CA3184819A1 - Polyfunctional orthogonal protein chimeras - Google Patents
Polyfunctional orthogonal protein chimerasInfo
- Publication number
- CA3184819A1 CA3184819A1 CA3184819A CA3184819A CA3184819A1 CA 3184819 A1 CA3184819 A1 CA 3184819A1 CA 3184819 A CA3184819 A CA 3184819A CA 3184819 A CA3184819 A CA 3184819A CA 3184819 A1 CA3184819 A1 CA 3184819A1
- Authority
- CA
- Canada
- Prior art keywords
- cells
- polypeptide
- domain
- protein
- engineered
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
- 108090000623 proteins and genes Proteins 0.000 title claims abstract description 385
- 102000004169 proteins and genes Human genes 0.000 title claims abstract description 358
- 108090000765 processed proteins & peptides Proteins 0.000 claims abstract description 346
- 102000004196 processed proteins & peptides Human genes 0.000 claims abstract description 317
- 229920001184 polypeptide Polymers 0.000 claims abstract description 308
- 239000000427 antigen Substances 0.000 claims abstract description 191
- 108091007433 antigens Proteins 0.000 claims abstract description 191
- 102000036639 antigens Human genes 0.000 claims abstract description 191
- 239000000833 heterodimer Substances 0.000 claims abstract description 165
- 239000012634 fragment Substances 0.000 claims abstract description 147
- 230000027455 binding Effects 0.000 claims abstract description 146
- 210000001744 T-lymphocyte Anatomy 0.000 claims abstract description 103
- 239000013598 vector Substances 0.000 claims abstract description 83
- 238000000034 method Methods 0.000 claims abstract description 80
- 239000000203 mixture Substances 0.000 claims abstract description 75
- 101710160107 Outer membrane protein A Proteins 0.000 claims abstract description 63
- 210000000822 natural killer cell Anatomy 0.000 claims abstract description 63
- 210000004027 cell Anatomy 0.000 claims description 259
- 238000006471 dimerization reaction Methods 0.000 claims description 93
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 claims description 59
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 claims description 59
- 101000607306 Homo sapiens UL16-binding protein 1 Proteins 0.000 claims description 45
- 102100040012 UL16-binding protein 1 Human genes 0.000 claims description 38
- 101000607320 Homo sapiens UL16-binding protein 2 Proteins 0.000 claims description 36
- 101000607318 Homo sapiens UL16-binding protein 3 Proteins 0.000 claims description 35
- 101000991061 Homo sapiens MHC class I polypeptide-related sequence B Proteins 0.000 claims description 34
- 102100030301 MHC class I polypeptide-related sequence A Human genes 0.000 claims description 34
- 102100030300 MHC class I polypeptide-related sequence B Human genes 0.000 claims description 34
- 108020003285 Isocitrate lyase Proteins 0.000 claims description 32
- 102100039989 UL16-binding protein 2 Human genes 0.000 claims description 32
- 102100040011 UL16-binding protein 3 Human genes 0.000 claims description 32
- 101001132524 Homo sapiens Retinoic acid early transcript 1E Proteins 0.000 claims description 30
- 102100040013 UL16-binding protein 6 Human genes 0.000 claims description 30
- 101100101727 Homo sapiens RAET1L gene Proteins 0.000 claims description 27
- 101000607316 Homo sapiens UL-16 binding protein 5 Proteins 0.000 claims description 27
- 102100033964 Retinoic acid early transcript 1E Human genes 0.000 claims description 27
- 239000010445 mica Substances 0.000 claims description 27
- 229910052618 mica group Inorganic materials 0.000 claims description 27
- 102100040010 UL-16 binding protein 5 Human genes 0.000 claims description 26
- 208000002250 Hematologic Neoplasms Diseases 0.000 claims description 23
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 claims description 19
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 claims description 19
- 230000009033 hematopoietic malignancy Effects 0.000 claims description 19
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 claims description 18
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 claims description 6
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 claims description 4
- 150000007523 nucleic acids Chemical class 0.000 abstract description 77
- 102000039446 nucleic acids Human genes 0.000 abstract description 63
- 108020004707 nucleic acids Proteins 0.000 abstract description 63
- 238000011282 treatment Methods 0.000 abstract description 26
- 210000002865 immune cell Anatomy 0.000 abstract description 14
- 235000018102 proteins Nutrition 0.000 description 333
- 125000003275 alpha amino acid group Chemical group 0.000 description 82
- 235000001014 amino acid Nutrition 0.000 description 61
- 230000014509 gene expression Effects 0.000 description 60
- 201000009030 Carcinoma Diseases 0.000 description 59
- 108020004414 DNA Proteins 0.000 description 58
- 102000053602 DNA Human genes 0.000 description 58
- 239000003795 chemical substances by application Substances 0.000 description 55
- 208000031261 Acute myeloid leukaemia Diseases 0.000 description 46
- 206010028980 Neoplasm Diseases 0.000 description 45
- 208000033776 Myeloid Acute Leukemia Diseases 0.000 description 40
- -1 cells Substances 0.000 description 33
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 32
- 239000003446 ligand Substances 0.000 description 31
- 102000040430 polynucleotide Human genes 0.000 description 31
- 108091033319 polynucleotide Proteins 0.000 description 31
- 239000002157 polynucleotide Substances 0.000 description 31
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 28
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 28
- 201000011510 cancer Diseases 0.000 description 26
- 230000004927 fusion Effects 0.000 description 26
- 108010076504 Protein Sorting Signals Proteins 0.000 description 25
- 102000037865 fusion proteins Human genes 0.000 description 25
- 108020001507 fusion proteins Proteins 0.000 description 25
- 239000013612 plasmid Substances 0.000 description 23
- 125000000539 amino acid group Chemical group 0.000 description 22
- 108091028043 Nucleic acid sequence Proteins 0.000 description 20
- 239000008194 pharmaceutical composition Substances 0.000 description 20
- 102000005962 receptors Human genes 0.000 description 20
- 108020003175 receptors Proteins 0.000 description 20
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 19
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 19
- 201000010099 disease Diseases 0.000 description 19
- 239000013604 expression vector Substances 0.000 description 19
- 230000004083 survival effect Effects 0.000 description 19
- 150000001413 amino acids Chemical class 0.000 description 18
- 125000003729 nucleotide group Chemical group 0.000 description 18
- 210000001519 tissue Anatomy 0.000 description 18
- 241001465754 Metazoa Species 0.000 description 17
- 230000000694 effects Effects 0.000 description 17
- 239000002773 nucleotide Substances 0.000 description 17
