate (polysorbate85, CAS numbers 9005-70-3).

Especially particularly advantageous

-anhydrous sorbitol polyoxyethylene (20) ether monopalmitate (polysorbate40, CAS numbers 9005-66-7)

-anhydrous sorbitol polyoxyethylene (20) ether monostearate (polysorbate60, CAS numbers 9005-67-8).

According to the present invention, these polysorbates based on composition total weight advantageously with the concentration of 0.1-5 weight % and especially used individually or as the mixture of two or more polysorbates with the concentration of 1.5-2.5 weight %.

Conditioner

In a preferred embodiment of the invention, compositions also comprises conditioner.Preferred conditioner for example is at international cosmetic ingredient dictionary and handbook (the 4th volume according to the present invention, editor: R.C.Pepe, J.A.Wenninger, G.N.McEwen, The Cosmetic, Toiletry and FragranceAssociation, the 9th edition, 2002) in the 4th part at key word: hair conditioner, wetting agent, skin-conditioner, skin-conditioner-lubricant, skin-conditioner-wetting agent, skin-conditioner-miscellaneous (Miscellaneous), whole chemical compounds of listing under skin-conditioner-Firm sealing (Occlusive) and the shielding medicine for skin and whole chemical compounds of in EP-A 934 956 (11-13), under " water solublity conditioner " and " oil-soluble conditioner ", listing.Other favourable conditioner for example is the chemical compound that is called polyquaternary ammonium salt (especially polyquaternary ammonium salt-1 is to polyquaternary ammonium salt-56) according to INCI.

Suitable conditioner also comprises for example polymerism quaternary ammonium compound, cationic cellulose derivative and polysaccharide.

The conditioner favourable according to the present invention can be selected from the chemical compound shown in the following table at this paper.

Table 4: the conditioner of favourable use

Other favourable conditioner is cellulose derivative and quaternized guar gum derivatives according to the present invention, especially melon ear hydroxypropyl ammonium chloride (Jaguar for example , Jaguar C

(Rhodia), CAS 65497-29-2, CAS 39421-75-5).

In addition, nonionic poly-N-vinyl ketopyrrolidine/the polyvinyl acetate ester copolymer (for example VA 64 (BASF Aktiengesellschaft)), the anionic acrylic ester copolymer (for example

Soft (BASF Aktiengesellschaft)) and/or the both sexes amide/the acrylate/methacrylate copolymer (for example

(National Starch)) can advantageously use according to the present invention as conditioner.

Powder raw material

Adding powder raw material can be favourable usually.Especially preferably use Talcum.

The ethoxylated glycerol fatty acid ester

According to the present invention, except meeting the present invention and/or effector molecule according to the keratin-binding that the inventive method produced, compositions can also comprise the ethyoxyl carburetion as required, wherein said ethoxylation grease separation is from the ethoxylated glycerol fatty acid ester, especially preferably PEG-10 olive oil glyceride, PEG-11 American Avocado Tree oil glyceride, PEG-11 cocoa butter glyceride, PEG-13 sunflower oil glyceride, the PEG-15 glyceryl isostearate, PEG-9 coconut oil fat acid glyceride, the PEG-54 castor oil hydrogenated, polyoxyethylene (7) castor oil hydrogenated, the PEG-60 castor oil hydrogenated, (the PEG-26 Jojoba fat acid of Jojoba oil ethoxylate, PEG-26 Jojoba alcohol), glycerin polyether-5 cocos nucifera oil acid esters, PEG-9 coconut oil fat acid glyceride, the PEG-7 glyceryl cocoate, PEG-45 palm-kernel oil glyceride, the PEG-35 Oleum Ricini, olive oil PEG-7 ester, PEG-6 caprylic/capric glyceride, hydrogenated palm kernel oil glyceride PEG-6 ester, PEG-20 Semen Maydis oil glyceride, PEG-18 oleic acid glyceryl cocoate, polyoxyethylene (40) castor oil hydrogenated, the PEG-40 Oleum Ricini, the PEG-60 castor oil hydrogenated, PEG-60 Semen Maydis oil glyceride, the PEG-54 castor oil hydrogenated, PEG-45 palm-kernel oil glyceride, the PEG-35 Oleum Ricini, the PEG-80 glyceryl cocoate, PEG-60 almond oil glyceride, PEG-60 Radix Oenotherae erythrosepalae glyceride, PEG-200 hydrogenated palm acid glyceride and PEG-90 glyceryl isostearate.

Preferred ethyoxyl carburetion is PEG-7 glyceryl cocoate, PEG-9 glyceryl cocoate class, polyoxyethylene (40) castor oil hydrogenated, PEG-200 hydrogenated palm acid glyceride.For multiple purpose is used the ethoxylated glycerol fatty acid ester in the water cleaning preparation.Fatty glyceride with low degree of ethoxylation (3-12 ethylene oxide unit(s)) plays fatting agent usually to improve the effect of dry back dermal sensation, and the fatty glyceride with about 30-50 degree of ethoxylation plays the solubilizing agent effect to apolar substance such as aromatic oil.Use has the fatty glyceride of highly ethoxylatedization degree as thickening agent.The feature that whole these materials have jointly is when dilute with water on skin uses, and they produce special sensation on skin.

Light protective agent

Meet the present invention and/or meet the present invention equally according to the purposes that the effector molecule and the light protective agent of the keratin-binding that the inventive method produced is combined in the skin cosmetic product.These cosmetics and/or dermatological are that cosmetic and/or dermatological photoprotection use with the light protection component, and are used for the treatment of with nursing skin and/or hair and as cosmetic product and use in decorative cosmetic product having.These cosmetic products comprise for example sunscreen cream, suntan lotion, sunscreen, suntan lotion, sun-proof face cream, sun protection gel, lip nursing thing and lip pomade, concealer and pen, moisturiser, washing liquid, Emulsion, facial cream, body frost and hands frost, hair conditioner (hair treatment) and rinsing liquid (rinse), hair style is set and is used compositions, the typing gel, hair spray, abrasive tumbling formula deodorizer or eye reduce wrinkle frost, torrid zone thing (tropicals), sun-proof spacer (sunblock), goods behind the sun tan.All goods comprise the effector molecule of at least a keratin-binding and described UV medium one of.

Suntan lotion mainly is to contain the different oil of one or more photoprotection filtering mediums and the mixture of aromatic oil.Oil ingredient is selected according to different cosmetic properties.Sufficient lubrication and to the oil of skin-communication soft feeling such as mineral oil (for example paraffin oil) and fatty acid triglyceride (for example Oleum Arachidis hypogaeae semen, Oleum sesami, American Avocado Tree oil, medium chain triglyceride) with improve the suntan lotion extended capability and absorb to skin, reduce thickness and oil film is mixed the oil of air and water vapor permeable (perspiration).These comprise side chain fatty acid ester (for example isopropyl palmitate) and silicone oil (for example polydimethylsiloxane).When using based on unsaturated fatty acid oily, then add antioxidant for example tocopherol lose to prevent oily souring, suntan lotion does not comprise antiseptic usually as anhydrous formulation.Sunscreen and sunscreen cream are prepared as oil-in-water (oil/water) Emulsion and Water-In-Oil (water/oil) Emulsion.Depend on the Emulsion type, the characteristic variations of goods is very big: oil/aqueous emulsion can be distributed on the skin like a dream, and they are absorbed rapidly and water flush away like a dream always almost mostly.Water/oil emulsion more is difficult to rub into the more lubricated skin of, their degree and therefore looks how many more thickness, but protects skin to avoid parching on the other hand better.The most waterproof of water/oil emulsion.Under the situation of oil/aqueous emulsion, emulsion bases, select the appropriate light protective substance and make used additives (for example polymer) determine the degree of water proofing property as required.The substrate of liquid and white sample oil/aqueous emulsion is similar to habitual other Emulsion in the skin nursing with regard to composition.Sunscreen should sufficient lubrication because of the exsiccant skin of the sun, water and wind.They should not be heavy-gravity, because this feels uncomfortable especially when contacting with sand under sweltering heat.Sunscreen composition is usually based on the carrier that comprises at least a oil phase.Yet the compositions based on water-based also is possible fully.Therefore, oil preparation, oil-in-water and water in oil emulsion, ointment and paste, lip care rod (lip protectioin stick) compositions or not have fat (grease-free) gel be suitable.Suitable Emulsion especially still contains oil/water coarse emulsion, oil/aqueous microemulsions or the oil/water/oil emulsion of the TiO 2 particles of the surface-coating that exists with discrete form, and wherein Emulsion can obtain by phase-inversion technologies, as described at DE-A-197 26 121.The habitual cosmetic supplement that can regard additive as is for example (to assist) emulsifying agent, fat and wax, stabilizing agent, thickening agent, biogenic effective ingredient, film former, aromatic, dyestuff, pearling agent, antiseptic, pigment, electrolyte (for example magnesium sulfate) and pH regulator agent.Operable stabilizing agent is the slaine of fatty acid, as magnesium stearate, aluminium stearate and/or zinc stearate.The biogenic effective ingredient is interpreted as and means for example plant extract, protolysate and compound vitamin.Habitual film former for example is a hydrocolloid, as chitosan, crystallite chitosan or quaternized chitosan, polyvinylpyrrolidone, vinylpyrrolidone/vinyl acetate copolymer, acrylic acid series polymeric compounds, quaternary ammonium type (quaternary) cellulose derivative and similar compound.

Suitable optical filtering effective ingredient is to absorb ultraviolet material in UV-B and the UV-A district.These materials are interpreted as and mean the Organic substance that can absorb ultraviolet and discharge absorbed energy with the long forms of radiation of wavelength (for example heat) once more.This Organic substance can be an oil-soluble or water miscible.Suitable ultraviolet filtering thing be for example wherein aryl can carry respectively that at least one is substituent 2,4,6-triaryl-1,3,5-triazine, wherein said substituent group preferably are selected from hydroxyl, alkoxyl, especially methoxyl group, alkoxy carbonyl group, especially methoxycarbonyl group and carbethoxyl group.Also suitable is the pigment of p-aminobenzoate, cinnamate, benzophenone, camphor derivatives and shielding of ultraviolet, as titanium dioxide, Talcum and zinc oxide.Be preferably based on the pigment of titanium dioxide especially.

Operable oil-soluble UV-B filtering medium is for example following material:

3-benzylidene camphor and derivant thereof, for example 3-(4-methyl benzal) Camphora;

The 4-aminobenzoic acid derivative, preferred 4-(dimethylamino) benzoic acid 2-Octyl Nitrite, 2-octyl group-4-(dimethylamino) benzoate and 4-(dimethylamino) amyl benzoate;

The ester of cinnamic acid, preferred 4-methoxy cinnamic acid 2-Octyl Nitrite, 4-methoxy cinnamic acid propyl ester, 4-methoxy cinnamic acid isopentyl ester, 4-methoxy cinnamic acid isopentyl ester, 2-cyano group-3-phenyl-cinnamic acid 2-Octyl Nitrite (2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite);

Salicylic ester, preferred salicylic acid 2-Octyl Nitrite, salicylic acid 4-isopropyl benzyl ester, salicylic acid height

Ester.

The derivant of benzophenone, preferred 2-hydroxyl-4-methoxy benzophenone, 2-hydroxyl-4-methoxyl group-4 '-methyldiphenyl ketone, 2,2 '-dihydroxy-4-methoxy benzophenone;

The ester of benzal malonic acid, preferred 2-ethylhexyl 4-methoxybenzyl phenyl malonic ester;

Pyrrolotriazine derivatives, as 2,4,6-triphen amido-(right-carbonyl-2 '-ethyl-1 '-hexyloxy)-1,3,5-triazines (octyl triazone) and dioctyl amide-based small triazinone (

HEB);

Propane-1, the 3-diketone is as 1-(4-2-methyl-2-phenylpropane base)-3-(4 '-anisyl) propane-1,3-diketone.

Suitable water-soluble substances is:

2-Phenylbenzimidazole-5-sulfonic acid and alkali metal thereof, alkaline-earth metal, ammonium, alkylammonium, alkanol ammonium and its salt of glucose ammonium;

The sulfonic acid of benzophenone, preferred 2-hydroxyl-4-methoxy benzophenone-5-sulfonic acid and salt thereof;

The sulfonic acid of 3-benzylidene camphor is as 4-(the inferior bornyl methyl of 2-oxo-3-) benzenesulfonic acid and 2-methyl-5-(the inferior bornyl of 2-oxo-3-) sulfonic acid and salt thereof.

Especially preferably use cinnamate, preferably 4-methoxy cinnamic acid 2-Octyl Nitrite, 4-methoxy cinnamic acid isopentyl ester, 2-cyano group-3-phenyl-cinnamic acid 2-Octyl Nitrite (2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite).

In addition, the preferred derivant of using benzophenone, especially 2-hydroxyl-4-methoxy benzophenone, 2-hydroxyl-4-methoxyl group-4 '-methyldiphenyl ketone, 2,2 '-dihydroxy-4-methoxy benzophenone, with preferred use propane-1,3-diketone such as 1-(4-2-methyl-2-phenylpropane base)-3-(4 '-anisyl) propane-1, the 3-diketone.

Suitable common UV-A filtering medium is:

The derivant of benzoyl methane, as 1-(4 '-2-methyl-2-phenylpropane base)-3-(4 '-anisyl) propane-1,3-diketone, the 4-tert-butyl group-4 '-methoxy dibenzoyl methylmethane or 1-phenyl-3-(4 '-isopropyl phenyl) propane-1, the 3-diketone;

The hydroxy amino substitutive derivative of benzophenone, as N, N-diethylamino-hydroxybenzoyl positive hexyl phenenyl formic acid esters.

UV-A and UV-B filtering medium can certainly mix use.

Other suitable UV medium provides in following table.

Table 5: suitable light protective agent

Except above-mentioned two groups of main photoprotection materials, also might use the antioxidation type secondary light protective agent of the photochemical reaction chain that destruction is triggered when the ultraviolet radiation transdermal.Its common example is a superoxide dismutase, catalase, tocopherol (vitamin E) and ascorbic acid (vitamin C).

Another class is to the skin injury caused counter-stimulus with antiinflammatory action of ultraviolet light, and this type of material is for example bisabolol, phytol and phytantriol.

Same according to the invention be to meet the present invention and/or the inorganic pigment of the effector molecule of the keratin-binding that institute's method produces according to the present invention and shielding of ultraviolet makes up and purposes in the skin cosmetic product.Be preferably based on the pigment of metal-oxide and/or other metallic compound, wherein said pigment does not dissolve in water or minimal amounts of dissolved and be selected from oxide (ZnO), the titanyl compound (TiO of zinc ₂), the oxide of ferrum (Fe for example ₂O ₃), the oxide (ZrO of zirconium ₂), the oxide (SiO of silicon ₂), the oxide (for example MnO) of manganese, the oxide (Al of aluminum ₂O ₃), the oxide of cerium (Ce for example ₂O ₃), the mixed oxide of respective metal and the mixture of this type oxide.

Inorganic pigment can exist with the form of peplos, promptly passes through surface treatment.This surface treatment can for example comprise described in DE-A-33 14 742 by known method itself provides pigment with meagre hydrophobic layer.

Suitable expellent effective ingredient be can force or drive away some biology especially insecticide away from people's chemical compound.These chemical compounds comprise for example 2-ethyl-1,3-hexanediol, N, a N-diethyl-toluamide etc.Stimulating the endermic suitable congested material of blood flow for example is quintessence oil, as Pinus mugo extract, Herba Lysimachiae foenum-graeci extract, Herba Rosmarini Officinalis extract, Juniperus oxycedrus seed extract, Aesculus hippocastanum extract, birch leaf extract, Radix Gentianae extract, ethyl acetate, Camphora, menthol, Oleum menthae, Eucalyptus wet goods.The material with cutin formation that suitable cutin decomposes for example is salicylic acid, thioglycolic acid calcium, thioglycolic acid and salt, sulfur etc.Suitable anti-dandruff effective ingredient for example is sulfur, sulfur Polyethylene Glycol dehydrating sorbitol monooleate, sulfur Semen Ricini alcohol polyethoxylate (sulfur ricinol polyethoxylate), Zinc Pyrithione, pyrithione aluminum etc.The suitable antibiotic medicine of clearing up skin irritation for example is allantoin, bisabolol, bisabolol, chamomile extract, pantothenylol etc.

But meet the present invention and/or meet the present invention equally according to the purposes of the combination of the effector molecule of the keratin-binding that the inventive method produced and at least a used for cosmetic or pharmaceutically acceptable polymer.

Suitable polymers for example is the cationic polymer with INCI title polyquaternary ammonium salt, vinyl pyrrolidone/N-vinyl imidazole quinoline salt copolymer (Luviquat FC for example, Luviquat HM, Luviquat MS, Luviquat Care), with the quaternised N-vinyl pyrrolidone/copolymer of dimethylaminoethyl methacrylate of dithyl sulfate (Luviquat PQ 11), the copolymer (Luviquat E Hold) of N-caprolactam/N-vinyl pyrrolidone/N-vinyl imidazole quinoline salt, cationic cellulose derivative (hydroxyethyl-cellulose/diallyldimethylammonium chloride copolymer and polyquaternary ammonium salt-10), acrylamide copolymer (polyquaternary ammonium salt-7) and chitosan.

Suitable cation (quaternized) polymer also is Merquat (based on the polymer of dimethyl diallyl ammonium chloride), Gafquat (reacting the quaternary ammonium type polymer that forms by polyvinylpyrrolidone and quaternary ammonium compound), polymer JR (hydroxyethyl-cellulose of band cation group) and plant base cationic polymer, melon ear polymer for example is as the Jaguar rank from Rhodia.

Other suitable polymers also is a neutral polymer, as copolymer, polysiloxanes, the Vinylcaprolactam homopolymer of polyvinylpyrrolidone, N-vinyl pyrrolidone and vinyl acetate and/or propionate with have other copolymer, polymine and salt thereof, polyvinylamine and salt thereof, cellulose derivative, polyaspartic acid salts and the derivant of N-vinyl pyrrolidone.These neutral polymers comprise for example Luviflex 0 Swing (polyvinyl acetate of partial hydrolysis and the copolymer of Polyethylene Glycol, BASF Aktiengesellschaft).

Suitable polymers also is nonionic, water solublity or water-dispersible polymers or oligomer, as Vinylcaprolactam homopolymer Luviskol 0 Plus (BASF) for example, or polyvinylpyrrolidone and copolymer thereof, especially with the copolymer of vinyl esters such as vinyl acetate, Luviskol 0 VA37 (BASF) for example, polyamide is for example based on the polyamide of itaconic acid and aliphatic diamine, for example described in the DE-A-4333 238.

Suitable polymers also is both sexes or amphoteric ion polymer, as at the following obtainable octyl acrylamide/methyl methacrylate/t-butylaminoethyl methacrylate-Hydroxypropyl methacrylate copolymer of title Amphomer (National Starch), and as be disclosed in amphoteric ion polymer among for example German patent application DE39 29 973, DE 21 50 557, DE 28 17 369 and the DE 3,708 451.Acrylamide propyl trimethyl ammonium chloride/acrylic or methacrylic acid copolymer and alkali metal salt thereof and ammonium salt are preferred amphoteric ion polymers.Other suitable amphoteric ion polymer is down can the commercial methylacryoyloxyethyl betanin/methacrylate copolymer that obtains at title Amersette (AMERCHOL), and hydroxyethyl methylacrylate, methyl methacrylate, methacrylic acid N, N-dimethylamino ethyl ester and acrylic acid copolymer (Jordapon (D)).

Suitable polymers also is nonionic, contain the water solublity or the water-dispersible polymers of siloxanes, and polyether silicone for example is as Tegopren (Goldschmidt) or Besi﹠amp; Commat (Wacker).

Same according to the invention be to meet the present invention and/or according to the purposes of the combination of the effector molecule of the keratin-binding that the inventive method produced and skin cosmetic effective ingredient (one or more chemical compounds), wherein said skin cosmetic effective ingredient advantageously is selected from aspirin, atropine, azulenes, hydrocortisone and derivant thereof for example hydrocortisone-17-valerate, B and D vitamin, especially vitamin B ₁, vitamin B ₁₂Vitamin D, vitamin A or derivatives thereof such as retinyl palmitate, vitamin E or derivatives thereof such as tocopherol acetate, vitamin C and its derivant such as ascorbic acid glucoside, and niacin amide, pantothenylol, bisabolol, topical anesthetic cream, unsaturated fatty acid such as essential fatty acid (being called vitaminF usually), especially gamma-Linolenic acid, oleic acid, eicosapentaenoic acid, docosahexenoic acid and derivant thereof, chloromycetin, caffeine, prostaglandin, thymol, Camphora, Squalene, plant or zoogenous extract or other product, Radix Oenotherae erythrosepalae oil for example, borage (borage) oil or Ceratonia siliqua Oleum Glycines, fish oil, cod liver oil or ceramide and class ceramide chemical compound, the incense extract, green tea extract, narcissus (water lily) extract, Radix Glycyrrhizae (licorice) extract, Radix Hamamelidis Mollis (hamamelis), anti-dandruff effective ingredient (selenium sulfide for example, Zinc Pyrithione, piroctone olamine, climbazole, octopirox (octopirox), polidocanol (polydocanol) and its combination), compound effective ingredient, as gamma oryzanol and calcium salt such as calcium pantothenate, calcium chloride, the compound effective ingredient of calcium acetate.Select also advantageously from other effective ingredient of stuffing material type again, for example sad 16/octadecane ester (purcellin oil),

With

Effective ingredient or effective ingredient class also particularly advantageously are selected from the synthetic mortifier of NO, especially when goods of the present invention will be used for the treatment of and prevent the symptom of inherency and/or exogen skin aging and be used for the treatment of with anti-ultraviolet radiation in advance the illeffects of skin and hair.The synthetic mortifier of preferred NO is the nitro arginine.Effective ingredient or effective ingredient class also advantageously are selected from catechin and catechin bile acid ester and from plant with catechin or catechin bile acid ester composition or plant part such as Theaceae (Theaceae) plant, the water extract or the organic extract that are especially extracted the leaf of tea (Camellia sinensis).Their common composition (for example polyphenol or catechin, caffeine, vitamin, sugar, mineral, aminoacid, lipid) is particularly advantageous.Catechin be be interpreted as one group of chemical compound of hydrogenation flavone or anthocyanidin and representative " catechin " derivant (catechol, 3,3 ', 4 ', 5,7-flavane pentol, 2-(3, the 4-dihydroxy phenyl) benzodihydropyran-3,5,7-triol).Epicatechin ((2R, 3R)-3,3 ', 4 ', 5,7-flavane pentol) be the effective ingredient that helps the object of the invention.The plant extract that contains catechin component also advantageously, especially extract from green tea, as the extract that extracts from the leaf of following plant: Flos Camelliae Japonicae (Camellia spec.), the utmost point be the cenospecies of the remote tea (C.inawadiensis) in Folium Camelliae sinensis type tea (tea type Camellia sinensis), Folium camelliae assamicae (C.assamica), Dali tea (C.taliensis) and Yunnan and these species and for example Flos Camelliae Japonicae (Camellia japonica) in particular.Preferred effective ingredient also is polyphenol and the catechin from (-)-catechin, (+)-catechin, (-)-catechin and gallate, (-)-nutgall catechin gallic acid ester, (+)-epicatechin, (-)-epicatechin, (-)-L-Epicatechin gallate, (-)-epigallo catechin, (-)-epigallocatechin gallate (EGCG).

Flavone and derivant thereof (also often being referred to as " flavone ") are the effective ingredient that helps the object of the invention.They are characterised in that following basic structure (providing the position of substitution):

Some prior flavone that also can be preferably used in the goods of the present invention are listed in the table below 6.

Table 6: flavone

Flavone exists with the glycosylation form at occurring in nature usually.

According to the present invention, flavonoid preferably is selected from the material with following general formula

Z wherein ₁To Z ₇Be selected from H, OH, alkoxyl and hydroxy alkoxy base independently of each other, wherein alkoxyl or hydroxy alkoxy base can be side chain or straight chain and have 1-18 carbon atom, and wherein Gly is selected from monoglycosides and oligosaccharide glycosides group.

In addition, effective ingredient (one or more chemical compounds) also can be selected from the hydrophilic effective ingredient highly beneficially, especially from following group:

'alpha '-hydroxy acids is as lactic acid or salicylic acid or its salt, as sodium lactate, calcium lactate, TEA lactate, urea, allantoin, serine, Sorbitol, glycerol, lactoprotein, pantothenylol, chitosan.

The amount of this effective constituents (one or more chemical compounds) in goods of the present invention particularly preferably is 0.05-20 weight %, especially 1-10 weight % based on the gross weight of these goods 0.001-30 weight % preferably.Described effective ingredient and other effective ingredient that can use in goods of the present invention provide on the 12-17 page or leaf in DE 103 18 526 A1, and the full content of the document is in this in addition reference.

In addition, the present invention relates to the above goods of mentioning and be used to prevent undesired skin appearance Change Example such as acne or greasy skin, keratosis, rosacea, photosensitivity, inflammatory, erythema, anaphylaxis or autoimmune response reaction.

With regard to use, cosmetic product of the present invention is to be applied to skin, hair, fingernail or toenail for cosmetics or the habitual mode of cosmetics for skin.

The present invention also provides such cosmetics for skin, and it comprises one of effect protein of above-mentioned keratin-binding, especially is selected from preferably that enzyme, antibody, effector are conjugated protein, fluorescin, antimicrobial peptide and the effect protein of the keratin-binding of assembly protein automatically.Especially preferably comprise the cosmetics for skin of the effector molecule of keratin-binding as described in example 3 above.

The cosmetics for skin that most preferably comprises the effect protein of keratin-binding like this, the effect protein of wherein said keratin-binding comprises the No:2 according to SEQ ID, 4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164 or 166, preferably at SEQ ID No:2,4,6,8,10,12,14,40,42,44,46,48,146,150,153,156,157,158,160,162,164,166, the polypeptide of at least a keratin-binding of sequence shown in 213 or 215 (ii), and the effect polypeptide (ii) is a fibroin, preferably at sequence SEQ ID No:151,201,202,203,204,205,206,207,208, one of silk protein in 209 or 210, C16 spider silk fibroin especially preferably, wherein said C16 spider silk fibroin are that 16 times from the C-structure body (module) of the a-protein DF4 of cross epeira repeat.

In a preferred embodiment of the invention, based on the gross weight of compositions, cosmetics for skin, the nursing of preferred skin matter and hair quality care composition with 0.001-1 weight %, preferred 0.01-0.9 weight %, preferred especially 0.01-0.8 weight % or 0.01-0.7 weight %, very particularly preferably 0.01-0.6 weight % or 0.01-0.5 weight %, most preferably the concentration of 0.01-0.4 weight % or 0.01-0.3 weight % comprises the effect protein of keratin-binding of the present invention.In another embodiment, based on the gross weight of compositions, said composition comprises the effect protein of keratin-binding of the present invention with the concentration of 1-10 weight %, preferred 2-8 weight %, 3-7 weight %, 4-6 weight %.In same embodiment preferred, based on the gross weight of compositions, said composition comprises the effect protein of keratin-binding of the present invention with the concentration of 10-20 weight %, preferred 11-19 weight %, 12-18 weight %, 13-17 weight %, 14-16 weight %.In still another preferred embodiment, based on the gross weight of compositions, said composition comprises the effect protein of keratin-binding of the present invention with the concentration of 20-30 weight %, preferred 21-29 weight %, 22-28 weight %, 23-27 weight %, 24-26 weight %.

Compositions of the present invention is skin protection composition, skin care compositions and methods, skin cleansing compositions, hair protection compositions, hair care composition, hair Cleasing compositions, hair dye, collutory and mouthwass or be used for the goods of decorative cosmetic product having preferably; according to the use field, it preferably uses with ointment, ointment, Emulsion, suspensoid, washing liquid, breast, paste, gel, foam or spray form.

Except the effect protein of keratin-binding, cosmetics for skin of the present invention can comprise above listed whole polymer, pigment, wetting agent, oil, wax, enzyme, mineral, vitamin, sunscreen, dyestuff, aromatic, antioxidant, antiseptic and/or effective medicinal components.

In addition, below be applicable to cosmetics for skin of the present invention:

The preparation base material of the present composition preferably comprises cosmetics or cosmetics for skin can be used/pharmaceutically useful auxiliary agent.Pharmaceutically useful auxiliary agent is to become known for pharmacy, the auxiliary agent in food technology field and the association area, those auxiliary agents of in relevant pharmacopeia (for example DAB Ph.Eur.BP NF), listing with and characteristic do not get rid of other auxiliary agent that the physiology uses.

Proper auxiliary agent can be a fluidizer, wetting agent, emulsifying and suspending agent, antiseptic, antioxidant, counter-stimulus, chelating agen, emulsion stabilizer, film former, gellant, odor masking agent, resin, hydrocolloid, solvent, solubilizing agent, nertralizer, the infiltration accelerator, pigment, quaternary ammonium compound, fatting agent and superfatting agent, ointment, ointment or oil preparation substrate thing, silicone derivative, stabilizing agent, disinfectant, propellant, desiccant, opacifier, thickening agent, wax, softening agent, white oil.An embodiment in this regard is based on expertise, as at for example Fiedler, H.P.Lexikon derHilfsstoffe f ü r Pharmazie, Kosmetik und angrenzende Gebiete[Lexicon ofauxiliariss for pharmacy, cosmetics und related fields], the 4th edition, Aulendorf:ECV-Editio-Kantor-Verlag is shown in 1996.

For producing cutization composition for cosmetics of the present invention, effective ingredient can mix with suitable auxiliary agents (excipient) or dilute with it.Excipient can be solid, semisolid or the fluent material that can play media, carrier or medium effect as effective ingredient.As required, sneaking in the manner known to persons skilled in the art of other auxiliary agent carried out.In addition, polymer and dispersion are suitable for the auxiliary agent in the pharmacy, preferably as or at the auxiliary agent of coated composition that is used for solid drug forms or binding agent.They also can use in ointment and as tablet peplos and tablet binder.

According to another embodiment preferred, compositions of the present invention is cosmetic compositions, first care composition that is used to nurse and protect skin and hair or the goods that are used for decorative cosmetic product having.

Suitable skin cosmetic compositions for example is cosmetic water, facial film, deodorizer and other cosmetic washing liquid.The compositions that is used for decorative cosmetic product having comprises and for example hides flaw pen, stage cosmetics, mascara and eye shadow, lip pomade, eyelet writing brush, eyeliner, rouge, end powder and eyebrow pencil.

In addition, meet the present invention and/or according to the effector molecule of the keratin-binding that the inventive method produced the nose joint strip that is used for the pore cleaning, behind anti-pox compositions, expellent, Shave composition, shave back and shave preceding care composition, sun tan care composition, remove hair compositions, hair dye, pudendum care composition, footcare compositions and in Baby Care, use.

Skin care compositions and methods of the present invention is water/oil or oil/water protective skin cream, day cream and late frost, eye cream, facial cream, anti-wrinkle cream, suntan lotion, moisturiser, bleaching frost, automatic tanned cream, vitamin cream, skin lotion, nursing washing liquid and the washing liquid of preserving moisture especially.

Except meeting the present invention and/or effector molecule according to the keratin-binding that the inventive method produced; skin cosmetic of the present invention and dermatological also can comprise such effective ingredient with compositions, and it decomposes free radical as the protection to antioxidation process and relevant ageing process or skin and/or hair damages.The material that these effective ingredient are preferably described in patent application WO/0207698 and WO/03059312, quote reference especially in addition in its content literary composition, preferably wherein saidly can reduce peroxide or hydrogen peroxide do not form free radical subsequently to produce correspondent alcohol boron-containing compound.In addition, can be used for this purpose according to the sterically hindered amines of general formula 3,

Formula 3

Wherein group z has following meanings: H, C ₁-C ₂₂Alkyl, preferred C ₁-C ₁₂Alkyl such as methyl, ethyl, propyl group, isopropyl, butyl, isobutyl group, sec-butyl, the tert-butyl group, amyl group, isopentyl, neopentyl, tertiary pentyl, hexyl, heptyl, octyl group, nonyl, decyl, undecyl, dodecyl; C ₁-C ₂₂-alkoxyl, preferred C ₁-C ₁₂Alkoxyl such as alkoxyl-methyl, alkoxyl oxygen alkyl ethyl, alkoxyl propyl, alcoxyl isopropyl, alcoxyl butyl, alcoxyl isobutyl group, alcoxyl sec-butyl, the alcoxyl tert-butyl group, alcoxyl amyl group, alcoxyl isopentyl, alcoxyl neopentyl, alcoxyl tertiary pentyl, alcoxyl hexyl, alcoxyl heptyl, alcoxyl octyl group, alcoxyl nonyl, alcoxyl decyl, alcoxyl undecyl, alcoxyl dodecyl; Wherein phenyl group can be by C ₁-C ₄The C that alkyl group replaces ₆-C ₁₀Aryl such as phenyl and naphthyl can be by C ₁-C ₂₂Alkyl or C ₁-C ₂₂Alkoxyl, preferably by C as mentioned above ₁-C ₁₂Alkyl or C ₁-C ₁₂The C that alkoxyl replaces ₆-C ₁₀-O aryl, and

Radicals R ¹-R ⁶Have following meanings: H, OH, O, C independently of each other ₁-C ₂₂Alkyl, preferred C ₁-C ₁₂Alkyl such as methyl, ethyl, propyl group, isopropyl, butyl, isobutyl group, sec-butyl, the tert-butyl group, amyl group, isopentyl, neopentyl, tertiary pentyl, hexyl, heptyl, octyl group, nonyl, decyl, undecyl, dodecyl; C ₁-C ₂₂-alkoxyl, preferred C ₁-C ₁₂-alkoxyl such as alkoxyl-methyl, alkoxyl oxygen alkyl ethyl, alkoxyl propyl, alcoxyl isopropyl, alcoxyl butyl, alcoxyl isobutyl group, alcoxyl sec-butyl, the alcoxyl tert-butyl group, alcoxyl amyl group, alcoxyl isopentyl, alcoxyl neopentyl, alcoxyl tertiary pentyl, alcoxyl hexyl, alcoxyl heptyl, alcoxyl octyl group, alcoxyl nonyl, alcoxyl decyl, alcoxyl undecyl, alcoxyl dodecyl; Wherein phenyl group can be by C ₁-C ₄The C that alkyl group replaces ₆-C ₁₀Aryl such as phenyl and naphthyl can be by C ₁-C ₂₂Alkyl or C ₁-C ₂₂Alkoxyl, preferably by C as mentioned above ₁-C ₁₂Alkyl or C ₁-C ₁₂The C that alkoxyl replaces ₆-C ₁₀-O aryl.

Be preferably based on the gross weight of compositions especially, with 0.001-1 weight %, preferred 0.01-0.1 weight %, 0.1-1 the amount usage space bulky amine of weight %: 3-dodecyl-N-(2,2,6,6-tetramethyl-4-piperidyl) butanimide, 3-dodecyl-N-(1,2,2,6,6-pentamethyl-4-piperidyl) butanimide, 3-octyl group-N-(2,2,6,6-tetramethyl-4-piperidyl) butanimide, 3-octyl group-N-(1,2,2,6,6-pentamethyl-4-piperidyl) butanimide, 3-octenyl-N-(2,2,6,6-tetramethyl-4-piperidyl) butanimide, 3-octenyl-N-(1,2,2,6,6-pentamethyl-4-piperidyl) butanimide and/or Uvinul

5050H.

Except above-mentioned The compounds of this invention and suitable carrier, the skin cosmetic product also can comprise other effective ingredient and auxiliary agent commonly used in the cosmetics for skin as mentioned above.They preferably include emulsifying agent, antiseptic, aromatic oil, cosmetic effective ingredient, as phytantriol, vitamin A, E and C, retinol, bisabolol, pantothenylol, light protective agent, bleach, coloring agent, toner, tanning agent, collagen, protolysate, stabilizing agent, pH regulator agent, dyestuff, salt, thickening agent, gellant, denseness instrumentality, siloxanes, wetting agent, fatting agent and/or other typical additives.

The preferred oil ﹠ fat component of skin cosmetic and skin cosmetic compositions is above-mentioned mineral oil and artificial oil; as paraffin, silicone oil with have aliphatic hydrocarbon, animal oil and vegetable oil more than 8 carbon atoms; as sunflower oil, Oleum Cocois, American Avocado Tree oil, olive oil, lanoline or wax, fatty acid, fatty acid ester; triglyceride, wax ester as the C6-C30 fatty acid; as Jojoba oil, aliphatic alcohol, vaseline, hydrogenated lanolin and acetylated lanolin, and composition thereof.

For setting up some characteristic, as improve combining of sense of touch, extensibility, water proofing property and/or effective ingredient and auxiliary agent such as pigment, skin cosmetic and skin cosmetic product can also comprise the conditioning material based on silicone compounds extraly.

Suitable silicone compounds for example is poly-alkylsiloxane, poly-aryl siloxanes, poly-aralkyl siloxanes, polyether silicone or silicone resin.

Cosmetic or skin cosmetic product produce by common method well known by persons skilled in the art.

Preferably, cosmetic and cutization composition for cosmetics exist with the Emulsion form, especially as Water-In-Oil (water/oil) or oil-in-water (oil/water) Emulsion.

Yet, also might select the preparation of other types, example gel agent, oil preparation, oleogel agent, multiple Emulsion for example are in forms such as water/oil/water or oil/water/oil emulsion, anhydrous ointment or ointment base.Emulsifier-free preparation such as aqueous dispersion, hydrogel or pik woods Emulsion also are advantageous embodiment.

Emulsion produces by known method.Except the effector molecule of at least a keratin-binding, Emulsion comprises habitual component usually in the presence of water, as aliphatic alcohol, fatty acid ester and especially fatty acid triglyceride, fatty acid, lanoline and derivant thereof, natural or synthetic oil or wax and emulsifying agent.Selection is at the additive of Emulsion type specific and produce suitable Emulsion for example at Schrader, the key element and the preparation of Grundlagen und Rezepturen der Kosmetika[cosmetics], H ü thigBuch Verlag, Heidelberg, second edition, 1989, third part or Umbach, Kosmetik:Entwicklung, Herstellung und Anwendung kosmetischer Mittel[cosmetics: the exploitation of cosmetic compositions, make and use], the second edition of augmentation, 1995, Georg ThiemeVerlag, ISBN 3 13 712,602 9, described document thereby reference are especially in addition described among the 122nd page of ff..

The suitable Emulsion that is in water/oil emulsion form that for example is used for protective skin cream etc. comprises usually by utilizing the suitable emulsifying agent system to be emulsifiable in oil phase or fat water mutually.Compound polyelectrolyte can be used to provide this water.

The preferred fat component that can exist in mutually at the fat of Emulsion is: hydrocarbon ils, as paraffin oil, sad 16/octadecane ester (purcellin oil), perhydro Squalene and the microwax solution in these oil; Animal oil or vegetable oil, as Semen pruni armeniacae oil, American Avocado Tree oil, Radix Calophylli inophylli oil, lanoline and derivant thereof, Oleum Ricini, Oleum sesami, olive oil, Jojoba oil, candlenut oil, breast sour jujube Channa argus (hoplostethus) oil, its distillation starting point under atmospheric pressure is in about 250 ℃ and its distillation end point and is in 410 ℃ mineral oil, as vaseline oil, the ester of saturated or unsaturated fatty acid, as myristic acid Arrcostab, for example isopropyl myristate, butyl myristate or cetyl myristate, cetyl stearic, ethyl palmitate or isopropyl ester, sad or tricaprin and ricinoleic acid cetyl.

Fat also can comprise silicone oil such as dimethyl polysiloxane, methyl phenyl silicone and siloxane glycol copolymer, fatty acid and the aliphatic alcohol that dissolves in other oil mutually.

Except above-claimed cpd of the present invention, skin care compositions and methods also can comprise wax, as Brazil wax, candelilla wax, Cera Flava, microwax, ceresine and oleic acid, myristic acid, linoleic acid and stearic Ca, Mg and Al salt.

In addition, Emulsion of the present invention can be in the form of oil/aqueous emulsion.This Emulsion comprises oil phase usually, makes oil phase be stable at the emulsifying agent of aqueous phase and the water that exists with the thickening form usually.Suitable emulsifying agent is oil/water emulsifier preferably, as the glyceride of polyglycerin ester, polysorbate or partial esterification.

According to another embodiment preferred, compositions of the present invention is photoprotection compositions, shower gels, shampoo preparation or bathing goods, special preferred light protective article.

This type of preparation comprises at least a the present invention of meeting and/or according to the effector molecule of the keratin-binding that the inventive method produced with as the common anion surfactant of basic surface activating agent and as the both sexes and/or the nonionic surfactant of cosurfactant.Effective ingredient that other is suitable and/or auxiliary agent are selected from lipid, aromatic oil, dyestuff, organic acid, antiseptic and antioxidant and thickening agent/gellant, skin conditioning agent and wetting agent usually.

Based on the total formulation weight amount, these preparations advantageously comprise the surfactant of 2-50 weight %, preferred 5-40 weight %, preferred especially 8-30 weight %.

In washing, shower and bathing goods, can use custom is used in clean body compositions whole anionic properties, neutrality, both sexes or cationic surfactant.

Suitable anion surfactant for example is alkyl sulfate, alkyl ether sulfate, alkylsulfonate, alkylaryl sulfonate, alkyl succinate, alkyl sulfosuccinate, N-alkyl sarcosine salt, acyl group Calculus Bovis hydrochlorate, acyl-hydroxyethyl sulfonate, alkylphosphonic, alkyl ether phosphate, alkyl ether carbonate, alpha-alefinically sulfonate; especially alkali metal salt and alkali salt, for example sodium, potassium, magnesium, calcium, ammonium and triethanolamine salt.Alkyl ether sulfate, alkyl ether phosphate and alkyl ether carbonate can have 1-10 oxirane or expoxy propane unit, preferred 1-3 ethylene oxide unit(s) in molecule.

These comprise for example sodium lauryl sulphate, ammonium lauryl sulfate, sodium laureth sulfate, Zetesol AP, sodium lauryl sarcosinate, succinic acid grease sodium, succinic acid lauryl ichthyodin, dodecylbenzene sodium sulfonate, DBSA triethanolamine.

Suitable amphoteric surfactant for example is alkyl betaine, alkylamide propyl-betaine, alkyl sulfobetaines, alkyl glycinate hydrochloride, carboxyamino alkyl acetate, both sexes alkyl acetate or both sexes alkyl propionates, both sexes oxalic acid Arrcostab or both sexes dipropionic acid Arrcostab.

For example, can use cocos nucifera oil acyl dimethyl methyl CAB, lauryl betaine, cocoamidopropyl or N-cocamidopropyl ethyl-N-hydroxyethyl alanine sodium (sodiumcocamphopropionate).

Suitable non-ionic surface active agent for example is to be the product of the aliphatic alcohol that has 6-20 carbon atom in alkyl chain or alkylphenol and the oxirane and/or the expoxy propane of straight or branched.The amount of alkylene oxide is the about 6-60mol of every mol of alcohol.In addition, alkyl amine oxide, list-or fatty acid ester, ethoxylated fatty acid amide, APG or the anhydrosorbitol ether-ether of two alkyl chain triacontanol amide, Polyethylene Glycol be suitable.

In addition, washing, shower and bathing goods can comprise habitual cationic surfactant, as quaternary ammonium compound, and cetyl trimethyl ammonium chloride for example.

In addition, shower gels/shampoo preparation can comprise thickening agent, as sodium chloride, PEG-55, propylene glycol oleate, PEG-120 methyl glucose dioleate and other, and also has antiseptic, other effective ingredient and auxiliary agent and water.

The hair treatment compositions

According to another embodiment preferred, cosmetics for skin of the present invention is the hair treatment compositions.

Preferably, hair treatment of the present invention with the form of compositions be typing foam, hair mousse, hair jelly, shampoo, hair spray, hair foam, end liquid (end fluid), nertralizer, hair dye and bleach or the deep fat treatment of the wave that is used to finalize the design.According to the use field, the hair cosmetic product can be used as (aerosol) spray, (aerosol) foam, gel, gel spray, ointment, washing liquid or pomade (wax) and uses.Hair spray comprises aerosol spray and in this article not with the pump formula spray (pump sprays) of impelling gas.The hair foam comprises aerosol foam and not with the pump formula foam (pump foam) of impelling gas.Hair spray and hair foam preferably include main or complete water solublity or the dispersible component of water.When the chemical compound that uses in hair spray of the present invention and hair foam can disperse in water, they can be used in the aqueous differential prose style free from parallelism form that has 1-350nm, preferred 1-250nm particle diameter usually.The normally about in this article 0.5-20 weight % of the solid content of these goods.These differential prose style free from parallelisms do not need emulsifying agent or surfactant to be used for stabilisation usually.

Other component will be interpreted as and mean additive habitual in the cosmetics that for example propellant, defoamer, interfacial activity chemical compound are surfactant, emulsifying agent, foaming agent and solubilizing agent.Used interfacial activity chemical compound can be anion, cation, both sexes or neutral.Other habitual component also can for example be antiseptic, aromatic oil, opacifier, effective ingredient, ultraviolet filtering thing, care substance such as pantothenylol, collagen, vitamin, protolysate, α-and beta-hydroxycarboxylic acids, stabilizing agent, pH regulator agent, dyestuff, viscosity adjustment thing, gellant, salt, wetting agent, fatting agent, chelating agent and other typical additives.

If want to set up extremely special characteristic, also comprise known all styling polymers and the conditioning polymer that can be used in combination in the cosmetics here with the effector molecule of keratin-binding of the present invention.

Suitable conventional hair cosmetic polymer for example is above-mentioned cation, anion, neutrality, nonionic and the amphiphilic polymers of reference in addition in this article.

For setting up certain specific character, goods can also comprise the conditioning material based on silicone compounds extraly.Suitable silicone compounds for example is poly-alkylsiloxane, poly-aryl siloxanes, poly-aralkyl siloxanes, polyether silicone, silicone resin or dimethicone copolyol (CTFA) and amino-functional silicone chemical compound, as amino-terminated polydimethylsiloxane (CTFA).

Propellant is the propellant that habituation is used for hair spray or aerosol foam.Preferably propane/butane, pentane, dimethyl ether, 1,1-Difluoroethane (HFC-152a), carbon dioxide, nitrogen or compressed-air actuated mixture.

Operable emulsifying agent is the habitual whole emulsifying agents that use in the hair foam.Suitable emulsifying agent can be nonionic, cationic or anionic property or amphoteric.The example of nonionic emulsifier (INCI name) is a laureth, for example lauryl polyoxyethylene (4) ether; Ceteth; for example cetyl polyoxyethylene (1) ether, Polyethylene Glycol cetyl ether, 16/octadecyl polyoxyethylene ether, for example 16/octadecyl polyoxyethylene (25) ether, polyethylene glycol fatty acid glyceride, hydroxylated lecithin, the lactyl ester of fatty acid, APG.

The example of cationic emulsifier is that hexadecyldimethyl benzyl ammonium-2-ethoxy Ammonium biphosphate, hexadecyltrimethylammonium chloride, cetyl trimethyl ammonium bromide, cocoyl trimethyl sulphuric acid dimethylammonium, quaternary ammonium salt (Quaternium)-1 are to x (INCI).

Anion emulsifier can be selected from for example alkyl sulfate, alkyl ether sulfate, alkylsulfonate, alkylaryl sulfonate, alkyl succinate, alkyl sulfosuccinate, N-alkyl sarcosine salt, acyl group Calculus Bovis hydrochlorate, acyl-hydroxyethyl sulfonate, alkylphosphonic, alkyl ether phosphate, alkyl ether carbonate, alpha-alefinically sulfonic acid; especially alkali metal salt and alkali salt, for example sodium, potassium, magnesium, calcium, ammonium and triethanolamine salt.Alkyl ether sulfate, alkyl ether phosphate and alkyl ether carbonate can have 1-10 oxirane or expoxy propane unit, preferred 1-3 ethylene oxide unit(s) in molecule.