- 238000002560 therapeutic procedure Methods 0.000 description 17
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 16
- 102000004190 Enzymes Human genes 0.000 description 15
- 108090000790 Enzymes Proteins 0.000 description 15
- 229940088598 enzyme Drugs 0.000 description 15
- 201000000050 myeloid neoplasm Diseases 0.000 description 15
- 229920002477 rna polymer Polymers 0.000 description 15
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 14
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 14
- 210000004881 tumor cell Anatomy 0.000 description 14
- 208000035475 disorder Diseases 0.000 description 13
- 238000005516 engineering process Methods 0.000 description 13
- 238000000746 purification Methods 0.000 description 13
- 239000006228 supernatant Substances 0.000 description 13
- 229940127089 cytotoxic agent Drugs 0.000 description 12
- 239000000539 dimer Substances 0.000 description 12
- 239000012636 effector Substances 0.000 description 12
- 230000006870 function Effects 0.000 description 12
- 239000000546 pharmaceutical excipient Substances 0.000 description 12
- 108010029485 Protein Isoforms Proteins 0.000 description 11
- 102000001708 Protein Isoforms Human genes 0.000 description 11
- 230000001472 cytotoxic effect Effects 0.000 description 11
- 238000004519 manufacturing process Methods 0.000 description 11
- 102000043129 MHC class I family Human genes 0.000 description 10
- 108091054437 MHC class I family Proteins 0.000 description 10
- 230000003213 activating effect Effects 0.000 description 10
- 210000004369 blood Anatomy 0.000 description 10
- 239000008280 blood Substances 0.000 description 10
- 230000003013 cytotoxicity Effects 0.000 description 10
- 231100000135 cytotoxicity Toxicity 0.000 description 10
- 230000034994 death Effects 0.000 description 10
- 210000004408 hybridoma Anatomy 0.000 description 10
- 239000012528 membrane Substances 0.000 description 10
- 230000003612 virological effect Effects 0.000 description 10
- 102000014914 Carrier Proteins Human genes 0.000 description 9
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 9
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 9
- 241000124008 Mammalia Species 0.000 description 9
- 241000699670 Mus sp. Species 0.000 description 9
- 238000002784 cytotoxicity assay Methods 0.000 description 9
- 230000002068 genetic effect Effects 0.000 description 9
- 239000005090 green fluorescent protein Substances 0.000 description 9
- 230000002163 immunogen Effects 0.000 description 9
- 230000002401 inhibitory effect Effects 0.000 description 9
- 230000005764 inhibitory process Effects 0.000 description 9
- 230000003993 interaction Effects 0.000 description 9
- 239000000178 monomer Substances 0.000 description 9
- 241000894007 species Species 0.000 description 9
- 208000024891 symptom Diseases 0.000 description 9
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 8
- 108060003951 Immunoglobulin Proteins 0.000 description 8
- 108010002350 Interleukin-2 Proteins 0.000 description 8
- 101100506192 Mus musculus H60b gene Proteins 0.000 description 8
- 101100506193 Mus musculus H60c gene Proteins 0.000 description 8
- 108010090804 Streptavidin Proteins 0.000 description 8
- 210000003719 b-lymphocyte Anatomy 0.000 description 8
- 108091008324 binding proteins Proteins 0.000 description 8
- 229960002685 biotin Drugs 0.000 description 8
- 235000020958 biotin Nutrition 0.000 description 8
- 239000011616 biotin Substances 0.000 description 8
- 210000004899 c-terminal region Anatomy 0.000 description 8
- 239000002254 cytotoxic agent Substances 0.000 description 8
- 231100000599 cytotoxic agent Toxicity 0.000 description 8
- 239000003937 drug carrier Substances 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 230000028993 immune response Effects 0.000 description 8
- 102000018358 immunoglobulin Human genes 0.000 description 8
- 239000000463 material Substances 0.000 description 8
- 210000000066 myeloid cell Anatomy 0.000 description 8
- 230000001105 regulatory effect Effects 0.000 description 8
- 239000003053 toxin Substances 0.000 description 8
- 231100000765 toxin Toxicity 0.000 description 8
- 108700012359 toxins Proteins 0.000 description 8
- 102000002260 Alkaline Phosphatase Human genes 0.000 description 7
- 108020004774 Alkaline Phosphatase Proteins 0.000 description 7
- 108010012236 Chemokines Proteins 0.000 description 7
- 102000019034 Chemokines Human genes 0.000 description 7
- 101100048372 Human cytomegalovirus (strain AD169) H301 gene Proteins 0.000 description 7
- 101100048373 Human cytomegalovirus (strain Merlin) UL18 gene Proteins 0.000 description 7
- 108010001657 NK Cell Lectin-Like Receptor Subfamily K Proteins 0.000 description 7
- 102000000812 NK Cell Lectin-Like Receptor Subfamily K Human genes 0.000 description 7
- 206010035226 Plasma cell myeloma Diseases 0.000 description 7
- 101150037769 TRX2 gene Proteins 0.000 description 7
- 238000013459 approach Methods 0.000 description 7
- 230000001580 bacterial effect Effects 0.000 description 7
- 239000000872 buffer Substances 0.000 description 7
- 238000009396 hybridization Methods 0.000 description 7
- 238000000338 in vitro Methods 0.000 description 7
- 230000036210 malignancy Effects 0.000 description 7
- 210000004962 mammalian cell Anatomy 0.000 description 7
- FWBHETKCLVMNFS-UHFFFAOYSA-N 4',6-Diamino-2-phenylindol Chemical compound C1=CC(C(=N)N)=CC=C1C1=CC2=CC=C(C(N)=N)C=C2N1 FWBHETKCLVMNFS-UHFFFAOYSA-N 0.000 description 6
- 108091026890 Coding region Proteins 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 6
- 108090000695 Cytokines Proteins 0.000 description 6
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 6
- 241001529936 Murinae Species 0.000 description 6
- 201000003793 Myelodysplastic syndrome Diseases 0.000 description 6
- 208000014767 Myeloproliferative disease Diseases 0.000 description 6
- 206010039491 Sarcoma Diseases 0.000 description 6
- 101150042088 UL16 gene Proteins 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 231100000433 cytotoxic Toxicity 0.000 description 6
- 238000000684 flow cytometry Methods 0.000 description 6
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 6
- 229930004094 glycosylphosphatidylinositol Natural products 0.000 description 6
- 125000005842 heteroatom Chemical group 0.000 description 6
- 102000048777 human ULBP1 Human genes 0.000 description 6
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 6
- 230000001965 increasing effect Effects 0.000 description 6
- 208000032839 leukemia Diseases 0.000 description 6
- 108020004999 messenger RNA Proteins 0.000 description 6
- 239000011347 resin Substances 0.000 description 6
- 229920005989 resin Polymers 0.000 description 6
- 230000001225 therapeutic effect Effects 0.000 description 6
- 238000013518 transcription Methods 0.000 description 6
- 230000035897 transcription Effects 0.000 description 6
- 239000013603 viral vector Substances 0.000 description 6
- 206010006187 Breast cancer Diseases 0.000 description 5
- 208000026310 Breast neoplasm Diseases 0.000 description 5
- 208000003170 Bronchiolo-Alveolar Adenocarcinoma Diseases 0.000 description 5
- 241000282412 Homo Species 0.000 description 5
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 5
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 5
- 241000700605 Viruses Species 0.000 description 5
- 208000009956 adenocarcinoma Diseases 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 238000004113 cell culture Methods 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 150000001875 compounds Chemical class 0.000 description 5
- 238000007796 conventional method Methods 0.000 description 5
- 231100000263 cytotoxicity test Toxicity 0.000 description 5
- 239000003085 diluting agent Substances 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 230000002538 fungal effect Effects 0.000 description 5
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 5
- 230000036039 immunity Effects 0.000 description 5
- 230000003053 immunization Effects 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 238000003259 recombinant expression Methods 0.000 description 5
- 230000003248 secreting effect Effects 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 230000003827 upregulation Effects 0.000 description 5
- LLXVXPPXELIDGQ-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(2,5-dioxopyrrol-1-yl)benzoate Chemical compound C=1C=CC(N2C(C=CC2=O)=O)=CC=1C(=O)ON1C(=O)CCC1=O LLXVXPPXELIDGQ-UHFFFAOYSA-N 0.000 description 4
- 102100033639 Acetylcholinesterase Human genes 0.000 description 4
- 108010022752 Acetylcholinesterase Proteins 0.000 description 4
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 4
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 4
- 108090001008 Avidin Proteins 0.000 description 4
- 102100026189 Beta-galactosidase Human genes 0.000 description 4
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 4
- 208000009458 Carcinoma in Situ Diseases 0.000 description 4
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 4
- 239000004971 Cross linker Substances 0.000 description 4
- 241000701022 Cytomegalovirus Species 0.000 description 4
- 241000196324 Embryophyta Species 0.000 description 4
- XZWYTXMRWQJBGX-VXBMVYAYSA-N FLAG peptide Chemical compound NCCCC[C@@H](C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@@H](NC(=O)[C@@H](N)CC(O)=O)CC1=CC=C(O)C=C1 XZWYTXMRWQJBGX-VXBMVYAYSA-N 0.000 description 4
- 108010015776 Glucose oxidase Proteins 0.000 description 4
- 239000004366 Glucose oxidase Substances 0.000 description 4
- 108010070675 Glutathione transferase Proteins 0.000 description 4
- 101710154606 Hemagglutinin Proteins 0.000 description 4
- 102100029100 Hematopoietic prostaglandin D synthase Human genes 0.000 description 4
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 4
- 101000617823 Homo sapiens Solute carrier organic anion transporter family member 6A1 Proteins 0.000 description 4
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 4
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 4
- 102100021462 Natural killer cells antigen CD94 Human genes 0.000 description 4
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 description 4
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 4
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 4
- 206010033128 Ovarian cancer Diseases 0.000 description 4
- 108010004729 Phycoerythrin Proteins 0.000 description 4
- 239000004698 Polyethylene Substances 0.000 description 4
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 4
- 101710176177 Protein A56 Proteins 0.000 description 4
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 4
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 4
- 206010070308 Refractory cancer Diseases 0.000 description 4
- 208000006265 Renal cell carcinoma Diseases 0.000 description 4
- 102100021991 Solute carrier organic anion transporter family member 6A1 Human genes 0.000 description 4
- 108010088160 Staphylococcal Protein A Proteins 0.000 description 4
- 229940022698 acetylcholinesterase Drugs 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 239000002246 antineoplastic agent Substances 0.000 description 4
- 108010005774 beta-Galactosidase Proteins 0.000 description 4
- 239000002458 cell surface marker Substances 0.000 description 4
- 238000012412 chemical coupling Methods 0.000 description 4
- 238000010367 cloning Methods 0.000 description 4
- 238000004132 cross linking Methods 0.000 description 4
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- ZWIBGKZDAWNIFC-UHFFFAOYSA-N disuccinimidyl suberate Chemical compound O=C1CCC(=O)N1OC(=O)CCCCCCC(=O)ON1C(=O)CCC1=O ZWIBGKZDAWNIFC-UHFFFAOYSA-N 0.000 description 4
- 231100000276 dose-dependent cytotoxicity Toxicity 0.000 description 4
- 231100000673 dose–response relationship Toxicity 0.000 description 4
- 239000003814 drug Substances 0.000 description 4
- 210000003527 eukaryotic cell Anatomy 0.000 description 4
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 4
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 4
- 239000007850 fluorescent dye Substances 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 229940116332 glucose oxidase Drugs 0.000 description 4
- 235000019420 glucose oxidase Nutrition 0.000 description 4
- 239000000185 hemagglutinin Substances 0.000 description 4
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 4
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 4
- 230000001976 improved effect Effects 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 230000006698 induction Effects 0.000 description 4
- 230000003211 malignant effect Effects 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 201000010879 mucinous adenocarcinoma Diseases 0.000 description 4
- 239000008177 pharmaceutical agent Substances 0.000 description 4
- 229920002704 polyhistidine Polymers 0.000 description 4
- 239000000047 product Substances 0.000 description 4
- 230000004853 protein function Effects 0.000 description 4
- 238000001742 protein purification Methods 0.000 description 4
- 230000002285 radioactive effect Effects 0.000 description 4
- 239000012857 radioactive material Substances 0.000 description 4
- 208000016691 refractory malignant neoplasm Diseases 0.000 description 4
- 230000010076 replication Effects 0.000 description 4
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 4
- 230000028327 secretion Effects 0.000 description 4
- 239000004055 small Interfering RNA Substances 0.000 description 4
- 239000000243 solution Substances 0.000 description 4
- 210000001082 somatic cell Anatomy 0.000 description 4
- 125000006850 spacer group Chemical group 0.000 description 4
- 230000008685 targeting Effects 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 238000013519 translation Methods 0.000 description 4