Operable gellant is whole gellant habitual in the cosmetics.These comprise for example carbomer (INCI) of lightly crosslinked polyacrylic acid, cellulose derivative is hydroxypropyl cellulose for example, hydroxyethyl-cellulose, cation-modified cellulose, polysaccharide, for example Xanthan gum, glycerol three (caprylic/capric) ester, sodium acrylate copolymer, polyquaternium-32 (with) vaseline (INCI), sodium acrylate copolymer (with) vaseline (with) PPG-1 tridecyl polyoxyethylene (6) ether, acrylamide propyl trimethyl ammonium chloride/acrylamide copolymer, stearyl polyoxyethylene (10) ether allyl ether, acrylate copolymer, polyquaternary ammonium salt-37 (with) vaseline (with) PPG-1 tridecyl polyoxyethylene (6) ether, polyquaternary ammonium salt 37 (with) propylene glycol two sad/dicaprates (with) PPG-1 tridecyl polyoxyethylene (6) ether, polyquaternary ammonium salt-7, polyquaternary ammonium salt-44.

In the shampoo preparation, can use habitual whole aniones, neutrality, both sexes or the cationic surfactant that uses in shampoo.

Suitable anion surfactant for example is alkyl sulfate, alkyl ether sulfate, alkylsulfonate, alkylaryl sulfonate, alkyl succinate; alkyl sulfosuccinate, N-alkyl sarcosine salt, acyl group Calculus Bovis hydrochlorate, acyl-hydroxyethyl sulfonate, alkylphosphonic, alkyl ether phosphate, alkyl ether carbonate, alpha-alefinically sulphonic acid ester; especially alkali metal salt and alkali salt, for example sodium, potassium, magnesium, calcium, ammonium and triethanolamine salt.Alkyl ether sulfate, alkyl ether phosphate and alkyl ether carbonate can have 1-10 oxirane or expoxy propane unit, preferred 1-3 ethylene oxide unit(s) in molecule.

What be fit to is for example sodium lauryl sulphate, ammonium lauryl sulfate, sodium laureth sulfate, Zetesol AP, sodium lauryl sarcosinate, succinic acid grease sodium, succinic acid lauryl ichthyodin, dodecylbenzene sodium sulfonate, DBSA triethanolamine.

Suitable non-ionic surface active agent for example is to be the product of the aliphatic alcohol that has 6-20 carbon atom in alkyl chain or alkylphenol and the oxirane and/or the expoxy propane of straight or branched.The amount of alkylene oxide is the about 6-60mol of every mol of alcohol.In addition, alkyl amine oxide, list-or fatty acid ester, APG or the anhydrosorbitol ether-ether of two alkyl chain triacontanol amide, Polyethylene Glycol be suitable.

In addition, the shampoo preparation can comprise habitual cationic surfactant, as quaternary ammonium compound, and cetyl trimethyl ammonium chloride for example.

In the shampoo preparation, for realizing certain effect, habitual conditioner can be used in combination with the effector molecule of keratin-binding of the present invention.

More than for example comprising, these mention cationic polymer with INCI title polyquaternary ammonium salt, especially copolymer (the Luviquat FC of vinyl pyrrolidone/N-vinyl imidazole quinoline salt, LuviquatHM, Luviquat MS, Luviquat Care), copolymer (Luviquat D PQ 11) with the quaternised N-vinyl pyrrolidone/dimethylaminoethyl methacrylate of dithyl sulfate, the copolymer (Luviquat DHold) of N-caprolactam/N-vinyl pyrrolidone/N-vinyl imidazole quinoline salt, cationic cellulose derivative (hydroxyethyl-cellulose/diallyldimethylammonium chloride copolymer and polyquaternary ammonium salt-10), acrylamide copolymer (polyquaternary ammonium salt-7).In addition, can use protolysate, also have conditioning material, for example poly-alkylsiloxane, poly-aryl siloxanes, poly-aralkyl siloxanes, polyether silicone or silicone resin based on silicone compounds.Other suitable silicone compounds is dimethicone copolyol (CTFA) and amino functional silicone compounds, as amino-terminated polydimethylsiloxane (CTFA).In addition, can use the cationic guar gum derivant, as Rhaball Gum CG-M 8M (INCI).

According to another embodiment; effect and its form that this hair cosmetic or skin cosmetic product play nursing and protection skin or hair are Emulsion, dispersion, suspensoid, water quality surface activity goods, and breast, washing liquid, ointment, face cream, ointment, gel, granule, powder, rod-shaped products (stick preparation) are as lip pomade, foam, aerosol or spray.This type of preparation is very to be suitable for the part goods.Suitable Emulsion is oil in water emulsion and water in oil emulsion or micro emulsion.

In principle, hair cosmetic or skin cosmetic product are used to be applied to skin (part) or hair.Local here be interpreted as to mean with goods be suitable for FINE DISTRIBUTION and preferably using the goods of effective ingredient to the skin by the form of skin absorbs.What be suitable for this purpose for example is aqueous solution and water-alcohol solution, spray, foam, foamed aerosol, ointment, hydrogel, oil/water or water/oil type Emulsion, micro emulsion or cosmetic rod-shaped products.

According to the preferred embodiment of cosmetic compositions of the present invention, said composition comprises carrier.Preferred carrier is water, gas, the liquid based on water, oil, gel, emulsion or micro emulsion, dispersion or its mixture.Described carrier performance advantages of good skin compatibility, particularly advantageous with goods to the part is hydrogel, emulsion or micro emulsion.

Operable emulsifying agent is non-ionic surface active agent, zwitterionic surfactant, amphoteric surfactant or anion emulsifier.Emulsifying agent can exist in compositions of the present invention based on the amount of compositions with 0.1-10 weight %, preferred 1-5 weight %.

Used non-ionic surface active agent can for example be from the surfactant in following at least one group:

2-30 moles of ethylene oxide and/or 0-5 mole expoxy propane and straight-chain fatty alcohol with 8-22 carbon atom, and have 12-22 carbon atom fatty acid and with alkyl in have the addition compound product of the alkylphenol of 8-15 carbon atom;

The C of the oxirane of 1-30 mole and the addition compound product of glycerol _12/18-fatty-acid monoester and diester; Have the monoglyceride of saturated and unsaturated fatty acid of 6-22 carbon atom and diester and sorbitan monoesters and diester with and oxirane additive product; In alkyl group, have the alkyl monoglycosides of 8-22 carbon atom and oligosaccharide glycosides with and the ethoxylation analog; The addition compound product of the oxirane of 15-60 mole and Oleum Ricini and/or castor oil hydrogenated; Polyol and polyglycerin ester especially are as polyglycerol polyricinoleate, the poly-12-hydroxy stearic acid ester of polyglycereol or polyglycereol dimerized linoleic acid ester.Same suitable be mixture from the chemical compound in two or more sets of these material groups;

The addition compound product of the oxirane of 2-15 mole and Oleum Ricini and/or castor oil hydrogenated;

Based on straight chain, side chain, unsaturated or saturated C _6/22The partial ester of fatty acid, castor oil acid and 12-hydroxystearic acid and glycerol, polyglycereol, tetramethylolmethane, dipentaerythritol, sugar alcohol (for example Sorbitol), alkyl androstanediol (for example methyl glucosamine, butyl glucoside, lauryl glucoside) and poly glucoside (for example cellulose); Single-, two-and trialkyl phosphates and single-, two-and/or three-PEG alkyl phosphate and salt thereof;

Wool wax alcohol;

Polysiloxanes-poly-alkyl, polyether copolymer and corresponding derivant;

As the mixed ester of tetramethylolmethane, fatty acid, citric acid and aliphatic alcohol in the German patent specification 1165574 and/or have fatty acid, methyl glucoside and polyol, preferably glycerine or the polyglycereol of 6-22 carbon atom and the mixed ester of ployalkylene glycol.

In addition, can use zwitterionic surfactant as emulsifying agent.Zwitterionic surfactant is to be used to refer to the term that carries at least one quaternary ammonium group and at least one carboxyl or sulfonic those chemical compounds in molecule.Specially suitable zwitterionic surfactant is so-called betanin, as N-alkyl-N, and N-dimethylglycine ammonium, for example cocos nucifera oil alkyl dimethyl glycine ammonium; N-amidopropyl-N; N-dimethylglycine ammonium; for example cocamidopropyl propyl-dimethyl glycine ammonium and in alkyl or acyl group, have the 2-alkyl-3-carboxymethyl-3-hydroxyethyl imidazole quinoline of 8-18 carbon atom respectively, and cocamidopropyl ethyl-hydroxyethyl carboxymethyl glycinate.Particularly preferably in known fatty acid amide derivant under the CTFA title cocoamidopropyl.

Same suitable emulsifying agent is an amphoteric surfactant.Amphoteric surfactant is interpreted as and means such surface active cpd that they are except the C in the molecule _8,18 ^-Outside alkyl base or the acyl group, also comprise at least one free amine group and at least one-COOH-or-SO ₃H group and can form inner salt.The example of suitable amphoteric surfactants is N-alkyl glycine, the sweet propanoic acid of N-alkyl, N-alkyl amino butanoic acid, N-alkyl imines dipropionic acid, N-ethoxy-N-alkylamidoalkyl propyl group glycine, N-alkyl taurine, N-alkyl sarcosine, 2-alkyl aminopropionic acid and p dialkylaminobenzoic acid, has about 8-18 carbon atom in each case in alkyl.

Particularly preferred amphoteric surfactant is N-cocos nucifera oil alkylamino alanine salt, cocamidopropyl ethylamino alanine salt and C _12/18-acyl group sarcosine.Except that amphoteric emulsifier, quaternary ammonium type (quaternary) emulsifying agent also is suitable, preferably those ester quaternary ammonium types (ester quat type) emulsifying agent, the quaternized difatty acid triethanolamine ester salts of preferable methyl especially.In addition, operable anion emulsifier is alkyl ether sulfate, monoglyceride sulfate, fatty acid sulfate, sulfosuccinate and/or ether carboxylic acid.

Suitable oil substances be based on have 6-18, Guerbet alcohols, the straight chain C of the aliphatic alcohol of preferred 8-10 carbon atom ₆-C ₂₂-fatty acid and straight chain C ₆-C ₂₂The ester of-aliphatic alcohol, side chain C ₆-C ₁₃Carboxylic acid and straight chain C ₆-C ₂₂The ester of-aliphatic alcohol, straight chain C ₆-C ₂₂-fatty acid and branched-chain alcoho especially ester, straight chain and/or the branched chain fatty acid of 2-Ethylhexyl Alcohol and polyhydric alcohol (as propylene glycol, two poly-dihydric alcohols (dimerdiol) or trimerization trihydroxylic alcohol (trimertriol)) and/or Guerbet alcohols ester, based on C ₆-C ₁₀Fatty acid triglycercide, based on C ₆-C ₁₈The liquid glycerin one-/two of-fatty acid-, three ester admixtures, C ₆-C ₂₂The especially benzoic ester of-aliphatic alcohol and/or Guerbet alcohols and aromatic carboxylic acid, C ₂-C ₁₂-dicarboxylic acids is with the straight or branched alcohol with 1-22 carbon atom or have ester, vegetable oil, branched-chain primary alcohol, the cyclohexane extraction of replacement, the straight chain C of the polyol of 2-10 carbon atom and 2-6 hydroxyl ₆-C ₂₂Aliphatic alcohol carbonic ester, Guerbet carbonic ester, benzoic acid and straight chain and/or side chain C ₆-C ₂₂The ester of alcohol (for example

TN), the open-loop products of dialkyl ether, epoxidized fatty acid ester and polyol, silicone oil and/or aliphatic hydrocarbon or cycloalkane.Operable oil substances also has silicone compounds, for example dimethyl polysiloxane, methyl phenyl silicone, annular siloxane and room temperature can be in liquid form or resin form through amino-, fatty acid-, alcohol-, polyethers-, epoxy-, fluoro-, alkyl-and/or silicone compounds of modifying of glucosides.Oil substances can be in compositions of the present invention based on said composition with 1-90 weight %, preferred 5-80 weight % and especially the amount of 10-50 weight % exist.

It is limit or restrictive that the described composition tabulation that can use with the effector molecule of the keratin-binding that meets the present invention and/or produced by the inventive method should not be considered as certainly.Described composition can be individually or combination with one another ground use.

The present invention also is provided at the effect protein of the keratin-binding that shows among the sequence SEQ ID No:168,176,182,188,194 and 200.

The present invention provides equally according to SEQ ID No:167,175,181,187,193 and 199 nucleic acid molecules and nucleic acid encoding molecule, and wherein said polypeptide comprises according at least a polypeptide in sequence shown in the SEQ ID No:168,176,182,188,194 and 200.

The present invention also provides the DNA that comprises at least one nucleic acid molecules with nucleic acid encoding sequence expression cassette, and wherein said polypeptide comprises by at least a polypeptide according to the nucleic acid molecule encoding of sequence shown in the SEQ ID No:167,175,181,187,193 or 199.According to the present invention, preferably comprise the DNA expression cassette that has according to the nucleic acid molecules of nucleotide sequence shown in the SEQ ID No:167.

Preferably, this class construct of the present invention comprise specific coding sequence 5 '-promoter and 3 of upstream '-the terminator sequence in downstream and also have other habitual regulating element as required, they effectively are connected with described coded sequence respectively.

Regulating element comprises enhancer, targeting sequence, polyadenylation signal, selected marker, amplified signal, origin of replication etc.Proper regulation sequence is for example at Goeddel, Gene ExpressionTechnology:Methods in Enzymology 185, and Academic Press describes among the San Diego, CA (1990).

Except these regulate sequence, the natural regulating action of these sequences also may reside in before the practical structure gene, to such an extent as to and be subjected to as required that this natural regulating action of genetic modification has been closed and described expression of gene increases.

Preferred nucleic acid construct advantageously also comprises the ＂ enhancer ＂ sequence that is connected with promoter function that one or more has been mentioned, this allows to increase the expression of nucleotide sequence.At 3 ' end of DNA sequence, also might insert extra favourable sequence, as other regulating element or terminator.

Nucleic acid of the present invention can be present in the construct with one or more copy.In construct, also can there be other labelling that is used for as required the construct selection, as remedies antibiotic resistance or auxotrophic gene.

The adjusting sequence favourable for the inventive method for example is present in the promoter that is advantageously utilised in the gram negative bacteria, as cos, tac, trp, tet, trp-tet, Ipp, lac, Ipp, laclq-T7, T5, T3, gal, trc, ara, rhaP (rhaPBAD) SP6, λ-PR or im λ-P promoter.Other favourable adjusting sequence for example is present among the Gram-positive promoter amy and SP02, is present among yeast or fungal promoters ADC1, MF α, AC, P-60, CYC1, GAPDH, TEF, rp28, the ADH.

Also might use the son that manually starts that is used to regulate.

For expressing in host living beings, nucleic acid construct advantageously inserts the carrier that allows this gene optimum expression in the host, as plasmid or phage.Except plasmid and phage, carrier also is interpreted as and means all other carriers well known by persons skilled in the art, therefore for example is that virus is as SV40, CMV, baculovirus and adenovirus, transposon, IS element, phasmid, cosmid and linear or cyclic DNA and Agrobacterium system.

The generation of expression cassette can use habitual reorganization well known by persons skilled in the art and clone technology to realize, as at for example Maniatis T, Fritsch EF and Sambrook J (1989) MolecularCloning:A Laboratory Manual, Cold Spring Harbor Laboratory, ColdSpring Harbor (NY), at Silhavy TJ, Berman ML and EnquistLW (1984) Experiments with Gene Fusions, Cold Spring HarborLaboratory, Cold Spring Harbor (NY), at (1987) CurrentProtocols in Molecular Biology such as Ausubel FM, describe among the Greene Publishing Assoc.and WileyInterscience.Yet between two sequences, also might settle other sequence that for example has with the function of joint, signal peptide or the protein ancora (for example His label) of some restriction endonuclease restriction site.The insertion of sequence also can cause Expression of Fusion Protein.Preferably, can in carrier, there be and for example inserts the genome of cell in the integration mode by conversion by promoter and the expression cassette that connects and composes for the treatment of the express nucleic acid sequence.The expression cassette that inserts carrier also can exist in mode outside the chromosome in cell and breed.

Except that promoter, the nucleotide sequence that is present in expression cassette of the present invention or the carrier can functionally be connected with other genetic control sequence.Term genetic control sequence will be understood in a broad sense and mean the formation of expression cassette of the present invention and effective all those sequences of function.The genetic control sequence is regulated transcribing and translating in for example protokaryon and eukaryote.Preferably, expression cassette of the present invention comprises the promoter and 3 ' of concrete the nucleotide sequence 5 '-upstream for the treatment of transgene expression-downstream as the terminator sequence of extra genetic control sequence and also have other habitual regulating element as required, and they effectively are connected with the nucleotide sequence for the treatment of transgene expression respectively.

The genetic control sequence also comprises to regulate expresses controlled characteristic other promoter, promoter element or minimal promoter.In principle, might use all natural promoter that in preferred biology, to control the gene expression of nucleic acid molecules with its adjusting sequence.In addition, also can advantageously use synthetic promoter.

In addition, the genetic control sequence also comprises 5 ' of gene-untranslated region, intron or non-coding 3 ' district.For example, shown that 5 '-non-translated sequence can strengthen the transient expression of heterologous gene.

Expression cassette can advantageously also comprise one or more so-called ＂ enhancer sequence ＂ that is connected with promoter function, and this allows to increase the transgene expression of nucleotide sequence.At 3 ' end of the nucleotide sequence for the treatment of transgene expression, also might insert extra favourable sequence, as other regulating element or terminator.The nucleotide sequence for the treatment of transgene expression can exist in gene construct with one or more copy.

In addition, control sequence will be interpreted as mean allow homologous recombination to and/or those control sequences of inserting the host living beings genome or allowing from genome, to shift out.Under the situation of homologous recombination, for example the natural promoter of specific gene can exchange with the promoter with other characteristic.

Expression cassette and can comprise other functional element from deutero-carrier wherein. the term functional element will be understood and mean generation to expression cassette of the present invention, carrier or genetically modified organism in a broad sense, duplicate and effective all those elements of function.Can mention following limiting examples:

A) selected marker: for successfully selecting transformant, need usually to import extraly can give successfully select cell transformed to biocide (for example herbicide) but, the selected marker of metabolic antagonist or antibiotic opposing.This selected marker allows difference transformant and no transformed cells and required host living beings selected individually and is that those skilled in the art are known fully.Selected marker is for example given metabolic antagonist such as 2-deoxyglucose-6-phosphoric acid (WO 98/45456), antibiotic or biocide, preferred herbicide as to kanamycin, and G 418, bleomycin, the resistance of hygromycin or kanamycin etc.As selected marker, preferably give aasa gene, give streptomycin phosphotransferase (SPT) gene, give neomycin phosphotransferase (NPTII) gene, give hygromix phosphotransferase (HPT) gene, give the acetolactic acid sy nthase gene (ALS) to the sulfonylurea herbicide resistance (for example having mutability ALS variant) as sudden change S4 and/or Hra to hygromycin resistance to kanamycin or Geneticin (geneticidin) resistance to streptomycin resistance to antibiotic apectinomycin resistance.

B) coding can be easily quantitative property protein or guarantee to assess transformation efficiency or the reporter gene of expressive site or time by inherent colour or enzymatic activity.This paper very particularly preferably reports albumen (Schenborn E, Groskreutz D.Mol Biotechnol.1999; 13 (1): 29-44) as " green fluorescent protein " (GFP) (Sheen etc. (1995) Plant Journal 8 (5): 777-784; Haseloff etc. (1997) Proc Natl Acad Sci USA 94 (6): 2122-2127; Reichel etc. (1996) Proc Natl Acad Sci USA 93 (12): 5888-5893; Tian etc. (1997) PlantCell Rep 16:267-271; WO 97/41228; (1996) Curr Biol6:325-330 such as Chui WL; (1997) BioTechniques.23 (5) such as Leffel SM: 912-8), CAT, luciferase (Ow etc. (1986) Science 234:856-859; Millar etc. (1992) PlantMol Biol Rep 10:324-414), aequorin gene (Prasher etc. (1985) Biochem Biophys Res Commun 126 (3): 1259-1268), β-gala glucosidase.

C) guarantee the origin of replication that expression cassette of the present invention or carrier duplicate in escherichia coli for example.Mode by way of example, can mention ORI (starting point of dna replication dna), pBR322 ori or P15A ori (Sambrook etc.: Molecular Cloning.A Laboratory Manual, second edition .Cold Spring Harbor Laboratory Press, Cold Spring Harbor, NY, 1989).

Expression cassette of the present invention is inserted cell or biologically can advantageously use the carrier that wherein has this expression cassette and realize.Expression cassette can be inserted carrier (for example plasmid) by suitable restriction site.The plasmid that produces imports escherichia coli at first.The method that escherichia coli that select, results correctly transform and recombiant plasmid use those skilled in the art to be familiar with obtains.Restriction analysis and order-checking also can be played the effect of check clone step.

The present invention provides the carrier that comprises expression cassette equally, and wherein said expression cassette comprises the nucleic acid molecules that has according at nucleotide sequence shown in the sequence SEQ ID No:167,175,181,187,193 or 199.

For expressing in host living beings, nucleic acid construct advantageously inserts the carrier that allows this gene optimum expression in the host, as plasmid or phage.Except plasmid and phage, carrier also is interpreted as and means all other carriers well known by persons skilled in the art, therefore for example is virus as SV40, CMV, baculovirus and adenovirus, transposon, IS element, phasmid, cosmid and linear or cyclic DNA and Agrobacterium system in addition.

These carriers can be in the host self-replicating or chromosome other places duplicate.These carrier representatives another embodiment of the present invention.Suitable plasmid for example is the pLG338 in escherichia coli, pQE30, pACYC184, pBR322, pUC18, pUC19, pKC30, pRep4, pHS1, pKK223-3, pDHE19.2, pHS2, pPLc236, pMBL24, pLG200, pUR290, pIN-III ＂ 3-B1, tgt11 or pBdCI, plJ101 in streptomycete (Streptomyce), pIJ364, plJ702 or plJ361, pUB110 in bacillus cereus (Bacillus), pC194, pWH320, pMM1520, pMM1525 or pBD214, pSA77 or pAJ667 in corynebacterium (Corynebacterium), pALS1 in fungus, plL2 or pBB116,2 α in yeast, pAG-1, YEp6, YEp13 or pEMBLYe23 or the pLGV23 in plant, pGHlac+, pBIN19, pAK2004 or pDH51.On behalf of the sub-fraction of possibility plasmid, described plasmid select.Other plasmid is well known by persons skilled in the art and can for example finds in books " Cloning Vectors " (Elsevier, Amsterdam-New York-Oxford, 1985, ISBN 0 444 904018 such as editor Pouwels P.H.).

The nucleic acid construct certificate of the present invention or the carrier that comprise nucleic acid molecules of the present invention also can advantageously be integrated in the host living beings genome with linear dna form importing microorganism or by allos or homologous recombination.This linear DNA can be constituted or only is made of nucleic acid construct of the present invention or nucleic acid by linearized vector such as plasmid.

Be the optimum expression of heterologous gene in biology, advantageously the modification of nucleic acids sequence is with corresponding with used specific ＂ codon usage frequency ＂ in this biology.＂ codon usage frequency ＂ can use the computer evaluation of other the biological known of discussing (for example to pass through: from the generalized codon usage frequency in international dna sequence data storehouse: present situation in 2000.Nakamura, Y., Gojobori, T. and Ikemura, T. (2000) Nucl.Acids Res.28,292., http://www.kazusa.or.jp/codon/index.html) determine easily.

For expressing in the suitable host biology, recombinant nucleic acid construct or gene construct advantageously insert the host specificity carrier that allows this gene optimum expression in the host.Carrier is that those skilled in the art are fully known and can be for example find in books " Cloning Vectors " (1985, ISBN 0 444 904018 for Elsevier such as editor Pouwels P.H., Amsterdam-New York-Oxford).

By carrier of the present invention, might preparation example as transforming with at least a carrier of the present invention and can being used in the recombinant microorganism that produces polypeptide of the present invention.Recombinant precursor of the present invention advantageously inserts the suitable hosts system and obtains expressing., preferably use habitual clone well known by persons skilled in the art and transfection method herein,, be intended to cause that described nucleic acid expresses in the particular expression system as co-precipitation, protoplast fusion, electroporation, retrovirus transfection etc.Suitable system is for example at Current Protocols in Molecular Biology, editors such as F.Ausubel, WileyInterscience, Molecular Cloning:ALaboratory Manual. second editions such as New York 1997 or Sambrook, Cold Spring Harbor Laboratory, ColdSpring Harbor Laboratory Press, Cold Spring Harbor, NY describes in 1989.

According to the present invention, also might prepare the homologous recombination microorganism.For this purpose, the carrier that has prepared at least a portion of at least a portion that wherein comprises gene of the present invention or coded sequence, in described part, import at least one aminoacid deletion, interpolation or displacement as required so that modify, for example functionally destroyed sequence of the present invention (＂ knocks out the ＂ carrier).The sequence of inserting can also for example be from the congener of related microorganisms or derived from mammal, yeast source or insecticide source.During homologous recombination, suddenlyd change in some way or modified to such an extent as to can alternatively be designed for the carrier endogenous gene of homologous recombination, but encoding function protein (to such an extent as to for example if the expression of endogenous protein can be modified thereby change to upstream region according to mode like this) still.The modification of gene of the present invention partly is arranged in homologous recombination vector.Structure is used for the suitable carrier of homologous recombination for example at Thomas, and K.R. and Capecchi describe among M.R. (1987) the Cell 51:503.

The transgenic recombinant host biology that is applicable to nucleic acid of the present invention or nucleic acid construct is whole prokaryotes (comprising archeobacteria) or eukaryote in principle.Especially the antibacterial, fungus, insect cell, plant cell and the mammalian cell that comprise halophilic bacteria and methane coccus guiding principle.Used host living beings uses advantageously microorganism such as antibacterial, fungus or yeast.Can advantageously use fungus, Gram-positive or gram negative bacteria, preferred enterobacteriaceae (Enterobacteriaceae), pseudomonadaceae (Pseudomonadaceae), Rhizobiaceae (Rhizobiaceae), the antibacterial of Streptomycetaceae (Streptomycetaceae) or Nocardiaceae (Nocardiaceae), preferred especially Escherichia (Escherichia), Rhodopseudomonas (Pseudomonas), streptomyces (Streptomyces), Nocardia (Nocardia), bulkholderia cepasea belongs to (Burkholderia), Salmonella (Salmonella), the antibacterial of Agrobacterium (Agrobacterium) or Rhod (Rhodococcus).Most preferably escherichia coli, bacillus subtilis, bacillus megaterium, pseudomonas, lactobacillus, multiple-shaped nuohan inferior yeast, aspergillus oryzae, aspergillus nidulans, aspergillus niger, finish red saccharomyces pastorianus, trichoderma reesei and SF9 cell (or relevant cell).

The biology that is used to produce the effect protein of keratin-binding of the present invention is cultivated in the manner known to persons skilled in the art or is cultivated, and depends on host living beings.The common liquid medium within of microorganism, between 0 ° of C and 100 ℃, preferably cultivate under the temperature oxygen between 10 ℃ to 60 ℃, the wherein said fluid medium most common form that comprises is that carbon source, the most common form of sugar is nitrogenous source, trace element such as iron salt, manganese salt and magnesium salt and (as required) vitamin of organic nitrogen source such as yeast extract or salt such as ammonium sulfate.In this article, the pH of nutritional solution can remain on the fixed value, is promptly regulated in the training period or does not regulate.Cultivation can batch-type, semi-batch and continous way.Nutrient can import or after this semi-continuously or continuously send into when the fermentation beginning at first.Enzyme can separate by the method for describing among the embodiment from this biology or use as the crude extract that reacts.

Therefore polypeptide can also in commercial quantity produce as required.Recombinant microorganism can be cultivated and fermentation by known method.Antibacterial can for example reach in TB or LB culture medium and breed on 20 ℃ of-40 ℃ of temperature and 6-9 pH.Particularly, suitable condition of culture is for example at T.Maniatis, E.F.Fritsch and J.Sambrook, Molecular Cloning:A Laboratory Manual, ColdSpring Harbor Laboratory describes among the Cold Spring Harbor, NY (1989).

Fragmentation and purification

If polypeptide is not secreted to culture medium, then cell breakage and product are obtained from lysate by known protein matter separation method.Cell can according to required by high-frequency ultrasonic, by high pressure as in French (French) pressure chamber, by the infiltration cracking, by detergent, lyases or organic solvent effect, by homogenizer or in addition broken by two or more listed methods of combination.

The purification of polypeptide can use known layer analysis method such as sieve chromatography (gel filtration) as Q-agarose gel chromatography, ion-exchange chromatography and hydrophobic chromatography and with other common method such as ultrafiltration, crystallization, saltout, dialysis and natural gel electrophoresis and realize.Suitable method is for example at Cooper, F.G., Biochemische Arbeits Methoden[Biochemical working Methods], VerlagWater de Gruyter, Berlin, New York or at Scopes, R., Protein Purification, Springer Verlag, New York, Heidelberg describes among the Berlin.

Can advantageously use such carrier system or oligonucleotide to separating recombinant proteins, it prolongs cDNA by some nucleotide sequence, thereby coding is brought into play for example modified polypeptide or the fusion rotein of the effect of easier purification.This type of suitable modification for example is the so-called ＂ label ＂ of performance ancora effect, as be known as the modification of six histidine anchors, or can be by the epi-position of antibody recognition (for example at Harlow as antigen, E. and Lane, D., 1988, describe among Antibodis:A Laboratory Manual.ColdSpring Harbor (N.Y.) Press).Other suitable label for example is HA, calmodulin, CaM-BD, GST, MBD; Chitin-BD, Streptavidin-BD-Avi label, Flag label, T7 etc.These ancoras can play protein is connected to effect on fixing holder such as the polymeric matrix, and wherein fixedly substrate can be sent into for example chromatographic column, or can be in microtitration use on the dull and stereotyped or another kind of holder.Corresponding purification process can obtain from commercialization affinity tag suppliers.

The effect protein of keratin-binding of the present invention its fusion form promptly with its fusion partner part together and under unpack format, all have a proteinic desirable characteristics of keratin-binding.Protein of the present invention therefore can directly use as fusion rotein or in excision and after separating fusion partner the protein as " pure " keratin-binding use.

Separate fusion partner as needs, suggestion with effective cleavage site (the specific recognition site of protease) the protein portion of keratin-binding with and fusion partner incorporate fusion rotein between partly.Suitable cleavage site is all non-existent those peptide sequences in the protein portion of keratin-binding and fusion partner part especially, and these peptide sequences can use the bioinformatics instrument to determine easily.Particularly be fit to for example be BrCN to the cutting of methionine or with the protease of factor Xa, enterokinase, thrombin mediate the property cutting, TEV cuts (marmor erodens protease).

In addition, the invention provides transgenic cell, comprise

V) at least a above-mentioned carrier, or

W) at least a above-mentioned expression cassette, or

X) at least a above-mentioned nucleic acid encoding molecule, wherein said polypeptide comprise by at least a polypeptide according to the nucleic acid molecule encoding of sequence shown in the SEQ ID No:167,175,181,187,193 or 199.

Preferably,, cell (seeing above) or biological (seeing above) they are transgenic cell or biology, it has used at least one nucleic acid molecules according to sequence shown in the SEQ ID No:167,175,181,187,193 or 199 to transform.

Particularly preferred genetically modified organism is escherichia coli, bacillus subtilis, bacillus megaterium, aspergillus oryzae, aspergillus nidulans, aspergillus niger, finishes red saccharomyces pastorianus, pseudomonas, lactobacillus, multiple-shaped nuohan inferior yeast, trichoderma reesei and SF9 cell (or relevant cell).

Sequence

SEQ

The ID sequence

NO: type sequence explanation

1 nucleic acid homo sapiens (Homo sapiens) desmoplakin _ accession number NM_004415

2 protein homo sapiens desmoplakin _ accession number NM_004415

3 nucleic acid homo sapiens desmoplakins _ accession number NM_004415 domain B

4 protein homo sapiens desmoplakins _ accession number NM_004415 domain B

5 nucleic acid homo sapiens desmoplakins _ accession number NM_004415 domain B-1

6 protein homo sapiens desmoplakins _ accession number NM_004415 domain B-1

7 nucleic acid homo sapiens desmoplakins _ accession number NM_004415 domain B-2

8 protein homo sapiens desmoplakins _ accession number NM_004415 domain B-2

9 nucleic acid homo sapiens desmoplakin _ accession number NM_004415 domain Cs

10 protein homo sapiens desmoplakin _ accession number NM_004415 domain Cs

11 nucleic acid homo sapiens desmoplakin _ accession number NM_004415 domain Cs-1

12 protein homo sapiens desmoplakin _ accession number NM_004415 domain Cs-1

13 nucleic acid homo sapiens desmoplakin _ accession number NM_004415 domain Cs-2

14 protein homo sapiens desmoplakin _ accession number NM_004415 domain Cs-2

15 nucleic acid homo sapiens _ poly-fibroin _ accession number CAI19595

16 protein homo sapiens _ poly-fibroin _ accession number CAI19596

17 nucleic acid homo sapiens parent speckle albumen, 1 accession number NM_001005337, transcript variant 1a

18 protein homo sapiens parent speckle albumen, 1 accession number NM_001005337, transcript variant 1a

19 nucleic acid homo sapiens parent speckle albumen, 1 accession number NM_000299, transcript variant 1b

20 protein homo sapiens parent speckle albumen, 1 accession number NM_000299, transcript variant 1b

The close speckle albumen 2 accession number NM_026163 of house mouse (Mus musculus)

21 nucleic acid NM_027894

22 protein house mouses parent speckle albumen, 2 accession number NM_026163NM_027895

23 nucleic acid house mouses parent speckle albumen, 1 accession number NM_019645

24 protein house mouses parent speckle albumen, 1 accession number NM_019646

The close speckle albumen 1 part mRNA of common cattle (Bos taurus), accession number

25 nucleic acid XM_868348

The common cattle parent of 26 protein speckle albumen 1 part mRNA, accession number XM_868349

Domesticated dog (Canis familiaris) and similar close speckle albumen 1 isotype 1a, accession number

27 nucleic acid XM_851528

28 protein domesticated dogs are to similar close speckle albumen 1 isotype 1a, accession number XM_851529

29 nucleic acid Brachydanio rerio (Danio rerio), similar to close speckle albumen 1, accession number XM_695832

30 protein zebra fishes are similar to close speckle albumen 1, accession number XM_695833

Rattus norvegicus (Rattus norvegicus), similar to close speckle albumen 1, accession number

31 nucleic acid XM_222666

32 protein Rattus norvegicuss are similar to close speckle albumen 1, accession number XM_222667

Chimpanzee (Pan troglodytes), similar to close speckle albumen 1, accession number

33 nucleic acid XM_514091

34 protein chimpanzees are similar to close speckle albumen 1, accession number XM_514092

35 nucleic acid jungle fowls (Gallus gallus), similar to close speckle albumen 1, accession number XM_419240

36 protein jungle fowls, similar to close speckle albumen 1, accession number XM_419241

Africa xenopus (Xenopus laevis), similar to close speckle albumen 4, accession number

37 nucleic acid BI390496

38 protein Africa xenopus, similar to close speckle albumen 4, accession number BI390497

39 nucleic acid homo sapiens desmoplakins, transcript variant 2, accession number NM_001008844

40 protein homo sapiens desmoplakins, transcript variant 2, accession number NM_001008845

41 nucleic acid house mouse desmoplakins, accession number XM_621314

42 protein house mouse desmoplakins, accession number XM_621315

Rattus norvegicus (Rattus norvegicus), II is similar to the desmoplakin isotype, steps on

43 nucleic acid record XM_225259

44 protein Rattus norvegicuss, II is similar to the desmoplakin isotype, accession number XM_225260

45 nucleic acid chimpanzee desmoplakins, accession number XM_518227

46 protein chimpanzee desmoplakins, accession number XM_518228

47 nucleic acid jungle fowls, similar to desmoplakin, accession number XM_418957

48 protein jungle fowls, similar to desmoplakin, accession number XM_418958

49 nucleic acid homo sapiens joint plakoglobins (JUP), transcript variant 2, accession number NM_021991

50 protein homo sapiens joint plakoglobins (JUP), transcript variant 2, accession number NM_021992

51 nucleic acid house mouses, plakoglobin; γ-Lian albumen, accession number NM_010593

52 protein house mouses, plakoglobin; γ-Lian albumen, accession number NM_010594

53 nucleic acid Rattus norvegicus γ-Lian albumen (plakoglobin), accession number NM_031047

54 protein Rattus norvegicus γ-Lian albumen (plakoglobin), accession number NM_031048

55 nucleic acid Brachydanio rerio tatou protein families; Plakoglobin, accession number NM_131177

56 protein zebra fish tatou protein families; Plakoglobin, accession number NM_131178

Torrid zone Xenopus laevis (Xenopus tropicalis) joint plakoglobin, accession number

57 nucleic acid BC064717

58 protein torrid zone Xenopus laevis joint plakoglobin, accession number BC064718

59 nucleic acid domesticated dogs, similar to joint plakoglobin isotype 10, accession number XM_856625

60 protein domesticated dogs, similar to joint plakoglobin isotype 10, accession number XM_856626

61 nucleic acid Africa xenopus Jup protein, accession number BC094116

62 protein Africa xenopus Jup protein, accession number BC094117

The common cattle joint of 63 nucleic acid plakoglobin, accession number NM_001004024

The common cattle joint of 64 protein plakoglobin, accession number NM_001004025

65 nucleic acid wild boars (Sus scrofa) plakoglobin, accession number NM_214323

66 protein wild boar plakoglobins, accession number NM_214324

67 nucleic acid Brachydanio rerio joint plakoglobins, accession number BC058305

68 protein zebra fish joint plakoglobins, accession number BC058306

Saccharomyces cerevisiae (Saccharomyces cerevisiae), plakoglobin/tatou albumen/β-

69 nucleic acid connection albumen, accession number AF005267

70 protein saccharomyces cerevisiaes, plakoglobin/tatou albumen/beta-catenin, accession number AF005268

71 nucleic acid homo sapiens plectins 1, intermediate filament's Rapsyn, accession number NM_201380

72 protein homo sapiens plectins 1, intermediate filament's Rapsyn, accession number NM_201381

House mouse plectin 1 (Plec1), transcript variant 11, mRNA, accession number

73 nucleic acid NM_201394 XM

House mouse plectin 1 (Plec1), transcript variant 11, mRNA, accession number

74 protein N M_201394 XM

Common cattle, similar to plectin 1 isotype 1 (LOC510991), accession number

75 nucleic acid XM_588232

Common cattle, similar to plectin 1 isotype 1 (LOC510991), accession number

76 protein XM_588233

77 nucleic acid domesticated dogs, similar to plectin 1 isotype, accession number XM_539204

78 protein domesticated dogs, similar to plectin 1 isotype, accession number XM_539205

Schizotrypanum cruzi (Trypanosoma cruzi), plectin sample albumen, accession number

79 nucleic acid XM_809849

80 protein schizotrypanum cruzis, plectin sample albumen, accession number XM_809850

81 nucleic acid Rattus norvegicus plectins, accession number X59601

82 protein Rattus norvegicus plectins, accession number X59602

83 nucleic acid Cricetulus barabensis (Cricetulus griseus) plectin, accession number AF260753

84 protein Cricetulus barabensis plectins, accession number AF260754

85 nucleic acid homo sapiens speckle peripheral proteins, accession number NM_002705

86 protein homo sapiens speckle peripheral proteins, accession number NM_002706

87 nucleic acid house mouse speckle peripheral proteins, accession number NM_008909XM_358905

88 protein house mouse speckle peripheral proteins, accession number NM_008909XM_358906

89 nucleic acid homo sapiens are outer by speckle albumen, accession number NM_001988

90 protein homo sapiens are outer by speckle albumen, accession number NM_001989

91 nucleic acid house mouses are outer by speckle albumen, accession number NM_025276XM_283024

92 protein house mouses are outer by speckle albumen, accession number NM_025276XM_283025

The common cattle of 93 nucleic acid is and outward by speckle protein similar, accession number XM_587641

The common cattle of 94 protein is and outward by speckle protein similar, accession number XM_587642

95 nucleic acid domesticated dogs are and outward by speckle protein similar, accession number XM_540443

96 protein domesticated dogs are and outward by speckle protein similar, accession number XM_540444

97 nucleic acid Brachydanio rerio are and outward by speckle protein similar, accession number XM_687958

98 protein zebra fishes are and outward by speckle protein similar, accession number XM_687959

99 nucleic acid Rattus norvegicuss, with outward by the speckle protein similar, db_xref gene I: 303687

100 protein Rattus norvegicuss, with outward by the speckle protein similar, db_xref gene I: 303688

101 nucleic acid chimpanzees are and outward by speckle protein similar, accession number XM_511692

102 protein chimpanzees are and outward by speckle protein similar, accession number XM_511693

103 nucleic acid people bullous pemphigoid antigens, accession number M63618

104 protein people bullous pemphigoid antigens, accession number M63619

105 nucleic acid house mouse bullous pemphigoid antigen 1s (Bpag1), accession number AF396877

106 protein house mouse bullous pemphigoid antigen 1s (Bpag1), accession number AF396878

107 nucleic acid house mouse trichohyalin samples 1, accession number NM_027762

108 protein house mouse trichohyalin samples 1, accession number NM_027763

The common cattle of 109 nucleic acid, similar to trichohyalin sample 1, accession number XM_597026

The common cattle of 110 protein, similar to trichohyalin sample 1, accession number XM_597027

111 nucleic acid homo sapiens trichohyalin samples 1, accession number NM_001008536XM_060104

112 protein homo sapiens trichohyalin samples 1, accession number NM_001008536XM_060105

Purple ball Hemicentrotus seu Strongylocentrotus (Strongylocentrotus purpuratus), with trichohyalin mutually

113 nucleic acid seemingly, accession number XM_793822

The purple ball Hemicentrotus seu Strongylocentrotus of 114 protein, similar to trichohyalin, accession number XM_793823

115 nucleic acid schizotrypanum cruzis, predictive trichohyalin, accession number XM_809758

116 protein schizotrypanum cruzis, predictive trichohyalin, accession number XM_809759

Giardia lamblia (Giardia lamblia) ATCC 50803 trichohyalins,

117 nucleic acid accession number XM_765825

Giardia lamblia ATCC 50803 trichohyalins, accession number

118 protein XM_765826

Aspergillus fumigatus (Giardia lamblia) Af293, trichohyalin, accession number

119 nucleic acid XM_748643

120 protein Aspergillus fumigatus Af293, trichohyalin, accession number XM_748644

121 nucleic acid rabbit (O.cuniculus) trichohyalins, accession number Z19092

122 protein rabbit trichohyalins, accession number Z19093

123 nucleic acid chimpanzees, similar to trichohyalin, accession number XM_526770

124 protein chimpanzees, similar to trichohyalin, accession number XM_526771

125 nucleic acid people trichohyalins (TRHY), accession number L09190

126 protein people trichohyalins (TRHY), accession number L09191

127 nucleic acid house mouse proline enrich small protein 3, accession number NM_011478

128 protein house mouse proline enrich small protein 3, accession number NM_011479

129 nucleic acid homo sapiens proline enrich small protein 2B (SPRR2B), accession number NM_001017418

130 protein homo sapiens proline enrich small protein 2B (SPRR2B), accession number NM_001017419

131 nucleic acid house mouse hair follicle a-protein HF, accession number XM_485271

132 protein house mouse hair follicle a-protein HF, accession number XM_485272

133 nucleic acid homo sapiens epidermis speckle albumen, 1 (EPPK1), accession number NM_031308XM_372063

134 protein homo sapiens epidermis speckle albumen, 1 (EPPK1), accession number NM_031308XM_372064

135 nucleic acid house mouse epidermis speckle albumen 1, accession number NM_144848NM_173025

136 protein house mouse epidermis speckle albumen 1, accession number NM_144848NM_173026

137 nucleic acid house mouse structural protein FBF1, accession number AF241249

138 protein house mouse structural protein FBF1, accession number AF241250

The spaP gene of Streptococcus mutans (Streptococcus mutans) antigen I/II,

139 nucleic acid accession number X17390

The spaP gene of 140 protein variations streptococcal antigen I/II, accession number X17391

The sequence of 141 nucleic acid PCR primer Bag 43

The sequence of 142 nucleic acid PCR primer Bag 44

The sequence of 143 nucleic acid PCR primer Bag 53

The sequence of 144 nucleic acid PCR primer Bag 51

The sequence of 145 nucleic acid PCR primer Lib197

The sequence of 146 nucleic acid PCR primer Lib198

147 nucleic acid use PCR-primer Lib197 (SEQ ID No:145) and Lib198 (SEQ ID

No:146) variant according to the sequence of SEQ ID No:ID3 of mutation

The sequence Lib201 of 148 nucleic acid PCR primers

The sequence Lib202 of 149 nucleic acid PCR primers

Coding is from the C16 structure of the spider silk fibroin ADF-4C of cross epeira

The nucleic acid of 150 nucleic acid (module)

The translation product of 151 protein core acid molecule SEQ ID No:150

Variant according to the sequence of SEQ ID No:ID3; By PCR Lib151 (SEQ

152 nucleic acid ID No:154) and the dna fragmentation of Lib152 (SEQ ID No:155) amplification;

The translation product of 153 protein core acid molecule SEQ ID No:152

The sequence of 154 nucleic acid PCR primer Lib151

The sequence of 155 nucleic acid PCR primer Lib152

156 protein KBD-B_ homo sapiens desmoplakins _ accession number NM_004415 domain B-3

157 protein KBD-B_ homo sapiens desmoplakins _ accession number NM_004415 domain B-4

158 protein KBD-B_ homo sapiens desmoplakins _ accession number NM_004415 domain B-5

159 nucleic acid KBD-B_ homo sapiens desmoplakins _ accession number NM_004415 domain B-6

160 protein KBD-B_ homo sapiens desmoplakins _ accession number NM_004415 domain B-6

161 nucleic acid homo sapiens hirsutism albumen, BC004285

162 protein homo sapiens hirsutism albumen, BC004285

Homo sapiens's desmoplakin _ accession number NM_004415 is with SEQ ID No:ID 1

163 nucleic acid are compared has the nucleic acid exchange

Homo sapiens's desmoplakin accession number NM_004415 is with SEQ ID No:ID 1

164 protein are compared in the position 905,2687 and 2688 places and are had aminoacid exchange exchange

165 nucleic acid KBD-B_ homo sapiens desmoplakins _ accession number NM_004415 domain B-7

166 protein KBD-B_ homo sapiens desmoplakins _ accession number NM_004415 domain B-7

Coding is from C16 structure (SEQ among the spider silk fibroin ADF-4C of cross epeira

ID No:150) with the proteinic nucleic acid molecules of encoded K BD-B (SEQ ID No:

167 nucleic acid 147) chimeric nucleic acid molecule of Rong Heing

The chimeric translation product of 168 protein S EQ ID No:167

The sequence of 169 nucleic acid PCR primer pLib199

The sequence of 170 nucleic acid PCR primer pLib 200

Carotenoid from silkworm conjugated protein (CBP) (Swiss prot.