- 229960005486 vaccine Drugs 0.000 description 4
- 230000035899 viability Effects 0.000 description 4
- 102000007469 Actins Human genes 0.000 description 3
- 108010085238 Actins Proteins 0.000 description 3
- 108091008875 B cell receptors Proteins 0.000 description 3
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 3
- 206010058354 Bronchioloalveolar carcinoma Diseases 0.000 description 3
- 102100025250 C-X-C motif chemokine 14 Human genes 0.000 description 3
- 102100024217 CAMPATH-1 antigen Human genes 0.000 description 3
- 108010065524 CD52 Antigen Proteins 0.000 description 3
- 108020004705 Codon Proteins 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 241000699802 Cricetulus griseus Species 0.000 description 3
- 241000702421 Dependoparvovirus Species 0.000 description 3
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 3
- 102100025137 Early activation antigen CD69 Human genes 0.000 description 3
- 208000006168 Ewing Sarcoma Diseases 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102100039619 Granulocyte colony-stimulating factor Human genes 0.000 description 3
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 description 3
- 208000017604 Hodgkin disease Diseases 0.000 description 3
- 208000010747 Hodgkins lymphoma Diseases 0.000 description 3
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 3
- 101000858068 Homo sapiens C-X-C motif chemokine 14 Proteins 0.000 description 3
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 description 3
- 101000934374 Homo sapiens Early activation antigen CD69 Proteins 0.000 description 3
- 101000746367 Homo sapiens Granulocyte colony-stimulating factor Proteins 0.000 description 3
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 description 3
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 3
- 101000607314 Homo sapiens UL16-binding protein 6 Proteins 0.000 description 3
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 3
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 3
- 108010063738 Interleukins Proteins 0.000 description 3
- 102000015696 Interleukins Human genes 0.000 description 3
- 241000713666 Lentivirus Species 0.000 description 3
- 108090000028 Neprilysin Proteins 0.000 description 3
- 102000003729 Neprilysin Human genes 0.000 description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 description 3
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 3
- 102000010292 Peptide Elongation Factor 1 Human genes 0.000 description 3
- 108010077524 Peptide Elongation Factor 1 Proteins 0.000 description 3
- 241000276498 Pollachius virens Species 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 108091008874 T cell receptors Proteins 0.000 description 3
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 230000001154 acute effect Effects 0.000 description 3
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 3
- 238000004873 anchoring Methods 0.000 description 3
- 230000001588 bifunctional effect Effects 0.000 description 3
- 210000000988 bone and bone Anatomy 0.000 description 3
- 230000030833 cell death Effects 0.000 description 3
- 230000003915 cell function Effects 0.000 description 3
- 238000007385 chemical modification Methods 0.000 description 3
- 208000029742 colonic neoplasm Diseases 0.000 description 3
- 230000000295 complement effect Effects 0.000 description 3
- 230000021615 conjugation Effects 0.000 description 3
- 239000012228 culture supernatant Substances 0.000 description 3
- 230000009089 cytolysis Effects 0.000 description 3
- 230000001086 cytosolic effect Effects 0.000 description 3
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 3
- 238000013461 design Methods 0.000 description 3
- 239000012149 elution buffer Substances 0.000 description 3
- 238000005755 formation reaction Methods 0.000 description 3
- 230000012010 growth Effects 0.000 description 3
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 3
- 102000048775 human ULBP2 Human genes 0.000 description 3
- 239000001257 hydrogen Substances 0.000 description 3
- 229910052739 hydrogen Inorganic materials 0.000 description 3
- 238000003018 immunoassay Methods 0.000 description 3
- 229960003444 immunosuppressant agent Drugs 0.000 description 3
- 230000001861 immunosuppressant effect Effects 0.000 description 3
- 239000003018 immunosuppressive agent Substances 0.000 description 3
- 238000009169 immunotherapy Methods 0.000 description 3
- 229940047122 interleukins Drugs 0.000 description 3
- 238000005304 joining Methods 0.000 description 3
- 230000002147 killing effect Effects 0.000 description 3
- 210000000265 leukocyte Anatomy 0.000 description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 3
- 230000001404 mediated effect Effects 0.000 description 3
- 201000001441 melanoma Diseases 0.000 description 3
- 230000035772 mutation Effects 0.000 description 3
- 208000029974 neurofibrosarcoma Diseases 0.000 description 3
- 201000002528 pancreatic cancer Diseases 0.000 description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 description 3
- 239000002245 particle Substances 0.000 description 3
- 230000008569 process Effects 0.000 description 3
- 238000000734 protein sequencing Methods 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 206010041823 squamous cell carcinoma Diseases 0.000 description 3
- 238000010186 staining Methods 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 230000000638 stimulation Effects 0.000 description 3
- 238000010361 transduction Methods 0.000 description 3
- 230000026683 transduction Effects 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 241001430294 unidentified retrovirus Species 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 2
- 102100025218 B-cell differentiation antigen CD72 Human genes 0.000 description 2
- 208000003950 B-cell lymphoma Diseases 0.000 description 2
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 2
- 208000032791 BCR-ABL1 positive chronic myelogenous leukemia Diseases 0.000 description 2
- 206010004146 Basal cell carcinoma Diseases 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 102000002086 C-type lectin-like Human genes 0.000 description 2
- 108050009406 C-type lectin-like Proteins 0.000 description 2
- 102100027207 CD27 antigen Human genes 0.000 description 2
- 102100036008 CD48 antigen Human genes 0.000 description 2
- 241000282465 Canis Species 0.000 description 2
- 102100025470 Carcinoembryonic antigen-related cell adhesion molecule 8 Human genes 0.000 description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 description 2
- 206010057248 Cell death Diseases 0.000 description 2
- 102100023126 Cell surface glycoprotein MUC18 Human genes 0.000 description 2
- 208000006332 Choriocarcinoma Diseases 0.000 description 2
- 208000010833 Chronic myeloid leukaemia Diseases 0.000 description 2
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 2
- 208000008334 Dermatofibrosarcoma Diseases 0.000 description 2
- 206010057070 Dermatofibrosarcoma protuberans Diseases 0.000 description 2
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 2
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- 208000032027 Essential Thrombocythemia Diseases 0.000 description 2
- 102100031507 Fc receptor-like protein 5 Human genes 0.000 description 2
- 241000282324 Felis Species 0.000 description 2
- 102100035716 Glycophorin-A Human genes 0.000 description 2
- 102100023849 Glycophorin-C Human genes 0.000 description 2
- 208000001258 Hemangiosarcoma Diseases 0.000 description 2
- 208000021519 Hodgkin lymphoma Diseases 0.000 description 2
- 101000934359 Homo sapiens B-cell differentiation antigen CD72 Proteins 0.000 description 2
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 2
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 description 2
- 101000716130 Homo sapiens CD48 antigen Proteins 0.000 description 2
- 101000914320 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 8 Proteins 0.000 description 2
- 101000623903 Homo sapiens Cell surface glycoprotein MUC18 Proteins 0.000 description 2
- 101000846908 Homo sapiens Fc receptor-like protein 5 Proteins 0.000 description 2
- 101001074244 Homo sapiens Glycophorin-A Proteins 0.000 description 2
- 101000905336 Homo sapiens Glycophorin-C Proteins 0.000 description 2
- 101001078143 Homo sapiens Integrin alpha-IIb Proteins 0.000 description 2
- 101001046686 Homo sapiens Integrin alpha-M Proteins 0.000 description 2
- 101001015004 Homo sapiens Integrin beta-3 Proteins 0.000 description 2
- 101001076422 Homo sapiens Interleukin-1 receptor type 2 Proteins 0.000 description 2
- 101000998120 Homo sapiens Interleukin-3 receptor subunit alpha Proteins 0.000 description 2
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 2
- 101000971513 Homo sapiens Natural killer cells antigen CD94 Proteins 0.000 description 2
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 2
- 101000622137 Homo sapiens P-selectin Proteins 0.000 description 2
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 description 2
- 102100025306 Integrin alpha-IIb Human genes 0.000 description 2
- 102100022338 Integrin alpha-M Human genes 0.000 description 2
- 102100032999 Integrin beta-3 Human genes 0.000 description 2
- 102100026017 Interleukin-1 receptor type 2 Human genes 0.000 description 2
- 101800003050 Interleukin-16 Proteins 0.000 description 2
- 102000049772 Interleukin-16 Human genes 0.000 description 2
- 102100033493 Interleukin-3 receptor subunit alpha Human genes 0.000 description 2
- 208000008839 Kidney Neoplasms Diseases 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 2
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 2
- 208000034578 Multiple myelomas Diseases 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 101710150912 Myc protein Proteins 0.000 description 2
- 208000033761 Myelogenous Chronic BCR-ABL Positive Leukemia Diseases 0.000 description 2
- 201000007224 Myeloproliferative neoplasm Diseases 0.000 description 2
- 108091008877 NK cell receptors Proteins 0.000 description 2
- 102100022682 NKG2-A/NKG2-B type II integral membrane protein Human genes 0.000 description 2
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 2
- 208000002454 Nasopharyngeal Carcinoma Diseases 0.000 description 2
- 206010061306 Nasopharyngeal cancer Diseases 0.000 description 2
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 2
- 239000004677 Nylon Substances 0.000 description 2
- 108091034117 Oligonucleotide Proteins 0.000 description 2
- 102100023472 P-selectin Human genes 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- 206010057846 Primitive neuroectodermal tumour Diseases 0.000 description 2
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 2
- 102100040678 Programmed cell death protein 1 Human genes 0.000 description 2
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 2
- 208000015634 Rectal Neoplasms Diseases 0.000 description 2
- 206010038389 Renal cancer Diseases 0.000 description 2
- 108091027967 Small hairpin RNA Proteins 0.000 description 2
- 108020004459 Small interfering RNA Proteins 0.000 description 2
- 241000713880 Spleen focus-forming virus Species 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 230000024932 T cell mediated immunity Effects 0.000 description 2
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 241000251539 Vertebrata <Metazoa> Species 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 239000000556 agonist Substances 0.000 description 2
- 210000004102 animal cell Anatomy 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 230000006023 anti-tumor response Effects 0.000 description 2
- 230000006907 apoptotic process Effects 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 230000029918 bioluminescence Effects 0.000 description 2
- 238000005415 bioluminescence Methods 0.000 description 2
- 239000003153 chemical reaction reagent Substances 0.000 description 2
- 238000002512 chemotherapy Methods 0.000 description 2
- 208000006990 cholangiocarcinoma Diseases 0.000 description 2
- 230000002596 correlated effect Effects 0.000 description 2
- 201000011063 cribriform carcinoma Diseases 0.000 description 2
- 230000007402 cytotoxic response Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 201000006827 desmoid tumor Diseases 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- 210000003162 effector t lymphocyte Anatomy 0.000 description 2
- 238000010828 elution Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 210000004475 gamma-delta t lymphocyte Anatomy 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 230000002496 gastric effect Effects 0.000 description 2
- 238000012239 gene modification Methods 0.000 description 2
- 238000010362 genome editing Methods 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 208000019691 hematopoietic and lymphoid cell neoplasm Diseases 0.000 description 2
- 230000002440 hepatic effect Effects 0.000 description 2
- 238000005734 heterodimerization reaction Methods 0.000 description 2
- 102000044042 human KLRK1 Human genes 0.000 description 2
- 102000053324 human RAET1E Human genes 0.000 description 2
- 102000052075 human ULBP3 Human genes 0.000 description 2
- 210000005260 human cell Anatomy 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 239000012642 immune effector Substances 0.000 description 2
- 238000003119 immunoblot Methods 0.000 description 2
- 229940121354 immunomodulator Drugs 0.000 description 2
- 201000004933 in situ carcinoma Diseases 0.000 description 2
- 230000005917 in vivo anti-tumor Effects 0.000 description 2
- 108020004201 indoleamine 2,3-dioxygenase Proteins 0.000 description 2
- 102000006639 indoleamine 2,3-dioxygenase Human genes 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 201000010982 kidney cancer Diseases 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 206010024627 liposarcoma Diseases 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 239000012160 loading buffer Substances 0.000 description 2