171 nucleic acid Q8MYA9_BOMMO) nucleic acid molecules

From the nucleic acid molecules SEQ ID No:171 CBP of silkworm coding property gene

172 protein translation products

The sequence of 173 nucleic acid PCR primer HRe1

The sequence of 174 nucleic acid PCR primer HRe2

Nucleic acid molecules (SEQ ID with encoded K BD-B protein (SEQ ID.No:166)

No:165) the chimeric nuclear of the coding CBP protein (SEQ ID.No:172) of Rong Heing

175 neucleic acid molecules

176 protein are according to the translation product of SEQ ID No:175 nucleic acid molecules

The sequence of 177 nucleic acid PCR primer Lib 212

The sequence of 178 nucleic acid PCR primer Lib219

Coding is from colibacillary metal-binding protein (ZntA) accession number NP_417926

The nucleic acid molecules of 179 nucleic acid

180 protein are according to the translation product of the nucleic acid molecules of SEQ ID No:179

Nucleic acid molecules (SEQ ID with encoded K BD-B protein (SEQ ID.No:166)

No:165) coding of Rong Heing is from colibacillary metal-binding protein

The chimeric nucleic acid molecule of 181 nucleic acid (ZntA) (SEQ ID.No:179)

182 protein are according to the translation product of the nucleic acid molecules of SEQ ID No:181

The sequence of 183 nucleic acid PCR primer Bag 102

The sequence of 184 nucleic acid PCR primer Bag 103

Coding is from colibacillary (trxA) thioredoxin gene accession number

The nucleic acid molecules of 185 nucleic acid NP_417926 (accession number EG1103)

186 protein are according to the translation product of the nucleic acid molecules of SEQ ID No:185

Nucleic acid molecules (SEQ ID with encoded K BD-B protein (SEQ ID.No:166)

No:165) coding of Rong Heing is from carrier pThioHisC's (SEQ ID.No:185)

The chimeric nucleic acid molecule of 187 nucleic acid thioredoxin fragments (SEQ ID.No:185)

188 protein are according to the translation product of the nucleic acid molecules of SEQ ID No:187

The sequence of 189 nucleic acid PCR primer Bag 89

The sequence of 190 nucleic acid PCR primer Bag 90

191 nucleic acid codings are from the segmental nucleic acid molecules of eGFP of carrier pEGFP-1 (Clontech)

192 protein are according to the translation product of the nucleic acid molecules of SEQ ID No:191

Nucleic acid molecules (SEQ ID with encoded K BD-B protein (SEQ ID.No:166)

No:165) coding of Rong Heing is from the eGFP sheet of carrier pEGFP-1 (Clontech)

The chimeric nucleic acid molecule of 193 nucleic acid sections (SEQ ID.No:191)

194 protein are according to the translation product of the nucleic acid molecules of SEQ ID No:193

The sequence of 195 nucleic acid PCR primer Bag 93

The sequence of 196 nucleic acid PCR primer Bag 94

Coding is from carrier pDX14 (OmniGene Bioproducts) (accession number

197 nucleic acid BG10075) the segmental nucleic acid molecules of YaaD

198 protein are according to the translation product of the nucleic acid molecules of SEQ ID No:197

Nucleic acid molecules (SEQ ID with encoded K BD-B protein (SEQ ID.No:166)

No:165) coding of Rong Heing is from carrier pDX14 (OmniGene

The chimeric nucleic acid molecule of YaaD fragment 199 nucleic acid Bioproducts) (SEQ ID.No:197)

200 protein are according to the translation product of the nucleic acid molecules of SEQ ID No:199

201 protein are from the AAC47011 fibroin of cross epeira

202 protein are from the fibroin of network bride spider accession number AY855102

203 protein are from the fibroin of cat face spider accession number AY855101

204 protein are from the fibroin of cat face spider accession number AY855100

205 protein are from the fibroin of golden spider accession number AY855099

206 protein are from the fibroin of golden spider accession number AY855098

207 protein synthesis construct spider silk fibroin sample protein (SF1); Accession number DQ001900

208 protein are from the fibroin of nephila clavatus spider accession number U37520

209 protein synthesis construct RGD-Araneas are led the fibroin gene; Accession number DQ186903

From black widow spider (Latrodectus Hesperus) accession number AY994149's

210 protein thread albumen

211 protein are from attacin=insecticide antibacterium albumen of silkworm accession number S78369

KBD-D with aminoterminal histidine anchor, homo sapiens parent speckle albumen 1a accession number

212 nucleic acid NM_001005337

213 protein N P_001005337

KBD-D amino acid/11-273 with c-terminus histidine anchor, homo sapiens parent speckle albumen

214 nucleic acid 1a accession number NM_001005337

215 protein 1a accession number NP_001005337

The sequence of 216 nucleic acid PCR primer HRe6

The sequence of 217 nucleic acid PCR primer HRe9

The sequence of 218 nucleic acid PCR primer HRe7

The sequence of 219 nucleic acid PCR primer HRe8

The sequence of 220 nucleic acid PCR primer HRe26

The sequence of 221 nucleic acid PCR primer HRe27

Chimeric nucleic acid molecule, its by with encoded K BD-B protein (SEQ ID No:166)

The coding CBP protein (SEQ that merges of nucleic acid molecules (SEQ ID No:165)

The joint preface of nucleic acid molecules ID No:172) (SEQ ID No:171) and sudden change

222 nucleic acid row constitute

223 protein are according to the nucleic acid molecules of SEQ ID No:222;

The joint sequence of the mutation of nucleic acid molecules SEQ ID.No:222;

The translation product of the catenation sequence between the 224 protein core acid molecule SEQ ID No:165 and 171;

The sudden change of protein sequence GGTGGSELE to GGTGGSGGG

The sequence of 225 nucleic acid PCR primer Lib 230

The sequence of 226 nucleic acid PCR primer Lib 231

Chimeric nucleic acid molecule, its coding with from the spider silk fibroin ADF-4C of cross epeira

The KBD-B egg that merges of C16 structure (module) (SEQ ID No:150)

227 nucleic acid white matters (SEQ ID No:166)) merge

The chimeric translation product of 228 protein S EQ ID No:227

229 nucleic acid change the sequence of PCR primer HRe22 fast

230 nucleic acid change the sequence of PCR primer HRe23 fast

Experimental embodiment

Open following examples are so that the explanation preferred embodiment of the invention.These embodiment will not be considered as limit or limit theme of the present invention.

In experiment is described, use following abbreviation:

(2-amino-2-methyl propanol) AMP, (degree centigrade) ℃, (ethylenediaminetetraacetic acid) EDTA, (sterically hindered amine stabilizer) HA, (1, the 1-Difluoroethane) HFC 152, (world name of cosmetic composition) INCI, (milliliter) ml, (minute) min, (oil-in-water) oil/water, (Polyethylene Glycol) PEG-25, (para-amino benzoic acid) PABA, (per 1,000,000 parts) ppm, (in right amount) q.s., (vinyl pyrrolidone) VP, (Water-In-Oil) water/oil, (effective ingredient) AI, (polyvinylpyrrolidone) PVP, (keratin binding structural domain) KBD, (the keratin binding structural domain B of people's desmoplakin) KBD-B, (the keratin binding structural domain C of people's desmoplakin) KBD-C, (, wherein connect and to produce or directly to have produced as fusion rotein (for example by translating the expression of fusion dna construct in host living beings) fusion rotein-KBD because of chemical reaction as the construct of the KBD that in description, explained with effect protein/peptide, (the proteic keratin binding structural domain of people's parent's speckle D) KBD-D.

Embodiment 1: expression vector and production bacterial strain

Multiple expression vector test is used for express keratin binding structural domain (KBD).For this reason, use multiple promoter (IPTG induction type for example, rhamnose induction type, arabinose induction type, methanol evoked, constitutive promoter etc.).Tested equally wherein KBD be expressed as fusion rotein (for example when and C16 spider silk fibroin [Huemmerich etc.; 2004, the primary structure element of Aranea traction fiber and to the contribution of protein solubility; Biochemistry 43:13604-13612] (below be also referred to as C16), thioredoxin or eGFP or YaaD[bacillus subtilis, SWISS-PROT:P37527, PDX1] or carotenoid binding proteins [silkworm, SWISS-PROT:Q8MYA9] (below be also referred to as CBP) or metal-binding protein ZntA[escherichia coli, SWISS-PROT:P37617]) etc. when merging) construct.Herein, described KBD-B (keratin binding structural domain B, SEQ IDNo:4) and KBD-C (keratin binding structural domain C, SEQ ID No:10) and the combination of these two domain KBD-BC all use multiple expression system to express.Mentioned vector construction body is nonrestrictive for claims.

Provide typically as an example be the carrier figure of IPTG induction type carrier pQE30-KBD-B (Fig. 1), pLib076 (Fig. 2) and pRee017 (Fig. 4) and pLib072 (Fig. 5).The method that is used for KBD-C also can similarly be used for described vector construction and expression.

Be expressing K BD, use multiple production host, (see embodiment 2 as escherichia coli (E.Coli) bacterial strain; XL10-Gold[Stratagene for example], BL21-CodonPlus[Stratagene] and other bacterial strain).But, also used other bacillary production host such as bacillus megaterium or bacillus subtilis.Under the situation that KBD expresses in bacillus megaterium, carry out and " Barg, H., Malten, M.﹠amp; Jahn, D. (2005) protein and the vitamin production in bacillus megaterium " similar method.(Barredo, J.-L. edits, 205-224) at Methods in Biotechnology-Microbial Products andBiotransformations.

The fungoid of using produce bacterial strain be pichia pastoris phaff (for example GS115 and KM71[the two all from Invitrogen]; With other bacterial strain) and aspergillus nidulans (RMS011[Stringer for example, MA, Dean, RA, SEwall, TC, Timberlake, WE (1991) Rodletless, the inductive novel aspergillosis developmental character mutant .Genes Dev 5:1161-1171 by the direct gene activation] and SRF200[Karos, M, Fischer, R (1999) is to the characterization of molecules of the protein HymA of a kind of the evolve high conservative and the high expressed of aspergillus nidulans.Mol Genet Genomics 260:510-521] and bacterial strain).But, also might use other fungoid production host such as aspergillus niger (KBD expresses with EP 0635574A1 and/or WO 98/46772 similar) to be used for KBD expresses.

Embodiment 2: for example pass through expression plasmid pQE30-KBD-B expressing K BD with the IPTG inducible promoter in coli strain

In order to express, use multiple production host, as multiple coli strain (for example XL10-Gold[Stratagene], BL21-CodonPlus[Stratagene] and other bacterial strain), bacillus megaterium, bacillus subtilis etc.

Typically as an example, clone and the escherichia coli expression KBD-B by transforming with pQE30-KBD-B have been described in herein:

The clone of pQE30-KBD-B

λ-MaxiDNA (DNA-λ Maxi test kit, (BD Bioscience, Clontech, people's keratinocyte cDNA, logarithmic (log) phase foreskin primary culture, carrier: preparation λ gt11) Qiagen) from people's keratinocyte cDNA storehouse.

PCR uses following oligonucleotide to carry out:

Bag 43 (5 '-GGTCAGTTACGTGCAGCTGAAGG-3 ') (SEQ ID No:141) and

Bag 44 (5 ' GCTGAGGCTGCCGGATCG-3 ') (SEQ ID No:142) 50 μ l PCR mixture:

10 * be used for the PCR buffer of superelevation fidelity Pfu: 5 μ l

λ DNA (744ng/ μ l) 1 μ l (1:30 dilution)

DNTP mixture (10mM) 1 μ l

Oligo Bag 43(192ng/μl) 0.5μl

Oligo Bag 44(181ng/μl) 0.5μl

Pfu superelevation fidelity polymerase 1 μ l

H ₂O 41μl

Temperature program(me):

2 minutes 95 ℃

10 minutes 72 ℃

-the PCR product of the generation of the about 1102bp of size is cut out from agarose gel and purification.

The PCR product of-use purification carries out second subsequently and takes turns PCR as template:

The oligonucleotide that uses:

Bag 53:(5 '-CGCGCCTCGAGCCACATACTGGTCTGC-3 ') (SEQ ID No:143) and

Bag 51(5’-GCTTAGCTGAGGCTGCCGGATCG-3’)(SEQ ID No：144)

50 μ l PCR mixture:

10 * PCR buffer TAQ:5 μ l

Template 3.5 μ l from above PCR

DNTP mixture (10mM) 1 μ l

Oligo Bag 53(345ng/μl) 0.5μl

Oligo Bag 51(157ng/μl) 0.5μl

TAQ polymerase 1 μ l

H2O 39μl

Temperature program(me):

2 minutes 95 ℃

10 minutes 72 ℃

-with the PCR product of the generation of the about 1073bp of size from agarose gel, cut out, purification and clone in following carrier: pCR2.1-TOPO (Invitrogen).

-carrier the pCR2.1-TOPO+KBD-B (5027bp) that produces transforms subsequently, increases in escherichia coli, subsequently with XhoI and EcoRI cutting and with the KBD-B fragment of generation at pBAD/HisA (Invitrogen; Same with XhoI and EcoRI cutting) middle clone.

The carrier pBAD/HisA+KBD-B (5171bp) that-Xin forms once more with SacI and StuI cutting and with the KBD-B fragment that produces at pQE30 (Qiagen; With SacI and SmaI cutting) middle clone.Expression vector pQE30-KBD-B (the 4321bp that produces; Also see Fig. 1) be used for KBD-B express.

Comprise aminoacid MRGSHHHHHHGSACEL at aminoterminal by carrier pQE30-KBD-B extraly at the KBD-B of expression in escherichia coli (SEQ ID No:4), and comprise aminoacid GVDLQPSLIS (SEQ ID No:166) at c-terminus.

KBD-B is by the expression of pQE30-KBD-B in escherichia coli

-pre-culture inoculation is from the flat board or the glycerol culture that contain the coli strain that pQE30-KBD-B transforms (for example XL10-Gold[Stratagene]).According to main scale of cultivating, inoculation LB culture medium (about 1:100) in pipe or little flask.

-antibiotic uses according to bacterial strain uses therefor (for pQE30-KBD-B, ampicillin 100 μ g/ml).

-incubation carries out at 250 rev/mins and 37 ℃.

-inoculate master culture, master culture: have corresponding antibiotic LB culture medium or suitable minimal medium with the about 1:100 of pre-culture.At 250 rev/mins and 37 ℃ of incubations.

-induce to be higher than with 1mM IPTG at 0.5 o'clock at OD (600nm) and to carry out.

-induce 4 hours after, cell centrifugation is got off.

In fermentation tank, process is similarly, but might implement to induce in much higher OD unit and so might increase cell and protein yields significantly.

Embodiment 3: for example express C16-KBD by expression plasmid pLib76 with the IPTG inducible promoter in coli strain

Typically as an example, clone and the escherichia coli expression C16-KBD-B by transforming with pLib76 have been described in herein:

The clone of pLib76

The BsgI cleavage site that exists in the KBD-B sequence of-carrier pQE30-KBD-B (seeing embodiment 2) uses the site-directed mutagenesis kit of Quickchange XL (Stratagene), use oligonucleotide Lib197 (5 '-GAGCTCTCGACTCCTGACAATCAC-3 ')

(SEQ ID NO:145) and Lib198 (5 '-GAGCTCGGTTCCTCCGGTACCGCCTCTCCTGCGCAACAATCTTAACG-3 ') (SEQ ID NO:146) remove (SEQ ID No:147) according to manufacturer specification.The carrier that produces is called pLib50.

The plasmid DNA of-carrier pLib50 is as the pcr template of oligonucleotide Lib201 (5 '-CGTACTGCATGCGGCGGTACCGGAGGAACTGCACAAGAGCTCGAGCCACATACTGG TCTGCTCTTGC-3 ') (SEQ ID NO:148) and Lib202 (5 '-CTGCAGGTCGACCCCCTCCTGAACAGACATTTC-3 ') (SEQ ID NO:149).By oligonucleotide Lib201, the BsgI cleavage site is imported fragment.

PCR carries out in having 50 μ l reactant mixtures of following composition:

The plasmid DNA pLib50 of 1 μ l

DNTP mixture (each 10mM of 1 μ l; Eppendorf)

10 * PCR buffer+MgCl of 5 μ l ₂(Roche)

Lib201 5 ' the primer (corresponding to 50pmol) of 1 μ l

Lib202 3 ' the primer (corresponding to 50pmol) of 1 μ l

5 U Pwo-polymerases (Roche)

Use H ₂O is added into 50 μ l.

PCR is reflected under the following cycling condition and carries out:

Step 1:95 ℃, 5 minutes (degeneration)

Step 2:95 ℃, 60 seconds

Step 3:50 ℃, 45 seconds (renaturation)

Step 4:72 ℃, 2 minutes (extension)

Step 2-4 circulation 30 times

Step 5:72 ℃, 10 minutes (extend the back)

Step 6:4 ℃ (stopping)

-with the PCR product of the generation of the about 924bp of size from agarose gel, cut out, purification and clone in following carrier: pCR2.1-TOPO (Invitrogen).

The carrier pLib58 of-generation transforms subsequently, increases in escherichia coli, (sees embodiment 2 with the SphI/SalI cutting and with the KBD-B fragment that produces at pQE30-KBD-B subsequently; Cut with SphI/SalI equally) middle clone.

-(Huemmerich etc. [2004 with the spider silk fibroin ADF-4 of BsgI/BseRI cutting; The primary structure element of Aranea traction fiber and to the contribution of protein solubility; Biochemistry43:13604-13612]) in the fragment (SEQ ID No:150) of C16 structure (module) be connected among the carrier pLib59 (cutting) of generation with BsgI.

-this clone produces the chimeric nucleic acid molecule (SEQ ID No:167) of the C16 protein (SEQ ID No:151) of coding and KBD-B protein (SEQ ID No:166) fusion.Being connected of described coding nucleic acid molecules (SEQ ID No:150 and SEQ ID No:147) causes described proteinic translation to be merged, and in translation the protein of back generation according to SEQ ID No:168 takes place.The expression vector pLib76 (also referring to Fig. 2) that produces is used for follow-up C16-KBD-B to express.

C16-KBD-B is by the expression (also referring to Fig. 2) of pLib76 in escherichia coli

Pre-culture inoculation is from the flat board or the glycerol culture that contain the coli strain that pLib76 transforms (for example XL10-Gold[Stratagene]).According to main scale of cultivating, inoculation LB culture medium (about 1:100) in pipe or little flask.

-antibiotic uses according to bacterial strain uses therefor (for pLib76, ampicillin 100 μ g/ml).

-incubation carries out at 250 rev/mins and 37 ℃

-induce to be higher than with 1mM IPTG at 0.5 o'clock at OD (600nm) and to carry out.Cell carries out incubation at 32 ℃ and 250 rev/mins subsequently.

-induce 4 hours after, cell centrifugation is got off.

-in fermentation tank, process is similarly, but might in much higher OD unit, implement to induce and so might increase cell and protein yields significantly.

Fig. 6 shows the expression of C16-KBD-B, and this is by checking in Western blotting at the antibody of C16-KBD-B fusions aminoterminal His label or at the antibody of KBD-B domain.In each case, detect the protein of identical size.This shows that the protein at expression in escherichia coli comprises C16 domain and KBD-B domain really.Be used for inductive IPTG concentration and realized comparable result.

In a word, these data show and realize that C16-KBD-B is in colibacillary successful expression.

3.a KBD-B-C16 passes through the expression of expression plasmid pLib78 with the IPTG inducible promoter in coli strain

With describe among the embodiment 3 comprise the C-16 fibroin and comprise the proteinic fusion rotein variant of KBD-B opposite at c-terminus at aminoterminal, this embodiment describes the clone and the expression of the reverse variant of described fusion rotein.

Use multiple production host to be used for expressing, as multiple coli strain (for example XL10-Gold[Stratagene], BL21-CodonPlus[Stratagene], BLR (DE3) [Novagen] and other bacterial strain), bacillus megaterium, bacillus subtilis etc.

Typically as an example, clone and the escherichia coli expression KBD-B-C16 by transforming with pLib78 have been described in herein:

The clone of pLib78

-comprise the KBD-B DNA sequence carrier pLib15 plasmid DNA as oligonucleotide Lib230 (5 '-AGATCTCATCACCATCACCATCACGAGCCACATACT-3 ') (SEQ ID NO:225) and

The template of the PCR of Lib231 (5 '-AGATCTAGTTCCTCCGGTACCGCCGCTAATTAAGCTTGGCTGCAGGTC-3 ') (SEQ ID NO:226).

-under any circumstance, the BgIII cleavage site is imported through oligonucleotide Lib230 and Lib231, and joint sequence imports fragment by oligonucleotide Lib231.

PCR carries out in having 100 μ l reactant mixtures of following composition:

The plasmid of 5 μ l-DNA pLib15

DNTP mixture (the 10mM of 1 μ l; Eppendorf)

The herculase buffer of 10 μ l (10 *; Stratagene)

Lib230 5 ' the primer (corresponding to 50pmol) of 4 μ l

Lib231 3 ' the primer (corresponding to 50pmol) of 4 μ l

The herculase polymerase of 1 μ l (5U/ μ l; Stratagene)

Use H ₂O is added into 100 μ l.

PCR is reflected under the following cycling condition and carries out:

Step 1:95 ℃, 5 minutes (degeneration)

Step 2:95 ℃, 1 minute

Step 3:60 ℃, 1 minute (renaturation)

Step 4:72 ℃, 1.5 minutes (extension)

Step 2-4 circulation 30 times

Step 5:72 ℃, 10 minutes (extend the back)

Step 6:4 ℃ (stopping)

With the PCR product of the generation of the about 945bp of size from agarose gel, cut out, purification and clone in following carrier: pCR2.1-TOPO (Invitrogen).The new plasmid that forms is called pLib77.

PLib77 transforms subsequently, increases in escherichia coli, is comprising clone among plasmid pET21a (+) C16 of C16 sequence (H ü mmerich etc., 2004, Biochemistry 43:13604-13612) with the BglII cutting and with the KBD-B fragment that produces subsequently.Accepting carrier cuts with BamHI in advance.

This clone produces the chimeric nucleic acid molecule (SEQ ID No:227) of the KBD-B protein (SEQ ID No:166) of coding and C16 protein (SEQ ID No:151) fusion.Being connected of described coding nucleic acid molecules (SEQ ID No:165 and SEQ ID No:150) causes described proteinic translation to be merged, and in translation the protein of back generation according to SEQ ID No:228 takes place.The expression vector pLib78 (also referring to Figure 11) that produces is used for follow-up KBD-B-C16 to express.

KBD-B-C16 is by the expression of pLib78 in escherichia coli

-pre-culture inoculation is from flat board or the glycerol culture from the coli strain BLR (DE3) of Novagen that contain that pLib78 transforms.According to main scale of cultivating, inoculation LB culture medium (about 1:100) in pipe or little flask.

-corresponding to this carrier, the antibiotic of use is ampicillin 100 μ g/ml.

-incubation carries out at 250 rev/mins and 37 ℃

-master culture is inoculated master culture: the LB culture medium that contains ampicillin 100 μ g/ml with the about 1:100 of pre-culture.At 250 rev/mins and 37 ℃ of incubations.

-induce with 100 μ M IPTG and carried out in 0.5 o'clock being higher than OD (600nm).Cell is other 3 hours of incubation subsequently.

-induce 3 hours after, cell centrifugation is got off.

Figure 12 shows the expression of KBD-B-C16, and this is by checking in Western blotting at the antibody of the T7 label of KBD-B-C16 fusions, aminoterminal His label or at the antibody of KBD-B domain.In each case, detect the protein of identical size.This shows at the protein of expression in escherichia coli and is made up of C16 domain and KBD-B domain really.

In a word, these data show and realize that KBD-B-C16 is in colibacillary successful expression.

Protein purification carries out as described in example 11 above.The fusion rotein KBD-B-C16 of purification has expection molecular weight about 82 500.This can use at the antibody of His label, be confirmed at the antibody of T7 label with at the antibody of KBD-B.

By the formation fusion rotein KBD-B-C16 of check institute in the degree of functionality aspect the keratin binding structural domain, carried out hair in conjunction with testing (seeing embodiment 16).In this test, this fusion rotein is confirmed to the combination of hair.The degree of functionality of C16 protein portion is tested by producing microballon and film assembling form (method is seen embodiment 22a) in the KBD-B-C16 fusion rotein.KBD-B-C16 fusion rotein assembling film forming and microballon and therefore performance as the C16-KBD-B-fusion rotein.

Embodiment 4: for example express conjugated protein (the CBP)-KBD of carotenoid by expression plasmid pRee017 with the IPTG inducible promoter in coli strain

Typically as an example, clone and the escherichia coli expression CBP-KBD-B by transforming with pRee017 have been described in herein:

The clone of pRee017

-coding prepares synthetically from the DNA of the gene of the CBP (SWISS-PROT:Q8MYA9) of silkworm (B.mori) and is connected in the plasmid vector.The plasmid 051794pPCR-script that produces is as the pcr template of oligonucleotide Lib199 (5 '-GAGCTCGCCGACTCTACGTCGAAAAGC-3 ') (SEQ ID NO:169) and Lib200 (5 '-GAGCTCAGAACCTCCGGTACCACCGATTTCGGCTCTGGCCTTCGCTTCGGCCAC-3 ') (SEQ ID NO:170).

PCR carries out in having 100 μ l reactant mixtures of following composition:

Plasmid DNA 051794 pPCR-script of the band CBP of 1 μ l

DNTP mixture (each 10mM of 1 μ l; Eppendorf)

10 * Herculase buffer (Stratagene) of 10 μ l

Lib199 5 ' the primer of 4 μ l (240 μ g/ml)

Lib200 3 ' the primer of 4 μ l (730 μ g/ml)

The Herculase of 5 U (Stratagene)

Use H ₂O is added into 100 μ l

PCR is reflected under the following cycling condition and carries out:

Step 1:95 ℃, 5 minutes (degeneration)

Step 2:95 ℃, 1 minute

Step 3:58 ℃, 1 minute (renaturation)

Step 4:72 ℃, 1.5 minutes (extension)

Step 2-4 circulation 30 times

Step 5:72 ℃, 10 minutes (extend the back)

Step 6:4 ℃ (stopping)

-with the PCR product of the generation of the about 918bp of size from agarose gel, cut out, purification and clone in following carrier: pCR2.1-TOPO (Invitrogen).

The carrier pLib54 of-generation transforms subsequently and increases in escherichia coli.

The CBP gene is used following primer in later step

HRe1 (5 '-AAAGCATGCGCCGACTCTACGTCGAAAAGCGCG-3 ') (SEQ ID No:173) and

HRe2 (5 '-CCTTGAGCTCAGAACCTCCGGTACCACCGATT-3 ') (SEQ ID No:174) passes through pcr amplification.

The PCR mixture of 50 μ l:

10 * be used for the PCR buffer 5 μ l of Accu Prime polymerase (Invitrogen)

pLib54(50ng) 1μl

DNTP mixture (10mM) 3 μ l

Oligo HRe1(312ng/μl) 1μl

Oligo Hre2(338ng/μl) 1μl

Accu Prime polymerase (Invitrogen) 1 μ l

H2O 38μl

Temperature program(me):

1 minute 95 ℃

8 minutes 72 ℃

The fragment (SEQ ID No:171) that produces is cut and is cloned in pQE30-KBD-B with SphI and SacI and (sees embodiment 2; Same with SphI and SacI cutting) in.This clone produces the chimeric nucleic acid molecule (SEQ ID No:175) of the CBP protein (SEQ ID No:172) of coding and KBD-B protein (SEQ ID No:166) fusion.Therefore the expression vector pRee017 (Fig. 4) that produces comprises the nucleic acid molecules (SEQ ID.No:175) of the coding CBP protein (SEQ ID.No:172) that the nucleic acid molecules (SEQ ID No:165) with encoded K BD-B protein (SEQ ID.No:166) merges.The connection of described nucleic acid molecules causes described proteinic translation to be merged, and in translation the protein of back generation according to SEQ ID No:176 takes place.

In another embodiment, produced another variant of the chimeric nucleic acid molecule with SEQ ID No:175, the catenation sequence that the two kinds of nucleic acid of CBP protein (SEQ ID No:172) and KBD-B protein (SEQ ID No:166) of wherein will encoding are connected is by site directed mutagenesis (fast-changing site-directed mutation mutagenesis kit, Stratagene) change.Method is carried out according to the description of manufacturer.The oligonucleotide that uses is HRe22 (SEQ ID No:229) and HRe23 (SEQ ID No:230).The template of using is pRee017 (Fig. 4).

Therefore the expression vector pRee023 that produces comprises nucleic acid molecules SEQ ID No:222, the fusion rotein that this nucleic acid molecule encoding is made of CBP protein (SEQ ID No:172) and KBD-B protein (SEQ ID No:166), the sequence that wherein connects these two kinds of protein is the joint sequence of mutation (SEQ ID No:224).The connection of described nucleic acid molecules causes described proteinic translation to be merged, and in translation the protein of back generation according to SEQ ID No:223 takes place, and proteinic feature is a special proteolysis stability in producing bacterial strain.Expression vector pRee017 (also referring to Fig. 4) that produces and pRee023 are used for following CBP-KBD-B to express.

CBP-KBD-B is by pRee017 or the expression of pRee023 in escherichia coli

-pre-culture inoculation is from containing the pRee017 that is converted into coli strain or flat board or the glycerol culture of pRee023.According to main scale of cultivating, (about 1:100) inoculates in the pipe or little flask of LB culture medium.

-antibiotic uses according to bacterial strain uses therefor (for the bacterial strain that transforms with pRee017 or pRee023, ampicillin 100 μ g/ml).

-incubation carries out at 250 rev/mins and 37 ℃

-induce 4 hours after, cell centrifugation is got off.

This protein purification carries out as described in example 11 above.The fusion rotein CBP-KBD of purification has expection relative molecular weight about 70 000.This can use at the antibody of His label with at the antibody of KBD and be confirmed.

Embodiment 5: for example express metal-binding protein (ZntA)-KBD by expression plasmid pLib72 with the IPTG inducible promoter in coli strain

Typically as an example, clone and the escherichia coli expression ZntA-KBD-B by transforming with pLib72 have been described in herein:

The clone of pLib72

-chromosome e. coli dna is as the pcr template of oligonucleotide Lib212 (5 '-GAGCTCTCGACTCCTGACAATCAC-3 ') (SEQ ID NO:177) and Lib219 (5 '-GAGCTCGGTTCCTCCGGTACCGCCTCTCCTGCGCAACAATCTTAACG-3 ') (SEQ ID No:178).

-with the PCR product of the generation of the about 2223bp of size from agarose gel, cut out, purification and clone in following carrier: pCR2.1-TOPO (Invitrogen).

The carrier pLib71 that produces transforms subsequently and increases in escherichia coli, cuts and the zntA fragment (SEQ ID No:179) that produces is cloned in pQE30-KBD-B with SacI subsequently and (see embodiment 2; Cut with SacI equally) in.This clone produces the chimeric nucleic acid molecule (SEQ ID No:181) of the ZntA protein (SEQ ID.No:180) of coding and KBD-B protein (SEQ ID No:166) fusion.Therefore the expression vector pLib72 (Fig. 5) that produces comprises the nucleic acid molecules (SEQ ID.No:179) of the coding ZntA protein (SEQ ID.No:180) that the nucleic acid molecules (SEQ ID No:165) with encoded K BD-B protein (SEQ ID.No:166) merges.The connection of described nucleic acid molecules causes described proteinic translation to be merged, and in translation the protein of back generation according to SEQ ID No:182 takes place.The expression vector pLib72 (also referring to Fig. 5) that produces is used for following ZntA-KBD-B to express.

PCR carries out in having 50 μ l reactant mixtures of following composition:

The genomic DNA XL10-Gold of 1 μ l (1.7 μ g)

DNTP mixture (each 10mM of 1 μ l; Eppendorf)

10 * Herculase buffer (Stratagene) of 5 μ l

Lib212 5 ' the primer of 1 μ l (341 μ g/ml)

Lib219 3 ' the primer of 2 μ l (464 μ g/ml)

The Herculase of 5U (Stratagene)

Use H ₂O is added into 50 μ l

PCR is reflected under the following cycling condition and carries out:

Step 1:95 ℃, 5 minutes (degeneration)

Step 2:95 ℃, 1 minute

Step 3:60 ℃, 45 seconds (renaturation)

Step 4:72 ℃, 2 minutes (extension)

Step 2-4 circulation 35 times

Step 5:72 ℃, 10 minutes (extend the back)

Step 6:4 ℃ (stopping)

Embodiment 6: express thioredoxin-KBD with the IPTG inducible promoter in coli strain

Typically as an example, clone and by escherichia coli expression thioredoxin-KBD-B has been described in herein:

At first, from the purpose thioredoxin fragment of carrier pThioHisC (Invitrogen) by pcr amplification (the PCR mixture conditions is similar to embodiment 2).For this purpose, use following oligonucleotide:

Bag 102：(5’-GTAAGAATGCGGCCGCCTCCTGAACAGACATTTCTTT ATTG-3’)(SEQ ID No：183)

Bag 103：(5’-GCAGATCTAGAGGATCGCATCACCATCACCAT CACGGATCC-3’)(SEQ ID No：184)

With amplification PCR products (SEQ ID No:185) from agarose gel, cut out, purification, with restriction endonuclease NotI and BglII cutting and among pQE30-KBD-B (seeing embodiment 2), clone.

This clone produces the chimeric nucleic acid molecule (SEQ ID No:187) of the thioredoxin protein (SEQ ID.No:186) of coding and KBD-B protein (SEQ ID No:166) fusion.Therefore the expression vector that produces comprises the nucleic acid molecules (SEQID.No:185) of the coding thioredoxin protein (SEQ ID.No:186) that the nucleic acid molecules (SEQ IDNo:165) with encoded K BD-B protein (SEQ ID.No:166) merges.The connection of described nucleic acid molecules causes described proteinic translation to be merged, and in translation the protein of back generation according to SEQ ID No:188 takes place.The expression vector that produces is used for following thioredoxin-KBD-B expresses.

Embodiment 7: express eGFP-KBD with the IPTG inducible promoter in coli strain

Typically as an example, clone and by escherichia coli expression eGFP-KBD-B has been described in herein:

At first, purpose eGFP fragment increases from carrier pEGFP-1 (Clontech) by PCR (the PCR mixture conditions is similar to embodiment 2).For this purpose, use following oligonucleotide:

Bag 89：(5’-GCGAGCTCGTGAGCAAGGGCGAGGAGC-3’)

Bag 90：(5’-GCGAGCTCCTTGTACAGCTCGTCCATG-3’)

Amplification PCR products (SEQ ID No:191) is cut out from agarose gel, purification, clones with restriction endonuclease SacI cutting and among pQE30-KBD-B (seeing embodiment 2).

This clone produces the chimeric nucleic acid molecule (SEQ ID No:193) of the eGFP albumen (SEQ ID.No:192) of coding and KBD-B protein (SEQ ID No:166) fusion.Therefore the expression vector that produces comprises the nucleic acid molecules (SEQ ID.No:191) of the coding eGFP albumen (SEQ ID.No:192) that the nucleic acid molecules (SEQ ID No:165) with encoded K BD-B protein (SEQ ID.No:166) merges.The connection of described nucleic acid molecules causes described proteinic translation to be merged, and in translation the protein of back generation according to SEQ ID No:194 takes place.The expression vector that produces is used for following eGFP-KBD-B expresses.

Embodiment 8: express YaaD-KBD with the IPTG inducible promoter in coli strain

In order to express, use multiple production host, as multiple coli strain (for example XL10-Gold[Stratagene], BL21-CodonPlus[Stratagene] and other bacterial strain), bacillus megaterium, bacillus subtilis especially.

Typically as an example, clone and by escherichia coli expression YaaD-KBD has been described in herein:

At first, the purpose YaaD fragment from carrier pDX14 (OmniGene Bioproducts) increases by PCR (the PCR mixture conditions is similar to embodiment 2).For this purpose, use following oligonucleotide:

Bag 93：(5’-GCGAGCTCGCTCAAACAGGTACTGAACG-3’)(SEQID No：195)

Bag 94：(5’-GCGAGCTCCCAGCCGCGTTCTTGCATACG-3’)(SEQ ID No：196)

With amplification PCR products (SEQ ID No:197) from agarose gel, cut out, purification and being connected among the pCR2.1 TOPO (unrestriction digestion).YaaD cuts out and is cloned into pQE30-KBD-B (seeing embodiment 2) with SacI from plasmid pCR2.1 TOPO-YaaD.

This clone produces the yaaD protein (SEQ ID.No:198) that coding and KBD-B protein (SEQ ID No:166) merge) chimeric nucleic acid molecule (SEQ ID No:199).Therefore the expression vector that produces comprises the nucleic acid molecules (SEQ ID.No:197) of the coding yaaD protein (SEQ ID.No:198) that the nucleic acid molecules (SEQ ID No:165) with encoded K BD-B protein (SEQ ID.No:166) merges.The connection of described nucleic acid molecules causes described proteinic translation to be merged, and in translation the protein of back generation according to SEQ ID No:200 takes place.The expression vector that produces is used for following yaaD-KBD-B expresses.

Self-explantory is also can use carrier pRee024 (Fig. 8, embodiment 18-22) in conjunction with the fusion rotein DNA construct that mode produced by way of example in embodiment 3-8 and produce for producing keratin.KBD-D protein (SEQ IDNo:212) when therefore the fusion rotein that forms is included in the pRee024 situation.

Embodiment 9: by the aspergillus nidulans bacterial strain, use induction type alcA promoter for example by expression plasmid pLib 19 (shaking bottle) expressing K BD

In order to express, use the aspergillus nidulans wild-type strain, as RMS011 or SRF200.Typically as an example, describe with pLib19 (Fig. 6) transforming in this article, by aspergillus nidulans expressing K BD-B.

-for making up pLib19, the dna fragmentation (SEQ IDNo:152) of the encoded K BD-B of size 922bp uses oligonucleotide Lib151, and ((embodiment 2, Fig. 1) pass through pcr amplification as template for 5 '-CACCATGCATCACCATCACCATCACGAGCCACATACTGGTCTGCT-3 ' (SEQ ID No:154) and Lib152 (5 '-GCTAATTAAGCTTGGCTGCA-3 ' (SEQ ID No:155) and carrier pQE30-KBD-B.

-PCR carries out in having 50 μ l reactant mixtures of following composition:

The plasmid DNA pQE30-KBD-B of 1 μ l

DNTP mixture (each 10mM of 1 μ l; Eppendorf)

10 * PCR buffer+MgCl of 5 μ l ₂(Roche)

Lib151 5 ' the primer (corresponding to 50pmol) of 1 μ l

Lib152 3 ' the primer (corresponding to 50pmol) of 1 μ l

The Pwo polymerase (Roche) of 5U

PCR is reflected under the following cycling condition and carries out:

Step 1:95 ℃, 5 minutes (degeneration)

Step 2:95 ℃, 45 seconds

Step 3:53 ℃, 45 seconds (renaturation)

Step 4:72 ℃, 2 minutes (extension)

Step 2-4 circulation 30 times

Step 5:72 ℃, 10 minutes (extend the back)

Step 6:4 ℃ (stopping)

-PCR product is connected to carrier pENTR/D (pENTR ^TMDirectional

Clone's test kit, the E type, Invitrogen).Correct KBD-B amplification is checked by order-checking.

The dna fragmentation of-encoded K BD-B is to carrier pMT-OvE (Toews MW, Warmbold J, Konzack S, Rischitor P, Veith D, Vienken K, VinuesaC, Wei H, Fischer R; MRFP1 is as fluorescently-labeled foundation in the aspergillus nidulans and use vitro recombination method (GATEWAY) to make up the expression vector that is used for the high throughput protein labelization. (2004) Curr Genet 45:383-389) reorganization use "

LR clones enzyme ^TMEnzymatic mixture " (Invitrogen) carry out.This produces carrier pLib19 (Fig. 6).

The protoplast of-aspergillus nidulans wild-type strain circular vectors pLib19 (Yelton MM, Hamer JE, Timberlake WE; By using the trpC plasmid to transform aspergillus nidulans, (1984) Proc Natl Acad Sci USA 81:1479-1474) transform.Transformant uses chromosomal DNA by PCR and southern blotting technique analysis.

-for the aspergillus nidulans transformant of pre-culture expression KBD-B, with 100ml minimal medium (0.6%NaNO ₃0.152%KH ₂PO ₄0.052%KCI[pH6.5]; 0.8% glucose; 0.05%MgSO ₄1ml trace element solution [1g/l FeSO ₄* 7H ₂O; 8.8g/l ZnSO ₄* 7 H ₂O; 0.4g/l CuSO ₄* 5 H ₂O; 0.15g/l MnSO ₄* 4 H ₂O; 0.1g/lNa ₂B ₄O ₇* 10 H ₂O; 0.05g/l (NH ₄) ₆Mo ₇O ₂₄* 4 H ₂O] ,+bacterial strain specificity fill-in) or 100ml complete medium (2% malt extract; 0.1% peptone; 2% glucose; + bacterial strain specificity fill-in) in the 500ml flask with 10 ⁶-10 ⁷Individual spore inoculating and 200-250 rev/min and 37 ℃ incubation 16-24 hour.

-after pre-the cultivation, fungal mycelium by filtration gather in the crops, with distilled water wash and be transferred in the flask that contains the fresh minimal medium of 100-500ml.In this main medium, use 0.1% fructose place of glucose as carbon source.For inducing KBD to express, ethanol (1% final concentration) or glycerol (50mM) or sodium acetate (50mM) or ethamine or threonine are added in this culture medium extraly.The mentioned additive that is used for abduction delivering is nonrestrictive for claims.Master culture was 200-250 rev/min and 37 ℃ incubation 5-48 hour again.

-when cultivate finishing, fungal mycelium gather in the crops with centrifugal 5 minutes of 1500-3000 * g and is passed through the Menton-Gaulin fragmentation in room temperature.

-except peptide sequence SEQ ID No:4, the KBD-B that expresses in the aspergillus nidulans (SEQ ID No:152) (pLib19) comprises aminoacid MHHHHHH at aminoterminal extraly, and comprises aminoacid GVDLQPSLISKGGRADPAFLYKVVMIRLLTKPERKLLEGGPGTQLLFPLVRVNCAL GVIMVIAVSCVKLLSAHNSTQHTSRKHKV at c-terminus.

Embodiment 10: cell breakage and inclusion body purification (pQE30-KBD-B).

The KBD of solubility expression or fusion rotein-KBD can be behind cell breakage (for example by Menton-Gaulin) directly use) or by chromatography purification (seeing embodiment 11).The following purification that carries out of the KBD of insoluble expression or fusion rotein-KBD (for example in inclusion body):

-the fermentation tank content is centrifugal, precipitation is suspended in 20mM phosphate buffer pH=7.5 and passes through the Menton-Gaulin fragmentation.

-with the cell recentrifuge (15000g) of fragmentation, handle and so stir with 20mM phosphate, 500mM NaCl and 8M urea from this centrifugal precipitation.(dissolving inclusion body)

The pH regulator to 7.5 of-supernatant.

-centrifugally carry out once more subsequently and supernatant be applied on the Ni chelating agarose gel post and as described in embodiment 6 carrying out purification.

Embodiment 11: purification keratin binding structural domain B on Ni chelating agarose gel.

The His label that KBD or fusion rotein-KBD can connect by spreading all on the Ni post and chromatography ground purification.

Column material: efficient Ni-agarose gel Amersham Biosciences order number: 17-5268-02

This material is filled in the post (for example diameter 2.6cm, height 10cm) and with buffer A+4% buffer B (corresponding to the 20mM imidazoles) balance.

Protein extract (seeing for example cell breakage and inclusion body purification) use Superloop (

System) (the about 5ml/ of flow velocity minute) is applied on this post at pH 7.5.

After applying, washing is implemented with buffer A+20mM imidazoles.

Eluting is implemented with buffer B (the 500mM imidazoles in buffer A).

Eluent uses the classification of fraction catcher to collect.

Eluent desalination subsequently (helping treating spissated sample).For this reason, eluent for example passes through the medium post of Sephadex G25 (Amersham) and carries out desalination.Subsequently, in order to concentrate, for example can use the Amicon chamber (stirring-type ultrafiltration chamber, Millipore).

Buffer A: 20mM sodium dihydrogen phosphate

500mM NaCl (as required, also might use and has lower concentration

The buffer concentration of NaCl)

The 8M urea (if " activity " KBD of solubility expression is by chromatography,

Then do not need to use urea.During without urea, after then not needing

Continuous protein renaturation.)

pH＝7.50

Buffer B: 20mM sodium dihydrogen phosphate

500mM NaCl (as required, also might use and has lower concentration

The buffer concentration of NaCl)

The 8M urea

The 500mM imidazoles

pH＝7.50

Embodiment 12: the renaturation of keratin binding structural domain B or fusion rotein-KBD

Can make the keratin binding structural domain of insoluble expression or fusion rotein-KBD (for example from inclusion body) renaturation and thereby following activation:

Method 1: discontinuous dialysis

6.5ml Cellytic IB (Sigma, order number C5236) and 5mM DTT are added into 8M urea (Ni chelating eluent, HiTrap) in 6.5ml KBD-B inclusion body or fusion rotein-KBD.The solution for the treatment of renaturation is impouring bag filter (Spectrum:Spectra Por MWCO:12-14kD) subsequently.

Dialysis was implemented about 12 hours at 4 ℃ the 6M urea solution of 1L, the careful stirring.

Adding 25mM Tris/HCl pH=7.50 and the dialysis of 500ml so carried out 9 hours at 4 ℃.Add 250ml Tris buffer (seeing above) subsequently again and dialysed other 12 hours.

Adding 25mM Tris/HCl pH=7.50 and the dialysis of 500ml subsequently once more so carried out 9 hours at 4 ℃. and add 250ml Tris buffer (seeing above) subsequently again and dialysed other 12 hours.

Adding 25mM Tris/HCl pH=7.50 and the dialysis of 500ml subsequently once more so carried out 9 hours at 4 ℃.The bag filter that will contain dialysis solution subsequently places in the 2L:25mM Tris+150mMNaCl pH=7.50.Dialysis was carried out 12 hours at 4 ℃ subsequently again.

Take out the content of bag filter subsequently.

Method 2: dialysis continuously

In 8M urea (Ni chelating eluent, HiTrap) the 20ml KBD-B inclusion body in (or fusion rotein-KBD) usefulness 10ml Cellytic IB (Sigma, order number C5236) and 5mM DTT processing.Solution is the impouring dialysate chamber subsequently: Slide-A-Lyzer Dialyses Cassette PIERCE, MWCO:10 kD. order number: 66830.

Dialysis was implemented about 1 hour at 4 ℃ the 6M urea solution of 1L subsequently.

Subsequently, following buffer was metered into by peristaltic pump continuously through 48 hour time: 25mMTris/HCl pH=7.5

The bag filter that will contain dialysis solution moves into 2L last buffer eventually subsequently: 25mM Tris+150mMNaCl pH=7.50 and dialysis were carried out about 12 hours at 4 ℃.

Take out the content of bag filter subsequently.

Embodiment 13: skin in conjunction with 1 (qualitative)

Whether exploitation is looked the sight qualitative test and is combined with skin with check KBD or fusion rotein-KBD.

Used solution

Confining liquid: Western closed reagent 1921673 Roche (10 * solution) that in TBS, dilute.

TBS：20mM Tris；150mM NaCl pH 7.5

The TTBS:TBS+0.05% polysorbas20

The first step is that the laterior horn albumin layer with skin is transferred to and stablizes on the holder.For this purpose, adhesive tape is firmly applied on the application on human skin of depilation and takes off once more.This test can directly be carried out on adhesive tape, or the keratin layer of adhesion can be transferred on the microscope slide by sticking action again.The following demonstration of combination:

-for the plurality of reagents incubation, be transferred to Fa Erken (Falcon) container

-add ethanol as required with defat, remove ethanol and dry microscope slide

-room temperature and sealing buffer incubation 1 hour

-wash 2 times each 5 minutes with TTBS

-wash 1 time 5 minutes with TBS

-KBD to be tested or fusion rotein-KBD in room temperature and TBS/0.05% polysorbas20 is (with label His for example ₆, coupling such as HA) or reference protein incubation 2-4 hour

-remove supernatant

-wash 3 times with TBS

-anti-poly histidine monoclonal (or specificity KBD rabbit) the antibody incubation of room temperature and 1:2000 dilution in the TBS+0.01% sealer 1 hour

-wash 2 times each 5 minutes with TTBS

-wash 1 time 5 minutes with TBS

-the anti-mice IgG alkali phosphatase conjugate incubation of room temperature and 1:5000 dilution in the TBS+0.01% sealer 1 hour

-wash 2 times each 5 minutes with TTBS

-wash 1 time 5 minutes with TBS

-interpolation phosphatase substrate (NBT-BCIP; 1/40ml of Boehringer MA water continues 2.5 minutes; Stop: water)

-with the naked eye or use Optics in Microscope ground to detect coloured precipitation.Blue precipitation expression KBD or fusion rotein-KBD combine with skin.

Embodiment 14: with 2 (the quantitatively property) that combine of skin

Developed quantitative test, wherein the hair of KBD or fusion rotein-KBD/skin bond strength can compare with described quantitative test and nonspecific proteins.