- 201000005202 lung cancer Diseases 0.000 description 2
- 208000020816 lung neoplasm Diseases 0.000 description 2
- 230000001926 lymphatic effect Effects 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 230000035800 maturation Effects 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 239000002184 metal Chemical class 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 230000009401 metastasis Effects 0.000 description 2
- 108091070501 miRNA Proteins 0.000 description 2
- 239000002679 microRNA Substances 0.000 description 2
- 238000000302 molecular modelling Methods 0.000 description 2
- 206010028537 myelofibrosis Diseases 0.000 description 2
- 201000011216 nasopharynx carcinoma Diseases 0.000 description 2
- 230000031942 natural killer cell mediated cytotoxicity Effects 0.000 description 2
- 229920001778 nylon Polymers 0.000 description 2
- 201000008968 osteosarcoma Diseases 0.000 description 2
- 210000001672 ovary Anatomy 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 210000000496 pancreas Anatomy 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 description 2
- 239000008024 pharmaceutical diluent Substances 0.000 description 2
- 229940124531 pharmaceutical excipient Drugs 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 208000003476 primary myelofibrosis Diseases 0.000 description 2
- 208000029340 primitive neuroectodermal tumor Diseases 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- 230000000069 prophylactic effect Effects 0.000 description 2
- 238000010188 recombinant method Methods 0.000 description 2
- 206010038038 rectal cancer Diseases 0.000 description 2
- 201000001275 rectum cancer Diseases 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 210000003289 regulatory T cell Anatomy 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 229930002330 retinoic acid Natural products 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 201000009410 rhabdomyosarcoma Diseases 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 208000000649 small cell carcinoma Diseases 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 238000004448 titration Methods 0.000 description 2
- 239000012096 transfection reagent Substances 0.000 description 2
- 229960001727 tretinoin Drugs 0.000 description 2
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 2
- JXYWFNAQESKDNC-BTJKTKAUSA-N (z)-4-hydroxy-4-oxobut-2-enoate;2-[(4-methoxyphenyl)methyl-pyridin-2-ylamino]ethyl-dimethylazanium Chemical compound OC(=O)\C=C/C(O)=O.C1=CC(OC)=CC=C1CN(CCN(C)C)C1=CC=CC=N1 JXYWFNAQESKDNC-BTJKTKAUSA-N 0.000 description 1
- FALRKNHUBBKYCC-UHFFFAOYSA-N 2-(chloromethyl)pyridine-3-carbonitrile Chemical compound ClCC1=NC=CC=C1C#N FALRKNHUBBKYCC-UHFFFAOYSA-N 0.000 description 1
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 1
- 102100033400 4F2 cell-surface antigen heavy chain Human genes 0.000 description 1
- 102100022464 5'-nucleotidase Human genes 0.000 description 1
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 1
- YXHLJMWYDTXDHS-IRFLANFNSA-N 7-aminoactinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=C(N)C=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 YXHLJMWYDTXDHS-IRFLANFNSA-N 0.000 description 1
- 108700012813 7-aminoactinomycin D Proteins 0.000 description 1
- 102100031585 ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Human genes 0.000 description 1
- 102100033793 ALK tyrosine kinase receptor Human genes 0.000 description 1
- 102100033350 ATP-dependent translocase ABCB1 Human genes 0.000 description 1
- 241000321096 Adenoides Species 0.000 description 1
- 102100026402 Adhesion G protein-coupled receptor E2 Human genes 0.000 description 1
- 102100026423 Adhesion G protein-coupled receptor E5 Human genes 0.000 description 1
- 208000005748 Aggressive Fibromatosis Diseases 0.000 description 1
- 102100035248 Alpha-(1,3)-fucosyltransferase 4 Human genes 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- 208000037540 Alveolar soft tissue sarcoma Diseases 0.000 description 1
- 102100022749 Aminopeptidase N Human genes 0.000 description 1
- 102100020895 Ammonium transporter Rh type A Human genes 0.000 description 1
- 102100022014 Angiopoietin-1 receptor Human genes 0.000 description 1
- 102100030988 Angiotensin-converting enzyme Human genes 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 102100030356 Arginase-2, mitochondrial Human genes 0.000 description 1
- 101710186578 Arginase-2, mitochondrial Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- 241000282672 Ateles sp. Species 0.000 description 1
- 102100022717 Atypical chemokine receptor 1 Human genes 0.000 description 1
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 1
- 208000004736 B-Cell Leukemia Diseases 0.000 description 1
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 1
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 1
- 102100021264 Band 3 anion transport protein Human genes 0.000 description 1
- 102100028239 Basal cell adhesion molecule Human genes 0.000 description 1
- 102100032412 Basigin Human genes 0.000 description 1
- 208000003609 Bile Duct Adenoma Diseases 0.000 description 1
- 206010005003 Bladder cancer Diseases 0.000 description 1
- 206010005949 Bone cancer Diseases 0.000 description 1
- 102100037086 Bone marrow stromal antigen 2 Human genes 0.000 description 1
- 102100025423 Bone morphogenetic protein receptor type-1A Human genes 0.000 description 1
- 102100027052 Bone morphogenetic protein receptor type-1B Human genes 0.000 description 1
- 208000018084 Bone neoplasm Diseases 0.000 description 1
- 208000013165 Bowen disease Diseases 0.000 description 1
- 102100022595 Broad substrate specificity ATP-binding cassette transporter ABCG2 Human genes 0.000 description 1
- 102100027138 Butyrophilin subfamily 3 member A1 Human genes 0.000 description 1
- 102100035875 C-C chemokine receptor type 5 Human genes 0.000 description 1
- 102100036305 C-C chemokine receptor type 8 Human genes 0.000 description 1
- 102100036303 C-C chemokine receptor type 9 Human genes 0.000 description 1
- 102100031650 C-X-C chemokine receptor type 4 Human genes 0.000 description 1
- 102100032557 C-type lectin domain family 1 member A Human genes 0.000 description 1
- 101710160443 C-type lectin domain family 1 member A Proteins 0.000 description 1
- 102100032529 C-type lectin domain family 1 member B Human genes 0.000 description 1
- 101710160442 C-type lectin domain family 1 member B Proteins 0.000 description 1
- 102100032532 C-type lectin domain family 10 member A Human genes 0.000 description 1
- 102100026197 C-type lectin domain family 2 member D Human genes 0.000 description 1
- 102100028668 C-type lectin domain family 4 member C Human genes 0.000 description 1
- 102100028681 C-type lectin domain family 4 member K Human genes 0.000 description 1
- 102100040843 C-type lectin domain family 4 member M Human genes 0.000 description 1