Use 5mm cork perforator and do not drill through a part (or under situation of surface test) the hair skin (people or pig) your Ken Gainei of parts of skin insertion so that the drying of melting from a slice has.Skin samples is subsequently converted to 2-3mm thickness to remove any tissue that exists.Skin samples is transferred to Eppendorf container (low-protein associativity) subsequently to be showed (also referring to Fig. 7 so that implement combination; Perhaps also can use Episkin system [application on human skin of reconstruction] from L ' Oreal):

-wash 2 times with the PBS/0.05% polysorbas20

-be added on 1ml 1%BSA among the PBS and room temperature incubation 1 hour, gentleness rotatablely move (900 rev/mins).

-remove supernatant

-be added on 100 μ g KBD or fusion rotein-KBD among the PBS that contains 0.05% polysorbas20; Room temperature incubation 2 hours and gentleness rotatablely move (900 rev/mins).

-remove supernatant

-wash 3 times with the PBS/0.05% polysorbas20

-in mouse anti label (His6 or HA or the specific KBD) monoclonal antibody of room temperature and 1ml band peroxidase conjugated thing (containing 1:2000 among the PBS of 0.05% polysorbas20) [anti-poly histidine monoclonal antibody-peroxidase conjugated thing, in mice, produce, freeze-dried powder, Sigma] incubation 2-4 hour, gentleness rotatablely move (900 rev/mins)

-wash 3 times with the PBS/0.05% polysorbas20

-interpolation peroxidase substrate (1ml/Eppendorf container; Form and see below)

-allow reaction to carry out until showing blue (about 90 seconds).

-react with 100 μ l 2M H ₂SO ₄Stop.

-measurement absorbs at the 405nm place.

Peroxidase substrate (with not long ago preparing):

0.1ml TMB solution (the 42mM TMB in DMSO)

+ 10ml substrate buffer solution (0.1M sodium acetate, pH 4.9)

+ 14.7 μ l H ₂O ₂3% concentration

Embodiment 15: with combine (the quantitatively property) of hair

Also relevant in order to show KBD or fusion rotein-KBD with other protein to the bond strength of hair, developed a kind of quantitative property test (also referring to Fig. 7).In this test, hair at first with KBD (the excessive KBD of incubation of or fusion rotein-KBD) and flush away (or fusion rotein-KBD).Antibody-peroxidase conjugated thing is subsequently by KBD (the His label of or fusion rotein-KBD) and coupling.The unconjugated antibody of flush away-peroxidase conjugated thing once more.Bonded antibody-peroxidase conjugated thing [anti-poly histidine monoclonal antibody-peroxidase conjugated thing, in mice, produce, freeze-dried powder, Sigma] colourless substrate (TMB) can be changed into and can sentence coloured product that the photometering mode is measured at 405nm.The intensity that absorbs is indicated bonded KBD (or the fusion rotein-KBD) or the amount of aligned protein.Selected aligned protein for example is the YaaD from bacillus subtilis, and wherein YaaD has the His label that is used to detect equally because of this test is required.Also can use and the alternative His label of other specific antibody of peroxidase conjugated.

5mg hair (people) is cut into the section of length 5mm and it is transferred to Eppendorf container (low-protein associativity) to be showed so that implement combination:

-add 1ml ethanol with defat

-centrifugal, remove ethanol and use H ₂O washs hair

-being added on 1ml 1%BSA among the PBS and room temperature incubation 1 hour, gentleness rotatablely moves.

-centrifugal, remove supernatant

-(or fusion rotein-KBD) is (with label His for example to be added on KBD to be tested in the 1ml PBS/0.05% polysorbas20 ₆, coupling such as HA) or reference protein; In 4 ℃ of incubations 16 hours (or room temperature at least 2 hours), gentleness rotatablely moves.

-centrifugal, remove supernatant

-wash 3 times with the PBS/0.05% polysorbas20

-in mouse anti label (His6 or HA) monoclonal antibody (1:2000 in the PBS/0.05% polysorbas20) [the anti-poly histidine monoclonal antibody-peroxidase conjugated thing of room temperature and 1ml band peroxidase conjugated thing, in mice, produce, freeze-dried powder, Sigma] incubation 2-4 hour, gentleness rotatablely moves

-wash 3 times with the PBS/0.05% polysorbas20

-interpolation peroxidase substrate (1ml/Eppendorf container)

-allow reaction to carry out until showing blue (about 2 minutes).

-react with 100 μ l 2M H ₂SO ₄Stop.

-measurement absorbs at the 405nm place.

Peroxidase substrate (with not long ago preparing):

0.1ml TMB solution (the 42mM TMB in DMSO)

+ 10ml substrate buffer solution (0.1M sodium acetate pH 4.9)

+ 14.7 μ l H ₂O ₂3% concentration

The BSA=bovine serum albumin

The saline solution of PBS=phosphate-buffered

Polysorbas20=anhydrous sorbitol polyoxyethylene ether monolaurate, n about 20

TMB=3,5,3 ', 5 '-tetramethyl benzidine

Compare with the combination that comparison protein YaaD is obviously relatively poor, to KBD-B by way of example mode showed KBD-B (SEQ ID No:166) and the bonded clear superiority of hair what hair was implemented in conjunction with test:

1	Buffer	A _405nm＝0.000
1	Buffer	A _405nm＝0.000	2	Comparison protein YaaD	A _405nm＝0.088
3	Degeneration KBD-B	A _405nm＝0.254	2	Comparison protein YaaD	A _405nm＝0.088
3	Degeneration KBD-B	A _405nm＝0.254	4	Renaturation KBD-B	A _405nm＝1.591

Table 7: to the quantitative KBD activity test of hair: 1) buffer; 2) comparison protein YaaD; 3) degeneration KBD-B; 4) renaturation KBD-B.This table is presented at the absorption value that the 405nm place is measured.

Embodiment 16: the hair of fusion rotein-KBD-B is in conjunction with activity

In order to check fusion rotein-KBD-B whether also to combine, developed a kind of quantitative property test (see figure 7) with hair.This test in, hair at first with fusion rotein-KBD-B incubation and the unconjugated fusion rotein-KBD-B of flush away.Peroxidase is the coupling by the His label of KBD-B subsequently.The unconjugated peroxidase of flush away once more.Bonded peroxidase can change into colourless substrate (TMB) can sentence coloured product that the photometering mode is measured at 405nm.The amount that the intensity that absorbs is indicated bonded fusion rotein-KBD-B.Selected comparative sample is the proteic KBD-B of amixis.

1	The KBD-B reference sample	A _405nm＝0.65
1	The KBD-B reference sample	A _405nm＝0.65	2	The C16-KBD-B fusion rotein	A _405nm＝0.59

The hair that the C16-KBD-B fusion rotein is compared with the KBD-B reference protein is in conjunction with activity.Shown in these results, with KBD-B protein (A _405nm=0.65) fusion rotein (A that compares _405nm=0.59) in fact hair does not change in conjunction with activity.

In a word, these activity tests show that multiple fusion rotein-KBD-B construct has excellent hair in conjunction with activity, as KBD-B itself.In most of the cases, hair does not reduce in conjunction with activity, but at least seldom be lower than 20% the proteic KBD-B of amixis in conjunction with active.

Embodiment 16a: beta-carotene is to the combination according to the CBP-KBD fusion rotein of embodiment 4 preparation

Mode shows and the compared combination of protein KBD-B (SEQ ID No.4) CBP-KBD-B when comparing (SEQ ID No.223) to hair in conjunction with test the hair that fusion rotein CBP-KBD-B (SEQ ID No.223) is carried out by way of example.Identical result is applicable to that hair that mode by way of example carries out with C16-KBD (SEQ ID No.168) and KBD-B-C16 (SEQ ID 228) is in conjunction with test.

Studied with KBD (SEQ ID No.4) and compared, beta-carotene is to the combination of CBP-KBD (SEQ IDNo.223).The UV-Vis absorption spectra of beta-carotene has the maximum at 440nm.This characteristic is used to study the combination of beta-carotene to fusion rotein.At first, the CBP-KBD solution of various concentration (0-20 μ M) mixes with the alcoholic solution of the beta-carotene of same amount.When the concentration increase of fusion rotein, the colour developing of solution increases.This is observed by the photometric measurement at 440nm and determines.

	0μM CBP-KBD-B	10μM CBP-KBD-B	20μM CBP-KBD-B
	0μM CBP-KBD-B	10μM CBP-KBD-B	20μM CBP-KBD-B	Average absorption at 440nm	0.059	0.195	0.261

Be the combination of checking beta-carotene to the CBP-KBD fusion rotein, under any circumstance, KBD solution mixes with the alcoholic solution of the beta-carotene of same concentrations with CBP-KBD solution (having identical mole respectively) and to the buffer dialysed overnight.Next day, the combination of beta-carotene by measuring solution at 440nm the absorption value and compare with the calibration trace of beta-carotene solution.Although the conclusion that obtains is that CBP-KBD compares with KBD, in conjunction with the beta-carotene of twice through dialysis.This as a result Display Realization by the successful combination of fusion rotein to beta-carotene.

Embodiment 17: check successful coupled action (ehrmann's test)

Effector molecule is link coupled successfully monitors by two kinds of different tests:

(iv) wherein can measure free Cys-SH base in the protein ehrmann's test of number before the effector molecule coupling and afterwards.Herein, the sound response process is represented in the free obvious minimizing of SH base after coupling.

(v) wherein can measure KBD (or fusion rotein-KBD) to hair in conjunction with activity test.Good fusion rotein-KBD should reduce the activity of the fusion rotein-KBD that compares with non-link coupled KBD.

Reference (iii)

Material requested:

-ellman's reagent: in the 0.1M sodium phosphate buffer 5 of 4mg/1ml, 5 '-two sulfur two (2-nitrobenzoic acid) (DTNB);

-0.1M sodium phosphate buffer pH 8.0

-cysteine solution (26.3mg one hydration cysteine hydrochloride/100ml sodium phosphate buffer) solution is and must is with preparation not long ago.

1. under any circumstance, 25 μ l, 50 μ l, 100 μ l, 150 μ l, 200 μ l and 250 μ l cysteine solution are moved into test tube (13 x 100mm) to form calibration trace.Each test tube of protein example impouring to be determined (volume＜=250 μ l).For KBD to be tested, each reactant mixture distributes the amount of 1mg at least.Under the situation of test tube, then cumulative volume under any circumstance is adjusted to 250 μ l with sodium phosphate buffer.If 250 μ l sample volumes excessive (because required 1mg KBD) when using 2.5ml sodium phosphate buffer liquid feeding in the 2nd, are taken into account this point.

2. under any circumstance, add 50 μ l ellman's reagents and 2.5ml sodium phosphate buffer.Of short duration mixing and room temperature incubation 15 minutes.

3. measure absorption at 412nm.

4. structure calibration trace, the value of mapping and reading protein example to be determined.

Embodiment 18: expression plasmid pRee024 (Fig. 8) the expressing K BD-D (SEQ ID No:212) that uses band IPTG inducible promoter by coli strain

In order to express, use coli strain XL10 Gold[Stratagene].

Typically as an example, clone and the escherichia coli expression KBD-D protein (SEQ ID No:213) by transforming with pRee024 (Fig. 8) have been described in herein:

The clone of pRee024

The PCR of KBD-D gene of being used to increase carries out with two steps.5 ' terminal and 3 ' end at first, independently increases.These fragments are to be used to increase the basis of complete KBD-D gene.

5 ' terminal following the carrying out of PCR is used to increase:

Primer has following sequence:

HRe6：5’-ATGAACCACTCGCCGCTCAAGACCGCCTTG-3’(SEQID No：216)

HRe9：5’-CGTTCCCGGTTCTCCTCAGGAGGCTGACTG-3’(SEQ ID No：217)

100 μ l PCR mixture:

10 * be used for the PCR buffer of superelevation fidelity Pfu: 10 μ l

λ DNA (744ng/ μ l) 1 μ l (1:10 dilution)

DNTP mixture (10mM) 10 μ l

HRe6(196ng/μl) 1μl

HRe9(201ng/μl) 1μl

Pfu superelevation fidelity polymerase 1 μ l

Two steaming H ₂O 76 μ l

Temperature program(me):

2 minutes 95 ℃

-agarose gel detect the size about 1kb fragment.With the reactant purification and hereinafter as 5 ' terminal template of amplification KBD-D gene.

3 ' terminal following the carrying out of PCR is used to increase:

Primer has following sequence:

HRe7：5’-TTAGAATCGGGAGGTGAAGTTCCTGAGGCT-3’(SEQID No：218)

HRe8：5’-CACCACCAACAAGCTGGAGACCCGGAG-3’(SEQ IDNo：219)

100 μ l PCR mixture:

10 * be used for the PCR buffer of superelevation fidelity Pfu: 10 μ l

λ DNA (744ng/ μ l) 1 μ l (1:10 dilution)

DNTP mixture (10mM) 10 μ l

Hre7(201ng/μl) 1μl

HRe8(209ng/μl) 1μl

Pfu superelevation fidelity polymerase 1 μ l

Two steaming H ₂O 76 μ l

Temperature program(me):

2 minutes 95 ℃

-agarose gel detect the size about 1.2kb fragment.With the reactant purification and hereinafter as 3 ' terminal template of amplification KBD-D gene.

-for amplification KBD-D gene, use 5 ' terminal template and 3 ' terminal template as the basis.PCR is following to carry out:

100 μ l PCR mixture:

10 * be used for the PCR buffer of superelevation fidelity Pfu: 10 μ l

DNTP mixture (10mM) 10 μ l

Two steaming H ₂O 75 μ l

5 ' terminal template 1 μ l

3 ' terminal template 1 μ l

Pfu superelevation fidelity polymerase 1 μ l

H ₂O 76μl

Temperature program(me):

After 10 circulations, add the primer HRe6 (196 μ g/ml) of 1 μ l and HRe7 (206 μ g/ml) and 1 μ l Pfu superelevation fidelity polymerase and to the following temperature program(me) of this reaction enforcement:

Temperature program(me):

2 minutes 95 ℃

Add 1 μ l Taq polymerase to it then, and with mixture 72 ℃ of incubations 10 minutes.

-with the PCR product of the generation of the about 2150bp of size from agarose gel, cut out, purification and be cloned into following carrier: pCR2.1-TOPO (Invitrogen).

The carrier pRee019 (6112bp) that produces transforms subsequently, increases in escherichia coli, and the KBD-D gene is checked by order-checking.

Subsequently, the KBD-D gene clone is gone in the expression vector.For this reason, another PCR is that template is carried out with carrier pRee019:

Used oligonucleotide:

HRe26：5’-CTCGGTACCAACCACTCGCCGCTCAAGACCGCCTTGGCG-3’(SEQ ID No：220)

HRe27：5’-ATTAAGCTTTTAGAATCGGGAGGTGAAGTTCCTGAGGCT-3’(SEQ ID No：221)

100 μ l PCR mixture:

10 * be used for the PCR buffer of superelevation fidelity Pfu: 10 μ l

pRee019(25ng/μl) 1μl

DNTP mixture (10mM) 10 μ l

HRe26(287ng/μl) 1μl

HRe27(354ng/μl) 1μl

Pfu superelevation fidelity polymerase 1 μ l

Two steaming H ₂O 76 μ l

Temperature program(me):

2 minutes 95 ℃

-agarose gel detect the size about 2.2kb fragment.With the reactant purification and subsequently with restriction endonuclease KpnI and HindIII cutting; With the fragment cloning that produces to expression vector.This produces and is used for the carrier pRee024 that KBD-D expresses subsequently.

KBD-D (SEQ ID No:212) is by the expression of pRee024 in escherichia coli

-pre-culture inoculation is from the flat board or the glycerol culture of the coli strain (for example TG10) that contains the pRee024 conversion.According to main scale of cultivating, inoculation LB culture medium (about 1:100) in pipe or little flask.

-antibiotic uses according to bacterial strain uses therefor (for the escherichia coli that transform with pRee024 TG10, ampicillin 100 μ g/ml).

-incubation carries out at 250 rev/mins and 37 ℃.

-induce with 1mM IPTG be higher than 1 OD _578nmShi Jinhang.Heated culture temperature is reduced to room temperature (about 20 ℃) subsequently.With cell centrifugal (see figure 9) down after inducing 2 hours.

Embodiment 19: cell breakage and inclusion body purification (pRee024)

The following purification of the KBD-D of insoluble expression (SEQ ID No:213) (for example in inclusion body):

Cell precipitation from embodiment 2 is resuspended in the 20mM phosphate buffer pH=7.5 that contains 100mM NaCl and passes through the supersound process fragmentation.

Cell recentrifuge (4 ℃, 12000g, 20 minutes) with fragmentation.Abandoning supernatant.With resolution of precipitate at buffer A (10mM NaH ₂PO ₄, 2mM KH ₂PO ₄, 100mM NaCl, 8M urea, 5mM DTT) in.Be applied on the Ni chelating agarose gel with the mixture recentrifuge and with supernatant.After applying, with buffer A and the washing of 20mM imidazoles.With buffer B (10mMNaH ₂PO ₄, 2mM KH ₂PO ₄, 100mM NaCl, 8M urea, 5mM DTT, 500mM imidazoles) and the eluting of enforcement from post.Eluent is collected in the fraction and by SDS-PAGE and analyzes.The fraction that comprises purification KBD-D carries out renaturation as described in example 13 above.

Embodiment 20: the renaturation of keratin binding structural domain D (SEQ ID No:213)

The keratin binding structural domain of insoluble expression (for example from inclusion body) can renaturation and therefore activation by dialysis.Process is as follows:

The fraction impouring bag filter (MWCO12-14KD) that comprises purification KBD-D from embodiment 19.

Dialysis was carried out about 1 hour the 8M urea solution of 1L subsequently.

Subsequently, the 2L demineralized water was metered into by peristaltic pump continuously through 12 hour period.

Take out the content of bag filter subsequently.Activatory by this way KBD-D is used for following activity test.

Embodiment 21: combine with the qualitative of skin

Whether use is looked the sight qualitative test and is combined with skin with check KBD-D (SEQ ID No:213).

The solution that uses:

Confining liquid: Western closed reagent 1921673 Roche (10 * solution) that in TBS, dilute

TBS：20mM Tris；150mM NaCl pH 7.5

The TTBS:TBS+0.05% polysorbas20

-for the plurality of reagents incubation, be transferred to Fa Erken (Falcon) container, add ethanol as required with defat, remove ethanol and dry microscope slide

-room temperature and sealing buffer incubation 1 hour

-wash 2 times each 5 minutes with TTBS

-wash 1 time 5 minutes with TBS

-KBD (with for example coupling such as His6, HA of label) to be tested incubation 2-4 hour in room temperature and TBS/0.05% polysorbas20

-remove supernatant

-wash 3 times with TBS

-room temperature with have mouse anti label (His6 or HA) monoclonal antibody (1:2000 in the TBS+0.01% sealer) [anti-poly histidine monoclonal antibody-peroxidase conjugated thing of peroxidase conjugated thing, in mice, produce, freeze-dried powder, Sigma] incubation 1 hour

-wash 2 times each 5 minutes with TTBS

-wash 1 time 5 minutes with TBS

-with the naked eye or use Optics in Microscope ground to detect coloured precipitation.On the adhesive tape of handling with KBD-D, can see blue precipitation, promptly anti-poly histidine-AP conjugate and the interactional reactant of KBD-D.As negative control, adhesive tape is only handled with buffer.Can not detect tangible blue colour developing therein.These results show that KBD-D combines with skin keratin on the adhesive tape.

Embodiment 22: combine with the quantitative property of skin and hair

Compare with KBD-B (SEQ ID No:166) for research, KBD-D (SEQ ID No:213) to the bond strength of skin and hair, carries out quantitative test.In this test, hair at first with the excessive KBD-B of KBD-B or KBD-D incubation and flush away or-D.Antibody-peroxidase conjugated thing subsequently by KBD-B or-the His label of D and coupling.The unconjugated antibody of flush away-peroxidase conjugated thing once more.Bonded antibody-peroxidase conjugated thing can change into colourless substrate (TMB) can sentence coloured product that the photometering mode is measured at 405nm.The intensity that absorbs indicate bonded KBD-B or-amount of D.

Bonded test personnel selection keratinocyte following carrying out in the microtitration flat board with skin.

-wash 2 times with the PBS/0.05% polysorbas20

-remove supernatant

-be added on 100 μ g KBD among the PBS that contains 0.05% polysorbas20; Room temperature incubation 2 hours and gentleness rotatablely move (900 rev/mins).

-remove supernatant

-wash 3 times with the PBS/0.05% polysorbas20

-on room temperature and 1ml mouse anti label-His6 monoclonal antibody incubation 2-4 hour, gentleness rotatablely move (900 rev/mins)

-wash 3 times with the PBS/0.05% polysorbas20

-interpolation peroxidase substrate (1ml/Eppendorf container; Form and see below) react until showing blue (about 90 seconds).

-react with 100 μ l 2M H ₂SO ₄Stop.

-measurement absorbs at the 405nm place.

Peroxidase substrate (with not long ago preparing):

0.1ml TMB solution (the 42mM TMB in DMSO)

+ 10ml substrate buffer solution (0.1M sodium acetate, pH 4.9)

+ 14.7 μ l H ₂O ₂3% concentration

For comparing with KBD-B, characterize the hair combination of KBD-D, carry out below in conjunction with test:

-add 1ml ethanol with defat

-centrifugal, remove ethanol and use H ₂O washs hair

-centrifugal, remove supernatant

-be added on KBD to be tested in the 1ml PBS/0.05% polysorbas20 (with for example coupling such as His6, HA of label) or reference protein; Room temperature incubation 2 hours, gentleness rotatablely moves

-centrifugal, remove supernatant

-wash 3 times with the PBS/0.05% polysorbas20

-interpolation peroxidase substrate (1ml/Eppendorf container)

-allow reaction to carry out until showing blue (90 seconds).

-react with 100 μ l 2M H ₂SO ₄Stop.

Measure absorption at the 405nm place.

Peroxidase substrate (with not long ago preparing):

0.1ml TMB solution (the 42mM TMB in DMSO)

+ 10ml substrate buffer solution (0.1M sodium acetate pH 4.9)

+ 14.7 μ l H ₂O ₂3% concentration

The BSA=bovine serum albumin

The saline solution of PBS=phosphate-buffered

Polysorbas20=anhydrous sorbitol polyoxyethylene ether monolaurate, n about 20

TMB=3,5,3 ', 5 '-tetramethyl benzidine

Table 10a:KBD-D or KBD-B are to the quantitative property combination of skin.Listed absorption value is to (skin) surface standardized value in addition.

Table 10b:KBD-D is to the quantitative property combination of hair.Listed absorption value is to surface standardized value in addition.

Table 10c: with % represent with respect to KBD-D and untreated hair of KBD-B or skin, after 10% concentration SDS handled, KBD-D and KBD-B were to the quantitative sexual reaction of skin and hair.

These results show that protein KBD-D can combine and combine with skin more consumingly (seeing Table 10) with hair.With respect to KBD-B (SEQ ID No:166), the combination of KBD-D (SEQ ID No:168) only more faintly is subjected to the nearly SDS solution washing influence (seeing Table 10a) of 10% concentration.

The microballon of embodiment 22a:C16-KBD and film

In experimental analytic process, whether intention demonstration fusion rotein C16-KBD can form the assembling form and combine with hair.Microballon is from (dialysis back 5mM KH ₂PO ₄) in the aqueous solution by 1M KH with the 1-3 volume ₂PO ₄Buffer precipitates and produces.Pure C16 spider silk fibroin forms the spheroidal particle (Fig. 9) with the about 100nm-10 μ of size distribution m.The C16-KBD-B fusion rotein also forms spherical particle (Fig. 9).

Film equally can be from (dialysis back 5mM KH ₂PO ₄) protein aqueous solution or from the hexafluoroisopropanol solution that comprises 10-50mg/ml C16-KBD-B-fusion rotein, produce.For this purpose, in laboratory, measure several milliliters of described solution suctions to polystyrene surface (for example agar plate) and make solvent evaporation.The water-solubility protein plasma membrane that this generation can be taken off from described surface.Therefore the special nature of C16 spider silk fibroin is that this water-solubility membrane can be processed subsequently and becomes water-insoluble.For this reason, with KH ₂PO ₄Film use 100% Ethanol Treatment subsequently.The C16 albuminous membranae then no longer is water miscible.If C16-KBD-B solution is applied to polystyrene surface, after drying, film forms equally subsequently, and this film becomes water-insoluble after with Ethanol Treatment.In a word, can determine to produce assembling form from the C16-KBD fusion rotein.

Embodiment 22b: the film on hair forms

Purpose is intended to show whether the film formation of C16-KBD fusion rotein takes place on hair.For this reason, with hair in corresponding proteins matter solution incubation or not with protein incubation, dry and analyze (see figure 10) by ultramicroscope (SEM).

After handling hair with C16-KBD, make a scale smooth significantly, this shows C16-KBD-B fusion rotein film forming on hair surface.

The skin cosmetic product of the present invention of the effector molecule C16-KBD-B (according to SEQ ID No:168) that comprises the keratin-binding for preparing according to embodiment 3 is hereinafter described.C16-KBD-B mentions in following examples as fusion rotein-KBD by representing above-mentioned whole other KBD fusion rotein modes.It will be appreciated by those skilled in the art that all other described KBD fusion rotein also can use corresponding KBD fusion protein construct (for example basis (SEQ ID No:212's) KBD-D protein among the pRee024 (Fig. 8)) to be prepared according to embodiment 3, and use in the described hereinafter goods.

Embodiment 23: use KBD in nursing oil/water type day with Emulsion

AI 1％：

% composition (INCI)

A 1.7 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

0.7 16/octadecyl polyoxyethylene (25) ether

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 PEG-14 polydimethylsiloxane

3.6 16/octadecanol

6.0 ethylhexyl methoxy cinnamate

2.0 dibutyl adipate

B 5.0 glycerol

0.2 EDTA disodium

1.0 pantothenylol

An amount of antiseptic

67.8 demineralized water

C 4.0 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

D 0.2 phosphoric acid sodium ascorbate

1.0 tocopherol acetate

0.2 bisabolol

1.0 glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of sodium hydroxide of E

AI 5％：

% composition (INCI)

A 1.7 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

0.7 16/octadecyl polyoxyethylene (25) ether

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 PEG-14 polydimethylsiloxane

3.6 16/octadecanol

6.0 ethylhexyl methoxy cinnamate

2.0 dibutyl adipate

B 5.0 glycerol

0.2 EDTA disodium

1.0 pantothenylol

An amount of antiseptic

63.8 demineralized water

C 4.0 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

D 0.2 phosphoric acid sodium ascorbate

1.0 tocopherol acetate

0.2 bisabolol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of sodium hydroxide of E

Preparation: A is heated to about 80 ℃ mutually independently of one another with B mutually.With B be stirred to mutually A mutually in and homogenize.The A that C is stirred to merging mutually mutually and B mutually in homogenize once more also.Be cooled to about 40 ℃, stir simultaneously, add the D phase, use E to regulate pH mutually to about 6.5, homogenize also is cooled to room temperature, stirs simultaneously.

Attention: under unprotect gas, prepare said preparation.Bottling must for example be carried out in the aluminum pipe at the packing material of oxygen flow not.

Embodiment 24: use KBD in oil/water type protectiveness day cream

AI 1％：

% composition (INCI)

A 1.7 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

0.7 16/octadecyl polyoxyethylene (25) ether

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 PEG-14 polydimethylsiloxane

3.6 16/octadecanol

6.0 ethylhexyl methoxy cinnamate

2.0 dibutyl adipate

B 5.0 glycerol

0.2 EDTA disodium

1.0 pantothenylol

An amount of antiseptic

68.6 demineralized water

C 4.0 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

D 1.0 phosphoric acid sodium ascorbates

1.0 tocopherol acetate

0.2 bisabolol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of sodium hydroxide of E

AI 5％：

% composition (INCI)

A 1.7 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

0.7 16/octadecyl polyoxyethylene (25) ether

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 PEG-14 polydimethylsiloxane

3.6 16/octadecanol

6.0 ethylhexyl methoxy cinnamate

2.0 dibutyl adipate

B 5.0 glycerol

0.2 EDTA disodium

1.0 pantothenylol

An amount of antiseptic

64.6 demineralized water

C 4.0 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

D 1.0 phosphoric acid sodium ascorbates

1.0 tocopherol acetate

0.2 bisabolol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of sodium hydroxide of E

Preparation: A is heated to about 80 ℃ mutually independently of one another with B mutually.With B be stirred to mutually A mutually in and homogenize.The A that incorporates C into merging mutually mutually and B mutually in homogenize also.Be cooled to about 40 ℃, stir simultaneously.Add the D phase, use E to regulate pH mutually to about 6.5 and homogenize.Be cooled to room temperature, stir simultaneously.

Embodiment 25: use KBD in oil/water profile portion cleaning washing liquid

AI 1％：

% composition (INCI)

A 10.0 thylhexoic acids 16/stearyl

10.0 glycerol three (caprylic/capric) ester

1.5 ring-type five polysiloxanes, ring-type six polysiloxanes

2.0 polyoxyethylene (40) castor oil hydrogenated

B 3.5 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

C 1.0 tocopherol acetates

0.2 bisabolol

An amount of antiseptic

An amount of aromatic oil

D 3.0 polyquaternary ammonium salt-44

0.5 cocoyl trimethyl sulphuric acid dimethylammonium

0.5 16/octadecyl polyoxyethylene (25) ether

2.0 pantothenylol, propylene glycol

4.0 propylene glycol

0.1 EDTA disodium

1.0 have the aqueous solution of about 5% fusion rotein-KBD

60.7 demineralized water

AI 5％：

% composition (INCI)

A 10.0 thylhexoic acids 16/stearyl

10.0 glycerol three (caprylic/capric) ester

1.5 ring-type five polysiloxanes, ring-type six polysiloxanes

2.0 polyoxyethylene (40) castor oil hydrogenated

B 3.5 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

C 1.0 tocopherol acetates

0.2 bisabolol

An amount of antiseptic

An amount of aromatic oil

D 3.0 polyquaternary ammonium salt-44

0.5 cocoyl trimethyl sulphuric acid dimethylammonium

0.5 16/octadecyl polyoxyethylene (25) ether

2.0 pantothenylol, propylene glycol

4.0 propylene glycol

0.1 EDTA disodium

5.0 have the aqueous solution of about 5% fusion rotein-KBD

56.7 demineralized water

Preparation: dissolving A phase.Stir B go into mutually A mutually in.The A that incorporates C into merging mutually mutually with B mutually in.With the D phased soln, A, the B that is stirred to merging and C mutually in and homogenize.After this stirred 15 minutes.

Embodiment 26: use KBD in daily body care spray

AI 1％：

% composition (INCI)

A 3.0 ethylhexyl methoxy cinnamates

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

1.0 polyquaternary ammonium salt-44

3.0 propylene glycol

2.0 pantothenylol, propylene glycol

1.0 ring-type five polysiloxanes, ring-type six polysiloxanes

10.0 octyldodecanol

0.5 PVP

10.0 glycerol three (caprylic/capric) ester

3.0 benzoic acid C12-15 Arrcostab

3.0 glycerol

1.0 tocopherol acetate

0.3 bisabolol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

59.2 alcohol

AI 5％：

% composition (INCI)

A 3.0 ethylhexyl methoxy cinnamates

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

1.0 polyquaternary ammonium salt-44

3.0 propylene glycol

2.0 pantothenylol, propylene glycol

1.0 ring-type five polysiloxanes, ring-type six polysiloxanes

10.0 octyldodecanol

0.5 PVP

10.0 glycerol three (caprylic/capric) ester

3.0 benzoic acid C12-15 Arrcostab

3.0 glycerol

1.0 tocopherol acetate

0.3 bisabolol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

55.2 alcohol

Preparation: each component of weighing A phase and dissolving are until clarification.

Embodiment 27: use KBD in the skin nursing gel

AI 1％：

% composition (INCI)

A 3.6 polyoxyethylene (40) castor oil hydrogenated

15.0 alcohol

0.1 bisabolol

0.5 tocopherol acetate

An amount of aromatic oil

B 3.0 pantothenylol

0.6 carbomer

1.0 have the aqueous solution of about 5% fusion rotein-KBD

75.4 demineralized water

C 0.8 triethanolamine

AI 5％：

% composition (INCI)

A 3.6 polyoxyethylene (40) castor oil hydrogenated

15.0 alcohol

0.1 bisabolol

0.5 tocopherol acetate

An amount of aromatic oil

B 3.0 pantothenylol

0.6 carbomer

5.0 have the aqueous solution of about 5% fusion rotein-KBD

71.4 demineralized water

C 0.8 triethanolamine

The preparation: with the A phased soln until clarification.Make B phase swelling and neutralize mutually with C.A is stirred to mutually the interior mutually and homogenize of B of homogenize.

Embodiment 28: use KBD in shaving afterwards with washing liquid

AI 1％：

% composition (INCI)

A 10.0 basic caproic acid 16/stearyl

5.0 tocopherol acetate

1.0 bisabolol

0.1 aromatic oil

0.3 acrylate/acrylic acid C10-30 alkyl ester cross-linked polymer

B 15.0 alcohol

1.0 pantothenylol

3.0 glycerol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

0.1 triethanolamine

63.5 demineralized water

AI 5％：

% composition (INCI)

A 10.0 thylhexoic acids 16/stearyl

5.0 tocopherol acetate

1.0 bisabolol

0.1 aromatic oil

0.3 acrylate/acrylic acid C10-30 alkyl ester cross-linked polymer

B 15.0 alcohol

1.0 pantothenylol

3.0 glycerol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

0.1 triethanolamine

59.5 demineralized water

Preparation: the component of A phase is mixed.With the B phased soln, incorporate into A mutually in and homogenize.

Embodiment 29: after Exposure to Sunlight with using KBD in the washing liquid

AI 1％：

% composition (INCI)

A 0.4 acrylate/acrylic acid C10-30 alkyl ester cross-linked polymer

15.0 thylhexoic acid 16/stearyl

0.2 bisabolol

1.0 tocopherol acetate

An amount of aromatic oil

B 1.0 pantothenylol

15.0 alcohol

3.0 glycerol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

63.2 demineralized water

C 0.2 triethanolamine

AI 5％：

% composition (INCI)

A 0.4 acrylate/acrylic acid C10-30 alkyl ester cross-linked polymer

15.0 thylhexoic acid 16/stearyl

0.2 bisabolol

1.0 tocopherol acetate

An amount of aromatic oil

B 1.0 pantothenylol

15.0 alcohol

3.0 glycerol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

59.2 demineralized water

C 0.2 triethanolamine

Preparation: the component of A phase is mixed.Stir B go into mutually A mutually in and homogenize.Neutralize mutually and homogenize once more with C.

Embodiment 30: use KBD in suntan lotion

AI 1％：

% composition (INCI)

A 4.5 ethylhexyl methoxy cinnamates

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

3.0 2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite

2.5 the two C12-13 Arrcostabs of malic acid

0.5 tocopherol acetate

4.0 polyglycereol (3) methyl glucoside distearate

B 3.5 different n-nonanoic acid 16/octadecane esters

1.0 VP/ eicosylene copolymer

5.0 2-Methylpentadecane

2.5 the two C12-13 Arrcostabs of malic acid

3.0 titanium dioxide, trimethoxy decoyl silane

C 5.0 glycerol

1.0 16/sodium stearyl sulfate

0.5 Xanthan gum

59.7 demineralized water

D 1.0 has the aqueous solution of about 5% fusion rotein-KBD

1.0 phenoxyethanol, methyl parahydroxybenzoate, ethylparaben, butyl p-hydroxybenzoate, propyl p-hydroxybenzoate, p-Hydroxybenzoic acid isobutyl ester

0.3 bisabolol

AI 5％：

% composition (INCI)

A 4.5 ethylhexyl methoxy cinnamates

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

3.0 2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite

2.5 the two C12-13 Arrcostabs of malic acid

0.5 tocopherol acetate

4.0 polyglycereol (3) methyl glucoside distearate

B 3.5 different n-nonanoic acid 16/octadecane esters

1.0 VP/ eicosylene copolymer

5.0 2-Methylpentadecane

2.5 the two C12-13 Arrcostabs of malic acid

3.0 titanium dioxide, trimethoxy decoyl silane

C 5.0 glycerol

1.0 16/sodium stearyl sulfate

0.5 Xanthan gum

55.7 demineralized water

D 5.0 has the aqueous solution of about 5% fusion rotein-KBD

0.3 bisabolol

Preparation: A is heated to about 80 ℃ independently of one another with B component mutually mutually.With B be stirred to mutually A mutually in and homogenize.With the C heat phase to about 80 ℃ and the A that is stirred to merging mutually and B mutually in, the while homogenize.Be cooled to about 40 ℃, stir simultaneously, add mutually and once more homogenize of D.

Embodiment 31: use KBD in oil/water type suntan lotion

AI 1％：

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

3.0 glycerol San behenic acid ester

2.0 16/octadecanol

2.0 thylhexoic acid 16/stearyl

5.0 ethylhexyl methoxy cinnamate

1.0 ethylhexyl triazinone

1.0 VP/ eicosylene copolymer

7.0 isopropyl myristate

B 5.0 zinc oxide, triethoxy decoyl silane

C 0.2 Xanthan gum

0.5 2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers,

Squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate

0.2 EDTA disodium

5.0 propylene glycol

0.5 pantothenylol

60.9 demineralized water

D 1.0 has the aqueous solution of about 5% fusion rotein-KBD

0.5 phenoxyethanol, methyl parahydroxybenzoate, ethylparaben, butyl p-hydroxybenzoate, propyl p-hydroxybenzoate, p-Hydroxybenzoic acid isobutyl ester

1.0 tocopherol acetate

0.2 bisabolol

AI 5％：

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

3.0 glycerol San behenic acid ester

2.0 16/octadecanol

2.0 thylhexoic acid 16/stearyl

5.0 ethylhexyl methoxy cinnamate

1.0 ethylhexyl triazinone

1.0 VP/ eicosylene copolymer

7.0 isopropyl myristate

B 5.0 zinc oxide, triethoxy decoyl silane

C 0.2 Xanthan gum

0.5 2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers,

Squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate

0.2 EDTA disodium

5.0 propylene glycol

0.5 pantothenylol

56.9 demineralized water

D 5.0 has the aqueous solution of about 5% fusion rotein-KBD

1.0 tocopherol acetate

0.2 bisabolol

Preparation: heating A is mutually to about 80 ℃, be stirred to B mutually in and homogenize 3 minutes.Similarly heat C to 80 ℃ and the A that is stirred to merging mutually and B mutually in, the while homogenize.Be cooled to about 40 ℃, be stirred to D mutually in and homogenize once more.

Embodiment 32: use KBD in oil/water type suntan lotion

AI 1％：

% composition (INCI)

A 3.5 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

1.5 16/octadecyl polyoxyethylene (25) ether

7.5 ethylhexyl methoxy cinnamate

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 ring-type five polysiloxanes, ring-type six polysiloxanes

0.5 Cera Flava

3.0 16/octadecanol

10.0 glycerol three (caprylic/capric) ester

B 5.0 titanium dioxide, silicon dioxide, polymethyl siloxane, aluminium oxide

C 3.0 glycerol

0.2 EDTA disodium

0.3 Xanthan gum

1.0 decyl glucoside

2.0 pantothenylol, propylene glycol

56.3 demineralized water

D 1.0 has the aqueous solution of about 5% fusion rotein-KBD

1.0 tocopherol acetate

0.2 bisabolol

An amount of aromatic oil

An amount of antiseptic

AI 5％：

% composition (INCI)

A 3.5 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

1.5 16/octadecyl polyoxyethylene (25) ether

7.5 ethylhexyl methoxy cinnamate

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 ring-type five polysiloxanes, ring-type six polysiloxanes

0.5 Cera Flava

3.0 16/octadecanol

10.0 glycerol three (caprylic/capric) ester

B 5.0 titanium dioxide, silicon dioxide, polymethyl siloxane, aluminium oxide

C 3.0 glycerol

0.2 EDTA disodium

0.3 Xanthan gum

1.0 decyl glucoside

2.0 pantothenylol, propylene glycol

52.3 demineralized water

D 5.0 has the aqueous solution of about 5% fusion rotein-KBD

1.0 tocopherol acetate

0.2 bisabolol

An amount of aromatic oil

An amount of antiseptic

Embodiment 33: use KBD in sufficient face cream

AI 1％：

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

5.0 thylhexoic acid 16/stearyl

4.0 spermol

4.0 glyceryl stearate

5.0 mineral oil

0.2 menthol

0.5 Camphora

B 69.3 demineralized waters

An amount of antiseptic

C 1.0 bisabolols

1.0 tocopherol acetate

D 1.0 has the aqueous solution of about 5% fusion rotein-KBD

5.0 Radix Hamamelidis Mollis extract

AI 5％：

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

5.0 thylhexoic acid 16/stearyl

4.0 spermol

4.0 glyceryl stearate

5.0 mineral oil

0.2 menthol

0.5 Camphora

B 65.3 demineralized waters

An amount of antiseptic

C 1.0 bisabolols

1.0 tocopherol acetate

D 5.0 has the aqueous solution of about 5% fusion rotein-KBD

5.0 Radix Hamamelidis Mollis extract

Preparation: A is heated to about 80 ℃ independently of one another with B component mutually mutually.Stir B go into mutually A mutually in, homogenize simultaneously.Be cooled to about 40 ℃, stir simultaneously, add C mutually with D mutually and of short duration subsequently homogenize.Be cooled to room temperature, stir simultaneously.

Embodiment 34: use KBD in containing the water/oil emulsion of bisabolol

AI 1％：

% composition (INCI)

A 6.0 polyoxyethylene (7) castor oil hydrogenated

8.0 thylhexoic acid 16/stearyl

5.0 isopropyl myristate

15.0 mineral oil

0.3 magnesium stearate

0.3 aluminium stearate

2.0 PEG-45/ dodecyl diol copolymer

B 5.0 glycerol

0.7 magnesium sulfate

55.6 demineralized water

C 1.0 has the aqueous solution of about 5% fusion rotein-KBD

0.5 tocopherol acetate

0.6 bisabolol

AI 5％：

% composition (INCI)

A 6.0 polyoxyethylene (7) castor oil hydrogenated

8.0 thylhexoic acid 16/stearyl

5.0 isopropyl myristate

15.0 mineral oil

0.3 magnesium stearate

0.3 aluminium stearate

2.0 PEG-45/ dodecyl diol copolymer

B 5.0 glycerol

0.7 magnesium sulfate

51.6 demineralized water

C 5.0 has the aqueous solution of about 5% fusion rotein-KBD

0.5 tocopherol acetate

Preparation: A is heated to about 85 ℃ mutually independently of one another with B mutually.With B be stirred to mutually A mutually in and homogenize.Be cooled to about 40 ℃, stir simultaneously, add C phase and of short duration homogenize once more.Be cooled to room temperature, stir simultaneously.

Be used for the preparation tabulation of patentability keratin binding structural domain-hair-care

Embodiment 35: the foam conditioner that contains setting agent (setting agent)

AI 1％

% composition (INCI)

A 10.0 PVP/VA copolymers

0.2 ethoxy cetyl dimethyl ammonium phosphate

0.2 16/octadecyl polyoxyethylene (25) ether

0.5 dimethicone copolyol

An amount of aromatic oil

10.0 alcohol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

68.1 demineralized water

10.0 propane/butane

AI 5％

% composition (INCI)

A 10.0 PVP/VA copolymers

0.2 ethoxy cetyl dimethyl ammonium phosphate

0.2 16/octadecyl polyoxyethylene (25) ether

0.5 dimethicone copolyol

An amount of aromatic oil

10.0 alcohol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

64.1 demineralized water

10.0 propane/butane

Preparation: each component of the A phase of weighing together, stir until every kind of component and dissolve and bottle.

Embodiment 36: the foam conditioner

AI 1％

% composition (INCI)

A 1.0 hydroxyethyl-celluloses/diallyldimethylammonium chloride copolymer

0.5 ethoxy cetyl dimethyl ammonium phosphate

1.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of aromatic oil

An amount of antiseptic

91.5 demineralized water

6.0 propane/butane

AI 5％

% composition (INCI)

A 1.0 hydroxyethyl-celluloses/diallyldimethylammonium chloride copolymer

0.5 ethoxy cetyl dimethyl ammonium phosphate

5.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of aromatic oil

An amount of antiseptic

87.5 demineralized water

6.0 propane/butane

Preparation: each component of the A phase of weighing together, stir until every kind of component and dissolved to produce settled solution and bottling.

Embodiment 37: the foam conditioner

AI 1％

% composition (INCI)

A 1.0 polyquaternary ammonium salt-11

0.5 ethoxy cetyl dimethyl ammonium phosphate

1.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of aromatic oil

An amount of antiseptic

91.5 demineralized water

6.0 propane/butane

AI 5％

% composition (INCI)

A 1.0 polyquaternary ammonium salt-11

0.5 ethoxy cetyl dimethyl ammonium phosphate

5.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of aromatic oil

An amount of antiseptic

87.5 demineralized water

6.0 propane/butane

Preparation: each component of the A phase of weighing, stir until every kind of component and dissolved to produce settled solution and bottling.

Embodiment 38: the hair fashioning foam

AI 1％

% composition (INCI)

A 0.5 lauryl polyoxyethylene (4) ether

An amount of aromatic oil

B 77.3 demineralized waters

10.0 polyquaternary ammonium salt-28

1.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 dimethicone copolyol

0.2 16/octadecyl polyoxyethylene (25) ether

0.2 pantothenylol

0.1 PEG-25 PABA

0.2 hydroxyethyl-cellulose

C 10.0 HFC 152 A

AI 5％

% composition (INCI)

A 0.5 lauryl polyoxyethylene (4) ether

An amount of aromatic oil

B 73.3 demineralized waters

10.0 polyquaternary ammonium salt-28

5.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 dimethicone copolyol

0.2 16/octadecyl polyoxyethylene (25) ether

0.2 pantothenylol

0.1 PEG-25 PABA

0.2 hydroxyethyl-cellulose

C 10.0 HFC 152 A

Preparation: the component of A phase is mixed.Add each component and the dissolving of B phase one by one.Bottle mutually with C.

Embodiment 39: the hair fashioning foam

AI 1％

% composition (INCI)

A 2.0 cocoyl trimethyl sulphuric acid dimethylammoniums

An amount of aromatic oil

B 78.5 demineralized waters

6.7 acrylate copolymer

0.6 AMP

1.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 dimethicone copolyol

0.2 16/octadecyl polyoxyethylene (25) ether

0.2 pantothenylol

0.1 PEG-25 PABA

0.2 hydroxyethyl-cellulose

C 10.0 HFC 152 A

AI 5％

% composition (INCI)

A 2.0 cocoyl trimethyl sulphuric acid dimethylammoniums

An amount of aromatic oil

B 74.5 demineralized waters

6.7 acrylate copolymer

0.6 AMP

5.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 dimethicone copolyol

0.2 16/octadecyl polyoxyethylene (25) ether

0.2 pantothenylol

0.1 PEG-25 PABA

0.2 hydroxyethyl-cellulose

C 10.0 HFC 152 A

Embodiment 40: the hair fashioning foam

AI 1％

% composition (INCI)

A 2.0 cocoyl trimethyl sulphuric acid dimethylammoniums

An amount of aromatic oil

B 7.70 polyquaternary ammonium salt-44

1.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of antiseptic

79.3 demineralized water

C 10.0 propane/butane

AI 5％

% composition (INCI)

A 2.0 cocoyl trimethyl sulphuric acid dimethylammoniums

An amount of aromatic oil

B 7.70 polyquaternary ammonium salt-44

5.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of antiseptic

75.3 demineralized water

C 10.0 propane/butane

Preparation: the component of A phase is mixed.The component of dissolving B phase is until clarification, stir subsequently B go into mutually A mutually in.Regulate pH to 6-7, bottle mutually with C.

Embodiment 41: the hair fashioning foam

AI 1％

% composition (INCI)

A 2.00 cocoyl trimethyl sulphuric acid dimethylammoniums

An amount of aromatic oil

B 72.32 demineralized waters

2.00 VP/ acrylate/methacrylic acid lauryl alcohol ester copolymer

0.53 AMP

1.00 have the aqueous solution of about 5% fusion rotein-KBD

0.20 16/octadecyl polyoxyethylene (25) ether

0.50 pantothenylol

0.05 5-benzoyl-4-hydroxyl-2-methoxy benzenesulfonic acid

0.20 amino-terminated polydimethylsiloxane, hexadecyltrimethylammonium chloride, tridecyl polyoxyethylene (12) ether

15.00 alcohol

C 0.20 hydroxyethyl-cellulose

D 6.00 propane/butane

AI 5％

% composition (INCI)

A 2.00 cocoyl trimethyl sulphuric acid dimethylammoniums

An amount of aromatic oil

B 68.32 demineralized waters

2.00 VP/ acrylate/methacrylic acid lauryl alcohol ester copolymer

0.53 AMP

5.00 have the aqueous solution of about 5% fusion rotein-KBD

0.20 16/octadecyl polyoxyethylene (25) ether

0.50 pantothenylol

0.05 5-benzoyl-4-hydroxyl-2-methoxy benzenesulfonic acid

15.00 alcohol

C 0.20 hydroxyethyl-cellulose

D 6.00 propane/butane

Preparation: the component of A phase is mixed.Add each component and the dissolving of B phase one by one.The C phased soln in the mixture of A and B, is regulated pH to 6-7 subsequently.Bottle mutually with D.

Embodiment 42: the hair fashioning foam

AI 1％

% composition (INCI)

A 2.00 hexadecyltrimethylammonium chlorides

An amount of aromatic oil

B 67.85 demineralized waters

7.00 hydroxyethyl-cellulose/diallyldimethylammonium chloride copolymer 6

1.00 have the aqueous solution of about 5% fusion rotein-KBD

0.20 16/octadecyl polyoxyethylene (25) ether

0.50 pantothenylol

0.05 5-benzoyl-4-hydroxyl-2-methoxy benzenesulfonic acid

15.00 alcohol

C 0.20 hydroxyethyl-cellulose

D 6.00 propane/butane

AI 5％

% composition (INCI)

A 2.00 hexadecyltrimethylammonium chlorides

An amount of aromatic oil

B 63.85 demineralized waters

7.00 hydroxyethyl-cellulose/diallyldimethylammonium chloride copolymer 6

5.00 have the aqueous solution of about 5% fusion rotein-KBD

0.20 16/octadecyl polyoxyethylene (25) ether

0.50 pantothenylol

0.05 5-benzoyl-4-hydroxyl-2-methoxy benzenesulfonic acid

15.00 alcohol

C 0.20 hydroxyethyl-cellulose

D 6.00 propane/butane

Embodiment 43: the hair fashioning foam

AI 1％

% composition (INCI)

An amount of polyoxyethylene of A (40) castor oil hydrogenated

An amount of aromatic oil

85.5 demineralized water

B 7.0 kayexalates

1.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 cetyl trimethyl ammonium bromide

An amount of antiseptic

C 6.0 propane/butane

The hair fashioning foam

AI 5％

% composition (INCI)

An amount of polyoxyethylene of A (40) castor oil hydrogenated

An amount of aromatic oil

81.5 demineralized water

B 7.0 kayexalates

5.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 cetyl trimethyl ammonium bromide

An amount of antiseptic

C 6.0 propane/butane

Preparation: make A phase solubilising.With B be weighed into mutually A mutually in and the dissolving until clarification.Regulate pH to 6-7, bottle mutually with C.

Embodiment 40: the hair fashioning foam

AI 1％

% composition (INCI)

An amount of polyoxyethylene of A (40) castor oil hydrogenated

An amount of aromatic oil

92.0 demineralized water

B 0.5 polyquaternary ammonium salt-10

1.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 cetyl trimethyl ammonium bromide

An amount of antiseptic

C 6.0 propane/butane

AI 5％

% composition (INCI)

An amount of polyoxyethylene of A (40) castor oil hydrogenated

An amount of aromatic oil

88.0 demineralized water

B 0.5 polyquaternary ammonium salt-10

5.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 cetyl trimethyl ammonium bromide

An amount of antiseptic

C 6.0 propane/butane

Embodiment 44: the hair fashioning foam

AI1 ％

% composition (INCI)

An amount of polyoxyethylene of A (40) castor oil hydrogenated

An amount of aromatic oil

82.5 demineralized water

B 10.0 polyquaternary ammonium salt-16

1.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 ethoxy cetyl dimethyl ammonium phosphate

An amount of antiseptic

C 6.0 propane/butane

AI 5％

% composition (INCI)

An amount of polyoxyethylene of A (40) castor oil hydrogenated

An amount of aromatic oil

78.5 demineralized water

B 10.0 polyquaternary ammonium salt-16

5.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 ethoxy cetyl dimethyl ammonium phosphate

An amount of antiseptic

C 6.0 propane/butane

Embodiment 45: the hair fashioning foam

AI 1％

% composition (INCI)

A 2.0 cocoyl trimethyl sulphuric acid dimethylammoniums

An amount of aromatic oil

B 84.0 demineralized waters

2.0 chitosan

1.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 dimethicone copolyol

0.2 16/octadecyl polyoxyethylene (25) ether

0.2 pantothenylol

0.1 PEG-25 PABA

C 10.0 HFC 152 A

AI 5％

% composition (INCI)

A 2.0 cocoyl trimethyl sulphuric acid dimethylammoniums

An amount of aromatic oil

B 80.0 demineralized waters

2.0 chitosan

5.0 have the aqueous solution of about 5% fusion rotein-KBD

0.5 dimethicone copolyol

0.2 16/octadecyl polyoxyethylene (25) ether

0.2 pantothenylol

0.1 PEG-25 PABA

C 10.0 HFC 152 A

Embodiment 46: conditioning shampoo

AI 1％

% composition (INCI)

A 30.0 sodium laureth sulfates

6.0 N-cocamidopropyl ethyl-N-hydroxyethyl Sodium Glycinate

6.0 cocoamidopropyl

3.0 sodium laureth sulfate, diglycol stearate, cocoyl monoethanolamine, lauryl polyoxyethylene (10) ether

1.0 have the aqueous solution of about 5% fusion rotein-KBD

7.7 polyquaternary ammonium salt-44

2.0 amino-terminated polydimethylsiloxane

An amount of aromatic oil

An amount of antiseptic

1.0 sodium chloride

43.3 demineralized water

An amount of citric acid of B

AI 5％

% composition (INCI)

A 30.0 sodium laureth sulfates

6.0 N-cocamidopropyl ethyl-N-hydroxyethyl Sodium Glycinate

6.0 cocoamidopropyl

5.0 have the aqueous solution of about 5% fusion rotein-KBD

7.7 polyquaternary ammonium salt-44

2.0 amino-terminated polydimethylsiloxane

An amount of aromatic oil

An amount of antiseptic

1.0 sodium chloride

39.3 demineralized water

An amount of citric acid of B

Preparation: the component of A phase is mixed and dissolving.With the Fructus Citri Limoniae acid for adjusting pH to 6-7.

Embodiment 47: shower gels

AI 1％

% composition (INCI)

A 40.0 sodium laureth sulfates

5.0 decyl glucoside

5.0 cocoamidopropyl

1.0 have the aqueous solution of about 5% fusion rotein-KBD

1.0 pantothenylol

An amount of aromatic oil

An amount of antiseptic

2.0 sodium chloride

46.0 demineralized water

An amount of citric acid of B

AI 5％

% composition (INCI)

A 40.0 sodium laureth sulfates

5.0 decyl glucoside

5.0 cocoamidopropyl

5.0 have the aqueous solution of about 5% fusion rotein-KBD

1.0 pantothenylol

An amount of aromatic oil

An amount of antiseptic

2.0 sodium chloride

42.0 demineralized water

An amount of citric acid of B

Embodiment 48: shampoo

AI 1％

% composition (INCI)

A 40.0 sodium laureth sulfates

5.0 C12-15 alkyl polyoxyethylene (15) ether sulfonic acid sodium

5.0 decyl glucoside

An amount of aromatic oil

0.1 phytantriol

44.6 demineralized water

1.0 have the aqueous solution of about 5% fusion rotein-KBD

0.3 polyquaternary ammonium salt-10

1.0 pantothenylol

An amount of antiseptic

1.0 lauryl polyoxyethylene (3) ether

2.0 sodium chloride

AI 5％

% composition (INCI)

A 40.0 sodium laureth sulfates

5.0 C12-15 alkyl polyoxyethylene (15) ether sulfonic acid sodium

5.0 decyl glucoside

An amount of aromatic oil

0.1 phytantriol

40.6 demineralized water

5.0 have the aqueous solution of about 5% fusion rotein-KBD

0.3 polyquaternary ammonium salt-10

1.0 pantothenylol

An amount of antiseptic

1.0 lauryl polyoxyethylene (3) ether

2.0 sodium chloride

Embodiment 49: shampoo

AI 1％

% composition (INCI)

A 15.00 cocoamidopropyl

10.00 the amino oxalic acid disodium of N-cocamidopropyl ethyl-N-hydroxyethyl

5.00 anhydrous sorbitol polyoxyethylene (20) ether laurate

5.00 decyl glucoside

An amount of aromatic oil

An amount of antiseptic

1.00 have the aqueous solution of about 5% fusion rotein-KBD

0.15 Rhaball Gum CG-M 8M

2.00 lauryl polyoxyethylene (3) ether

58.00 demineralized water

An amount of citric acid

B 3.00 distearyl acid polyethylene glycol (150) esters

AI 5％

% composition (INCI)

A 15.00 cocoamidopropyl

10.00 the amino oxalic acid disodium of N-cocamidopropyl ethyl-N-hydroxyethyl

5.00 anhydrous sorbitol polyoxyethylene (20) ether laurate

5.00 decyl glucoside

An amount of aromatic oil

An amount of antiseptic

5.00 have the aqueous solution of about 5% fusion rotein-KBD

0.15 Rhaball Gum CG-M 8M

2.00 lauryl polyoxyethylene (3) ether

54.00 demineralized water

An amount of citric acid

B 3.00 distearyl acid polyethylene glycol (150) esters

Preparation: each component of weighing A phase and dissolving.Regulate pH to 6-7.Add the B phase and be heated to about 50 ℃.Be cooled to room temperature, stir simultaneously.

Embodiment 50: moisture retention body care frost

AI 1％

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (25) ether

2.0 16/octadecyl polyoxyethylene (6) ether, octadecanol

3.0 thylhexoic acid 16/stearyl

1.0 polydimethylsiloxane

4.0 16/octadecanol

3.0 self-emulsifying type tristerin

5.0 mineral oil

4.0 simmondsia (Jojoba) seed oil

3.0 mineral oil, lanolin alcohol

B 5.0 propylene glycol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

1.0 pantothenylol

0.5 Magnesiumaluminumsilicate

The q.s antiseptic

65.5 demineralized water

An amount of aromatic oil of C

An amount of citric acid of D

AI 5％

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (25) ether

2.0 16/octadecyl polyoxyethylene (6) ether, octadecanol

3.0 thylhexoic acid 16/stearyl

1.0 polydimethylsiloxane

4.0 16/octadecanol

3.0 self-emulsifying type tristerin

5.0 mineral oil

4.0 simmondsia (Jojoba) seed oil

3.0 mineral oil, lanolin alcohol

B 5.0 propylene glycol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

1.0 pantothenylol

0.5 Magnesiumaluminumsilicate

The q.s antiseptic

61.5 demineralized water

An amount of aromatic oil of C

An amount of citric acid of D

Preparation: A is heated to about 80 ℃ respectively mutually with B mutually.Of short duration pre-homogenize B phase, subsequently B is stirred to mutually A mutually in and homogenize once more.Be cooled to about 40 ℃, add C mutually and thoroughly once more homogenize with the Fructus Citri Limoniae acid for adjusting pH to 6-7.

Embodiment 51: moisture retention body care frost

AI 1％

% composition (INCI)

A 6.0 polyoxyethylene (7) castor oil hydrogenated

10.0 thylhexoic acid 16/stearyl

5.0 isopropyl myristate

7.0 mineral oil

0.5 Adeps Bovis seu Bubali resin (Butyrospermum)

0.5 aluminium stearate

0.5 magnesium stearate

0.2 bisabolol

0.7 dihydro tallow alkyl dimethyl ammonium chloride-hectorite

B 5.0 dipropylene glycols

0.7 magnesium sulfate

An amount of antiseptic

62.9 demineralized water

An amount of aromatic oil of C

1.0 have the aqueous solution of about 5% fusion rotein-KBD

AI 5％

% composition (INCI)

A 6.0 polyoxyethylene (7) castor oil hydrogenated

10.0 thylhexoic acid 16/stearyl

5.0 isopropyl myristate

7.0 mineral oil

0.5 Adeps Bovis seu Bubali resin (Butyrospermum)

0.5 aluminium stearate

0.5 magnesium stearate

0.2 bisabolol

0.7 dihydro tallow alkyl dimethyl ammonium chloride-hectorite

B 5.0 dipropylene glycols

0.7 magnesium sulfate

An amount of antiseptic

58.9 demineralized water

An amount of aromatic oil of C

5.0 have the aqueous solution of about 5% fusion rotein-KBD

Preparation: A is heated to about 80 ℃ respectively mutually with B mutually.With B be stirred to mutually A mutually in and homogenize.Be cooled to about 40 ℃, stir simultaneously, add mutually and once more homogenize of C.Allow to be cooled to room temperature, stir simultaneously.

Embodiment 52: at the bottom of the wet-milling-and oil/water type

AI 1％

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

6.0 glyceryl stearate

1.0 spermol

8.0 mineral oil

7.0 thylhexoic acid 16/stearyl

0.2 polydimethylsiloxane

B 3.0 propylene glycol

1.0 pantothenylol

An amount of antiseptic

61.9 demineralized water

C 0.1 bisabolol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of aromatic oil

D 5.7 C.I.77891, titanium dioxide

1.1 ferrum oxide

AI 5％

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

6.0 glyceryl stearate

1.0 spermol

8.0 mineral oil

7.0 thylhexoic acid 16/stearyl

0.2 polydimethylsiloxane

B 3.0 propylene glycol

1.0 pantothenylol

An amount of antiseptic

57.9 demineralized water

C 0.1 bisabolol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of aromatic oil

D 5.7 C.I.77891, titanium dioxide

1.1 ferrum oxide

Preparation: A is heated to about 80 ℃ respectively mutually with B mutually.With B be stirred to mutually A mutually in and homogenize.Be cooled to about 40 ℃, stir simultaneously, add C mutually with the mutually and thorough homogenize once more of D.Allow to be cooled to room temperature, stir simultaneously.

Embodiment 53

Hereinafter describe skin cosmetic product of the present invention, it comprises the effector molecule (according to the C16-KBD-B of SEQ ID No:168) according to the keratin-binding of embodiment 3 preparations.The fusion rotein of described keratin-binding uses as the about 5 weight % concentration that account for aqueous solution weight.Following data are weight portions.

The cleaning shampoo

Shampoo

Composition (INCI)	1	2	3	4	5
Composition (INCI)	1	2	3	4	5	Sodium laureth sulfate	1	-	-	0.1	-
Decyl glucoside	5.00	5.50	4.90	3.50	7.00	Sodium laureth sulfate	1	-	-	0.1	-
Decyl glucoside	5.00	5.50	4.90	3.50	7.00	Cocos nucifera oil acylamino-propyl group is sweet	10.00	5.00	12.50	7.50	15.00

Dish alkali
Dish alkali						Aromatic oil	0.10	0.10	0.10	0.10	0.10
Fusion rotein-KBD	1.0	5.0	0.1	20	10.0	Aromatic oil	0.10	0.10	0.10	0.10	0.10
Fusion rotein-KBD	1.0	5.0	0.1	20	10.0	D-panthenol USP	0.50	1.00	0.80	1.50	0.50
Antiseptic	0.10	0.10	0.10	0.10	0.10	D-panthenol USP	0.50	1.00	0.80	1.50	0.50
Antiseptic	0.10	0.10	0.10	0.10	0.10	Citric acid	0.10	0.10	0.10	0.10	0.10
Lauryl polyoxyethylene (3) ether	0.50	2.00	0.50	0.50	2.00	Citric acid	0.10	0.10	0.10	0.10	0.10
Lauryl polyoxyethylene (3) ether	0.50	2.00	0.50	0.50	2.00	Sodium chloride	1.50	1.50	1.50	1.50	1.50
Demineralized water	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Sodium chloride	1.50	1.50	1.50	1.50	1.50

The cleaning conditioning shampoo

Foam oil/aqueous emulsion

	Emulsion 1	Emulsion 2
	Emulsion 1	Emulsion 2		Weight %	Volume %	Weight %	Volume %
Stearic acid	5.00	1.00		Weight %	Volume %	Weight %	Volume %
Stearic acid	5.00	1.00	Spermol	5.50
16/octadecanol		2.00	Spermol	5.50
16/octadecanol		2.00	Stearic acid Polyethylene Glycol (40) ester	8.50
Stearic acid Polyethylene Glycol (20) ester		1.00	Stearic acid Polyethylene Glycol (40) ester	8.50
Stearic acid Polyethylene Glycol (20) ester		1.00	Glycerol three (caprylic/capric) ester	4.00		2.00
Benzoic acid C12-15 Arrcostab	10.00	15.00	Glycerol three (caprylic/capric) ester	4.00		2.00
Benzoic acid C12-15 Arrcostab	10.00	15.00	Annular dimethyl polysiloxane	4.00
Polydimethylsiloxane		0.50	Annular dimethyl polysiloxane	4.00
Polydimethylsiloxane		0.50	Fusion rotein-KBD	5.0		10.0
The isostearic acid Octyl Nitrite		5.00	Fusion rotein-KBD	5.0		10.0
The isostearic acid Octyl Nitrite		5.00	Myristyl myristate			2.00
Ceresin	1.50		Myristyl myristate			2.00
Ceresin	1.50		Glycerol			3.00
The hydroxypropyl starch phosphate ester	1.00	3.50	Glycerol			3.00
The hydroxypropyl starch phosphate ester	1.00	3.50	BHT			0.02
The EDTA disodium	0.50	0.10	BHT			0.02
The EDTA disodium	0.50	0.10	Aromatic oil, antiseptic	In right amount		In right amount

Coloring agent	In right amount		In right amount
Coloring agent	In right amount		In right amount	Potassium hydroxide	In right amount	In right amount
Demineralized water	Add to 100		Add to 100	Potassium hydroxide	In right amount	In right amount
Demineralized water	Add to 100		Add to 100		Regulate pH to 6.5-7.5	Regulate pH to 5.0-6.0
Emulsion 1		70			Regulate pH to 6.5-7.5	Regulate pH to 5.0-6.0
Emulsion 1		70		Emulsion 2			35
Nitrogen		30		Emulsion 2			35
Nitrogen		30		Propane/butane			65

The conditioning shampoo of band pearly-lustre

Regulate pH to 6.0

The cleaning conditioning shampoo

Regulate pH to 6.0

Cleaning conditioning shampoo with bulk effect

Regulate pH to 6.0

The gel cream

The OW sun-screening agent

Aqueous dispersion

The sun-proof Emulsion of WO

The strip cosmetics

The gel cream

The OW oneself shines black preparation

	1	2	3	4	5	6	7
	1	2	3	4	5	6	7	The self-emulsifying type glycerol monostearate	0.50	1.00	3.00			1.50

Ester
Ester								Glycerol stearic acid citrate	2.00		1.00	2.00	4.00
Stearic acid		3.00		2.00				Glycerol stearic acid citrate	2.00		1.00	2.00	4.00
Stearic acid		3.00		2.00				Stearic acid Polyethylene Glycol (40) ester	0.50					2.00
Phosphoric acid spermaceti alcohol ester						1.00		Stearic acid Polyethylene Glycol (40) ester	0.50					2.00
Phosphoric acid spermaceti alcohol ester						1.00		16/octadecanol sulfuric ester							0.75
Octadecanol			3.00			2.00	0.60	16/octadecanol sulfuric ester							0.75
Octadecanol			3.00			2.00	0.60	Spermol	2.50	1.10		1.50	0.60		2.00
Fusion rotein-KBD	0.1	0.5	0.025	5.0	3.0	10.0	1.0	Spermol	2.50	1.10		1.50	0.60		2.00
Fusion rotein-KBD	0.1	0.5	0.025	5.0	3.0	10.0	1.0	Dihydroxy acetone			3.00	5.00		4
Superfine titanic oxide	1.00				1.50		1.50	Dihydroxy acetone			3.00	5.00		4
Superfine titanic oxide	1.00				1.50		1.50	Super fine zinc oxide				0.25		2.00
Benzoic acid C12-15 Arrcostab		0.25			4.00	7.00		Super fine zinc oxide				0.25		2.00
Benzoic acid C12-15 Arrcostab		0.25			4.00	7.00		Dicaprylyl ether			3.50		2.00
Butanediol two sad/dicaprates	5.00		6.00					Dicaprylyl ether			3.50		2.00
Butanediol two sad/dicaprates	5.00		6.00					The glyceryl cocoate class			6.00		2.00
Polydimethylsiloxane	0.50		1.00		2.00			The glyceryl cocoate class			6.00		2.00
Polydimethylsiloxane	0.50		1.00		2.00			Annular dimethyl polysiloxane	2.00		0.50		0.50
Butyrospermum (Adeps Bovis seu Bubali resin)		2.00						Annular dimethyl polysiloxane	2.00		0.50		0.50
Butyrospermum (Adeps Bovis seu Bubali resin)		2.00						VP/ hexadecene copolymer	0.20			0.50		1.00
Glycerol	3.00	7.50		7.50	5.00		2.50	VP/ hexadecene copolymer	0.20			0.50		1.00
Glycerol	3.00	7.50		7.50	5.00		2.50	Xanthan gum	0.15		0.05			0.30
Carbomer sodium		0.20		0.15	0.25			Xanthan gum	0.15		0.05			0.30
Carbomer sodium		0.20		0.15	0.25			Vitamin E acetate	0.60		0.23		0.70	1.00
Biological carbohydrate gum-1		3.00	10.00					Vitamin E acetate	0.60		0.23		0.70	1.00
Biological carbohydrate gum-1		3.00	10.00					Soybean oil				0.50		1.50	1.00
Ethylhexyl glycerol	0.30							Soybean oil				0.50		1.50	1.00

Dimethyl dihydroxymethyl hydantoin		0.60	0.40	0.20
Dimethyl dihydroxymethyl hydantoin		0.60	0.40	0.20				The iodo propinyl butyl carbamate				0.18	0.20
Methyl parahydroxybenzoate	0.15		0.25		0.50			The iodo propinyl butyl carbamate				0.18	0.20
Methyl parahydroxybenzoate	0.15		0.25		0.50			Phenoxyethanol	1.00	0.40			0.40	0.50	0.40
The EDTA trisodium	0.02		0.05					Phenoxyethanol	1.00	0.40			0.40	0.50	0.40
The EDTA trisodium	0.02		0.05					Imino-diacetic succinic acid four sodium				0.25	1.00
Ethanol	2.00	1.50		3.00		1.20	5.00	Imino-diacetic succinic acid four sodium				0.25	1.00
Ethanol	2.00	1.50		3.00		1.20	5.00	Aromatic oil	0.10	0.25	0.30		0.40	0.20
Demineralized water	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Aromatic oil	0.10	0.25	0.30		0.40	0.20

OW foundation cream (make-up)

	1	2	3	4	5	6	7
	1	2	3	4	5	6	7	The self-emulsifying type glyceryl monostearate	0.50	1.00	3.00			1.50
Glyceryl stearate citrate	2.00		1.00	2.00	4.00			The self-emulsifying type glyceryl monostearate	0.50	1.00	3.00			1.50
Glyceryl stearate citrate	2.00		1.00	2.00	4.00			Stearic acid		3.00		2.00
Stearic acid Polyethylene Glycol (40) ester	0.50					2.00		Stearic acid		3.00		2.00
Stearic acid Polyethylene Glycol (40) ester	0.50					2.00		Phosphoric acid spermaceti alcohol ester						1.00
16/octadecanol sulfuric ester							0.75	Phosphoric acid spermaceti alcohol ester						1.00
16/octadecanol sulfuric ester							0.75	Octadecanol			3.00			2.00	0.60
Spermol	2.50	1.10		1.50	0.60		2.00	Octadecanol			3.00			2.00	0.60
Spermol	2.50	1.10		1.50	0.60		2.00	Fusion rotein-KBD	3.0	5.0	2.0	0.5	1.0	5.0	10.0
Titanium dioxide	10.00	12.00	9.00	8.50	11.00	9.50	10.00	Fusion rotein-KBD	3.0	5.0	2.0	0.5	1.0	5.0	10.0
Titanium dioxide	10.00	12.00	9.00	8.50	11.00	9.50	10.00	Ferrum oxide	2.00	4.00	3.00	5.00	3.40	6.00	4.40
Zinc oxide		4.00		2.00		3.00		Ferrum oxide	2.00	4.00	3.00	5.00	3.40	6.00	4.40

Benzoic acid C12-15 Arrcostab		0.25			4.00	7.00
Benzoic acid C12-15 Arrcostab		0.25			4.00	7.00		Dicaprylyl ether			3.50		2.00
Butanediol two sad/dicaprates	5.00		6.00					Dicaprylyl ether			3.50		2.00
Butanediol two sad/dicaprates	5.00		6.00					The glyceryl cocoate class			6.00		2.00
Polydimethylsiloxane	0.50		1.00		2.00			The glyceryl cocoate class			6.00		2.00
Polydimethylsiloxane	0.50		1.00		2.00			Annular dimethyl polysiloxane	2.00		0.50		0.50
Butyrospermum (Adeps Bovis seu Bubali resin)		2.00						Annular dimethyl polysiloxane	2.00		0.50		0.50
Butyrospermum (Adeps Bovis seu Bubali resin)		2.00						VP/ hexadecene copolymer	0.20			0.50		1.00
Glycerol	3.00	7.50		7.50	5.00		2.50	VP/ hexadecene copolymer	0.20			0.50		1.00
Glycerol	3.00	7.50		7.50	5.00		2.50	Xanthan gum	0.15		0.05			0.30
Carbomer sodium		0.20		0.15	0.25			Xanthan gum	0.15		0.05			0.30
Carbomer sodium		0.20		0.15	0.25			Vitamin E acetate	0.60		0.23		0.70	1.00
Soybean oil				0.50		1.50	1.00	Vitamin E acetate	0.60		0.23		0.70	1.00
Soybean oil				0.50		1.50	1.00	Ethylhexyl glycerol	0.30
Dimethyl dihydroxymethyl hydantoin		0.60	0.40	0.20				Ethylhexyl glycerol	0.30
Dimethyl dihydroxymethyl hydantoin		0.60	0.40	0.20				The iodo propinyl butyl carbamate				0.18	0.20
Methyl parahydroxybenzoate	0.15		0.25		0.50			The iodo propinyl butyl carbamate				0.18	0.20
Methyl parahydroxybenzoate	0.15		0.25		0.50			Phenoxyethanol	1.00	0.40			0.40	0.50	0.40
The EDTA trisodium	0.02		0.05					Phenoxyethanol	1.00	0.40			0.40	0.50	0.40
The EDTA trisodium	0.02		0.05					Imino-diacetic succinic acid four sodium				0.25	1.00
Ethanol	2.00	1.50		3.00		1.20	5.00	Imino-diacetic succinic acid four sodium				0.25	1.00
Ethanol	2.00	1.50		3.00		1.20	5.00	Aromatic oil	0.10	0.25	0.30		0.40	0.20
Demineralized water	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Aromatic oil	0.10	0.25	0.30		0.40	0.20

The tanned water dispersant of using of oneself

Aqueous dispersion behind the sun tan

WO Emulsion

Solid stabilizing Emulsion

(pik woods Emulsion)

	1	2	3	4	5
	1	2	3	4	5	Mineral oil			16.00	16.00
Octyldodecanol	9.00	9.00	5.00			Mineral oil			16.00	16.00
Octyldodecanol	9.00	9.00	5.00			Glycerol three (caprylic/capric) ester	9.00	9.00	6.00
Benzoic acid C12-15 Arrcostab				5.00	8.00	Glycerol three (caprylic/capric) ester	9.00	9.00	6.00

Butanediol two sad/dicaprates					8.00
Butanediol two sad/dicaprates					8.00	Dicaprylyl ether	9.00			4.00
Dicaprylyl carbonate		9.00				Dicaprylyl ether	9.00			4.00
Dicaprylyl carbonate		9.00				Hydroxyl octacosyl hydroxy stearic acid ester	2.00	2.00	2.20	2.50	1.50
Distearyl Dimethyl Ammonium-hectorite	1.00	0.75		0.50	0.25	Hydroxyl octacosyl hydroxy stearic acid ester	2.00	2.00	2.20	2.50	1.50
Distearyl Dimethyl Ammonium-hectorite	1.00	0.75		0.50	0.25	Microwax+vaseline		0.35			5.00
Hydroxypropyl emthylcellulose			0.10		0.05	Microwax+vaseline		0.35			5.00
Hydroxypropyl emthylcellulose			0.10		0.05	Polydimethylsiloxane					3.00
Fusion rotein-KBD	1.0	0.5	0.1	3.0	5.0	Polydimethylsiloxane					3.00
Fusion rotein-KBD	1.0	0.5	0.1	3.0	5.0	Titanium dioxide+aluminium oxide+the polydimethylsiloxane of dimethyl siloxane chain length 200-350 and the mixture+water of silica gel		3.00
Titanium dioxide+trimethoxy decoyl silane		2.00	4.00	2.00	4.00			3.00
Titanium dioxide+trimethoxy decoyl silane		2.00	4.00	2.00	4.00	The dimetylsilyl Silicon stone	2.50			6.00	2.50
Boron nitride			1.00			The dimetylsilyl Silicon stone	2.50			6.00	2.50
Boron nitride			1.00			Starch/Polymeric sodium metaphosphate. polymer	2.00
Tapioca		0.50				Starch/Polymeric sodium metaphosphate. polymer	2.00
Tapioca		0.50				Sodium chloride	5.00	7.00	8.50	3.00	4.50
Glycerol				1.00		Sodium chloride	5.00	7.00	8.50	3.00	4.50
Glycerol				1.00		The EDTA trisodium	1.00	1.00	1.00	1.00	1.00
Vitamin E acetate	5.00	10.00	3.00	6.00	10.00	The EDTA trisodium	1.00	1.00	1.00	1.00	1.00
Vitamin E acetate	5.00	10.00	3.00	6.00	10.00	Ascorbic palmitate	1.00	1.00		1.00
Methyl parahydroxybenzoate		0.60			0.20	Ascorbic palmitate	1.00	1.00		1.00
Methyl parahydroxybenzoate		0.60			0.20	Propyl p-hydroxybenzoate					0.20
Phenoxyethanol			0.20			Propyl p-hydroxybenzoate					0.20
Phenoxyethanol			0.20			Two (hydroxyethylsulfonic acid .) hexamidine			0.40	0.50	0.40
N-(methylol)-N-(1, the two methylols-2 of 3-, 5-					0.08	Two (hydroxyethylsulfonic acid .) hexamidine			0.40	0.50	0.40

Dioxy-4-imidazolidinyl)-N '-(methylol) urea
Dioxy-4-imidazolidinyl)-N '-(methylol) urea						Ethanol		0.23	0.20
Aromatic oil	5.00		3.00	4.00		Ethanol		0.23	0.20
Aromatic oil	5.00		3.00	4.00		Demineralized water	0.20	0.30	0.10
	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Demineralized water	0.20	0.30	0.10

The strip cosmetics

The tanned PIT Emulsion of oneself

The oleogel agent

	1	2	3	4
	1	2	3	4	Glycerol three (caprylic/capric) ester	12.00	10.00	6.00
Octyldodecanol	7.00	14.00	8.00	3.00	Glycerol three (caprylic/capric) ester	12.00	10.00	6.00
Octyldodecanol	7.00	14.00	8.00	3.00	Butanediol two sad/dicaprates				12.00
Pentaerythritol tetraoctyl stearate	10.00	6.00	8.00	7.00	Butanediol two sad/dicaprates				12.00
Pentaerythritol tetraoctyl stearate	10.00	6.00	8.00	7.00	Two isostearic acid polyglycereol (3) esters	2.50
Two-two many acyl groups of glycerol adipate esters-2	9.00	8.00	10.00	8.00	Two isostearic acid polyglycereol (3) esters	2.50
Two-two many acyl groups of glycerol adipate esters-2	9.00	8.00	10.00	8.00	Myristyl myristate	3.50	3.00	4.00	3.00
Dihydro tallow alkyl dimethyl ammonium chloride bentonite	5.00	5.00	6.00	6.00	Myristyl myristate	3.50	3.00	4.00	3.00
Dihydro tallow alkyl dimethyl ammonium chloride bentonite	5.00	5.00	6.00	6.00	Propylene carbonate	15.00	20.00	18.00	19.50
Fusion rotein-KBD	1.0	0.5	3.0	5.0	Propylene carbonate	15.00	20.00	18.00	19.50
Fusion rotein-KBD	1.0	0.5	3.0	5.0	Vitamin E acetate	0.50	1.00
Ascorbic palmitate	0.05		0.05		Vitamin E acetate	0.50	1.00
Ascorbic palmitate	0.05		0.05		Jojoba oil	2.00	1.00		1.00
Aromatic oil, BHT	0.10	0.25		0.35	Jojoba oil	2.00	1.00		1.00
Aromatic oil, BHT	0.10	0.25		0.35	Oleum Ricini	Add to 100	Add to 100	Add to 100	Add to 100

Embodiment 54:

In following preparation, described and comprised at least a inorganic pigment, the composite face-painting sunscreen of preferred zinc oxide and/or titanium dioxide and organic UV-A and UV-B filtering medium.

The preparation of the following stated prepares with ways customary well known by persons skilled in the art.

The content of fusion rotein C16-KBD-B (according to SEQ ID No:168) refers to 100% effective ingredient.Effective ingredient of the present invention can use with pure form or aqueous solution form.Under the situation of aqueous solution, the content of demineralized water in concrete preparation must be adjusted.

It will be appreciated by those skilled in the art that mentioned whole other KBD fusion rotein also can use corresponding KBD fusion protein construct (for example basis (SEQ ID No:212's) KBD-D protein among the pRee024 (Fig. 8)) to be prepared according to embodiment 3, and use in the described hereinafter goods.C16-KBD-B mentions in following examples as fusion rotein-KBD by representing above-mentioned whole other KBD fusion rotein modes.

A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate
A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul M 40	2-hydroxyl-4-methoxy benzophenone
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul M 40	2-hydroxyl-4-methoxy benzophenone
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 T-Lite SF
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	D 1.00 SEpigel 305	Polyacrylamide, C13-14 isoparaffin, lauryl polyoxyethylene (7) ether
1% fusion rotein-KBD		D 1.00 SEpigel 305
1% fusion rotein-KBD		In right amount	Antiseptic

A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate
A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul M 40	2-hydroxyl-4-methoxy benzophenone
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul M 40	2-hydroxyl-4-methoxy benzophenone
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
The C5.00 butanediol	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
The C5.00 butanediol	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
1% fusion rotein-KBD		D 2.00 Simulgel NS
1% fusion rotein-KBD		In right amount	Antiseptic

A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate
A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul A Plus
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
1% fusion rotein-KBD		D 2.00 Simulgel NS
1% fusion rotein-KBD		In right amount	Antiseptic

A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate
A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	2.00 Uvinul T 150	The ethylhexyl triazinone

0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
1% fusion rotein-KBD		D 2.00 Simulgel NS
1% fusion rotein-KBD		In right amount	Antiseptic

A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate
A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus		0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.50 Vitamin E acetate	Tocopherol acetate

3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
3.00 Dracorin 100SE		1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated
B 3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated
B 3.00 T-Lite SF		1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)
6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)
6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab	C 5.00 butanediols	Butanediol
0.30 Keltrol	Xanthan gum	C 5.00 butanediols	Butanediol
0.30 Keltrol	Xanthan gum	0.10 Edeta BD	The EDTA disodium
0.10 allantoin	Allantoin	0.10 Edeta BD	The EDTA disodium
0.10 allantoin	Allantoin	66.20 demineralized water	Demineralized water
D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	66.20 demineralized water	Demineralized water
D 2.00 Simulgel NS		1% fusion rotein-KBD
In right amount	Antiseptic	1% fusion rotein-KBD

A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate
A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus		0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.50 Vitamin E acetate	Tocopherol acetate
3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester	0.50 Vitamin E acetate	Tocopherol acetate

1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
1% fusion rotein-KBD		D 2.00 Simulgel NS
1% fusion rotein-KBD		In right amount	Antiseptic

A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate
A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate	1.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Parsol 1789	PAROSOL 1789	1.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Parsol 1789	PAROSOL 1789	0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.50 Vitamin E acetate	Tocopherol acetate
3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester	0.50 Vitamin E acetate	Tocopherol acetate
3.00 Dracorin 100SE		1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated
B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxane is common	1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated

	Polymers
	Polymers	1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)
6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)
6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab	C 5.00 butanediols	Butanediol
0.30 Keltrol	Xanthan gum	C 5.00 butanediols	Butanediol
0.30 Keltrol	Xanthan gum	0.10 Edeta BD	The EDTA disodium
0.10 allantoin	Allantoin	0.10 Edeta BD	The EDTA disodium
0.10 allantoin	Allantoin	66.70 demineralized water	Demineralized water
D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	66.70 demineralized water	Demineralized water
D 2.00 Simulgel NS		0.5% fusion rotein-KBD
In right amount	Antiseptic	0.5% fusion rotein-KBD

A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate
A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate	1.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Parsol 1789	PAROSOL 1789	1.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Parsol 1789	PAROSOL 1789	0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.50 Vitamin E acetate	Tocopherol acetate
3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester	0.50 Vitamin E acetate	Tocopherol acetate
3.00 Dracorin 100SE		1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)
6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)

C 5.00 butanediols	Butanediol
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
67.10 demineralized water	Demineralized water	0.10 allantoin	Allantoin
67.10 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
0.1% fusion rotein-KBD		D 2.00 Simulgel NS
0.1% fusion rotein-KBD		In right amount	Antiseptic

A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Parsol 1789	PAROSOL 1789
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Parsol 1789	PAROSOL 1789
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 T-Lite SF-S
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum

0.10 Edeta BD	The EDTA disodium
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
1% fusion rotein-KBD		D 2.00 Simulgel NS
1% fusion rotein-KBD		In right amount	Antiseptic

A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul A Plus
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 T-Lite SF
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
65.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin

D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
D 2.00 Simulgel NS		2% fusion rotein-KBD
In right amount	Antiseptic	2% fusion rotein-KBD

A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul A Plus
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.70 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.70 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
0.5% fusion rotein-KBD		D 2.00 Simulgel NS

In right amount

Antiseptic

A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul A Plus
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
2.0 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids	0.10 allantoin	Allantoin
2.0 Mexoryl SX		66.20 demineralized water	Demineralized water
D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	66.20 demineralized water	Demineralized water
D 2.00 Simulgel NS		1% fusion rotein-KBD
In right amount	Antiseptic	1% fusion rotein-KBD

A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
2.0 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids	0.10 allantoin	Allantoin
2.0 Mexoryl SX		65.20 demineralized water	Demineralized water
D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	65.20 demineralized water	Demineralized water
D 2.00 Simulgel NS		2% fusion rotein-KBD
In right amount	Antiseptic	2% fusion rotein-KBD

A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
2.00 Mexoryl XL	The drometrizole trisiloxanes	2.00 Uvinul A Plus

0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
67.10 demineralized water	Demineralized water	0.10 allantoin	Allantoin
67.10 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
0.1% fusion rotein-KBD		D 2.00 Simulgel NS
0.1% fusion rotein-KBD		In right amount	Antiseptic

A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
A 5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100)

	Ester
	Ester	1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)
6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)
6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab	C 5.00 butanediols	Butanediol
0.30 Keltrol	Xanthan gum	C 5.00 butanediols	Butanediol
0.30 Keltrol	Xanthan gum	0.10 Edeta BD	The EDTA disodium
0.10 allantoin	Allantoin	0.10 Edeta BD	The EDTA disodium
0.10 allantoin	Allantoin	66.20 demineralized water	Demineralized water
D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	66.20 demineralized water	Demineralized water
D 2.00 Simulgel NS		1% fusion rotein-KBD
In right amount	Antiseptic	1% fusion rotein-KBD

A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Fitoderm	Squalane	2.00 Dracorin 100SE
1.00 Fitoderm	Squalane	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Dry Flo Pure	The Dry Flo PC

C 4.00 1,2-propylene glycol nursing thing	Propylene glycol
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		0.50 Vitamin E acetate	Tocopherol acetate
2% fusion rotein-KBD		0.50 Vitamin E acetate	Tocopherol acetate
2% fusion rotein-KBD		1.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol

A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Fitoderm	Squalane	2.00 Dracorin 100SE
1.00 Fitoderm	Squalane	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	2.00 Dry Flo Pure	The Dry Flo PC

C 4.00 1,2-propylene glycol nursing thing	Propylene glycol
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		2.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol

A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Fitoderm	Squalane	2.00 Dracorin 100SE
1.00 Fitoderm	Squalane	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 T-Lite SF		C 4.00 1,2-propylene glycol nursing thing	Propylene glycol

1.00 D-panthenol 50 P	Pantothenylol, propylene glycol
1.00 D-panthenol 50 P	Pantothenylol, propylene glycol	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		1.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol

A 5.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 5.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol
2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester	3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol
2.00 Dracorin 100SE		1.00 Fitoderm	Squalane
0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	1.00 Fitoderm	Squalane
0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate
2.00 Dry Flo Pure	The Dry Flo PC	0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate
2.00 Dry Flo Pure	The Dry Flo PC	B 5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	B 5.00 T-Lite SF
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		0.50 Vitamin E acetate	Tocopherol acetate
2% fusion rotein-KBD		0.50 Vitamin E acetate	Tocopherol acetate
2% fusion rotein-KBD		1.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol

A 1.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00 Abil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	1.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes

B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids	C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX		0.20 Keltrol	Xanthan gum
0.06 Edeta BD	The EDTA disodium	0.20 Keltrol	Xanthan gum
0.06 Edeta BD	The EDTA disodium	0.04 TEA	Triethanolamine
0.30 Carbopol Ultrez 10P	Carbomer	0.04 TEA	Triethanolamine
0.30 Carbopol Ultrez 10P	Carbomer	63.50 demineralized water	Demineralized water
1% fusion rotein-KBD		63.50 demineralized water	Demineralized water
1% fusion rotein-KBD		An amount of aromatic oil of D
0.50 Glydant	Dimethyl dihydroxymethyl hydantoin	An amount of aromatic oil of D

A 5.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 5.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol
2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester	3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol
2.00 Dracorin 100SE		1.00 Fitoderm	Squalane
0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	1.00 Fitoderm	Squalane
0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate
2.00 Dry Flo Pure	The Dry Flo PC	0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate
2.00 Dry Flo Pure	The Dry Flo PC	B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	B 5.00 T-Lite SF-S
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Keltrol	Xanthan gum
2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	0.20 Keltrol	Xanthan gum
2.00 Simulgel NS		66.30 demineralized water	Demineralized water
An amount of antiseptic		66.30 demineralized water	Demineralized water
An amount of antiseptic		0.50 Vitamin E acetate	Tocopherol acetate
		0.50 Vitamin E acetate	Tocopherol acetate
		0.5% fusion rotein-KBD
1.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol	0.5% fusion rotein-KBD

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Ganex V-220	VP/ eicosylene copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 0.20 Keltrol	Xanthan gum
0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	C 0.20 Keltrol	Xanthan gum
0.50 Simulgel NS		65.10 demineralized water	Demineralized water
0.20 Edeta BD	The EDTA disodium	65.10 demineralized water	Demineralized water
0.20 Edeta BD	The EDTA disodium	5.00 1,2-propylene glycol nursing thing	Propylene glycol
0.5% fusion rotein-KBD		5.00 1,2-propylene glycol nursing thing	Propylene glycol
0.5% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
An amount of antiseptic		D 1.00 Vitamin E acetate	Tocopherol acetate

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Ganex V-220	VP/ eicosylene copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF		C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS		65.10 demineralized water	Demineralized water
0.20 Edeta BD	The EDTA disodium	65.10 demineralized water	Demineralized water
0.20 Edeta BD	The EDTA disodium	5.00 1,2-propylene glycol nursing thing	Propylene glycol
0.5% fusion rotein-KBD		5.00 1,2-propylene glycol nursing thing	Propylene glycol
0.5% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
An amount of antiseptic		D 1.00 Vitamin E acetate	Tocopherol acetate

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Ganex V-220	VP/ eicosylene copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF-S		C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS		64.60 demineralized water	Demineralized water
0.20 Edeta BD	The EDTA disodium	64.60 demineralized water	Demineralized water
0.20 Edeta BD	The EDTA disodium	5.00 1,2-propylene glycol nursing thing	Propylene glycol
1% fusion rotein-KBD		5.00 1,2-propylene glycol nursing thing	Propylene glycol
1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
An amount of antiseptic		D 1.00 Vitamin E acetate	Tocopherol acetate

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Ganex V-220	VP/ eicosylene copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF-S		C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS		64.10 demineralized water	Demineralized water
2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium	64.10 demineralized water	Demineralized water
2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		An amount of antiseptic

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Ganex V-220	VP/ eicosylene copolymer	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Ganex V-220	VP/ eicosylene copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF-S		C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS		64.60 demineralized water	Demineralized water
1.00 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids	64.60 demineralized water	Demineralized water
1.00 Mexoryl SX		0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		An amount of antiseptic

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Mexoryl XL	The drometrizole trisiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Mexoryl XL	The drometrizole trisiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl palmitate	Isopropyl palmitate	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl palmitate	Isopropyl palmitate	B 3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
C 0.50 Keltrol	Xanthan gum	B 3.00 T-Lite SF
C 0.50 Keltrol	Xanthan gum	0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
65.10 demineralized water	Demineralized water	0.50 Simulgel NS
65.10 demineralized water	Demineralized water	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	D 1.00 Vitamin E acetate	Tocopherol acetate
0.5% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
0.5% fusion rotein-KBD		An amount of antiseptic

1.00 urea	Urea
1.00 urea	Urea	2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium
2.00 glycerol 87%	Glycerol	2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium
2.00 glycerol 87%	Glycerol	1.20 Aristoflex AVC	Acryloyldimethyl taurine/VP copolymer ammonium salt
71.30 demineralized water	Demineralized water	1.20 Aristoflex AVC	Acryloyldimethyl taurine/VP copolymer ammonium salt
71.30 demineralized water	Demineralized water	B 3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
An amount of aromatic oil		B 3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
An amount of aromatic oil		5.00 Miglyol 812	Glycerol three (caprylic/capric) ester
2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	5.00 Miglyol 812	Glycerol three (caprylic/capric) ester
2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	8.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
5% fusion rotein-KBD		8.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
5% fusion rotein-KBD		An amount of antiseptic

5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Parsol 1789	PAROSOL 1789
1.00 Uvinul T 150	The ethylhexyl triazinone	2.00 Parsol 1789	PAROSOL 1789
1.00 Uvinul T 150	The ethylhexyl triazinone	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul T 539 N	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul T 539 N	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	0.50 Abil 350	Polydimethylsiloxane
2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin	0.50 Abil 350	Polydimethylsiloxane
2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin	3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax
1.80 Cera Flava 3050 PH	Cera Flava	3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax

3.20 TeCero wax 30445	Microwax
3.20 TeCero wax 30445	Microwax	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	6.40 vaseline	Vaseline
7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type	6.40 vaseline	Vaseline
7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl
0.17 natural bisabolol	Bisabolol	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl
0.17 natural bisabolol	Bisabolol	1.84 Vitamin E acetate	Tocopherol acetate
0.42 D, the L-alpha-tocopherol	Tocopherol	1.84 Vitamin E acetate	Tocopherol acetate
0.42 D, the L-alpha-tocopherol	Tocopherol	1% fusion rotein-KBD
40.38 Oleum Ricini	Oleum Ricini	1% fusion rotein-KBD