- 102100040841 C-type lectin domain family 5 member A Human genes 0.000 description 1
- 101710186546 C-type lectin domain family 5 member A Proteins 0.000 description 1
- 102100040840 C-type lectin domain family 7 member A Human genes 0.000 description 1
- 102100025351 C-type mannose receptor 2 Human genes 0.000 description 1
- 102100032957 C5a anaphylatoxin chemotactic receptor 1 Human genes 0.000 description 1
- 102100037917 CD109 antigen Human genes 0.000 description 1
- 102100024263 CD160 antigen Human genes 0.000 description 1
- 108010009992 CD163 antigen Proteins 0.000 description 1
- 102100024210 CD166 antigen Human genes 0.000 description 1
- 102100021992 CD209 antigen Human genes 0.000 description 1
- 102100038077 CD226 antigen Human genes 0.000 description 1
- 102100038078 CD276 antigen Human genes 0.000 description 1
- 102100025238 CD302 antigen Human genes 0.000 description 1
- 102100025240 CD320 antigen Human genes 0.000 description 1
- 229940124294 CD33 monoclonal antibody Drugs 0.000 description 1
- 102000049320 CD36 Human genes 0.000 description 1
- 108010045374 CD36 Antigens Proteins 0.000 description 1
- 101150013553 CD40 gene Proteins 0.000 description 1
- 102100032937 CD40 ligand Human genes 0.000 description 1
- 102100032912 CD44 antigen Human genes 0.000 description 1
- 102100022002 CD59 glycoprotein Human genes 0.000 description 1
- 102100025222 CD63 antigen Human genes 0.000 description 1
- 102100025221 CD70 antigen Human genes 0.000 description 1
- 102100027221 CD81 antigen Human genes 0.000 description 1
- 102100027217 CD82 antigen Human genes 0.000 description 1
- 102100035793 CD83 antigen Human genes 0.000 description 1
- 102000024905 CD99 Human genes 0.000 description 1
- 108060001253 CD99 Proteins 0.000 description 1
- 102100035350 CUB domain-containing protein 1 Human genes 0.000 description 1
- 102100025805 Cadherin-1 Human genes 0.000 description 1
- 102100036364 Cadherin-2 Human genes 0.000 description 1
- 102100029761 Cadherin-5 Human genes 0.000 description 1
- 102100024533 Carcinoembryonic antigen-related cell adhesion molecule 1 Human genes 0.000 description 1
- 102100025473 Carcinoembryonic antigen-related cell adhesion molecule 6 Human genes 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 102100037182 Cation-independent mannose-6-phosphate receptor Human genes 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 102100031699 Choline transporter-like protein 1 Human genes 0.000 description 1
- 208000005243 Chondrosarcoma Diseases 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 206010073140 Clear cell sarcoma of soft tissue Diseases 0.000 description 1
- 102100025877 Complement component C1q receptor Human genes 0.000 description 1
- 102100025680 Complement decay-accelerating factor Human genes 0.000 description 1
- 102100030886 Complement receptor type 1 Human genes 0.000 description 1
- 102100032768 Complement receptor type 2 Human genes 0.000 description 1
- 206010010144 Completed suicide Diseases 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 102100039061 Cytokine receptor common subunit beta Human genes 0.000 description 1
- 102100026234 Cytokine receptor common subunit gamma Human genes 0.000 description 1
- 102100027816 Cytotoxic and regulatory T-cell molecule Human genes 0.000 description 1
- 239000012625 DNA intercalator Substances 0.000 description 1
- 230000007018 DNA scission Effects 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 206010059352 Desmoid tumour Diseases 0.000 description 1
- 208000008743 Desmoplastic Small Round Cell Tumor Diseases 0.000 description 1
- 208000002699 Digestive System Neoplasms Diseases 0.000 description 1
- 102100023471 E-selectin Human genes 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 101150029707 ERBB2 gene Proteins 0.000 description 1
- 208000009129 Ear Neoplasms Diseases 0.000 description 1
- 102100036993 Ecto-ADP-ribosyltransferase 4 Human genes 0.000 description 1
- 102100029722 Ectonucleoside triphosphate diphosphohydrolase 1 Human genes 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 102100037241 Endoglin Human genes 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 102100038083 Endosialin Human genes 0.000 description 1
- 201000005231 Epithelioid sarcoma Diseases 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 108700024394 Exon Proteins 0.000 description 1
- 102100031517 Fc receptor-like protein 1 Human genes 0.000 description 1
- 102100031511 Fc receptor-like protein 2 Human genes 0.000 description 1
- 102100031512 Fc receptor-like protein 3 Human genes 0.000 description 1
- 102100023593 Fibroblast growth factor receptor 1 Human genes 0.000 description 1
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 1
- 102100027842 Fibroblast growth factor receptor 3 Human genes 0.000 description 1
- 102100027844 Fibroblast growth factor receptor 4 Human genes 0.000 description 1
- 201000008808 Fibrosarcoma Diseases 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- 102100021261 Frizzled-10 Human genes 0.000 description 1
- 102100039820 Frizzled-4 Human genes 0.000 description 1
- 102100028461 Frizzled-9 Human genes 0.000 description 1
- 102100024405 GPI-linked NAD(P)(+)-arginine ADP-ribosyltransferase 1 Human genes 0.000 description 1
- 102100021260 Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 Human genes 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108700007698 Genetic Terminator Regions Proteins 0.000 description 1
- 208000008999 Giant Cell Carcinoma Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 1
- 102100025783 Glutamyl aminopeptidase Human genes 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 102100033366 Glutathione hydrolase 1 proenzyme Human genes 0.000 description 1
- 244000068988 Glycine max Species 0.000 description 1
- 235000010469 Glycine max Nutrition 0.000 description 1
- 102100036430 Glycophorin-B Human genes 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102100039622 Granulocyte colony-stimulating factor receptor Human genes 0.000 description 1
- 102100028113 Granulocyte-macrophage colony-stimulating factor receptor subunit alpha Human genes 0.000 description 1
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 description 1
- 108010010378 HLA-DP Antigens Proteins 0.000 description 1
- 102000015789 HLA-DP Antigens Human genes 0.000 description 1
- 108010062347 HLA-DQ Antigens Proteins 0.000 description 1
- 208000002125 Hemangioendothelioma Diseases 0.000 description 1
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 102100038030 High affinity immunoglobulin alpha and immunoglobulin mu Fc receptor Human genes 0.000 description 1
- 208000002291 Histiocytic Sarcoma Diseases 0.000 description 1
- 101710160350 Histocompatibility antigen 60c Proteins 0.000 description 1
- 101000800023 Homo sapiens 4F2 cell-surface antigen heavy chain Proteins 0.000 description 1