5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
5.00 T-Lite SF		2.00 Parsol 1789	PAROSOL 1789
1.00 Uvinul T150	The ethylhexyl triazinone	2.00 Parsol 1789	PAROSOL 1789
1.00 Uvinul T150	The ethylhexyl triazinone	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	0.50 Abil 350	Polydimethylsiloxane
2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin	0.50 Abil 350	Polydimethylsiloxane
2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin	3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax
1.80 Cera Flava 3050 PH	Cera Flava	3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax
1.80 Cera Flava 3050 PH	Cera Flava	3.20 TeCero wax 30445	Microwax
3.20 TeCero wax 1030 K	Microwax	3.20 TeCero wax 30445	Microwax
3.20 TeCero wax 1030 K	Microwax	1.34 Cutina CP	Hexadecyl palmitate

6.40 vaseline	Vaseline
6.40 vaseline	Vaseline	7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type
10.00 Luvitol EHO	Thylhexoic acid 16/stearyl	7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type
10.00 Luvitol EHO	Thylhexoic acid 16/stearyl	0.17 natural bisabolol	Bisabolol
1.84 Vitamin E acetate	Tocopherol acetate	0.17 natural bisabolol	Bisabolol
1.84 Vitamin E acetate	Tocopherol acetate	0.42 D, the L-alpha-tocopherol	Tocopherol
1% fusion rotein-KBD		0.42 D, the L-alpha-tocopherol	Tocopherol
1% fusion rotein-KBD		40.38 Oleum Ricini	Oleum Ricini

5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
5.00 T-Lite SF-S		2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
2.00 Mexoryl XL	The drometrizole trisiloxanes	2.00 Uvinul A Plus
2.00 Mexoryl XL	The drometrizole trisiloxanes	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
0.50 Abil 350	Polydimethylsiloxane	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
0.50 Abil 350	Polydimethylsiloxane	2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin
3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin
3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	1.80 Cera Flava 3050 PH	Cera Flava
3.20 TeCero wax 30445	Microwax	1.80 Cera Flava 3050 PH	Cera Flava
3.20 TeCero wax 30445	Microwax	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	6.40 vaseline	Vaseline
7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type	6.40 vaseline	Vaseline
7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl
0.17 natural bisabolol	Bisabolol	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl

1.84 Vitamin E acetate	Tocopherol acetate
1.84 Vitamin E acetate	Tocopherol acetate	0.42 D, the L-alpha-tocopherol	Tocopherol
2% fusion rotein-KBD		0.42 D, the L-alpha-tocopherol	Tocopherol
2% fusion rotein-KBD		39.38 Oleum Ricini	Oleum Ricini

A 6.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 6.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	2.00 Elfacos ST 9	PEG-45/ dodecyl diol copolymer
3.00 isopropyl myristate	Isopropyl myristate	2.00 Elfacos ST 9	PEG-45/ dodecyl diol copolymer
3.00 isopropyl myristate	Isopropyl myristate	8.00 Jojoba oil	Simmondsia (Jojoba) seed oil
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	8.00 Jojoba oil	Simmondsia (Jojoba) seed oil
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
1.00 Abil 350	Polydimethylsiloxane	2.00 Uvinul A Plus
1.00 Abil 350	Polydimethylsiloxane	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
3.00 T-Lite SF		C 0.20 Edeta BD	The EDTA disodium
5.00 glycerol 87%	Glycerol	C 0.20 Edeta BD	The EDTA disodium
5.00 glycerol 87%	Glycerol	0.30 Chemag 2000	Imidazolidinyl urea
59.00 demineralized water	Demineralized water	0.30 Chemag 2000	Imidazolidinyl urea
59.00 demineralized water	Demineralized water	An amount of aromatic oil of D
1% fusion rotein-KBD		An amount of aromatic oil of D
1% fusion rotein-KBD		An amount of antiseptic

2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl myristate	Isopropyl myristate	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl myristate	Isopropyl myristate	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 0.20 Keltrol	Xanthan gum	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 0.20 Keltrol	Xanthan gum	0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
61.10 demineralized water	Demineralized water	0.50 Simulgel NS
61.10 demineralized water	Demineralized water	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	D 1.00 Vitamin E acetate	Tocopherol acetate
1.5% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
1.5% fusion rotein-KBD		An amount of antiseptic

A 2.00 Luvitol EHO	Thylhexoic acid 16/stearyl
A 2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	5.00 paraffin oil	Mineral oil
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	5.00 paraffin oil	Mineral oil

B 1.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
B 1.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 glyceryl monostearate	Glyceryl stearate	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 glyceryl monostearate	Glyceryl stearate	4.00 16/ten P, eight alcohol	16/octadecanol
C 5.00 1,2-propylene glycol nursing thing	Propylene glycol	4.00 16/ten P, eight alcohol	16/octadecanol
C 5.00 1,2-propylene glycol nursing thing	Propylene glycol	7.50 Luviquat Care	Polyquaternary ammonium salt-44
An amount of antiseptic		7.50 Luviquat Care	Polyquaternary ammonium salt-44
An amount of antiseptic		An amount of aromatic oil
1% fusion rotein-KBD		An amount of aromatic oil
1% fusion rotein-KBD		64.50 demineralized water	Demineralized water

5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
5.00 T-Lite SF		10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
12.00 Cera Flava 3044 PH	Cera Flava	10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
12.00 Cera Flava 3044 PH	Cera Flava	8.00 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax
5.00 Tegin	The self-emulsifying type tristerin	8.00 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax
5.00 Tegin	The self-emulsifying type tristerin	5.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
5.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
5.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Softisan 154	Hydrogenated palm oil
8.00 high viscosity paraffin oil	Mineral oil	5.00 Softisan 154	Hydrogenated palm oil
8.00 high viscosity paraffin oil	Mineral oil	3.00 vaseline	Vaseline
2% fusion rotein-KBD		3.00 vaseline	Vaseline
2% fusion rotein-KBD		32.00 Oleum Ricini	Oleum Ricini

3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus		10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
12.00 Cera Flava 3044 PH	Cera Flava	10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
12.00 Cera Flava 3044 PH	Cera Flava	3.00 vaseline	Vaseline
8.00 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	3.00 vaseline	Vaseline
8.00 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	8.00 high viscosity paraffin oil	Mineral oil
5.00 Tegin	The self-emulsifying type tristerin	8.00 high viscosity paraffin oil	Mineral oil
5.00 Tegin	The self-emulsifying type tristerin	5.00 Softisan 154	Hydrogenated palm oil
5.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Softisan 154	Hydrogenated palm oil
5.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
0.1% fusion rotein-KBD		5.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
0.1% fusion rotein-KBD		28.90 Oleum Ricini	Oleum Ricini

5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
5.00 T-Lite SF		6.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	6.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	6.00 Miglyol 812	Glycerol three (caprylic/capric) ester
5.00 Arlacel P 135	Dimerization hydroxy stearic acid Polyethylene Glycol (30) ester	6.00 Miglyol 812	Glycerol three (caprylic/capric) ester
5.00 Arlacel P 135		2.00 Ganex V 216	PVP/ hexadecene copolymer
2.00 Elfacos ST 9	PEG-45/ dodecyl diol copolymer	2.00 Ganex V 216	PVP/ hexadecene copolymer
2.00 Elfacos ST 9	PEG-45/ dodecyl diol copolymer	B 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.10 Edeta BD	The EDTA disodium	B 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.10 Edeta BD	The EDTA disodium	1.00 bitter salt	Magnesium sulfate

59.40 demineralized water	Demineralized water
59.40 demineralized water	Demineralized water	0.5% fusion rotein-KBD
An amount of antiseptic		0.5% fusion rotein-KBD

A 4.00 Dehymuls SBL	Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
A 4.00 Dehymuls SBL		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	1.5% fusion rotein-KBD
An amount of antiseptic of D		1.5% fusion rotein-KBD

A 4.00 Dehymuls SBL

Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, stearic acid

	Aluminum, two cocoyl tetramethylolmethane distearyls alcohol citrate
		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 T-Lite SF-S		C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
1% fusion rotein-KBD		1.00 bitter salt	Magnesium sulfate
1% fusion rotein-KBD		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic of D		Add to 100 demineralized waters	Demineralized water

A 4.00 Dehymuls SBL	Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
A 4.00 Dehymuls SBL		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate and lignocaine	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester

	Oxybenzene formoxyl hexyl benzene formic acid esters
	Oxybenzene formoxyl hexyl benzene formic acid esters	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
0.1% fusion rotein-KBD		1.00 bitter salt	Magnesium sulfate
0.1% fusion rotein-KBD		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		Add to 100 demineralized waters	Demineralized water

A 4.00 Dehymuls SBL	Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
A 4.00 Dehymuls SBL		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate and lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B		2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 T-Lite SF		C 3.00 1,2-propylene glycol nursing thing	Propylene glycol

0.30 Abiol	Imidazolidinyl urea
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	0.2% fusion rotein-KBD
An amount of antiseptic		0.2% fusion rotein-KBD

A 4.00 Dehymuls SBL	Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
A 4.00 Dehymuls SBL		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate and lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B		2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 T-Lite SF-S		C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
0.5% fusion rotein-KBD		1.00 bitter salt	Magnesium sulfate
0.5% fusion rotein-KBD		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		Add to 100 demineralized waters	Demineralized water

A 4.00 Dehymuls SBL	Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
A 4.00 Dehymuls SBL		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 5.00 Z-COTE MAX	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 5.00 Z-COTE MAX		C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	0.01% fusion rotein-KBD
An amount of antiseptic		0.01% fusion rotein-KBD

A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus		1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	1.50 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes

B 3.50 Luvigel EM	Glycerol three (caprylic/capric) ester, sodium acrylate copolymer
B 3.50 Luvigel EM		C 46.00 demineralized waters	Demineralized water
D 5.00 1,2-propylene glycol nursing thing	Propylene glycol	C 46.00 demineralized waters	Demineralized water
D 5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.05% fusion rotein-KBD		0.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.05% fusion rotein-KBD		20.00 ethanol 96%	Alcohol

A 1.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 1.00 Uvinul A Plus		1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	8.00 Miglyol 812	Glycerol three (caprylic/capric) ester
1.50 Dow Corning 350 Fluid	Polydimethylsiloxane	8.00 Miglyol 812	Glycerol three (caprylic/capric) ester
1.50 Dow Corning 350 Fluid	Polydimethylsiloxane	3.00 Z-COTE MAX	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
3.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	3.00 Z-COTE MAX
3.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
B 2.00 Luvigel EM	Glycerol three (caprylic/capric) ester, sodium acrylate copolymer	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
B 2.00 Luvigel EM		C 54.80 demineralized waters	Demineralized water
D 15.00 ethanol 96%	Alcohol	C 54.80 demineralized waters	Demineralized water
D 15.00 ethanol 96%	Alcohol	5.00 1,2-propylene glycol nursing thing	Propylene glycol
0.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	5.00 1,2-propylene glycol nursing thing	Propylene glycol
0.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	1% fusion rotein-KBD
1.00 Vitamin E acetate	Tocopherol acetate	1% fusion rotein-KBD
1.00 Vitamin E acetate	Tocopherol acetate	0.20 synthetic raceme bisabolol	Bisabolol

A 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
A 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul T 150	The ethylhexyl triazinone
0.50 Vitamin E acetate	Tocopherol acetate	2.00 Uvinul T 150	The ethylhexyl triazinone
0.50 Vitamin E acetate	Tocopherol acetate	B 5.00 2-Methylpentadecanes	2-Methylpentadecane
5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	B 5.00 2-Methylpentadecanes	2-Methylpentadecane

3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 T-Lite SF		C 60.00 demineralized waters	Water
5.00 glycerol 87%	Glycerol	C 60.00 demineralized waters	Water
5.00 glycerol 87%	Glycerol	1.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	1.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	0.2% fusion rotein-KBD
An amount of antiseptic of D		0.2% fusion rotein-KBD

A 8.00 Cetiol B	Dibutyl adipate
A 8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
12.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
12.00 Myritol 331	The glyceryl cocoate class	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
3.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	2.00 Lanette O	16/octadecanol
3.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	1.00 Vitamin E acetate	Tocopherol acetate
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	1.00 Vitamin E acetate	Tocopherol acetate
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	1.50 Veegum Ultra	Magnesiumaluminumsilicate
49.45 demineralized water	Demineralized water	1.50 Veegum Ultra	Magnesiumaluminumsilicate
49.45 demineralized water	Demineralized water	1% fusion rotein-KBD
An amount of antiseptic of D		1% fusion rotein-KBD

A 8.00 Cetiol B	Dibutyl adipate
A 8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
12.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
12.00 Myritol 331	The glyceryl cocoate class	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
3.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	2.00 Lanette O	16/octadecanol
3.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	1.00 Vitamin E acetate	Tocopherol acetate
B 4.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	1.00 Vitamin E acetate	Tocopherol acetate
B 4.00 T-Lite SF		C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	1.50 Veegum Ultra	Magnesiumaluminumsilicate
50.25 demineralized water	Demineralized water	1.50 Veegum Ultra	Magnesiumaluminumsilicate
50.25 demineralized water	Demineralized water	D 0.50 citric acid	Citric acid
An amount of aromatic oil		D 0.50 citric acid	Citric acid
An amount of aromatic oil		0.2% fusion rotein-KBD
An amount of antiseptic		0.2% fusion rotein-KBD

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul T 150	The ethylhexyl triazinone

B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	2.50 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
C 5.00 glycerol 87%	Glycerol	2.50 T-Lite SF
C 5.00 glycerol 87%	Glycerol	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	42.00 demineralized water	Demineralized water
D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid	42.00 demineralized water	Demineralized water
D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid	10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	1% fusion rotein-KBD
An amount of antiseptic		1% fusion rotein-KBD

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	5.00 2-Methylpentadecane	2-Methylpentadecane

0.50 Vitamin E acetate	Tocopherol acetate
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Ganex V-220	VP/ eicosylene copolymer
2.50 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	1.00 Ganex V-220	VP/ eicosylene copolymer
2.50 T-Lite SF		C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	1.00 Pationic SSL	Stearoyl dilactic acid sodium
41.00 demineralized water	Demineralized water	1.00 Pationic SSL	Stearoyl dilactic acid sodium
41.00 demineralized water	Demineralized water	D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
2% fusion rotein-KBD		D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
2% fusion rotein-KBD		10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	An amount of antiseptic

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	2.50 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group methyl polysilicone

	Alkane
	Alkane	C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	1.00 Pationic SSL	Stearoyl dilactic acid sodium
42.50 demineralized water	Demineralized water	1.00 Pationic SSL	Stearoyl dilactic acid sodium
42.50 demineralized water	Demineralized water	D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
0.5% fusion rotein-KBD		D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
0.5% fusion rotein-KBD		10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	An amount of antiseptic

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	7.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Mexoryl XL	The drometrizole trisiloxanes	7.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Mexoryl XL	The drometrizole trisiloxanes	B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
5.00 2-Methylpentadecane	2-Methylpentadecane	B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
5.00 2-Methylpentadecane	2-Methylpentadecane	3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
0.50 Vitamin E acetate	Tocopherol acetate	3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	0.30 Keltrol	Xanthan gum

1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	1.00 Pationic SSL	Stearoyl dilactic acid sodium
40.50 demineralized water	Demineralized water	1.00 Pationic SSL	Stearoyl dilactic acid sodium
40.50 demineralized water	Demineralized water	D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
1% fusion rotein-KBD		D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
1% fusion rotein-KBD		10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	An amount of antiseptic

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	5.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate	5.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 5.00 glycerol 87%	Glycerol	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 5.00 glycerol 87%	Glycerol	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	41.50 demineralized water	Demineralized water

D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid	0.5% fusion rotein-KBD
9.50 demineralized water	Demineralized water	0.5% fusion rotein-KBD
9.50 demineralized water	Demineralized water	E 0.70 sodium hydroxide	Sodium hydroxide
An amount of antiseptic		E 0.70 sodium hydroxide	Sodium hydroxide

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	5.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate	5.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
C 5.00 glycerol 87%	Glycerol	5.00 T-Lite SF-S
C 5.00 glycerol 87%	Glycerol	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	40.50 demineralized water	Demineralized water
D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid	40.50 demineralized water	Demineralized water
D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid	1% fusion rotein-KBD

10.00 demineralized water	Demineralized water
10.00 demineralized water	Demineralized water	E 0.70 sodium hydroxide	Sodium hydroxide
An amount of antiseptic		E 0.70 sodium hydroxide	Sodium hydroxide

A 8.00 Cetiol B	Dibutyl adipate
A 8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Myritol 331	The glyceryl cocoate class	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	2.00 Lanette O	16/octadecanol
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	1.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Vitamin E acetate	Tocopherol acetate	1.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Vitamin E acetate	Tocopherol acetate	B 5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
C 3.00 glycerol 87%	Glycerol	B 5.00 T-Lite SF
C 3.00 glycerol 87%	Glycerol	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.30 Keltrol	Xanthan gum
2% fusion rotein-KBD		0.30 Keltrol	Xanthan gum
2% fusion rotein-KBD		1.50 Veegum Ultra	Magnesiumaluminumsilicate
Add to 100 demineralized waters	Demineralized water	1.50 Veegum Ultra	Magnesiumaluminumsilicate
Add to 100 demineralized waters	Demineralized water	An amount of aromatic oil of D
An amount of antiseptic		An amount of aromatic oil of D

A 8.00 Cetiol B	Dibutyl adipate
A 8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Myritol 331	The glyceryl cocoate class	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	2.00 Lanette O	16/octadecanol
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	1.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Vitamin E acetate	Tocopherol acetate	1.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Vitamin E acetate	Tocopherol acetate	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 3.00 glycerol 87%	Glycerol	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 3.00 glycerol 87%	Glycerol	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.30 Keltrol	Xanthan gum
1% fusion rotein-KBD		0.30 Keltrol	Xanthan gum
1% fusion rotein-KBD		1.50 Veegum Ultra	Magnesiumaluminumsilicate
Add to 100 demineralized waters	Demineralized water	1.50 Veegum Ultra	Magnesiumaluminumsilicate
Add to 100 demineralized waters	Demineralized water	An amount of aromatic oil of D
An amount of antiseptic		An amount of aromatic oil of D

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside

57.00 demineralized water	Demineralized water
57.00 demineralized water	Demineralized water	B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	B 5.00 T-Lite SF-S
C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul A Plus
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	2% fusion rotein-KBD
0.20 synthetic raceme bisabolol	Bisabolol	2% fusion rotein-KBD

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	58.00 demineralized water	Demineralized water
B 5.00 Z-COTE MAXp	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	58.00 demineralized water	Demineralized water

C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
2.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul A Plus
2.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	1% fusion rotein-KBD
0.20 synthetic raceme bisabolol	Bisabolol	1% fusion rotein-KBD

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	58.50 demineralized water	Demineralized water
B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	58.50 demineralized water	Demineralized water
B 5.00 T-Lite SF-S		C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Parsol 1789	PAROSOL 1789

Fluid
Fluid		3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	0.5% fusion rotein-KBD
0.20 synthetic raceme bisabolol	Bisabolol	0.5% fusion rotein-KBD

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	2.00 Mexoryl SL	To inferior phenylenedimethylidyne two camphorsulfonic acids
58.40 demineralized water	Demineralized water	2.00 Mexoryl SL
58.40 demineralized water	Demineralized water	B 6.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 6.00 T-Lite SF-S
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Parsol 1789	PAROSOL 1789

3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.50 Cera Flava 3044 PH	Cera Flava	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.50 Cera Flava 3044 PH	Cera Flava	3.00 Lanette O	16/octadecanol
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	3.00 Lanette O	16/octadecanol
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	D 1.00 Vitamin E acetate	Tocopherol acetate
0.1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
0.1% fusion rotein-KBD		0.20 synthetic raceme bisabolol	Bisabolol

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	2.00 Mexoryl SL	To inferior phenylenedimethylidyne two camphorsulfonic acids
58.45 demineralized water	Demineralized water	2.00 Mexoryl SL
58.45 demineralized water	Demineralized water	B 6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	0.50 Cera Flava 3044 PH	Cera Flava

3.00 Lanette O	16/octadecanol
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	0.05% fusion rotein-KBD
0.20 synthetic raceme bisabolol	Bisabolol	0.05% fusion rotein-KBD

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium
57.50 demineralized water	Demineralized water	2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium
57.50 demineralized water	Demineralized water	B 6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	1.0% fusion rotein-KBD

0.20 synthetic raceme bisabolol

Bisabolol

A 25.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
A 25.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	20.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes
8.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	20.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes
8.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane
7.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane
7.00 T-Lite SF		B 17.00 alcohol 95 %	Alcohol
10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	B 17.00 alcohol 95 %	Alcohol
10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	4.50 demineralized water	Demineralized water
3.00 glycerol 87%	Glycerol	4.50 demineralized water	Demineralized water
3.00 glycerol 87%	Glycerol	0.5% fusion rotein-KBD
1.00 Talcum	Talcum	0.5% fusion rotein-KBD

A 25.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
A 25.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	20.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes
8.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	20.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes
8.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane
7.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane

B 17.00 alcohol 95 %	Alcohol
B 17.00 alcohol 95 %	Alcohol	9.99 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
5.00 demineralized water	Demineralized water	9.99 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
5.00 demineralized water	Demineralized water	3.00 glycerol 87%	Glycerol
0.01% fusion rotein-KBD		3.00 glycerol 87%	Glycerol
0.01% fusion rotein-KBD		1.00 Talcum	Talcum

A 20.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
A 20.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	10.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	10.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul T 150	The ethylhexyl triazinone
12.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	2.00 Uvinul T 150	The ethylhexyl triazinone
12.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane
B 7.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane
B 7.00 T-Lite SF		C 15.00 alcohol 95 %	Alcohol
10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 15.00 alcohol 95 %	Alcohol
10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	3.00 glycerol 87%	Glycerol
1.5% fusion rotein-KBD		3.00 glycerol 87%	Glycerol
1.5% fusion rotein-KBD		8.00 demineralized water	Demineralized water

A 20.00 Dow Corning 345 Fluid

Ring-type five polysiloxanes, ring-type six polysiloxanes

10.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes
10.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes	7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	12.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane	12.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane	B 7.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
C 15.00 alcohol 95 %	Alcohol	B 7.00 T-Lite SF
C 15.00 alcohol 95 %	Alcohol	10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
3.00 glycerol 87%	Glycerol	10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
3.00 glycerol 87%	Glycerol	0.5% fusion rotein-KBD
9.00 demineralized water	Demineralized water	0.5% fusion rotein-KBD

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.00 T-Lite SF		4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab

C 0.50 sodium chloride	Sodium chloride
C 0.50 sodium chloride	Sodium chloride	0.20 Edeta BD	The EDTA disodium
61.30 demineralized water	Demineralized water	0.20 Edeta BD	The EDTA disodium
61.30 demineralized water	Demineralized water	D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		An amount of antiseptic

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09		C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	62.20 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	62.20 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	0.1% fusion rotein-KBD
An amount of antiseptic		0.1% fusion rotein-KBD

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09		C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	60.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	60.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	2% fusion rotein-KBD
An amount of antiseptic		2% fusion rotein-KBD

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 4.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite

1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09		C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	62.10 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	62.10 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	0.2% fusion rotein-KBD
An amount of antiseptic		0.2% fusion rotein-KBD

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Mexoryl XL	The drometrizole trisiloxanes	B 3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Mexoryl XL	The drometrizole trisiloxanes	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester
C 0.50 sodium chloride	Sodium chloride	4.00 Abil WE 09

0.20 Edeta BD	The EDTA disodium
0.20 Edeta BD	The EDTA disodium	1% fusion rotein-KBD
61.30 demineralized water	Demineralized water	1% fusion rotein-KBD
61.30 demineralized water	Demineralized water	D 1.00 Vitamin E acetate	Tocopherol acetate
An amount of antiseptic		D 1.00 Vitamin E acetate	Tocopherol acetate

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 T-Lite SF-S		4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Mexoryl XL	The drometrizole trisiloxanes	B 3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Mexoryl XL	The drometrizole trisiloxanes	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester
C 0.50 sodium chloride	Sodium chloride	4.00 Abil WE 09
C 0.50 sodium chloride	Sodium chloride	0.20 Edeta BD	The EDTA disodium
61.80 demineralized water	Demineralized water	0.20 Edeta BD	The EDTA disodium
61.80 demineralized water	Demineralized water	D 1.00 Vitamin E acetate	Tocopherol acetate
0.5% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
0.5% fusion rotein-KBD		An amount of antiseptic

A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Uvinul T 150	The ethylhexyl triazinone	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Uvinul T 150	The ethylhexyl triazinone	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	D 44.00 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	D 44.00 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	1.00 Lanette E	16/sodium stearyl sulfate
15.00 LuViquat Care	Polyquaternary ammonium salt-44	1.00 Lanette E	16/sodium stearyl sulfate
15.00 LuViquat Care	Polyquaternary ammonium salt-44	1% fusion rotein-KBD
0.50 Keltrol	Xanthan gum	1% fusion rotein-KBD
0.50 Keltrol	Xanthan gum	E 1.00 Phenonip

A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	Two-ethyoxyl hexyl oxygen base phenol anisyl triazine	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite

2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	B 0.50 Vitamin E acetate	Tocopherol acetate
4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	B 0.50 Vitamin E acetate	Tocopherol acetate
4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
1.00 Gahex V-220	VP/ eicosylene copolymer	C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
1.00 Gahex V-220	VP/ eicosylene copolymer	5.00 2-Methylpentadecane	2-Methylpentadecane
2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	5.00 2-Methylpentadecane	2-Methylpentadecane
2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
D 44.90 demineralized waters	Demineralized water	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
D 44.90 demineralized waters	Demineralized water	5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	15.00 LuViquat Care	Polyquaternary ammonium salt-44
0.1% fusion rotein-KBD		15.00 LuViquat Care	Polyquaternary ammonium salt-44
0.1% fusion rotein-KBD		0.50 Keltrol	Xanthan gum
E 1.00 Phenonip		0.50 Keltrol	Xanthan gum

A 1.50 Mexoryl XL	The drometrizole trisiloxanes
A 1.50 Mexoryl XL	The drometrizole trisiloxanes	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	1.00 Ganex V-220	VP/ eicosylene copolymer

2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
D 44.50 demineralized waters	Demineralized water	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
D 44.50 demineralized waters	Demineralized water	5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	15.00 Luviquat Care	Polyquaternary ammonium salt-44
1.5% fusion rotein-KBD		15.00 Luviquat Care	Polyquaternary ammonium salt-44
1.5% fusion rotein-KBD		0.50 Keltrol	Xanthan gum
E 1.00 Phenonip		0.50 Keltrol	Xanthan gum

A 1.50 Mexoryl XL	The drometrizole trisiloxanes
A 1.50 Mexoryl XL	The drometrizole trisiloxanes	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 T-Lite SF		D 45.00 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	D 45.00 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	1.00 Lanette E	16/sodium stearyl sulfate

15.00 Luviquat Care	Polyquaternary ammonium salt-44
15.00 Luviquat Care	Polyquaternary ammonium salt-44	1% fusion rotein-KBD
0.50 Keltrol	Xanthan gum	1% fusion rotein-KBD
0.50 Keltrol	Xanthan gum	E 1.00 Phenonip

A 1.00A bil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00A bil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	2.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 5.00 1,2-propylene glycol	Propylene glycol
0.20 Keltrol	Xanthan gum	C 5.00 1,2-propylene glycol	Propylene glycol
0.20 Keltrol	Xanthan gum	0.10 Edeta BD	The EDTA disodium
2.0% fusion rotein-KBD		0.10 Edeta BD	The EDTA disodium
2.0% fusion rotein-KBD		1.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester
58.40 demineralized water	Demineralized water	1.50 Simulgel 600

An amount of aromatic oil of D
An amount of aromatic oil of D		0.50 Glydant	Dimethyl dihydroxymethyl hydantoin

A 2.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 2.00 Abil Care 85		4.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
1.50 Miglyol 812	Glycerol three (caprylic/capric) ester	4.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
1.50 Miglyol 812	Glycerol three (caprylic/capric) ester	0.50 Vitamin E acetate	Tocopherol acetate
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	0.50 Vitamin E acetate	Tocopherol acetate
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Cetiol B	Dibutyl adipate
3.00 Luvitol EHO	Thylhexoic acid 16/stearyl	4.00 Cetiol B	Dibutyl adipate
3.00 Luvitol EHO	Thylhexoic acid 16/stearyl	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
1.00 paraffin oil, low viscosity	Mineral oil	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
1.00 paraffin oil, low viscosity	Mineral oil	3.00 Plantacare 2000	Decyl glucoside
0.50 Phenonip		3.00 Plantacare 2000	Decyl glucoside
0.50 Phenonip		An amount of aromatic oil
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	An amount of aromatic oil
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
0.20 Keltrol	Xanthan gum	C 2.00 Simulgel NS
0.20 Keltrol	Xanthan gum	0.10 Edeta BD	The EDTA disodium
1% fusion rotein-KBD		0.10 Edeta BD	The EDTA disodium
1% fusion rotein-KBD		64.20 demineralized water	Demineralized water

A 6.00 Gilugel SIL 5	Annular dimethyl polysiloxane (with) aluminium hydroxystearate/magnesium
A 6.00 Gilugel SIL 5		5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul A Plus		1.00 Uvinul T 150	The ethylhexyl triazinone
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Uvinul T 150	The ethylhexyl triazinone
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester
2.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	4.00 Abil WE 09
2.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	3.00 isopropyl palmitate	Isopropyl palmitate
5.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.00 isopropyl palmitate	Isopropyl palmitate
5.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes	0.50 Abil 350	Polydimethylsiloxane
B 0.50 sodium chloride	Sodium chloride	0.50 Abil 350	Polydimethylsiloxane
B 0.50 sodium chloride	Sodium chloride	0.20 Edeta BD	The EDTA disodium
0.2% fusion rotein-KBD		0.20 Edeta BD	The EDTA disodium
0.2% fusion rotein-KBD		62.10 demineralized water	Demineralized water
C 1.00 Vitamin E acetate	Tocopherol acetate	62.10 demineralized water	Demineralized water
C 1.00 Vitamin E acetate	Tocopherol acetate	0.50 Phenonip

A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
0.50 Vitamin E acetate	Tocopherol acetate	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
0.50 Vitamin E acetate	Tocopherol acetate	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate

B 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
B 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
3.00 T-Lite SF		C 5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	C 5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	0.50 Keltrol	Xanthan gum
1% fusion rotein-KBD		0.50 Keltrol	Xanthan gum
1% fusion rotein-KBD		59.70 demineralized water	Demineralized water
D 1.00 Phenonip		59.70 demineralized water	Demineralized water
D 1.00 Phenonip		0.30 synthetic raceme bisabolol	Bisabolol

A 2.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 2.00 Abil Care 85		4.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
1.50 Miglyol 812	Glycerol three (caprylic/capric) ester	4.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
1.50 Miglyol 812	Glycerol three (caprylic/capric) ester	0.50 Vitamin E acetate	Tocopherol acetate
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	0.50 Vitamin E acetate	Tocopherol acetate
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Cetiol B	Dibutyl adipate
1.00 Luvitol EHO	Thylhexoic acid 16/stearyl	4.00 Cetiol B	Dibutyl adipate
1.00 Luvitol EHO	Thylhexoic acid 16/stearyl	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
1.00 paraffin oil, low viscosity	Mineral oil	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
1.00 paraffin oil, low viscosity	Mineral oil	3.00 Plantacare 2000	Decyl glucoside

1.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
1.00 Uvinul A Plus		0.50 Phenonip
2.50 Uvinul T 150	The ethylhexyl triazinone	0.50 Phenonip
2.50 Uvinul T 150	The ethylhexyl triazinone	An amount of aromatic oil
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	An amount of aromatic oil
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
0.10 Keltrol	Xanthan gum	C 2.00 Simulgel NS
0.10 Keltrol	Xanthan gum	0.10 Edeta BD	The EDTA disodium
0.5% fusion rotein-KBD		0.10 Edeta BD	The EDTA disodium
0.5% fusion rotein-KBD		59.90 demineralized water	Demineralized water

A 4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol
A 4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
12.00 Myritol 331	The glyceryl cocoate class	2.00 Lanette O	16/octadecanol
12.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	B 6.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	B 6.00 T-Lite SF
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 glycerol 87%	Glycerol
0.10 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.10 Edeta BD	The EDTA disodium	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	2% fusion rotein-KBD

0.30 Keltrol	Xanthan gum
0.30 Keltrol	Xanthan gum	45.10 demineralized water	Water
D 1.00 Phenonip	Phenoxyethanol, methyl parahydroxybenzoate, ethylparaben, butyl p-hydroxybenzoate, propyl p-hydroxybenzoate, p-Hydroxybenzoic acid isobutyl ester	45.10 demineralized water	Water

A 4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol
A 4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
12.00 Myritol 331	The glyceryl cocoate class	2.00 Lanette O	16/octadecanol
12.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	B 6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	B 6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 glycerol 87%	Glycerol
0.10 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.10 Edeta BD	The EDTA disodium	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	0.30 Carbopol Ultrez10 P	Carbomer
2% fusion rotein-KBD		0.30 Carbopol Ultrez10 P	Carbomer
2% fusion rotein-KBD		46.10 demineralized water	Demineralized water
D 1.00 Phenonip	Phenoxyethanol, methyl parahydroxybenzoate, ethylparaben, butyl p-hydroxybenzoate, propyl p-hydroxybenzoate, p-Hydroxybenzoic acid isobutyl ester	46.10 demineralized water	Demineralized water

A 4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol
A 4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
10.00 Myritol 331	The glyceryl cocoate class	2.00 Lanette O	16/octadecanol
10.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	B 2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	B 2.00 Uvinul A Plus
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 glycerol 87%	Glycerol
0.10 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.10 Edeta BD	The EDTA disodium	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	5.0% fusion rotein-KBD
0.30 Carbopol Ultrez10P	Carbomer	5.0% fusion rotein-KBD
0.30 Carbopol Ultrez10P	Carbomer	Add demineralized water	Water
D 1.00 Phenonip	Phenoxyethanol, methyl parahydroxybenzoate, ethylparaben, butyl p-hydroxybenzoate, propyl p-hydroxybenzoate, p-Hydroxybenzoic acid isobutyl ester	Add demineralized water	Water

A 3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
2.00 Dow Corning345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul A Plus

0.50 Cera Flava 3044 PH	Cera Flava
0.50 Cera Flava 3044 PH	Cera Flava	3.00 Lanette O	16/octadecanol
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	3.00 Lanette O	16/octadecanol
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
C 3.00 glycerol 87%	Glycerol	B 5.00 T-Lite SF-S
C 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Keltrol T	Xanthan gum	0.20 Edeta BD	The EDTA disodium
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
1% fusion rotein-KBD		1.00 Plantacare 2000	Decyl glucoside
1% fusion rotein-KBD		57.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	57.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	0.20 synthetic raceme bisabolol	Bisabolol

A 10.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate, lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 10.00 Uvinul A Plus B		10.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	10.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75		8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	2.00 Lanette O	16/octadecanol
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Lanette O	16/octadecanol

C 35.08 demineralized waters	Demineralized water
C 35.08 demineralized waters	Demineralized water	0.38 citric acid	Citric acid
2.9 glycerol 87%	Glycerol	0.38 citric acid	Citric acid
2.9 glycerol 87%	Glycerol	0.05 Edeta BD	EDTA sodium
0.20 allantoin	Allantoin	0.05 Edeta BD	EDTA sodium
0.20 allantoin	Allantoin	0.30 Keltrol	Xanthan gum
0.1% fusion rotein-KBD		0.30 Keltrol	Xanthan gum
0.1% fusion rotein-KBD		1.50 Veegum Ultra	Magnesiumaluminumsilicate
D 0.50 Phenonip		1.50 Veegum Ultra	Magnesiumaluminumsilicate
D 0.50 Phenonip		1.00 Vitamin E acetate	Tocopherol acetate

A 0.70 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
A 0.70 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	1.70 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	1.70 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
2.00 Uvinul A Plus		3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Abil B 8843	The PEG-14 polydimethylsiloxane
3.60 Lanette O	16/octadecanol	2.00 Abil B 8843	The PEG-14 polydimethylsiloxane
3.60 Lanette O	16/octadecanol	4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Cetiol B	Dibutyl adipate	4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Cetiol B	Dibutyl adipate	B 4.00 glycerol 87%	Glycerol
0.20 Edeta BD	The EDTA disodium	B 4.00 glycerol 87%	Glycerol
0.20 Edeta BD	The EDTA disodium	71.00 demineralized water	Pantothenylol
C 4.00 Luvigel EM	Glycerol three (caprylic/capric) ester, sodium acrylate copolymer	71.00 demineralized water	Pantothenylol
C 4.00 Luvigel EM		D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		0.20 synthetic raceme bisabolol	Bisabolol
An amount of antiseptic		0.20 synthetic raceme bisabolol	Bisabolol

A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Fitoderm	Squalane	2.00 Dracorin 100SE

0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate
2.00 Dry Flo Pure	The Dry Flo PC	0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate
2.00 Dry Flo Pure	The Dry Flo PC	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
0.03 Sicomet Blue P 77007	C.I.77 007, ultramarine	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
0.03 Sicomet Blue P 77007	C.I.77 007, ultramarine	C 4.00 1,2-propylene glycol nursing thing	Propylene glycol
2.00 D-panthenol 50P	Pantothenylol, propylene glycol	C 4.00 1,2-propylene glycol nursing thing	Propylene glycol
2.00 D-panthenol 50P	Pantothenylol, propylene glycol	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600		0.5% fusion rotein-KBD
65.27 demineralized water	Demineralized water	0.5% fusion rotein-KBD
65.27 demineralized water	Demineralized water	An amount of antiseptic
0.50 Vitamin E acetate	Tocopherol acetate	An amount of antiseptic

A 6.00 Gilugel SIL 5	Annular dimethyl polysiloxane (with) aluminium hydroxystearate/magnesium
A 6.00 Gilugel SIL 5		5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Mexoryl XL	The drometrizole trisiloxanes	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Mexoryl XL	The drometrizole trisiloxanes	1.00 Uvinul T 150	The ethylhexyl triazinone
3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	1.00 Uvinul T 150	The ethylhexyl triazinone
3.00 T-Lite SF-S		5.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl	5.00 Finsolv TN	Benzoic acid C12-15 Arrcostab

	The PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester
		2.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
3.00 isopropyl palmitate	Isopropyl palmitate	2.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
3.00 isopropyl palmitate	Isopropyl palmitate	5.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
0.50 Abil 350	Polydimethylsiloxane	5.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
0.50 Abil 350	Polydimethylsiloxane	B 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	B 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	1% fusion rotein-KBD
61.30 demineralized water	Demineralized water	1% fusion rotein-KBD
61.30 demineralized water	Demineralized water	C 1.00 Vitamin E acetate	Tocopherol acetate
0.50 Phenonip		C 1.00 Vitamin E acetate	Tocopherol acetate

A 1.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00 Abil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	2.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group silane	2.00 Uvinul A Plus
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group silane	C 5.00 1,2-propylene glycol	Propylene glycol
0.20 Keltrol	Xanthan gum	C 5.00 1,2-propylene glycol	Propylene glycol

0.10 Edeta BD	The EDTA disodium
0.10 Edeta BD	The EDTA disodium	1% fusion rotein-KBD
1.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	1% fusion rotein-KBD
1.50 Simulgel 600		59.40 demineralized water	Demineralized water
An amount of aromatic oil of D		59.40 demineralized water	Demineralized water
An amount of aromatic oil of D		0.50 Glydant	Dimethyl dihydroxymethyl hydantoin

A 7.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate, lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 7.00 Uvinul A Plus B		1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75		8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	2.00 Lanette O	16/octadecanol
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Lanette O	16/octadecanol
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 35.35 demineralized waters	Demineralized water
3.00 glycerol 87%	Glycerol	C 35.35 demineralized waters	Demineralized water
3.00 glycerol 87%	Glycerol	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.30 Keltrol	Xanthan gum

0.1% fusion rotein-KBD
0.1% fusion rotein-KBD	1.50 Veegum Ultra	Magnesiumaluminumsilicate
D 0.50 Phenonip	1.50 Veegum Ultra	Magnesiumaluminumsilicate
D 0.50 Phenonip	1.00 Vitamin E acetate	Tocopherol acetate

A 7.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate, lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 7.00 Uvinul A Plus B		1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75		8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	2.00 Lanette O	16/octadecanol
B 5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.00 Lanette O	16/octadecanol
B 5.00 T-Lite SF		C 30.45 demineralized waters	Demineralized water
3.00 glycerol 87%	Glycerol	C 30.45 demineralized waters	Demineralized water
3.00 glycerol 87%	Glycerol	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.30 Keltrol	Xanthan gum
5% fusion rotein-KBD		0.30 Keltrol	Xanthan gum
5% fusion rotein-KBD		1.50 Veegum Ultra	Magnesiumaluminumsilicate

D 0.50 Phenonip
D 0.50 Phenonip		1.00 Vitamin E acetate	Tocopherol acetate

5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
2.00 Mexoryl XL	The drometrizole trisiloxanes	2.00 Uvinul A Plus
2.00 Mexoryl XL	The drometrizole trisiloxanes	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
0.50 Abil 350	Polydimethylsiloxane	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
0.50 Abil 350	Polydimethylsiloxane	2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin
3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin
3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	1.80 Cera Flava 3050 PH	Cera Flava
3.20 TeCero wax 30445	Microwax	1.80 Cera Flava 3050 PH	Cera Flava
3.20 TeCero wax 30445	Microwax	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	6.40 vaseline	Vaseline
7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type	6.40 vaseline	Vaseline
7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl
0.17 natural bisabolol	Bisabolol	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl
0.17 natural bisabolol	Bisabolol	1.84 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		1.84 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		0.42 D, the L-alpha-tocopherol	Tocopherol
40.38 Oleum Ricini	Oleum Ricini	0.42 D, the L-alpha-tocopherol	Tocopherol

A 1.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00 Abil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated

0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	2.00 Mexoryl XL	The drometrizole trisiloxanes
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	2.00 Mexoryl XL	The drometrizole trisiloxanes
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	1.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	1.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 3.00 T-Lite SF-S		C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids	C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX		0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	1% fusion rotein-KBD
1.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	1% fusion rotein-KBD
1.50 Simulgel 600		69.50 demineralized water	Demineralized water
An amount of aromatic oil of D		69.50 demineralized water	Demineralized water
An amount of aromatic oil of D		0.50 Glydant	Dimethyl dihydroxymethyl hydantoin

A 1.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00 Abil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated

2.00 Parsol 1789	PAROSOL 1789
2.00 Parsol 1789	PAROSOL 1789	2.00 Mexoryl XL	The drometrizole trisiloxanes
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	2.00 Mexoryl XL	The drometrizole trisiloxanes
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	1.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	1.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 3.00 T-Lite SF-S		C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids	C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX		0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.2% fusion rotein-KBD
1.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	0.2% fusion rotein-KBD
1.50 Simulgel 600		68.30 demineralized water	Demineralized water
An amount of aromatic oil of D		68.30 demineralized water	Demineralized water
An amount of aromatic oil of D		0.50 Glydant	Dimethyl dihydroxymethyl hydantoin

A 0.70 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
A 0.70 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	1.70 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
2.00 Parsol 1789	PAROSOL 1789	1.70 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol

5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
2.00 Abil B 8843	The PEG-14 polydimethylsiloxane	4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
2.00 Abil B 8843	The PEG-14 polydimethylsiloxane	3.60 Lanette O	16/octadecanol
1.00 Uvinul T 150	The ethylhexyl triazinone	3.60 Lanette O	16/octadecanol
1.00 Uvinul T 150	The ethylhexyl triazinone	2.00 Cetiol B	Dibutyl adipate
B 4.00 glycerol 87%	Glycerol	2.00 Cetiol B	Dibutyl adipate
B 4.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
71.00 demineralized water	Pantothenylol	0.20 Edeta BD	The EDTA disodium
71.00 demineralized water	Pantothenylol	C 4.00 Luvigel EM	Glycerol three (caprylic/capric) ester, sodium acrylate copolymer
1% fusion rotein-KBD		C 4.00 Luvigel EM
1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
0.20 synthetic raceme bisabolol	Bisabolol	D 1.00 Vitamin E acetate	Tocopherol acetate
0.20 synthetic raceme bisabolol	Bisabolol	An amount of antiseptic

A 1.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00 Abil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes

B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids	C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX		0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	1.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester
0.5% fusion rotein-KBD		1.50 Simulgel 600
0.5% fusion rotein-KBD		68.00 demineralized water	Demineralized water
An amount of aromatic oil of D		68.00 demineralized water	Demineralized water
An amount of aromatic oil of D		0.50 Glydant	Dimethyl dihydroxymethyl hydantoin

A 2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 2.00 Uvinul A Plus		3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Fitoderm	Squalane	2.00 Dracorin 100SE
1.00 Fitoderm	Squalane	0.5 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.5 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	0.5 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.5 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 4.00 1,2-propylene glycol nursing thing	Propylene glycol
0.20 Keltrol	Xanthan gum	C 4.00 1,2-propylene glycol nursing thing	Propylene glycol
0.20 Keltrol	Xanthan gum	0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20)

	Oleic acid ester
	Oleic acid ester	65.80 demineralized water	Demineralized water
D 0.50 Euxyl K 300		65.80 demineralized water	Demineralized water
D 0.50 Euxyl K 300		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		1.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol

Hereinafter described skin cosmetic product of the present invention, it comprises the effector molecule C16-KBD-D (according to the SEQ ID No:212 among the pRee024 (Fig. 8)) of the keratin-binding of and preparation similar with embodiment 3.C16-KBD-B mentions in following examples as fusion rotein-KBD by representing above-mentioned whole other KBD fusion rotein modes.It will be appreciated by those skilled in the art that mentioned whole other KBD fusion rotein also can use corresponding KBD fusion protein construct to be prepared according to embodiment 3, and use in the described hereinafter goods.

Embodiment 55: use KBD in nursing oil/water type day with Emulsion

AI 1％：

% composition (INCI)

A 1.7 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

0.7 16/octadecyl polyoxyethylene (25) ether

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 PEG-14 polydimethylsiloxane

3.6 16/octadecanol

6.0 ethylhexyl methoxy cinnamate

2.0 dibutyl adipate

B 5.0 glycerol

0.2 EDTA disodium

1.0 pantothenylol

An amount of antiseptic

67.8 demineralized water

C 4.0 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

D 0.2 phosphoric acid sodium ascorbate

1.0 tocopherol acetate

0.2 bisabolol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of sodium hydroxide of E

AI 5％：

% composition (INCI)

A 1.7 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

0.7 16/octadecyl polyoxyethylene (25) ether

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 PEG-14 polydimethylsiloxane

3.6 16/octadecanol

6.0 ethylhexyl methoxy cinnamate

2.0 dibutyl adipate

B 5.0 glycerol

0.2 EDTA disodium

1.0 pantothenylol

An amount of antiseptic

63.8 demineralized water

C 4.0 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

D 0.2 phosphoric acid sodium ascorbate

1.0 tocopherol acetate

0.2 bisabolol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of sodium hydroxide of E

Embodiment 56: use KBD in oil/water type protectiveness day cream

AI 1％：

% composition (INCI)

A 1.7 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

0.7 16/octadecyl polyoxyethylene (25) ether

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 PEG-14 polydimethylsiloxane

3.6 16/octadecanol

6.0 ethylhexyl methoxy cinnamate

2.0 dibutyl adipate

B 5.0 glycerol

0.2 EDTA disodium

1.0 pantothenylol

An amount of antiseptic

68.6 demineralized water

C 4.0 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

D 1.0 phosphoric acid sodium ascorbates

1.0 tocopherol acetate

0.2 bisabolol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of sodium hydroxide of E

AI 5％：

% composition (INCI)

A 1.7 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

0.7 16/octadecyl polyoxyethylene (25) ether

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 PEG-14 polydimethylsiloxane

3.6 16/octadecanol

6.0 ethylhexyl methoxy cinnamate

2.0 dibutyl adipate

B 5.0 glycerol

0.2 EDTA disodium

1.0 pantothenylol

An amount of antiseptic

64.6 demineralized water

C 4.0 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

D 1.0 phosphoric acid sodium ascorbates

1.0 tocopherol acetate

0.2 bisabolol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of sodium hydroxide of E

Embodiment 57: use KBD in oil/water profile portion cleaning washing liquid

AI 1％：

% composition (INCI)

A 10.0 thylhexoic acids 16/stearyl

10.0 glycerol three (caprylic/capric) ester

1.5 ring-type five polysiloxanes, ring-type six polysiloxanes

2.0 polyoxyethylene (40) castor oil hydrogenated

B 3.5 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

C 1.0 tocopherol acetates

0.2 bisabolol

An amount of antiseptic

An amount of aromatic oil

D 3.0 polyquaternary ammonium salt-44

0.5 cocoyl trimethyl sulphuric acid dimethylammonium

0.5 16/octadecyl polyoxyethylene (25) ether

2.0 pantothenylol, propylene glycol

4.0 propylene glycol

0.1 EDTA disodium

1.0 have the aqueous solution of about 5% fusion rotein-KBD

60.7 demineralized water

AI 5％：

% composition (INCI)

A 10.0 thylhexoic acids 16/stearyl

10.0 glycerol three (caprylic/capric) ester

1.5 ring-type five polysiloxanes, ring-type six polysiloxanes

2.0 polyoxyethylene (40) castor oil hydrogenated

B 3.5 glycerol three (caprylic/capric) esters, sodium acrylate copolymer

C 1.0 tocopherol acetates

0.2 bisabolol

An amount of antiseptic

An amount of aromatic oil

D 3.0 polyquaternary ammonium salt-44

0.5 cocoyl trimethyl sulphuric acid dimethylammonium

0.5 16/octadecyl polyoxyethylene (25) ether

2.0 pantothenylol, propylene glycol

4.0 propylene glycol

0.1 EDTA disodium

5.0 have the aqueous solution of about 5% fusion rotein-KBD

56.7 demineralized water

Embodiment 58: use KBD in daily body care spray

AI 1％：

% composition (INCI)

A 3.0 ethylhexyl methoxy cinnamates

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

1.0 polyquaternary ammonium salt-44

3.0 propylene glycol

2.0 pantothenylol, propylene glycol

1.0 ring-type five polysiloxanes, ring-type six polysiloxanes

10.0 octyldodecanol

0.5 PVP

10.0 glycerol three (caprylic/capric) ester

3.0 benzoic acid C12-15 Arrcostab

3.0 glycerol

1.0 tocopherol acetate

0.3 bisabolol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

59.2 alcohol

AI 5％：

% composition (INCI)

A 3.0 ethylhexyl methoxy cinnamates

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

1.0 polyquaternary ammonium salt-44

3.0 propylene glycol

2.0 pantothenylol, propylene glycol

1.0 ring-type five polysiloxanes, ring-type six polysiloxanes

10.0 octyldodecanol

0.5 PVP

10.0 glycerol three (caprylic/capric) ester

3.0 benzoic acid C12-15 Arrcostab

3.0 glycerol

1.0 tocopherol acetate

0.3 bisabolol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

55.2 alcohol

Embodiment 59: use KBD in the skin nursing gel

AI 1％：

% composition (INCI)

A 3.6 polyoxyethylene (40) castor oil hydrogenated

15.0 alcohol

0.1 bisabolol

0.5 tocopherol acetate

An amount of aromatic oil

B 3.0 pantothenylol

0.6 carbomer

1.0 have the aqueous solution of about 5% fusion rotein-KBD

75.4 demineralized water

C 0.8 triethanolamine

AI 5％：

% composition (INCI)

A 3.6 polyoxyethylene (40) castor oil hydrogenated

15.0 alcohol

0.1 bisabolol

0.5 tocopherol acetate

An amount of aromatic oil

B 3.0 pantothenylol

0.6 carbomer

5.0 have the aqueous solution of about 5% fusion rotein-KBD

71.4 demineralized water

C 0.8 triethanolamine

Embodiment 60: use KBD in shaving afterwards with washing liquid

AI 1％：

% composition (INCI)

A 10.0 thylhexoic acids 16/stearyl

5.0 tocopherol acetate

1.0 bisabolol

0.1 aromatic oil

0.3 acrylate/acrylic acid C10-30 alkyl ester cross-linked polymer

B 15.0 alcohol

1.0 pantothenylol

3.0 glycerol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

0.1 triethanolamine

63.5 demineralized water

AI 5％：

% composition (INCI)

A 10.0 thylhexoic acids 16/stearyl

5.0 tocopherol acetate

1.0 bisabolol

0.1 aromatic oil

0.3 acrylate/acrylic acid C10-30 alkyl ester cross-linked polymer

B 15.0 alcohol

1.0 pantothenylol

3.0 glycerol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

0.1 triethanolamine

59.5 demineralized water

Embodiment 61: behind sun tan with using KBD in the washing liquid washing liquid

AI 1％：

% composition (INCI)

A 0.4 acrylate/acrylic acid C10-30 alkyl ester cross-linked polymer

15.0 thylhexoic acid 16/stearyl

0.2 bisabolol

1.0 tocopherol acetate

An amount of aromatic oil

B 1.0 pantothenylol

15.0 alcohol

3.0 glycerol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

63.2 demineralized water

C 0.2 triethanolamine

AI 5％：

% composition (INCI)

A 0.4 acrylate/acrylic acid C10-30 alkyl ester cross-linked polymer

15.0 thylhexoic acid 16/stearyl

0.2 bisabolol

1.0 tocopherol acetate

An amount of aromatic oil

B 1.0 pantothenylol

15.0 alcohol

3.0 glycerol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

59.2 demineralized water

C 0.2 triethanolamine

Embodiment 62: use KBD in suntan lotion

AI 1％：

% composition (INCI)

A 4.5 ethylhexyl methoxy cinnamates

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

3.0 2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite

2.5 the two C12-13 Arrcostabs of malic acid

0.5 tocopherol acetate

4.0 polyglycereol (3) methyl glucoside distearate

B 3.5 different n-nonanoic acid 16/octadecane esters

1.0 VP/ eicosylene copolymer

5.0 2-Methylpentadecane

2.5 the two C12-13 Arrcostabs of malic acid

3.0 titanium dioxide, trimethoxy decoyl silane

C 5.0 glycerol

1.0 16/sodium stearyl sulfate

0.5 Xanthan gum

59.7 demineralized water

D 1.0 has the aqueous solution of about 5% fusion rotein-KBD

0.3 bisabolol

AI 5％：

% composition (INCI)

A 4.5 ethylhexyl methoxy cinnamates

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

3.0 2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite

2.5 the two C12-13 Arrcostabs of malic acid

0.5 tocopherol acetate

4.0 polyglycereol (3) methyl glucoside distearate

B 3.5 different n-nonanoic acid 16/octadecane esters

1.0 VP/ eicosylene copolymer

5.0 2-Methylpentadecane

2.5 the two C12-13 Arrcostabs of malic acid

3.0 titanium dioxide, trimethoxy decoyl silane

C 5.0 glycerol

1.0 16/sodium stearyl sulfate

0.5 Xanthan gum

55.7 demineralized water

D 5.0 has the aqueous solution of about 5% fusion rotein-KBD

0.3 bisabolol

Embodiment 63: use KBD in oil/water type suntan lotion

AI 1％：

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

3.0 glycerol San behenic acid ester

2.0 16/octadecanol

2.0 thylhexoic acid 16/stearyl

5.0 ethylhexyl methoxy cinnamate

1.0 ethylhexyl triazinone

1.0 VP/ eicosylene copolymer

7.0 isopropyl myristate

B 5.0 zinc oxide, triethoxy decoyl silane

C 0.2 Xanthan gum

0.5 2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers,

Squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate

0.2 EDTA disodium

5.0 propylene glycol

0.5 pantothenylol

60.9 demineralized water

D 1.0 has the aqueous solution of about 5% fusion rotein-KBD

1.0 tocopherol acetate

0.2 bisabolol

AI 5％：

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

3.0 glycerol San behenic acid ester

2.0 16/octadecanol

2.0 thylhexoic acid 16/stearyl

5.0 ethylhexyl methoxy cinnamate

1.0 ethylhexyl triazinone

1.0 VP/ eicosylene copolymer

7.0 isopropyl myristate

B 5.0 zinc oxide, triethoxy decoyl silane

C 0.2 Xanthan gum

0.5 2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers,

Squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate

0.2 EDTA disodium

5.0 propylene glycol

0.5 pantothenylol

56.9 demineralized water

D 5.0 has the aqueous solution of about 5% fusion rotein-KBD

1.0 tocopherol acetate

0.2 bisabolol

Embodiment 64: in oil/water type suntan lotion

AI 1％：

% composition (INCI)

A 3.5 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

1.5 16/octadecyl polyoxyethylene (25) ether

7.5 ethylhexyl methoxy cinnamate

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 ring-type five polysiloxanes, ring-type six polysiloxanes

0.5 Cera Flava

3.0 16/octadecanol

10.0 glycerol three (caprylic/capric) ester

B 5.0 titanium dioxide, silicon dioxide, polymethyl siloxane, aluminium oxide

C 3.0 glycerol

0.2 EDTA sodium

0.3 Xanthan gum

1.0 decyl glucoside

2.0 pantothenylol, propylene glycol

56.3 demineralized water

D 1.0 has the aqueous solution of about 5% fusion rotein-KBD

1.0 tocopherol acetate

0.2 bisabolol

An amount of aromatic oil

An amount of antiseptic

AI 5％：

% composition (INCI)

A 3.5 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

1.5 16/octadecyl polyoxyethylene (25) ether

7.5 ethylhexyl methoxy cinnamate

2.0 lignocaine oxybenzene formoxyl hexyl benzene formic acid esters

2.0 ring-type five polysiloxanes, ring-type six polysiloxanes

0.5 Cera Flava

3.0 16/octadecanol

10.0 glycerol three (caprylic/capric) ester

B 5.0 titanium dioxide, silicon dioxide, polymethyl siloxane, aluminium oxide

C 3.0 glycerol

0.2 EDTA disodium

0.3 Xanthan gum

1.0 decyl glucoside

2.0 pantothenylol, propylene glycol

52.3 demineralized water

D 5.0 has the aqueous solution of about 5% fusion rotein-KBD

1.0 tocopherol acetate

0.2 bisabolol

An amount of aromatic oil

An amount of antiseptic

Embodiment 65: use KBD in sufficient face cream

AI 1％：

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

5.0 thylhexoic acid 16/stearyl

4.0 spermol

4.0 glyceryl stearate

5.0 mineral oil

0.2 menthol

0.5 Camphora

B 69.3 demineralized waters

An amount of antiseptic

C 1.0 bisabolols

1.0 tocopherol acetate

D 1.0 has the aqueous solution of about 5% fusion rotein-KBD

5.0 Radix Hamamelidis Mollis extract

AI 5％：

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

5.0 thylhexoic acid 16/stearyl

4.0 spermol

4.0 glyceryl stearate

5.0 mineral oil

0.2 menthol

0.5 Camphora

B 65.3 demineralized waters

An amount of antiseptic

C 1.0 bisabolols

1.0 tocopherol acetate

D 5.0 has the aqueous solution of about 5% fusion rotein-KBD

5.0 Radix Hamamelidis Mollis extract

Embodiment 66: use KBD in containing the water/oil emulsion of bisabolol

AI 1％：

% composition (INCI)

A 6.0 polyoxyethylene (7) castor oil hydrogenated

8.0 thylhexoic acid 16/stearyl

5.0 isopropyl myristate

15.0 mineral oil

0.3 magnesium stearate

0.3 aluminium stearate

2.0 PEG-45/ dodecyl diol copolymer

B 5.0 glycerol

0.7 magnesium sulfate

55.6 demineralized water

C 1.0 has the aqueous solution of about 5% fusion rotein-KBD

0.5 tocopherol acetate

0.6 bisabolol

AI 5％：

% composition (INCI)

A 6.0 polyoxyethylene (7) castor oil hydrogenated

8.0 thylhexoic acid 16/stearyl

5.0 isopropyl myristate

15.0 mineral oil

0.3 magnesium stearate

0.3 aluminium stearate

2.0 PEG-45/ dodecyl diol copolymer

B 5.0 glycerol

0.7 magnesium sulfate

51.6 demineralized water

C 5.0 has the aqueous solution of about 5% fusion rotein-KBD

0.5 tocopherol acetate

Embodiment 67: shower gels

AI 1％

% composition (INCI)

A 40.0 sodium laureth sulfates

5.0 decyl glucoside

5.0 cocoamidopropyl

1.0 have the aqueous solution of about 5% fusion rotein-KBD

1.0 pantothenylol

An amount of aromatic oil

An amount of antiseptic

2.0 sodium chloride

46.0 demineralized water

An amount of citric acid of B

AI 5％

% composition (INCI)

A 40.0 sodium laureth sulfates

5.0 decyl glucoside

5.0 cocoamidopropyl

5.0 have the aqueous solution of about 5% fusion rotein-KBD

1.0 pantothenylol

An amount of aromatic oil

An amount of antiseptic

2.0 sodium chloride

42.0 demineralized water

An amount of citric acid of B

Embodiment 68: moisture retention body care frost

AI 1％

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (25) ether

2.0 16/octadecyl polyoxyethylene (6) ether, octadecanol

3.0 thylhexoic acid 16/stearyl

1.0 polydimethylsiloxane

4.0 16/octadecanol

3.0 self-emulsifying type tristerin

5.0 mineral oil

4.0 simmondsia (Jojoba) seed oil

3.0 mineral oil, lanolin alcohol

B 5.0 propylene glycol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

1.0 pantothenylol

0.5 Magnesiumaluminumsilicate

The q.s antiseptic

65.5 demineralized water

An amount of aromatic oil of C

An amount of citric acid of D

AI 5％

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (25) ether

2.0 16/octadecyl polyoxyethylene (6) ether, octadecanol

3.0 thylhexoic acid 16/stearyl

1.0 polydimethylsiloxane

4.0 16/octadecanol

3.0 self-emulsifying type tristerin

5.0 mineral oil

4.0 simmondsia (Jojoba) seed oil

3.0 mineral oil, lanolin alcohol

B 5.0 propylene glycol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

1.0 pantothenylol

0.5 Magnesiumaluminumsilicate

The q.s antiseptic

61.5 demineralized water

An amount of aromatic oil of C

An amount of citric acid of D

Embodiment 69: moisture retention body care frost

AI 1％

% composition (INCI)

A 6.0 polyoxyethylene (7) castor oil hydrogenated

10.0 thylhexoic acid 16/stearyl

5.0 isopropyl myristate

7.0 mineral oil

0.5 Adeps Bovis seu Bubali resin (Butyrospermum)

0.5 aluminium stearate

0.5 magnesium stearate

0.2 bisabolol

0.7 dihydro tallow alkyl dimethyl ammonium chloride-hectorite

B 5.0 dipropylene glycols

0.7 magnesium sulfate

An amount of antiseptic

62.9 demineralized water

An amount of aromatic oil of C

1.0 have the aqueous solution of about 5% fusion rotein-KBD

AI 5％

% composition (INCI)

A 6.0 polyoxyethylene (7) castor oil hydrogenated

10.0 thylhexoic acid 16/stearyl

5.0 isopropyl myristate

7.0 mineral oil

0.5 Adeps Bovis seu Bubali resin (Butyrospermum)

0.5 aluminium stearate

0.5 magnesium stearate

0.2 bisabolol

0.7 dihydro tallow alkyl dimethyl ammonium chloride-hectorite

B 5.0 dipropylene glycols

0.7 magnesium sulfate

An amount of antiseptic

58.9 demineralized water

An amount of aromatic oil of C

5.0 have the aqueous solution of about 5% fusion rotein-KBD

Embodiment 70: at the bottom of the wet-milling-and oil/water type

AI 1％

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

6.0 glyceryl stearate

1.0 spermol

8.0 mineral oil

7.0 thylhexoic acid 16/stearyl

0.2 polydimethylsiloxane

B 3.0 propylene glycol

1.0 pantothenylol

An amount of antiseptic

61.9 demineralized water

C 0.1 bisabolol

1.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of aromatic oil

D 5.7 C.I.77 891, titanium dioxide

1.1 ferrum oxide

AI 5％

% composition (INCI)

A 2.0 ten six/octadecyl polyoxyethylene (6) ether, octadecanol

2.0 16/octadecyl polyoxyethylene (25) ether

6.0 glyceryl stearate

1.0 spermol

8.0 mineral oil

7.0 thylhexoic acid 16/stearyl

0.2 polydimethylsiloxane

B 3.0 propylene glycol

1.0 pantothenylol

An amount of antiseptic

57.9 demineralized water

C 0.1 bisabolol

5.0 have the aqueous solution of about 5% fusion rotein-KBD

An amount of aromatic oil

D 5.7 C.I.77 891, titanium dioxide

1.1 ferrum oxide

Embodiment 71

The skin cosmetic product of the present invention of the effector molecule C16-KBD-D (according to the SEQ ID No:212 among the pRee024 (Fig. 8)) that comprises the keratin-binding for preparing according to embodiment 3 is hereinafter described.The fusion rotein of described keratin-binding uses as the about 5 weight % concentration that account for aqueous solution weight.Following data are weight portions.

The gel cream

The OW sun-screening agent

Aqueous dispersion

The sun-proof Emulsion of WO

The strip cosmetics

The gel cream

The OW oneself shines black preparation

	1	2	3	4	5	6	7
	1	2	3	4	5	6	7	The self-emulsifying type glyceryl monostearate	0.50	1.00	3.00			1.50
Glycerol stearic acid citrate	2.00		1.00	2.00	4.00			The self-emulsifying type glyceryl monostearate	0.50	1.00	3.00			1.50
Glycerol stearic acid citrate	2.00		1.00	2.00	4.00			Stearic acid		3.00		2.00
Stearic acid Polyethylene Glycol (40) ester	0.50					2.00		Stearic acid		3.00		2.00
Stearic acid Polyethylene Glycol (40) ester	0.50					2.00		Phosphoric acid spermaceti alcohol ester						1.00
16/octadecanol sulfuric ester							0.75	Phosphoric acid spermaceti alcohol ester						1.00
16/octadecanol sulfuric ester							0.75	Octadecanol			3.00			2.00	0.60
Spermol	2.50	1.10		1.50	0.60		2.00	Octadecanol			3.00			2.00	0.60
Spermol	2.50	1.10		1.50	0.60		2.00	Fusion rotein-KBD	0.1	0.5	0.025	5.0	3.0	10.0	1.0
Dihydroxy acetone			3.00	5.00		4		Fusion rotein-KBD	0.1	0.5	0.025	5.0	3.0	10.0	1.0
Dihydroxy acetone			3.00	5.00		4		Superfine titanic oxide	1.00				1.50		1.50
Super fine zinc oxide				0.25		2.00		Superfine titanic oxide	1.00				1.50		1.50
Super fine zinc oxide				0.25		2.00		Benzoic acid C12-15 Arrcostab		0.25			4.00	7.00
Dicaprylyl ether			3.50		2.00			Benzoic acid C12-15 Arrcostab		0.25			4.00	7.00
Dicaprylyl ether			3.50		2.00			Butanediol two sad/dicaprates	5.00		6.00
The glyceryl cocoate class			6.00		2.00			Butanediol two sad/dicaprates	5.00		6.00
The glyceryl cocoate class			6.00		2.00			Polydimethylsiloxane	0.50		1.00		2.00
Annular dimethyl polysiloxane	2.00		0.50		0.50			Polydimethylsiloxane	0.50		1.00		2.00
Annular dimethyl polysiloxane	2.00		0.50		0.50			Butyrospermum (Adeps Bovis seu Bubali resin)		2.00
VP/ hexadecene copolymer	0.20			0.50		1.00		Butyrospermum (Adeps Bovis seu Bubali resin)		2.00
VP/ hexadecene copolymer	0.20			0.50		1.00		Glycerol	3.00	7.50		7.50	5.00		2.50

Xanthan gum	0.15		0.05			0.30
Xanthan gum	0.15		0.05			0.30		Carbomer sodium		0.20		0.15	0.25
Vitamin E acetate	0.60		0.23		0.70	1.00		Carbomer sodium		0.20		0.15	0.25
Vitamin E acetate	0.60		0.23		0.70	1.00		Biological carbohydrate gum-1		3.00	10.00
Soybean oil				0.50		1.50	1.00	Biological carbohydrate gum-1		3.00	10.00
Soybean oil				0.50		1.50	1.00	Ethylhexyl glycerol	0.30
Dimethyl dihydroxymethyl hydantoin		0.60	0.40	0.20				Ethylhexyl glycerol	0.30
Dimethyl dihydroxymethyl hydantoin		0.60	0.40	0.20				The iodo propinyl butyl carbamate				0.18	0.20
Methyl parahydroxybenzoate	0.15		0.25		0.50			The iodo propinyl butyl carbamate				0.18	0.20
Methyl parahydroxybenzoate	0.15		0.25		0.50			Phenoxyethanol	1.00	0.40			0.40	0.50	0.40
The EDTA trisodium	0.02		0.05					Phenoxyethanol	1.00	0.40			0.40	0.50	0.40
The EDTA trisodium	0.02		0.05					Imino-diacetic succinic acid four sodium				0.25	1.00
Ethanol	2.00	1.50		3.00		1.20	5.00	Imino-diacetic succinic acid four sodium				0.25	1.00
Ethanol	2.00	1.50		3.00		1.20	5.00	Aromatic oil	0.10	0.25	0.30		0.40	0.20
Demineralized water	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Aromatic oil	0.10	0.25	0.30		0.40	0.20

OW foundation cream (make-up)

	1	2	3	4	5	6	7
	1	2	3	4	5	6	7	The self-emulsifying type glyceryl monostearate	0.50	1.00	3.00		1.50
Glycerol stearic acid citrate	2.00		1.00	2.00	4.00			The self-emulsifying type glyceryl monostearate	0.50	1.00	3.00		1.50
Glycerol stearic acid citrate	2.00		1.00	2.00	4.00			Stearic acid		3.00		2.00
Stearic acid Polyethylene Glycol (40) ester	0.50					2.00		Stearic acid		3.00		2.00
Stearic acid Polyethylene Glycol (40) ester	0.50					2.00		Phosphoric acid spermaceti alcohol ester					1.00

16/octadecanol sulfuric ester							0.75
16/octadecanol sulfuric ester							0.75	Octadecanol			3.00			2.00	0.60
Spermol	2.50	1.10		1.50	0.60		2.00	Octadecanol			3.00			2.00	0.60
Spermol	2.50	1.10		1.50	0.60		2.00	Fusion rotein-KBD	3.0	5.0	2.0	0.5	1.0	5.0	10.0
Titanium dioxide	10.00	12.00	9.00	8.50	11.00	9.50	10.00	Fusion rotein-KBD	3.0	5.0	2.0	0.5	1.0	5.0	10.0
Titanium dioxide	10.00	12.00	9.00	8.50	11.00	9.50	10.00	Ferrum oxide	2.00	4.00	3.00	5.00	3.40	6.00	4.40
Zinc oxide		4.00		2.00		3.00		Ferrum oxide	2.00	4.00	3.00	5.00	3.40	6.00	4.40
Zinc oxide		4.00		2.00		3.00		Benzoic acid C12-15 Arrcostab		0.25			4.00	7.00
Dicaprylyl ether			3.50		2.00			Benzoic acid C12-15 Arrcostab		0.25			4.00	7.00
Dicaprylyl ether			3.50		2.00			Butanediol two sad/dicaprates	5.00		6.00
The glyceryl cocoate class			6.00		2.00			Butanediol two sad/dicaprates	5.00		6.00
The glyceryl cocoate class			6.00		2.00			Polydimethylsiloxane	0.50		1.00		2.00
Annular dimethyl polysiloxane	2.00		0.50		0.50			Polydimethylsiloxane	0.50		1.00		2.00
Annular dimethyl polysiloxane	2.00		0.50		0.50			Butyrospermum (Adeps Bovis seu Bubali resin)		2.00
VP/ hexadecene copolymer	0.20			0.50		1.00		Butyrospermum (Adeps Bovis seu Bubali resin)		2.00
VP/ hexadecene copolymer	0.20			0.50		1.00		Glycerol	3.00	7.50		7.50	5.00		2.50
Xanthan gum	0.15		0.05			0.30		Glycerol	3.00	7.50		7.50	5.00		2.50
Xanthan gum	0.15		0.05			0.30		Carbomer sodium		0.20		0.15	0.25
Vitamin E acetate	0.60		0.23		0.70	1.00		Carbomer sodium		0.20		0.15	0.25
Vitamin E acetate	0.60		0.23		0.70	1.00		Soybean oil				0.50		1.50	1.00
Ethylhexyl glycerol	0.30							Soybean oil				0.50		1.50	1.00
Ethylhexyl glycerol	0.30							Dimethyl dihydroxymethyl hydantoin		0.60	0.40	0.20
The iodo propinyl butyl carbamate				0.18	0.20			Dimethyl dihydroxymethyl hydantoin		0.60	0.40	0.20
The iodo propinyl butyl carbamate				0.18	0.20			Methyl parahydroxybenzoate	0.15		0.25		0.50
Phenoxyethanol	1.00	0.40			0.40	0.50	0.40	Methyl parahydroxybenzoate	0.15		0.25		0.50

The EDTA trisodium	0.02		0.05
The EDTA trisodium	0.02		0.05					Imino-diacetic succinic acid four sodium				0.25	1.00
Ethanol	2.00	1.50		3.00		1.20	5.00	Imino-diacetic succinic acid four sodium				0.25	1.00
Ethanol	2.00	1.50		3.00		1.20	5.00	Aromatic oil	0.10	0.25	0.30		0.40	0.20
Demineralized water	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Aromatic oil	0.10	0.25	0.30		0.40	0.20

The tanned water dispersant of using of oneself

Aqueous dispersion behind the sun tan

WO Emulsion

Solid stabilizing Emulsion

(pik woods Emulsion)

	1	2	3	4	5
	1	2	3	4	5	Mineral oil			16.00	16.00
Octyldodecanol	9.00	9.00	5.00			Mineral oil			16.00	16.00
Octyldodecanol	9.00	9.00	5.00			Glycerol three (caprylic/capric) ester	9.00	9.00	6.00
Benzoic acid C12-15 Arrcostab				5.00	8.00	Glycerol three (caprylic/capric) ester	9.00	9.00	6.00
Benzoic acid C12-15 Arrcostab				5.00	8.00	Butanediol two sad/dicaprates					8.00
Dicaprylyl ether	9.00			4.00		Butanediol two sad/dicaprates					8.00
Dicaprylyl ether	9.00			4.00		Dicaprylyl carbonate		9.00
Hydroxyl octacosyl hydroxy stearic acid ester	2.00	2.00	2.20	2.50	1.50	Dicaprylyl carbonate		9.00
Hydroxyl octacosyl hydroxy stearic acid ester	2.00	2.00	2.20	2.50	1.50	Distearyl Dimethyl Ammonium-hectorite	1.00	0.75		0.50	0.25
Microwax+vaseline		0.35			5.00	Distearyl Dimethyl Ammonium-hectorite	1.00	0.75		0.50	0.25
Microwax+vaseline		0.35			5.00	Hydroxypropyl emthylcellulose			0.10		0.05
Polydimethylsiloxane					3.00	Hydroxypropyl emthylcellulose			0.10		0.05
Polydimethylsiloxane					3.00	Fusion rotein-KBD	1.0	0.5	0.1	3.0	5.0
Titanium dioxide+aluminium oxide+the polydimethylsiloxane of dimethyl siloxane chain length 200-350 and the mixture+water of silica gel		3.00				Fusion rotein-KBD	1.0	0.5	0.1	3.0	5.0
		3.00				Titanium dioxide+trimethoxy decoyl silane		2.00	4.00	2.00	4.00
The dimetylsilyl Silicon stone	2.50			6.00	2.50	Titanium dioxide+trimethoxy decoyl silane		2.00	4.00	2.00	4.00
The dimetylsilyl Silicon stone	2.50			6.00	2.50	Boron nitride			1.00
Starch/Polymeric sodium metaphosphate. polymer	2.00					Boron nitride			1.00
Starch/Polymeric sodium metaphosphate. polymer	2.00					Tapioca		0.50
Sodium chloride	5.00	7.00	8.50	3.00	4.50	Tapioca		0.50

Glycerol				1.00
Glycerol				1.00		The EDTA trisodium	1.00	1.00	1.00	1.00	1.00
Vitamin E acetate	5.00	10.00	3.00	6.00	10.00	The EDTA trisodium	1.00	1.00	1.00	1.00	1.00
Vitamin E acetate	5.00	10.00	3.00	6.00	10.00	Ascorbic palmitate	1.00	1.00		1.00
Methyl parahydroxybenzoate		0.60			0.20	Ascorbic palmitate	1.00	1.00		1.00
Methyl parahydroxybenzoate		0.60			0.20	Propyl p-hydroxybenzoate					0.20
Phenoxyethanol			0.20			Propyl p-hydroxybenzoate					0.20
Phenoxyethanol			0.20			Two (hydroxyethylsulfonic acid .) hexamidine			0.40	0.50	0.40
N-(methylol)-N-(1, the two methylols-2 of 3-, 5-dioxy-4-imidazolidinyl)-N '-(methylol) urea					0.08	Two (hydroxyethylsulfonic acid .) hexamidine			0.40	0.50	0.40
					0.08	Ethanol			0.23	0.20
Aromatic oil	5.00		3.00	4.00		Ethanol			0.23	0.20
Aromatic oil	5.00		3.00	4.00		Demineralized water	0.20		0.30	0.10
	Add to 100	Add to 100	Add to 100	Add to 100	Add to 100	Demineralized water	0.20		0.30	0.10

The strip cosmetics

The tanned PIT Emulsion of oneself

The oleogel agent

	1	2	3	4
	1	2	3	4	Glycerol three (caprylic/capric) ester	12.00	10.00	6.00
Octyldodecanol	7.00	14.00	8.00	3.00	Glycerol three (caprylic/capric) ester	12.00	10.00	6.00
Octyldodecanol	7.00	14.00	8.00	3.00	Butanediol two sad/dicaprates				12.00
Pentaerythritol tetraoctyl stearate	10.00	6.00	8.00	7.00	Butanediol two sad/dicaprates				12.00
Pentaerythritol tetraoctyl stearate	10.00	6.00	8.00	7.00	Two isostearic acid polyglycereol (3) esters	2.50
Two-two many acyl groups of glycerol adipate esters-2	9.00	8.00	10.00	8.00	Two isostearic acid polyglycereol (3) esters	2.50
Two-two many acyl groups of glycerol adipate esters-2	9.00	8.00	10.00	8.00	Myristyl myristate	3.50	3.00	4.00	3.00
Dihydro tallow alkyl dimethyl ammonium chloride bentonite	5.00	5.00	6.00	6.00	Myristyl myristate	3.50	3.00	4.00	3.00
Dihydro tallow alkyl dimethyl ammonium chloride bentonite	5.00	5.00	6.00	6.00	Propylene carbonate	15.00	20.00	18.00	19.50
Fusion rotein-KBD	1.0	0.5	3.0	5.0	Propylene carbonate	15.00	20.00	18.00	19.50
Fusion rotein-KBD	1.0	0.5	3.0	5.0	Vitamin E acetate	0.50	1.00
Ascorbic palmitate	0.05		0.05		Vitamin E acetate	0.50	1.00
Ascorbic palmitate	0.05		0.05		Jojoba (Buxus Chinensis) oil	2.00	1.00		1.00

Aromatic oil, BHT	0.10	0.25		0.35
Aromatic oil, BHT	0.10	0.25		0.35	Oleum Ricini	Add to 100	Add to 100	Add to 100	Add to 100

Embodiment 72:

Content according to the effector molecule C16-KBD-D (according to the SEQ ID No:212 among the pRee024 (Fig. 8)) of the keratin-binding of embodiment 3 preparation refers to 100% effective ingredient.Effective ingredient of the present invention can use with pure form or aqueous solution form.Under the situation of aqueous solution, the content of demineralized water in concrete preparation must be adjusted.

A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate
A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul M 40	2-hydroxyl-4-methoxy benzophenone
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul M 40	2-hydroxyl-4-methoxy benzophenone
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 T-Lite SF
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum

0.10 allantoin	Allantoin
0.10 allantoin	Allantoin	66.20 demineralized water	Demineralized water
D 1.00 SEpigel 305	Polyacrylamide, C13-14 isoparaffin, lauryl polyoxyethylene (7) ether	66.20 demineralized water	Demineralized water
D 1.00 SEpigel 305		1% fusion rotein-KBD
In right amount	Antiseptic	1% fusion rotein-KBD

A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate
A 7.50 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul M 40	2-hydroxyl-4-methoxy benzophenone
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul M 40	2-hydroxyl-4-methoxy benzophenone
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate

1% fusion rotein-KBD
1% fusion rotein-KBD		In right amount	Antiseptic

A 4.00 Uvinul MC 80

2-Ethylhexyl cinnamate

2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul T 150	The ethylhexyl triazinone	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	2.00 Uvinul A Plus
0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Span 60	Span60
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
1% fusion rotein-KBD		D 2.00 Simulgel NS
1% fusion rotein-KBD		In right amount	Antiseptic

A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate
A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus		0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters

0.50 Vitamin E acetate	Tocopherol acetate
0.50 Vitamin E acetate	Tocopherol acetate	3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	3.00 Dracorin 100SE
1.00 Cremophor CO 410	Polyoxyethylene (40) castor oil hydrogenated	B 3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	B 3.00 T-Lite SF
1.00 Cetiol SB 45	Butyrospermum (Adeps Bovis seu Bubali resin)	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	6.50 Finsolv TN	Benzoic acid C12-15 Arrcostab
C 5.00 butanediols	Butanediol	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.30 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	0.10 allantoin	Allantoin
66.20 demineralized water	Demineralized water	D 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
1% fusion rotein-KBD		D 2.00 Simulgel NS
1% fusion rotein-KBD		In right amount	Antiseptic

A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate
A 4.00 Uvinul MC 80	2-Ethylhexyl cinnamate	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus		0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.80 Rylo PG 11	Polyglycereol dimerization soybean oil acid esters
1.00 Span 60	Span60	0.50 Vitamin E acetate	Tocopherol acetate
3.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100)	0.50 Vitamin E acetate	Tocopherol acetate

In right amount

Antiseptic

A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Fitoderm	Squalane	2.00 Dracorin 100SE
1.00 Fitoderm	Squalane	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 T-Lite SF-S		C 4.00 1,2-propylene glycol nursing thing	Propylene glycol

0.20 Keltrol	Xanthan gum
0.20 Keltrol	Xanthan gum	0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester
Add to 100 demineralized waters	Demineralized water	0.50 Simulgel 600
Add to 100 demineralized waters	Demineralized water	An amount of antiseptic
0.50 Vitamin E acetate	Tocopherol acetate	An amount of antiseptic
0.50 Vitamin E acetate	Tocopherol acetate	1% fusion rotein-KBD
2.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol	1% fusion rotein-KBD

A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Fitoderm	Squalane	2.00 Dracorin 100SE
1.00 Fitoderm	Squalane	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 T-Lite SF		C 4.00 1,2-propylene glycol nursing thing	Propylene glycol
1.00 D-panthenol 50P	Pantothenylol, propylene glycol	C 4.00 1,2-propylene glycol nursing thing	Propylene glycol
1.00 D-panthenol 50P	Pantothenylol, propylene glycol	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene	0.20 Keltrol	Xanthan gum

	(20) oleic acid ester
	(20) oleic acid ester	Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		1.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol

A 1.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00 Abil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	1.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 5.00 1,2-propylene glycol	Propylene glycol	B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 5.00 1,2-propylene glycol	Propylene glycol	1.00 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids
0.20 Keltrol	Xanthan gum	1.00 Mexoryl SX
0.20 Keltrol	Xanthan gum	0.06 Edeta BD	The EDTA disodium
0.04 TEA	Triethanolamine	0.06 Edeta BD	The EDTA disodium
0.04 TEA	Triethanolamine	0.30 Carbopol Ultrez 10P	Carbomer
63.50 demineralized water	Demineralized water	0.30 Carbopol Ultrez 10P	Carbomer

1% fusion rotein-KBD
1% fusion rotein-KBD		An amount of aromatic oil of D
0.50 Glydant	Dimethyl dihydroxymethyl hydantoin	An amount of aromatic oil of D

A 5.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 5.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol
2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester	3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol
2.00 Dracorin 100SE		1.00 Fitoderm	Squalane
0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	1.00 Fitoderm	Squalane
0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate
2.00 Dry Flo Pure	The Dry Flo PC	0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate
2.00 Dry Flo Pure	The Dry Flo PC	B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	B 5.00 T-Lite SF-S
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Keltrol	Xanthan gum
2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	0.20 Keltrol	Xanthan gum
2.00 Simulgel NS		66.30 demineralized water	Demineralized water
An amount of antiseptic		66.30 demineralized water	Demineralized water
An amount of antiseptic		0.50 Vitamin E acetate	Tocopherol acetate
		0.50 Vitamin E acetate	Tocopherol acetate

0.5% fusion rotein-KBD
0.5% fusion rotein-KBD		1.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether

2.00 Lanette O	16/octadecanol
2.00 Lanette O	16/octadecanol	2.00 Luvitol EHO	Thylhexoic acid 16/stearyl
5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Luvitol EHO	Thylhexoic acid 16/stearyl
5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl palmitate	Isopropyl palmitate	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl palmitate	Isopropyl palmitate	B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
C 0.50 Keltrol	Xanthan gum	B 3.00 T-Lite SF-S
C 0.50 Keltrol	Xanthan gum	0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
64.60 demineralized water	Demineralized water	0.50 Simulgel NS
64.60 demineralized water	Demineralized water	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	1% fusion rotein-KBD
D 1.00 Vitamin E acetate	Tocopherol acetate	1% fusion rotein-KBD
D 1.00 Vitamin E acetate	Tocopherol acetate	An amount of antiseptic

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate

1.00 Ganex V-220	VP/ eicosylene copolymer
1.00 Ganex V-220	VP/ eicosylene copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	7.00 isopropyl palmitate	Isopropyl palmitate
B 3.00 T-Lite SF-S		C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS		64.10 demineralized water	Demineralized water
2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium	64.10 demineralized water	Demineralized water
2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		An amount of antiseptic

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Ganex V-220	VP/ eicosylene copolymer	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Ganex V-220	VP/ eicosylene copolymer	7.00 isopropyl palmitate	Isopropyl palmitate

B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
B 3.00 T-Lite SF-S		C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	C 0.50 Keltrol	Xanthan gum
0.50 Simulgel NS		64.60 demineralized water	Demineralized water
1.00 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids	64.60 demineralized water	Demineralized water
1.00 Mexoryl SX		0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		An amount of antiseptic

A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 2.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Mexoryl XL	The drometrizole trisiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Mexoryl XL	The drometrizole trisiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl palmitate	Isopropyl palmitate	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl palmitate	Isopropyl palmitate	B 3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer

C 0.50 Keltrol	Xanthan gum
C 0.50 Keltrol	Xanthan gum	0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
65.10 demineralized water	Demineralized water	0.50 Simulgel NS
65.10 demineralized water	Demineralized water	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	D 1.00 Vitamin E acetate	Tocopherol acetate
0.5% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
0.5% fusion rotein-KBD		An amount of antiseptic

5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Parsol 1789	PAROSOL 1789
1.00 Uvinul T 150	The ethylhexyl triazinone	2.00 Parsol 1789	PAROSOL 1789

5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul T 539 N	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
0.50 Abil 350	Polydimethylsiloxane	2.00 Uvinul T 539 N	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
0.50 Abil 350	Polydimethylsiloxane	2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin
3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin
3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	1.80 Cera Flava 3050 PH	Cera Flava
3.20 TeCero wax 30445	Microwax	1.80 Cera Flava 3050 PH	Cera Flava
3.20 TeCero wax 30445	Microwax	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	6.40 vaseline	Vaseline
7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type	6.40 vaseline	Vaseline
7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl
0.17 natural bisabolol	Bisabolol	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl
0.17 natural bisabolol	Bisabolol	1.84 Vitamin E acetate	Tocopherol acetate
0.42 D, the L-alpha-tocopherol	Tocopherol	1.84 Vitamin E acetate	Tocopherol acetate
0.42 D, the L-alpha-tocopherol	Tocopherol	1% fusion rotein-KBD
40.38 Oleum Ricini	Oleum Ricini	1% fusion rotein-KBD

5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
5.00 T-Lite SF		2.00 Parsol 1789	PAROSOL 1789
1.00 Uvinul T150	The ethylhexyl triazinone	2.00 Parsol 1789	PAROSOL 1789
1.00 Uvinul T150	The ethylhexyl triazinone	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	0.50 Abil 350	Polydimethylsiloxane
2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin	0.50 Abil 350	Polydimethylsiloxane
2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin	3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax

1.80 Cera Flava 3050 PH	Cera Flava
1.80 Cera Flava 3050 PH	Cera Flava	3.20 TeCero wax 30445	Microwax
3.20 TeCero wax 1030 K	Microwax	3.20 TeCero wax 30445	Microwax
3.20 TeCero wax 1030 K	Microwax	1.34 Cutina CP	Hexadecyl palmitate
6.40 vaseline	Vaseline	1.34 Cutina CP	Hexadecyl palmitate
6.40 vaseline	Vaseline	7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type
10.00 Luvitol EHO	Thylhexoic acid 16/stearyl	7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type
10.00 Luvitol EHO	Thylhexoic acid 16/stearyl	0.17 natural bisabolol	Bisabolol
1.84 Vitamin E acetate	Tocopherol acetate	0.17 natural bisabolol	Bisabolol
1.84 Vitamin E acetate	Tocopherol acetate	0.42 D, the L-alpha-tocopherol	Tocopherol
1% fusion rotein-KBD		0.42 D, the L-alpha-tocopherol	Tocopherol
1% fusion rotein-KBD		40.38 Oleum Ricini	Oleum Ricini

5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
5.00 T-Lite SF-S		2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
2.00 Mexoryl XL	The drometrizole trisiloxanes	2.00 Uvinul A Plus
2.00 Mexoryl XL	The drometrizole trisiloxanes	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
0.50 Abil 350	Polydimethylsiloxane	3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
0.50 Abil 350	Polydimethylsiloxane	2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin
3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	2.75 Carnico wax LT 20	Carlow crust (babassu) wax, paraffin
3.70 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	1.80 Cera Flava 3050 PH	Cera Flava
3.20 TeCero wax 30445	Microwax	1.80 Cera Flava 3050 PH	Cera Flava
3.20 TeCero wax 30445	Microwax	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	3.20 TeCero wax 1030 K	Microwax
1.34 Cutina CP	Hexadecyl palmitate	6.40 vaseline	Vaseline

7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type
7.30 Softisan 100	Hydrogenation cocos nucifera oil glyceride type	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl
0.17 natural bisabolol	Bisabolol	10.00 Luvitol EHO	Thylhexoic acid 16/stearyl
0.17 natural bisabolol	Bisabolol	1.84 Vitamin E acetate	Tocopherol acetate
0.42 D, the L-alpha-tocopherol	Tocopherol	1.84 Vitamin E acetate	Tocopherol acetate
0.42 D, the L-alpha-tocopherol	Tocopherol	2% fusion rotein-KBD
39.38 Oleum Ricini	Oleum Ricini	2% fusion rotein-KBD

2.00 Cremophor A 6

16/octadecyl polyoxyethylene (6) ether, ten

	Eight alkanols
	Eight alkanols	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
3.00 Syncrowax HRC	Glycerol San behenic acid ester	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	2.00 Lanette O	16/octadecanol
2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl myristate	Isopropyl myristate	1.00 Ganex V-220	VP/ eicosylene copolymer
7.00 isopropyl myristate	Isopropyl myristate	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 0.20 Keltrol	Xanthan gum	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 0.20 Keltrol	Xanthan gum	0.50 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
61.10 demineralized water	Demineralized water	0.50 Simulgel NS
61.10 demineralized water	Demineralized water	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.20 Edeta BD	The EDTA disodium
5.00 1,2-propylene glycol nursing thing	Propylene glycol	D 1.00 Vitamin E acetate	Tocopherol acetate
1.5% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
1.5% fusion rotein-KBD		An amount of antiseptic

A 2.00 Luvitol EHO	Thylhexoic acid 16/stearyl
A 2.00 Luvitol EHO	Thylhexoic acid 16/stearyl	5.00 paraffin oil	Mineral oil
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	5.00 paraffin oil	Mineral oil
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	B 1.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
2.00 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	B 1.00 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol

3.00 glyceryl monostearate	Glyceryl stearate
3.00 glyceryl monostearate	Glyceryl stearate	4.00 16/octadecanol	16/octadecanol
C 5.00 1,2-propylene glycol nursing thing	Propylene glycol	4.00 16/octadecanol	16/octadecanol
C 5.00 1,2-propylene glycol nursing thing	Propylene glycol	7.50 Luviquat Care	Polyquaternary ammonium salt-44
An amount of antiseptic		7.50 Luviquat Care	Polyquaternary ammonium salt-44
An amount of antiseptic		An amount of aromatic oil
1% fusion rotein-KBD		An amount of aromatic oil
1% fusion rotein-KBD		64.50 demineralized water	Demineralized water

3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul A Plus		10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane

12.00 Cera Flava 3044 PH	Cera Flava
12.00 Cera Flava 3044 PH	Cera Flava	3.00 vaseline	Vaseline
8.00 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	3.00 vaseline	Vaseline
8.00 candelilla wax LT 281 LJ	Little candle tree (Euphorbia Cerifera) wax	8.00 high viscosity paraffin oil	Mineral oil
5.00 Tegin	The self-emulsifying type tristerin	8.00 high viscosity paraffin oil	Mineral oil
5.00 Tegin	The self-emulsifying type tristerin	5.00 Softisan 154	Hydrogenated palm oil
5.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Softisan 154	Hydrogenated palm oil
5.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
0.1% fusion rotein-KBD		5.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
0.1% fusion rotein-KBD		28.90 Oleum Ricini	Oleum Ricini

5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
5.00 T-Lite SF		6.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	6.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	6.00 Miglyol 812	Glycerol three (caprylic/capric) ester
5.00 Arlacel P 135	Dimerization hydroxy stearic acid Polyethylene Glycol (30) ester	6.00 Miglyol 812	Glycerol three (caprylic/capric) ester
5.00 Arlacel P 135		2.00 Ganex V 216	PVP/ hexadecene copolymer
2.00 Elfacos ST 9	PEG-45/ dodecyl diol copolymer	2.00 Ganex V 216	PVP/ hexadecene copolymer
2.00 Elfacos ST 9	PEG-45/ dodecyl diol copolymer	B 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.10 Edeta BD	The EDTA disodium	B 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.10 Edeta BD	The EDTA disodium	1.00 bitter salt	Magnesium sulfate
59.40 demineralized water	Demineralized water	1.00 bitter salt	Magnesium sulfate
59.40 demineralized water	Demineralized water	0.5% fusion rotein-KBD
An amount of antiseptic		0.5% fusion rotein-KBD

A 4.00 Dehymuls SBL

Dimerization hydroxy stearic acid polyglycereol (2) ester, two sufferings

	Base ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	1.5% fusion rotein-KBD
An amount of antiseptic of D		1.5% fusion rotein-KBD

A 4.00 Dehymuls SBL	Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
A 4.00 Dehymuls SBL		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
4.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxane	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite

	Copolymer
	Copolymer	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
1% fusion rotein-KBD		1.00 bitter salt	Magnesium sulfate
1% fusion rotein-KBD		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic of D		Add to 100 demineralized waters	Demineralized water

A 4.00 Dehymuls SBL	Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
A 4.00 Dehymuls SBL		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate and lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B		2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
0.1% fusion rotein-KBD		1.00 bitter salt	Magnesium sulfate
0.1% fusion rotein-KBD		Add to 100 demineralized waters	Demineralized water
An amount of antiseptic		Add to 100 demineralized waters	Demineralized water

A 4.00 Dehymuls SBL

Dimerization hydroxy stearic acid polyglycereol (2) ester, two sufferings

	Base ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate and lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B		2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 5.00 T-Lite SF		C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	0.2% fusion rotein-KBD
An amount of antiseptic		0.2% fusion rotein-KBD

A 4.00 Dehymuls SBL	Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
A 4.00 Dehymuls SBL		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
8.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate and lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester

2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
C 3.00 1,2-propylene glycol nursing thing	Propylene glycol	B 5.00 T-Lite SF-S
C 3.00 1,2-propylene glycol nursing thing	Propylene glycol	0.30 Abiol	Imidazolidinyl urea
1.00 bitter salt	Magnesium sulfate	0.30 Abiol	Imidazolidinyl urea
1.00 bitter salt	Magnesium sulfate	0.5% fusion rotein-KBD
Add to 100 demineralized waters	Demineralized water	0.5% fusion rotein-KBD
Add to 100 demineralized waters	Demineralized water	An amount of antiseptic

A 4.00 Dehymuls SBL	Dimerization hydroxy stearic acid polyglycereol (2) ester, dicaprylyl ether, glyceryl cocoate class, sorbitan sesquioleate, cera alba, aluminium stearate, two cocoyl tetramethylolmethane distearyls alcohol citrate
A 4.00 Dehymuls SBL		1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Dehymuls PGPH	Dimerization hydroxy stearic acid polyglycereol (2) ester
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Miglyol 812	Glycerol three (caprylic/capric) ester
7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 5.00 Z-COTE MAX	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 5.00 Z-COTE MAX		C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	C 3.00 1,2-propylene glycol nursing thing	Propylene glycol
0.30 Abiol	Imidazolidinyl urea	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	1.00 bitter salt	Magnesium sulfate
Add to 100 demineralized waters	Demineralized water	0.01% fusion rotein-KBD

An amount of antiseptic

A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus		1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	1.50 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
B 3.50 Luvigel EM	Glycerol three (caprylic/capric) ester, sodium acrylate copolymer	1.50 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
B 3.50 Luvigel EM		C 46.00 demineralized waters	Demineralized water
D 5.00 1,2-propylene glycol nursing thing	Propylene glycol	C 46.00 demineralized waters	Demineralized water
D 5.00 1,2-propylene glycol nursing thing	Propylene glycol	0.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.05% fusion rotein-KBD		0.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.05% fusion rotein-KBD		20.00 ethanol 96%	Alcohol

A 1.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 1.00 Uvinul A Plus		1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
3.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	8.00 Miglyol 812	Glycerol three (caprylic/capric) ester
1.50 Dow Corning 350Fluid	Polydimethylsiloxane	8.00 Miglyol 812	Glycerol three (caprylic/capric) ester
1.50 Dow Corning 350Fluid	Polydimethylsiloxane	3.00 Z-COTE MAX	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
3.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	3.00 Z-COTE MAX
3.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated

B 2.00 Luvigel EM	Glycerol three (caprylic/capric) ester, sodium acrylate copolymer
B 2.00 Luvigel EM		C 54.80 demineralized waters	Demineralized water
D 15.00 ethanol 96%	Alcohol	C 54.80 demineralized waters	Demineralized water
D 15.00 ethanol 96%	Alcohol	5.00 1,2-propylene glycol nursing thing	Propylene glycol
0.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	5.00 1,2-propylene glycol nursing thing	Propylene glycol
0.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	1% fusion rotein-KBD
1.00 Vitamin E acetate	Tocopherol acetate	1% fusion rotein-KBD
1.00 Vitamin E acetate	Tocopherol acetate	0.20 synthetic raceme bisabolol	Bisabolol

A 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
A 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul T 150	The ethylhexyl triazinone
0.50 Vitamin E acetate	Tocopherol acetate	2.00 Uvinul T 150	The ethylhexyl triazinone
0.50 Vitamin E acetate	Tocopherol acetate	B 5.00 2-Methylpentadecanes	2-Methylpentadecane
5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	B 5.00 2-Methylpentadecanes	2-Methylpentadecane
5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
1.00 Ganex V-220	VP/ eicosylene copolymer	3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer
C 60.00 demineralized waters	Water	5.00 T-Lite SF
C 60.00 demineralized waters	Water	5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	0.30 Keltrol	Xanthan gum
0.2% fusion rotein-KBD		0.30 Keltrol	Xanthan gum
0.2% fusion rotein-KBD		An amount of antiseptic of D

A 8.00 Cetiol B	Dibutyl adipate
A 8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
12.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
12.00 Myritol 331	The glyceryl cocoate class	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
3.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	2.00 Lanette O	16/octadecanol
3.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	1.00 Vitamin E acetate	Tocopherol acetate
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	1.00 Vitamin E acetate	Tocopherol acetate
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	1.50 Veegum Ultra	Magnesiumaluminumsilicate
49.45 demineralized water	Demineralized water	1.50 Veegum Ultra	Magnesiumaluminumsilicate
49.45 demineralized water	Demineralized water	1% fusion rotein-KBD

An amount of antiseptic of D

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate

2.00 Uvinul T 150	The ethylhexyl triazinone
2.00 Uvinul T 150	The ethylhexyl triazinone	B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
5.00 2-Methylpentadecane	2-Methylpentadecane	B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
5.00 2-Methylpentadecane	2-Methylpentadecane	3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
0.50 Vitamin E acetate	Tocopherol acetate	3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Ganex V-220	VP/ eicosylene copolymer
2.50 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	1.00 Ganex V-220	VP/ eicosylene copolymer
2.50 T-Lite SF		C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	1.00 Pationic SSL	Stearoyl dilactic acid sodium
42.00 demineralized water	Demineralized water	1.00 Pationic SSL	Stearoyl dilactic acid sodium
42.00 demineralized water	Demineralized water	D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
10.00 demineralized water	Demineralized water	D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
10.00 demineralized water	Demineralized water	E 0.70 sodium hydroxide	Sodium hydroxide
1% fusion rotein-KBD		E 0.70 sodium hydroxide	Sodium hydroxide
1% fusion rotein-KBD		An amount of antiseptic

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	2.50 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 5.00 glycerol 87%	Glycerol	2.50 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane

2.00 Lanette E	16/sodium stearyl sulfate
2.00 Lanette E	16/sodium stearyl sulfate	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	1.00 Pationic SSL	Stearoyl dilactic acid sodium
42.50 demineralized water	Demineralized water	1.00 Pationic SSL	Stearoyl dilactic acid sodium
42.50 demineralized water	Demineralized water	D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
0.5% fusion rotein-KBD		D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid
0.5% fusion rotein-KBD		10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	An amount of antiseptic

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	7.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Mexoryl XL	The drometrizole trisiloxanes	7.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Mexoryl XL	The drometrizole trisiloxanes	B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
5.00 2-Methylpentadecane	2-Methylpentadecane	B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
5.00 2-Methylpentadecane	2-Methylpentadecane	3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
0.50 Vitamin E acetate	Tocopherol acetate	3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester
0.50 Vitamin E acetate	Tocopherol acetate	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	C 5.00 glycerol 87%	Glycerol
2.00 Lanette E	16/sodium stearyl sulfate	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	0.30 Keltrol	Xanthan gum
1.00 Pationic 138 C	Lauroyl dilactic acid sodium	1.00 Pationic SSL	Stearoyl dilactic acid sodium
40.50 demineralized water	Demineralized water	1.00 Pationic SSL	Stearoyl dilactic acid sodium
40.50 demineralized water	Demineralized water	D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid

1% fusion rotein-KBD
1% fusion rotein-KBD		10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	10.00 demineralized water	Demineralized water
E 0.70 sodium hydroxide	Sodium hydroxide	An amount of antiseptic

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	5.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate	5.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 5.00 glycerol 87%	Glycerol	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 5.00 glycerol 87%	Glycerol	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	41.50 demineralized water	Demineralized water
D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid	41.50 demineralized water	Demineralized water
D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid	0.5% fusion rotein-KBD
9.50 demineralized water	Demineralized water	0.5% fusion rotein-KBD
9.50 demineralized water	Demineralized water	E 0.70 sodium hydroxide	Sodium hydroxide
An amount of antiseptic		E 0.70 sodium hydroxide	Sodium hydroxide

A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
A 5.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	5.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate	5.50 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl-benzoate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	2.00 Mexoryl XL	The drometrizole trisiloxanes
B 4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	5.00 2-Methylpentadecane	2-Methylpentadecane
3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	0.50 Vitamin E acetate	Tocopherol acetate
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
C 5.00 glycerol 87%	Glycerol	5.00 T-Lite SF-S
C 5.00 glycerol 87%	Glycerol	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	2.00 Lanette E	16/sodium stearyl sulfate
0.30 Keltrol	Xanthan gum	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	1.00 Pationic 138 C	Lauroyl dilactic acid sodium
1.00 Pationic SSL	Stearoyl dilactic acid sodium	40.50 demineralized water	Demineralized water
D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid	40.50 demineralized water	Demineralized water
D 5.00 Eusolex 232	Phenylbenzimidazolesulfonic acid	1% fusion rotein-KBD
10.00 demineralized water	Demineralized water	1% fusion rotein-KBD
10.00 demineralized water	Demineralized water	E 0.70 sodium hydroxide	Sodium hydroxide
An amount of antiseptic		E 0.70 sodium hydroxide	Sodium hydroxide

A 8.00 Cetiol B	Dibutyl adipate
A 8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab

1.00 Lanette E	16/sodium stearyl sulfate
1.00 Lanette E	16/sodium stearyl sulfate	4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol
2.00 Lanette O	16/octadecanol	4.00 Eumulgin VL 75
2.00 Lanette O	16/octadecanol	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Vitamin E acetate	Tocopherol acetate
B 5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	1.00 Vitamin E acetate	Tocopherol acetate
B 5.00 T-Lite SF		C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	2% fusion rotein-KBD
1.50 Veegum Ultra	Magnesiumaluminumsilicate	2% fusion rotein-KBD
1.50 Veegum Ultra	Magnesiumaluminumsilicate	Add to 100 demineralized waters	Demineralized water
An amount of aromatic oil of D		Add to 100 demineralized waters	Demineralized water
An amount of aromatic oil of D		An amount of antiseptic

A 8.00 Cetiol B	Dibutyl adipate
A 8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
10.00 Myritol 331	The glyceryl cocoate class	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	1.00 Lanette E	16/sodium stearyl sulfate
4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
1.00 Tinosorb S	Two-ethyl hexyl oxy phenol anisyl triazine	2.00 Lanette O	16/octadecanol

1.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Vitamin E acetate	Tocopherol acetate
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	1.00 Vitamin E acetate	Tocopherol acetate
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	1% fusion rotein-KBD
1.50 Veegum Ultra	Magnesiumaluminumsilicate	1% fusion rotein-KBD
1.50 Veegum Ultra	Magnesiumaluminumsilicate	Add to 100 demineralized waters	Demineralized water
An amount of aromatic oil of D		Add to 100 demineralized waters	Demineralized water
An amount of aromatic oil of D		An amount of antiseptic

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	57.00 demineralized water	Demineralized water
B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	57.00 demineralized water	Demineralized water
B 5.00 T-Lite SF-S		C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul A Plus		2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, ten	2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes

	Eight alkanols
	Eight alkanols	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.50 Cera Flava 3044 PH	Cera Flava	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.50 Cera Flava 3044 PH	Cera Flava	3.00 Lanette O	16/octadecanol
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	3.00 Lanette O	16/octadecanol
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	D 1.00 Vitamin E acetate	Tocopherol acetate
2% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
2% fusion rotein-KBD		0.20 synthetic raceme bisabolol	Bisabolol

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	58.00 demineralized water	Demineralized water
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	58.00 demineralized water	Demineralized water
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul A Plus		2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.50 Cera Flava 3044 PH	Cera Flava	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
0.50 Cera Flava 3044 PH	Cera Flava	3.00 Lanette O	16/octadecanol

10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
10.00 Miglyol 812	Glycerol three (caprylic/capric) ester	D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		0.20 synthetic raceme bisabolol	Bisabolol

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	58.50 demineralized water	Demineralized water
B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	58.50 demineralized water	Demineralized water
B 5.00 T-Lite SF-S		C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	C 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester

0.5% fusion rotein-KBD
0.5% fusion rotein-KBD		0.20 synthetic raceme bisabolol	Bisabolol

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	2.00 Mexoryl SL	To inferior phenylenedimethylidyne two camphorsulfonic acids
58.40 demineralized water	Demineralized water	2.00 Mexoryl SL
58.40 demineralized water	Demineralized water	B 6.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 6.00 T-Lite SF-S
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester

0.1% fusion rotein-KBD
0.1% fusion rotein-KBD		0.20 synthetic raceme bisabolol	Bisabolol

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	2.00 Mexoryl SL	To inferior phenylenedimethylidyne two camphorsulfonic acids
58.45 demineralized water	Demineralized water	2.00 Mexoryl SL
58.45 demineralized water	Demineralized water	B 6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	0.05% fusion rotein-KBD

0.20 synthetic raceme bisabolol

Bisabolol

A 3.00 glycerol 87%	Glycerol
A 3.00 glycerol 87%	Glycerol	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	0.20 Edeta BD	The EDTA disodium
0.30 Abiol	Imidazolidinyl urea	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	1.00 Plantacare 2000	Decyl glucoside
0.30 Keltrol T	Xanthan gum	2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium
57.50 demineralized water	Demineralized water	2.00 Neoheliopan AP	Phenyl bisbenzimidazole tetrasulfonic acid disodium
57.50 demineralized water	Demineralized water	B 6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
D 1.00 Vitamin E acetate	Tocopherol acetate	1.0% fusion rotein-KBD
0.20 synthetic raceme bisabolol	Bisabolol	1.0% fusion rotein-KBD

A 25.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
A 25.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	20.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes
8.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	20.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes
8.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane
7.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane
7.00 T-Lite SF-S		B 17.00 alcohol 95 %	Alcohol

9.99 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
9.99 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	5.00 demineralized water	Demineralized water
3.00 glycerol 87%	Glycerol	5.00 demineralized water	Demineralized water
3.00 glycerol 87%	Glycerol	0.01% fusion rotein-KBD
1.00 Talcum	Talcum	0.01% fusion rotein-KBD

A 20.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
A 20.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	10.00 Dow Corning 245 Fluid	Ring-type five polysiloxanes

7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
12.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
12.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane
B 7.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	4.00 Abil EM 90	Cetyl PEG/PPG-10/1 polydimethylsiloxane
B 7.00 T-Lite SF		C 15.00 alcohol 95 %	Alcohol
10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 15.00 alcohol 95 %	Alcohol
10.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	3.00 glycerol 87%	Glycerol
0.5% fusion rotein-KBD		3.00 glycerol 87%	Glycerol
0.5% fusion rotein-KBD		9.00 demineralized water	Demineralized water

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
3.00 T-Lite SF		4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Uvinul T 150	The ethylhexyl triazinone	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09		C 0.50 sodium chloride	Sodium chloride

0.20 Edeta BD	The EDTA disodium
0.20 Edeta BD	The EDTA disodium	61.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	61.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	1% fusion rotein-KBD
An amount of antiseptic		1% fusion rotein-KBD

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes

3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	B 7.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09		C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	60.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	60.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	2% fusion rotein-KBD
An amount of antiseptic		2% fusion rotein-KBD

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 4.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	B 4.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab

C 0.50 sodium chloride	Sodium chloride
C 0.50 sodium chloride	Sodium chloride	0.20 Edeta BD	The EDTA disodium
62.10 demineralized water	Demineralized water	0.20 Edeta BD	The EDTA disodium
62.10 demineralized water	Demineralized water	D 1.00 Vitamin E acetate	Tocopherol acetate
0.2% fusion rotein-KBD		D 1.00 Vitamin E acetate	Tocopherol acetate
0.2% fusion rotein-KBD		An amount of antiseptic

A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
A 2.00 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	4.00 isopropyl palmitate	Isopropyl palmitate
1.00 Abil 350	Polydimethylsiloxane	B 3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Mexoryl XL	The drometrizole trisiloxanes	B 3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Mexoryl XL	The drometrizole trisiloxanes	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester
C 0.50 sodium chloride	Sodium chloride	4.00 Abil WE 09
C 0.50 sodium chloride	Sodium chloride	0.20 Edeta BD	The EDTA disodium
1% fusion rotein-KBD		0.20 Edeta BD	The EDTA disodium
1% fusion rotein-KBD		61.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	61.30 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	An amount of antiseptic

A 2.00 Cremophor WO 7

Polyoxyethylene (7) castor oil hydrogenated

6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
6.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes	6.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
4.00 isopropyl palmitate	Isopropyl palmitate	6.00 T-Lite SF-S
4.00 isopropyl palmitate	Isopropyl palmitate	1.00 Abil 350	Polydimethylsiloxane
B 3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	1.00 Abil 350	Polydimethylsiloxane
B 3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	1.00 Mexoryl XL	The drometrizole trisiloxanes
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	1.00 Mexoryl XL	The drometrizole trisiloxanes
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester	7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
4.00 Abil WE 09		C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	C 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	61.80 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	61.80 demineralized water	Demineralized water
D 1.00 Vitamin E acetate	Tocopherol acetate	0.5% fusion rotein-KBD
An amount of antiseptic		0.5% fusion rotein-KBD

A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Uvinul T 150	The ethylhexyl triazinone	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Uvinul T 150	The ethylhexyl triazinone	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate

1.00 Ganex V-220	VP/ eicosylene copolymer
1.00 Ganex V-220	VP/ eicosylene copolymer	5.00 2-Methylpentadecane	2-Methylpentadecane
2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	5.00 2-Methylpentadecane	2-Methylpentadecane
2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
D 44.00 demineralized waters	Demineralized water	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
D 44.00 demineralized waters	Demineralized water	5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	15.00 Luviquat Care	Polyquaternary ammonium salt-44
1% fusion rotein-KBD		15.00 Luviquat Care	Polyquaternary ammonium salt-44
1% fusion rotein-KBD		0.50 Keltrol	Xanthan gum
E 1.00 Phenonipp		0.50 Keltrol	Xanthan gum

A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	Two-ethyoxyl hexyl oxygen base phenol anisyl triazine	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	Two-ethyoxyl hexyl oxygen base phenol anisyl triazine	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	D 44.90 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	D 44.90 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	1.00 Lanette E	16/sodium stearyl sulfate
15.00 Luviquat Care	Polyquaternary ammonium salt-44	1.00 Lanette E	16/sodium stearyl sulfate

0.1% fusion rotein-KBD
0.1% fusion rotein-KBD	0.50 Keltrol	Xanthan gum
E 1.00 Phenonip	0.50 Keltrol	Xanthan gum

A 1.50 Mexoryl 1XL	The drometrizole trisiloxanes
A 1.50 Mexoryl 1XL	The drometrizole trisiloxanes	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	D 44.50 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	D 44.50 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	1.00 Lanette E	16/sodium stearyl sulfate
15.00 Luviquat Care	Polyquaternary ammonium salt-44	1.00 Lanette E	16/sodium stearyl sulfate
15.00 Luviquat Care	Polyquaternary ammonium salt-44	1.5% fusion rotein-KBD
0.50 Keltrol	Xanthan gum	1.5% fusion rotein-KBD
0.50 Keltrol	Xanthan gum	E 1.00 Phenonip

A 1.50 Mexoryl XL	The drometrizole trisiloxanes
A 1.50 Mexoryl XL	The drometrizole trisiloxanes	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite

1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
B 0.50 Vitamin E acetate	Tocopherol acetate	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
C 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
5.00 T-Lite SF		D 45.00 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	D 45.00 demineralized waters	Demineralized water
5.00 glycerol 87%	Glycerol	1.00 Lanette E	16/sodium stearyl sulfate
15.00 Luviquat Care	Polyquaternary ammonium salt-44	1.00 Lanette E	16/sodium stearyl sulfate
15.00 Luviquat Care	Polyquaternary ammonium salt-44	1% fusion rotein-KBD
0.50 Keltrol	Xanthan gum	1% fusion rotein-KBD
0.50 Keltrol	Xanthan gum	E 1.00 Phenonip

A 1.00 Abil Care 85	Two-PEG/PPG-16/16 PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00 Abil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	2.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345 Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul T 150	The ethylhexyl triazinone

5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 5.00 1,2-propylene glycol	Propylene glycol	B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 5.00 1,2-propylene glycol	Propylene glycol	0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	2.0% fusion rotein-KBD
1.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	2.0% fusion rotein-KBD
1.50 Simulgel 600		58.40 demineralized water	Demineralized water
An amount of aromatic oil of D		58.40 demineralized water	Demineralized water
An amount of aromatic oil of D		0.50 Glydant	Dimethyl dihydroxymethyl hydantoin

A 2.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 2.00 Abil Care 85		4.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
1.50 Miglyol 812	Glycerol three (caprylic/capric) ester	4.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
1.50 Miglyol 812	Glycerol three (caprylic/capric) ester	0.50 Vitamin E acetate	Tocopherol acetate
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	0.50 Vitamin E acetate	Tocopherol acetate
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Cetiol B	Dibutyl adipate
3.00 Luvitol EHO	Thylhexoic acid 16/stearyl	4.00 Cetiol B	Dibutyl adipate
3.00 Luvitol EHO	Thylhexoic acid 16/stearyl	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
1.00 paraffin oil, low viscosity	Mineral oil	1.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
1.00 paraffin oil, low viscosity	Mineral oil	3.00 Plantacare 2000	Decyl glucoside
0.50 Phenonip		3.00 Plantacare 2000	Decyl glucoside

An amount of aromatic oil
An amount of aromatic oil		B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate	B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 2.00 Simulgel NS		0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	1% fusion rotein-KBD
64.20 demineralized water	Demineralized water	1% fusion rotein-KBD

A 6.00 Gilugel SIL 5	Annular dimethyl polysiloxane (with) aluminium hydroxystearate/magnesium
A 6.00 Gilugel SIL 5		5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	5.00 Uvinul MC 80	Ethylhexyl methoxy cinnamate
2.00 Uvinul A Plus		1.00 Uvinul T 150	The ethylhexyl triazinone
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	1.00 Uvinul T 150	The ethylhexyl triazinone
7.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester
2.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	4.00 Abil WE 09
2.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid	3.00 isopropyl palmitate	Isopropyl palmitate
5.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes	3.00 isopropyl palmitate	Isopropyl palmitate
5.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes	0.50 Abil 350	Polydimethylsiloxane
B 0.50 sodium chloride	Sodium chloride	0.50 Abil 350	Polydimethylsiloxane
B 0.50 sodium chloride	Sodium chloride	0.20 Edeta BD	The EDTA disodium
0.2% fusion rotein-KBD		0.20 Edeta BD	The EDTA disodium

62.10 demineralized water	Demineralized water
62.10 demineralized water	Demineralized water	C 1.00 Vitamin E acetate	Tocopherol acetate
0.50 Phenonip		C 1.00 Vitamin E acetate	Tocopherol acetate

A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 4.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
0.50 Vitamin E acetate	Tocopherol acetate	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
0.50 Vitamin E acetate	Tocopherol acetate	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
B 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	4.00 Tego Care 450	Polyglycereol (3) methyl glucoside distearate
B 3.50 Cetiol SN	Different n-nonanoic acid 16/octadecane ester	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	1.00 Ganex V-220	VP/ eicosylene copolymer
5.00 2-Methylpentadecane	2-Methylpentadecane	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
3.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.50 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
3.00 T-Lite SF		C 5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	C 5.00 glycerol 87%	Glycerol
1.00 Lanette E	16/sodium stearyl sulfate	0.50 Keltrol	Xanthan gum
1% fusion rotein-KBD		0.50 Keltrol	Xanthan gum
1% fusion rotein-KBD		59.70 demineralized water	Demineralized water
D 1.00 Phenonip		59.70 demineralized water	Demineralized water
D 1.00 Phenonip		0.30 synthetic raceme bisabolol	Bisabolol

A 2.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 2.00 Abil Care 85		4.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
1.50 MigIyol 812	Glycerol three (caprylic/capric) ester	4.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
1.50 MigIyol 812	Glycerol three (caprylic/capric) ester	0.50 Vitamin E acetate	Tocopherol acetate
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	0.50 Vitamin E acetate	Tocopherol acetate
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	4.00 Cetiol B	Dibutyl adipate
1.00 Luvitol EHO	Thylhexoic acid 16/stearyl	4.00 Cetiol B	Dibutyl adipate
1.00 Luvitol EHO	Thylhexoic acid 16/stearyl	1.00 Cremophor CO40	Polyoxyethylene (40) castor oil hydrogenated
1.00 paraffin oil, low viscosity	Mineral oil	1.00 Cremophor CO40	Polyoxyethylene (40) castor oil hydrogenated
1.00 paraffin oil, low viscosity	Mineral oil	3.00 Plantacare 2000	Decyl glucoside
1.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters	3.00 Plantacare 2000	Decyl glucoside
1.00 Uvinul A Plus		0.50 Phenonip
2.50 Uvinul T 150	The ethylhexyl triazinone	0.50 Phenonip
2.50 Uvinul T 150	The ethylhexyl triazinone	An amount of aromatic oil
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	An amount of aromatic oil
B 4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 2.00 Simulgel NS	2-(Acryloyloxy)ethanol/sodium acryloyldimethyl taurate copolymers, squalane, anhydrous sorbitol polyoxyethylene (20) ether stearate
0.10 Keltrol	Xanthan gum	C 2.00 Simulgel NS
0.10 Keltrol	Xanthan gum	0.10 Edeta BD	The EDTA disodium
0.5% fusion rotein-KBD		0.10 Edeta BD	The EDTA disodium
0.5% fusion rotein-KBD		59.90 demineralized water	Demineralized water

A 4.00 Eumulgin VL 75

The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol

2.00 Lanette O	16/octadecanol
2.00 Lanette O	16/octadecanol	12.00 Myritol 331	The glyceryl cocoate class
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	12.00 Myritol 331	The glyceryl cocoate class
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	8.00 Cetiol B	Dibutyl adipate
B 6.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	8.00 Cetiol B	Dibutyl adipate
B 6.00 T-Lite SF		5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 3.00 glycerol 87%	Glycerol	5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane
C 3.00 glycerol 87%	Glycerol	0.10 Edeta BD	The EDTA disodium
1.50 Veegum Ultra	Magnesiumaluminumsilicate	0.10 Edeta BD	The EDTA disodium
1.50 Veegum Ultra	Magnesiumaluminumsilicate	1.50 Lanette E	16/sodium stearyl sulfate
2% fusion rotein-KBD		1.50 Lanette E	16/sodium stearyl sulfate
2% fusion rotein-KBD		0.30 Keltrol	Xanthan gum
45.10 demineralized water	Water	0.30 Keltrol	Xanthan gum
45.10 demineralized water	Water	D 1.00 Phenonip	Phenoxyethanol, methyl parahydroxybenzoate, ethylparaben, butyl p-hydroxybenzoate, propyl p-hydroxybenzoate, p-Hydroxybenzoic acid isobutyl ester

A 4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol
A 4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
12.00 Myritol 331	The glyceryl cocoate class	2.00 Lanette O	16/octadecanol
12.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	B 6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	B 6.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 glycerol 87%	Glycerol

0.10 Edeta BD	The EDTA disodium
0.10 Edeta BD	The EDTA disodium	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	0.30 Carbopol Ultrez10 P	Carbomer
2% fusion rotein-KBD		0.30 Carbopol Ultrez10 P	Carbomer
2% fusion rotein-KBD		46.10 demineralized water	Demineralized water
D 1.00 Phenonip	Phenoxyethanol, methyl parahydroxybenzoate, ethylparaben, butyl p-hydroxybenzoate, propyl p-hydroxybenzoate, p-Hydroxybenzoic acid isobutyl ester	46.10 demineralized water	Demineralized water

A 4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol
A 4.00 Eumulgin VL 75		2.00 Lanette O	16/octadecanol
10.00 Myritol 331	The glyceryl cocoate class	2.00 Lanette O	16/octadecanol
10.00 Myritol 331	The glyceryl cocoate class	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab
8.00 Cetiol B	Dibutyl adipate	B 2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	B 2.00 Uvinul A Plus
5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 3.00 glycerol 87%	Glycerol
0.10 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.10 Edeta BD	The EDTA disodium	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Lanette E	16/sodium stearyl sulfate	5.0% fusion rotein-KBD
0.30 Carbopol Ultrez10 P	Carbomer	5.0% fusion rotein-KBD
0.30 Carbopol Ultrez10 P	Carbomer	Add demineralized water	Water

D 1.00 Phenonip

Phenoxyethanol, methyl parahydroxybenzoate, ethylparaben, butyl p-hydroxybenzoate, propyl p-hydroxybenzoate, p-Hydroxybenzoic acid isobutyl ester

A 3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol
A 3.50 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	1.50 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul A Plus
2.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	0.50 Cera Flava 3044 PH	Cera Flava
3.00 Lanette O	16/octadecanol	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
B 5.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	10.00 Miglyol 812	Glycerol three (caprylic/capric) ester
B 5.00 T-Lite SF-S		C 3.00 glycerol 87%	Glycerol
0.20 Edeta BD	The EDTA disodium	C 3.00 glycerol 87%	Glycerol
0.20 Edeta BD	The EDTA disodium	0.30 Keltrol T	Xanthan gum
1.00 Plantacare 2000	Decyl glucoside	0.30 Keltrol T	Xanthan gum
1.00 Plantacare 2000	Decyl glucoside	1% fusion rotein-KBD
57.30 demineralized water	Demineralized water	1% fusion rotein-KBD
57.30 demineralized water	Demineralized water	D 1.00 Vitamin E acetate	Tocopherol acetate
0.20 synthetic raceme bisabolol	Bisabolol	D 1.00 Vitamin E acetate	Tocopherol acetate

A 10.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate, lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 10.00 Uvinul A Plus B		10.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	10.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75		8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	2.00 Lanette O	16/octadecanol
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Lanette O	16/octadecanol
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 35.08 demineralized waters	Demineralized water
0.38 citric acid	Citric acid	C 35.08 demineralized waters	Demineralized water
0.38 citric acid	Citric acid	2.9 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	2.9 glycerol 87%	Glycerol
0.05 Edeta BD	The EDTA disodium	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	0.20 allantoin	Allantoin
0.30 Keltrol	Xanthan gum	0.1% fusion rotein-KBD
1.50 Veegum Ultra	Magnesiumaluminumsilicate	0.1% fusion rotein-KBD
1.50 Veegum Ultra	Magnesiumaluminumsilicate	D 0.50 Phenonip
1.00 Vitamin E acetate	Tocopherol acetate	D 0.50 Phenonip

A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate
A 7.50 Uvinul MC 80	Ethylhexyl methoxy cinnamate	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL 68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester

1.00 Fitoderm	Squalane
1.00 Fitoderm	Squalane	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	0.50 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.50 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	0.03 Sicomet Blue P 77007	C.I.77 007, ultramarine
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	0.03 Sicomet Blue P 77007	C.I.77 007, ultramarine
C 4.00 1,2-propylene glycol nursing thing	Propylene glycol	2.00 D-panthenol 50 P	Pantothenylol, propylene glycol
0.20 Keltrol	Xanthan gum	2.00 D-panthenol 50 P	Pantothenylol, propylene glycol
0.20 Keltrol	Xanthan gum	0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester
0.5% fusion rotein-KBD		0.50 Simulgel 600
0.5% fusion rotein-KBD		65.27 demineralized water	Demineralized water
An amount of antiseptic		65.27 demineralized water	Demineralized water
An amount of antiseptic		0.50 Vitamin E acetate	Tocopherol acetate

A 6.00 Gilugel SIL 5	Annular dimethyl polysiloxane (with) aluminium hydroxystearate/magnesium
A 6.00 Gilugel SIL 5		5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Mexoryl XL	The drometrizole trisiloxanes	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
2.00 Mexoryl XL	The drometrizole trisiloxanes	1.00 Uvinul T 150	The ethylhexyl triazinone
3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer	1.00 Uvinul T 150	The ethylhexyl triazinone
3.00 T-Lite SF-S		5.00 Finsolv TN	Benzoic acid C12-15 Arrcostab

4.00 Abil WE 09	Isostearic acid polyglycereol (4) ester, cetyl PEG/PPG-10/1 polydimethylsiloxane, lauric acid hexyl ester
4.00 Abil WE 09		2.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
3.00 isopropyl palmitate	Isopropyl palmitate	2.00 Cosmacol EMI	The two C12-13 Arrcostabs of malic acid
3.00 isopropyl palmitate	Isopropyl palmitate	5.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
0.50 Abil 350	Polydimethylsiloxane	5.00 Abil B 8839	Ring-type five polysiloxanes, ring-type six polysiloxanes
0.50 Abil 350	Polydimethylsiloxane	B 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	B 0.50 sodium chloride	Sodium chloride
0.20 Edeta BD	The EDTA disodium	1% fusion rotein-KBD
61.30 demineralized water	Demineralized water	1% fusion rotein-KBD
61.30 demineralized water	Demineralized water	C 1.00 Vitamin E acetate	Tocopherol acetate
0.50 Phenonip		C 1.00 Vitamin E acetate	Tocopherol acetate

A 1.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00 Abil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
10.00 Witconol APM	Myristyl polyoxypropylene (3) ether	2.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul T 150	The ethylhexyl triazinone
1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes	2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group silane	2.00 Uvinul A Plus
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group silane	C 5.00 1,2-propylene glycol	Propylene glycol

0.20 Keltrol	Xanthan gum
0.20 Keltrol	Xanthan gum	0.10 Edeta BD	The EDTA disodium
1% fusion rotein-KBD		0.10 Edeta BD	The EDTA disodium
1% fusion rotein-KBD		1.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester
59.40 demineralized water	Demineralized water	1.50 Simulgel 600
59.40 demineralized water	Demineralized water	An amount of aromatic oil of D
0.50 Glydant	Dimethyl dihydroxymethyl hydantoin	An amount of aromatic oil of D

A 7.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate, lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 7.00 Uvinul A Plus B		1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75		8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	2.00 Lanette O	16/octadecanol
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Lanette O	16/octadecanol
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 35.35 demineralized waters	Demineralized water
3.00 glycerol 87%	Glycerol	C 35.35 demineralized waters	Demineralized water
3.00 glycerol 87%	Glycerol	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.05 Edeta BD	The EDTA disodium

0.30 Keltrol	Xanthan gum
0.30 Keltrol	Xanthan gum	0.1% fusion rotein-KBD
1.50 Veegum Ultra	Magnesiumaluminumsilicate	0.1% fusion rotein-KBD
1.50 Veegum Ultra	Magnesiumaluminumsilicate	D 0.50 Phenonip
1.00 Vitamin E acetate	Tocopherol acetate	D 0.50 Phenonip

A 7.00 Uvinul A Plus B	Ethylhexyl methoxy cinnamate, lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 7.00 Uvinul A Plus B		1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Tinosorb S	The own oxy phenol anisyl of two-ethyl triazine
1.00 Uvinul T 150	The ethylhexyl triazinone	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75	The lauryl glucoside, dimerization hydroxy stearic acid polyglycereol (2) ester, glycerol	7.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Eumulgin VL 75		8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	8.00 Cetiol B	Dibutyl adipate
8.00 Finsolv TN	Benzoic acid C12-15 Arrcostab	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	12.00 Myritol 331	The glyceryl cocoate class
1.00 Lanette E	16/sodium stearyl sulfate	2.00 Lanette O	16/octadecanol
B 5.00 T-Lite SF	Titanium dioxide, hydrated alumina, polydimethylsiloxane/methyl polysilicone alkyl copolymer	2.00 Lanette O	16/octadecanol
B 5.00 T-Lite SF		C 30.45 demineralized waters	Demineralized water
3.00 glycerol 87%	Glycerol	C 30.45 demineralized waters	Demineralized water
3.00 glycerol 87%	Glycerol	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.05 Edeta BD	The EDTA disodium
0.20 allantoin	Allantoin	0.30 Keltrol	Xanthan gum
5% fusion rotein-KBD		0.30 Keltrol	Xanthan gum

1.50 Veegum Ultra	Magnesiumaluminumsilicate
1.50 Veegum Ultra	Magnesiumaluminumsilicate	D 0.50 Phenonip
1.00 Vitamin E acetate	Tocopherol acetate	D 0.50 Phenonip

0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	1.00 Dow Corning 345Fluid	Ring-type five polysiloxanes, ring-type six polysiloxanes
5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite	B 3.00 T-Lite SF-S	Titanium dioxide, hydrated SiO 2, hydrated alumina, polymethyl siloxane/polydimethylsiloxanecopolymer copolymer
C 5.00 1,2-propylene glycol	Propylene glycol	B 3.00 T-Lite SF-S
C 5.00 1,2-propylene glycol	Propylene glycol	1.00 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids
0.20 Keltrol	Xanthan gum	1.00 Mexoryl SX
0.20 Keltrol	Xanthan gum	0.10 Edeta BD	The EDTA disodium
0.2% fusion rotein-KBD		0.10 Edeta BD	The EDTA disodium
0.2% fusion rotein-KBD		1.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester
68.30 demineralized water	Demineralized water	1.50 Simulgel 600
68.30 demineralized water	Demineralized water	An amount of aromatic oil of D
0.50 Glydant	Dimethyl dihydroxymethyl hydantoin	An amount of aromatic oil of D

A 0.70 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether
A 0.70 Cremophor A 25	16/octadecyl polyoxyethylene (25) ether	1.70 Cremophor A 6	16/octadecyl polyoxyethylene (6) ether, octadecanol

2.00 Parsol 1789	PAROSOL 1789
2.00 Parsol 1789	PAROSOL 1789	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
4.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Abil B 8843	The PEG-14 polydimethylsiloxane
3.60 Lanette O	16/octadecanol	2.00 Abil B 8843	The PEG-14 polydimethylsiloxane
3.60 Lanette O	16/octadecanol	1.00 Uvinul T150	The ethylhexyl triazinone
2.00 Cetiol B	Dibutyl adipate	1.00 Uvinul T150	The ethylhexyl triazinone
2.00 Cetiol B	Dibutyl adipate	B 4.00 glycerol 87%	Glycerol
0.20 Edeta BD	The EDTA disodium	B 4.00 glycerol 87%	Glycerol
0.20 Edeta BD	The EDTA disodium	71.00 demineralized water	Pantothenylol
C 4.00 Luvigel EM	Glycerol three (caprylic/capric) ester, sodium acrylate copolymer	71.00 demineralized water	Pantothenylol
C 4.00 Luvigel EM		1% fusion rotein-KBD
D 1.00 Vitamin E acetate	Tocopherol acetate	1% fusion rotein-KBD
D 1.00 Vitamin E acetate	Tocopherol acetate	0.20 synthetic raceme bisabolol	Bisabolol
An amount of antiseptic		0.20 synthetic raceme bisabolol	Bisabolol

A 1.00 Abil Care 85	Two-the PEG/PPG-16/16PEG/PPG-16/16 polydimethylsiloxane, glycerol three (caprylic/capric) ester
A 1.00 Abil Care 85		3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	3.00 Cremophor CO 40	Polyoxyethylene (40) castor oil hydrogenated
0.30 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	2.00 Parsol 1789	PAROSOL 1789
2.00 Mexoryl XL	The drometrizole trisiloxanes	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	10.00 Witconol APM	Myristyl polyoxypropylene (3) ether
1.00 Uvinul T 150	The ethylhexyl triazinone	1.00 Dow Corning 345	Ring-type five polysiloxanes, ring-type six polysiloxanes

Fluid
Fluid		5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	5.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
B 3.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX	To inferior phenylenedimethylidyne two camphorsulfonic acids	C 5.00 1,2-propylene glycol	Propylene glycol
1.00 Mexoryl SX		0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	0.20 Keltrol	Xanthan gum
0.10 Edeta BD	The EDTA disodium	1.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester
0.5% fusion rotein-KBD		1.50 Simulgel 600
0.5% fusion rotein-KBD		68.00 demineralized water	Demineralized water
An amount of aromatic oil of D		68.00 demineralized water	Demineralized water
An amount of aromatic oil of D		0.50 Glydant	Dimethyl dihydroxymethyl hydantoin

A 2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 2.00 Uvinul A Plus		3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL68/50	Cetearyl glucoside, 16/octadecanol	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Fitoderm	Squalane	2.00 Dracorin 100SE
1.00 Fitoderm	Squalane	0.5 Cremophor WO7	Polyoxyethylene (7) castor oil hydrogenated
0.5 Cremophor PS20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	0.5 Cremophor WO7	Polyoxyethylene (7) castor oil hydrogenated
0.5 Cremophor PS20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Dry Flo Pure	The Dry Flo PC

The nursing of C 4.00 1,2-propylene glycol	Propylene glycol
The nursing of C 4.00 1,2-propylene glycol	Propylene glycol	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20) oleic acid ester	0.20 Keltrol	Xanthan gum
0.50 Simulgel 600		65.80 demineralized water	Demineralized water
D 0.50 Euxyl K 300		65.80 demineralized water	Demineralized water
D 0.50 Euxyl K 300		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		0.50 Vitamin E acetate	Tocopherol acetate
1% fusion rotein-KBD		1.00 RetiSTAR	Glycerol three (caprylic/capric) ester, sodium ascorbate, tocopherol, retinol

A 2.00 Uvinul A Plus	Lignocaine oxybenzene formoxyl hexyl benzene formic acid esters
A 2.00 Uvinul A Plus		3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL68/50	Cetearyl glucoside, 16/octadecanol	3.00 Uvinul N 539 T	2-cyano group-3,3-diphenylacrylate-2-Octyl Nitrite
3.00 Emulgade PL68/50	Cetearyl glucoside, 16/octadecanol	2.00 Dracorin 100SE	Glyceryl stearate, stearic acid Polyethylene Glycol (100) ester
1.00 Fitoderm	Squalane	2.00 Dracorin 100SE
1.00 Fitoderm	Squalane	0.5 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.5 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	0.5 Cremophor WO 7	Polyoxyethylene (7) castor oil hydrogenated
0.5 Cremophor PS 20	Anhydrous sorbitol polyoxyethylene (20) ether laurate	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	2.00 Dry Flo Pure	The Dry Flo PC
B 5.00 Z-COTE MAX	Zinc oxide (with) diphenyl octyl group polymethyl siloxane	The nursing of C 4.00 1,2-propylene glycol	Propylene glycol
0.20 Keltrol	Xanthan gum	The nursing of C 4.00 1,2-propylene glycol	Propylene glycol
0.20 Keltrol	Xanthan gum	0.50 Simulgel 600	Acrylamide/acryloyldimethyl taurine sodium copolymer, 2-Methylpentadecane, anhydrous sorbitol polyoxyethylene (20)

Claims

1. the effect protein of chimeric keratin-binding, it comprises

(a) polypeptide of at least a keratin-binding (i) and

(b) at least a further effect polypeptide (ii).

2. the effect protein of keratin-binding according to claim 1, wherein the polypeptide of keratin-binding (i) has the binding affinity to people's hair-keratin, first keratin or skin keratin.

3. the effect protein of keratin-binding according to claim 1 and 2, the polypeptide of use therein keratin-binding (i)

(a) comprise at least one according to SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215 sequence, or

(b) corresponding to at least one according to SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, same and the polypeptide that can keratin-binding of 213 or 215 sequence at least 40%.

4. according to the effect protein of each described keratin-binding in the claim 1 to 3, the polypeptide of use therein keratin-binding (i) is by such nucleic acid molecule encoding, and described nucleic acid molecules comprises and is selected from least one following nucleic acid molecules:

C) nucleic acid molecules, its coding comprise SEQ ID NO:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166, polypeptide of sequence shown in 213 or 215;

D) nucleic acid molecules, it comprises SEQ ID NO:1,3,5,7,9,11,13,15,17,19,21,23,25,27,29,31,33,35,37,39,41,43,45,47,49,51,53,55,57,59,61,63,65,67,69,71,73,75,77,79,81,83,85,87,89,91,93,95,97,99,101,103,105,107,109,111,113,115,117,119,121,123,125,127,129,131,133,135,137,139,145,149,152,159,161,163,165, at least one polynucleotide of sequence shown in 212 or 214;

E) nucleic acid molecules, it is encoded according to sequence SEQ ID No:2,4,6,8,10,12,14,16,18,20,22,24,26,28,30,32,34,36,38,40,42,44,46,48,50,52,54,56,58,60,62,64,66,68,70,72,74,76,78,80,82,84,86,88,90,92,94,96,98,100,102,104,106,108,110,112,114,116,118,120,122,124,126,128,130,132,134,136,138,140,146,150,153,156,157,158,160,162,164,166,213 or 215 polypeptide;

I) nucleic acid molecules that the proteinic nucleic acid molecules of coding keratin-binding, described nucleic acid molecules can be by using basis (c) to (e) or the part fragment that it comprises at least 15 nucleotide as probe under stringent hybridization condition, separate from dna library and

5. according to the effect protein of each described keratin-binding in the claim 1 to 4, wherein the effect polypeptide be selected from (ii) that enzyme, antibody, effector are conjugated protein, fluorescin, antimicrobial peptide and assembly protein automatically.

6. the effect protein of keratin-binding according to claim 5, wherein the effect polypeptide (ii) is to be selected from oxidase, peroxidase, protease, tryrosinase, lactoperoxidase, lysozyme, amyloglucosidase, glucoseoxidase, superoxide dismutase, photolyase and catalatic enzyme.

7. the effect protein of keratin-binding according to claim 6, wherein the effect polypeptide (ii) is a fibroin.

8. the effect protein of keratin-binding according to claim 7, wherein fibroin comprise at least one according to SEQ ID No:151,201,202,203,204,205,206,207,208,209 or 210 sequence or corresponding to at least one polypeptide same according to SEQ ID No:151,201,202,203,204,205,206,207,208,209 or 210 sequence at least 40%.

9. according to the effect protein of claim 7 or 8 described keratin-bindings, wherein fibroin is by such nucleic acid molecule encoding, and described nucleic acid molecules comprises and is selected from least one following nucleic acid molecules:

K) nucleic acid molecules, its coding comprise polypeptide of sequence shown in the SEQ ID NO:151,201,202,203,204,205,206,207,208,209 or 210;

L) nucleic acid molecules, it comprises the polynucleotide of sequence shown at least one SEQ ID NO:150;

M) nucleic acid molecules, its coding is according to sequence SEQ ID No:151,201,202,203,204,205,206,207,208,209 or 210 polypeptide;

N) have nucleic acid molecules according to the nucleotide sequence of SEQ ID No:150, or because of replace, disappearance or insert from its deutero-nucleic acid encoding molecule, wherein said polypeptide is with same according to the sequence at least 40% of SEQ IDNo:151;

10. according to the effect protein of each described keratin-binding in the claim 1 to 9, wherein polypeptide (i) and (ii) merging by translation couples together.

11. according to the effect protein of each described keratin-binding in the claim 1 to 9, polypeptide (i) and (ii) coupling together wherein by chemical coupling reaction.

12. the effect protein of keratin-binding according to claim 11, wherein the effect polypeptide (ii) covalently is bonded to side chain, c-terminus or the aminoterminal of internal amino acid of the polypeptide (i) of keratin-binding.

13. according to the effect protein of each described keratin-binding in the claim 1 to 9, wherein the effect polypeptide (ii) couples together by spacer element with the polypeptide (i) of keratin-binding.

14. the effect protein of keratin-binding according to claim 13, wherein spacer element is a cross-linking agent.

15. the effect protein of keratin-binding according to claim 13, wherein spacer element is dual functional at least joint, described joint by being bonded to keratin-binding polypeptide (i) and side chain, c-terminus or the aminoterminal of the internal amino acid of effect polypeptide and with described polypeptid covalence couple together.

16. the effect protein of keratin-binding according to claim 13, wherein spacer element is a polypeptide.

17. the purposes of the effect protein of the keratin-binding described in the claim 1-16 in cosmetics for skin.

18. purposes according to claim 17, wherein cosmetics for skin is skin protection composition, skin care compositions and methods, skin cleansing compositions, hair protection compositions, hair care composition, hair Cleasing compositions, hair dye or decorative cosmetic product having.

19. cosmetics for skin, it comprises the effector molecule according to the described keratin-binding of claim 1 to 16.

20. protein according to one of aminoacid sequence shown in the SEQ ID No:168,176,182,188,194 and 200.

21. nucleic acid molecules according to sequence shown in the SEQ ID No:167,175,181,187,193 or 199.

22.DNA expression cassette, it comprises the nucleic acid molecules that has according to the described nucleotide sequence of claim 21.

23. carrier, it comprises according to claim 21 or 22 described expression cassettes.

24. transgenic cell, it comprises nucleic acid molecules according to claim 21, according to the expression cassette of claim 22 or according to the carrier of claim 23.