- 101000678236 Homo sapiens 5'-nucleotidase Proteins 0.000 description 1
- 101000777636 Homo sapiens ADP-ribosyl cyclase/cyclic ADP-ribose hydrolase 1 Proteins 0.000 description 1
- 101000718243 Homo sapiens Adhesion G protein-coupled receptor E5 Proteins 0.000 description 1
- 101001022185 Homo sapiens Alpha-(1,3)-fucosyltransferase 4 Proteins 0.000 description 1
- 101000757160 Homo sapiens Aminopeptidase N Proteins 0.000 description 1
- 101000753291 Homo sapiens Angiopoietin-1 receptor Proteins 0.000 description 1
- 101000984546 Homo sapiens Bone morphogenetic protein receptor type-1B Proteins 0.000 description 1
- 101000716063 Homo sapiens C-C chemokine receptor type 8 Proteins 0.000 description 1
- 101000716070 Homo sapiens C-C chemokine receptor type 9 Proteins 0.000 description 1
- 101000922348 Homo sapiens C-X-C chemokine receptor type 4 Proteins 0.000 description 1
- 101000942296 Homo sapiens C-type lectin domain family 10 member A Proteins 0.000 description 1
- 101000912615 Homo sapiens C-type lectin domain family 2 member D Proteins 0.000 description 1
- 101000766907 Homo sapiens C-type lectin domain family 4 member C Proteins 0.000 description 1
- 101000749311 Homo sapiens C-type lectin domain family 4 member M Proteins 0.000 description 1
- 101000576898 Homo sapiens C-type mannose receptor 2 Proteins 0.000 description 1
- 101000867983 Homo sapiens C5a anaphylatoxin chemotactic receptor 1 Proteins 0.000 description 1
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 1
- 101000980845 Homo sapiens CD177 antigen Proteins 0.000 description 1
- 101000934351 Homo sapiens CD302 antigen Proteins 0.000 description 1
- 101000868273 Homo sapiens CD44 antigen Proteins 0.000 description 1
- 101000897400 Homo sapiens CD59 glycoprotein Proteins 0.000 description 1
- 101000934368 Homo sapiens CD63 antigen Proteins 0.000 description 1
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 1
- 101000914479 Homo sapiens CD81 antigen Proteins 0.000 description 1
- 101000914469 Homo sapiens CD82 antigen Proteins 0.000 description 1
- 101000946856 Homo sapiens CD83 antigen Proteins 0.000 description 1
- 101000981093 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 1 Proteins 0.000 description 1
- 101000914326 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 6 Proteins 0.000 description 1
- 101000940912 Homo sapiens Choline transporter-like protein 1 Proteins 0.000 description 1
- 101000933665 Homo sapiens Complement component C1q receptor Proteins 0.000 description 1
- 101000856022 Homo sapiens Complement decay-accelerating factor Proteins 0.000 description 1
- 101000727061 Homo sapiens Complement receptor type 1 Proteins 0.000 description 1
- 101000941929 Homo sapiens Complement receptor type 2 Proteins 0.000 description 1
- 101000622123 Homo sapiens E-selectin Proteins 0.000 description 1
- 101001012447 Homo sapiens Ectonucleoside triphosphate diphosphohydrolase 1 Proteins 0.000 description 1
- 101000846913 Homo sapiens Fc receptor-like protein 1 Proteins 0.000 description 1
- 101000846911 Homo sapiens Fc receptor-like protein 2 Proteins 0.000 description 1
- 101000846910 Homo sapiens Fc receptor-like protein 3 Proteins 0.000 description 1
- 101000894906 Homo sapiens Galactosylgalactosylxylosylprotein 3-beta-glucuronosyltransferase 1 Proteins 0.000 description 1
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 1
- 101001071776 Homo sapiens Glycophorin-B Proteins 0.000 description 1
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 description 1
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 description 1
- 101001081176 Homo sapiens Hyaluronan mediated motility receptor Proteins 0.000 description 1
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 description 1
- 101001078158 Homo sapiens Integrin alpha-1 Proteins 0.000 description 1
- 101001078133 Homo sapiens Integrin alpha-2 Proteins 0.000 description 1
- 101000994378 Homo sapiens Integrin alpha-3 Proteins 0.000 description 1
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 description 1
- 101000994369 Homo sapiens Integrin alpha-5 Proteins 0.000 description 1
- 101000994365 Homo sapiens Integrin alpha-6 Proteins 0.000 description 1
- 101001035237 Homo sapiens Integrin alpha-D Proteins 0.000 description 1
- 101001046677 Homo sapiens Integrin alpha-V Proteins 0.000 description 1
- 101000935043 Homo sapiens Integrin beta-1 Proteins 0.000 description 1
- 101000935040 Homo sapiens Integrin beta-2 Proteins 0.000 description 1
- 101000599852 Homo sapiens Intercellular adhesion molecule 1 Proteins 0.000 description 1
- 101000599862 Homo sapiens Intercellular adhesion molecule 3 Proteins 0.000 description 1
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 1
- 101001083151 Homo sapiens Interleukin-10 receptor subunit alpha Proteins 0.000 description 1
- 101001003135 Homo sapiens Interleukin-13 receptor subunit alpha-1 Proteins 0.000 description 1
- 101001003132 Homo sapiens Interleukin-13 receptor subunit alpha-2 Proteins 0.000 description 1
- 101000961065 Homo sapiens Interleukin-18 receptor 1 Proteins 0.000 description 1
- 101001019615 Homo sapiens Interleukin-18 receptor accessory protein Proteins 0.000 description 1
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 description 1
- 101000945371 Homo sapiens Killer cell immunoglobulin-like receptor 2DL2 Proteins 0.000 description 1
- 101001049181 Homo sapiens Killer cell lectin-like receptor subfamily B member 1 Proteins 0.000 description 1
- 101000971538 Homo sapiens Killer cell lectin-like receptor subfamily F member 1 Proteins 0.000 description 1
- 101001018097 Homo sapiens L-selectin Proteins 0.000 description 1
- 101000605020 Homo sapiens Large neutral amino acids transporter small subunit 1 Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101000868279 Homo sapiens Leukocyte surface antigen CD47 Proteins 0.000 description 1
- 101000980823 Homo sapiens Leukocyte surface antigen CD53 Proteins 0.000 description 1
- 101001138062 Homo sapiens Leukocyte-associated immunoglobulin-like receptor 1 Proteins 0.000 description 1
- 101000608935 Homo sapiens Leukosialin Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101001063392 Homo sapiens Lymphocyte function-associated antigen 3 Proteins 0.000 description 1
- 101001023379 Homo sapiens Lysosome-associated membrane glycoprotein 1 Proteins 0.000 description 1
- 101000604993 Homo sapiens Lysosome-associated membrane glycoprotein 2 Proteins 0.000 description 1
- 101000576894 Homo sapiens Macrophage mannose receptor 1 Proteins 0.000 description 1
- 101000934372 Homo sapiens Macrosialin Proteins 0.000 description 1
- 101000961414 Homo sapiens Membrane cofactor protein Proteins 0.000 description 1
- 101001109508 Homo sapiens NKG2-A/NKG2-B type II integral membrane protein Proteins 0.000 description 1
- 101001051490 Homo sapiens Neural cell adhesion molecule L1 Proteins 0.000 description 1
- 101000577540 Homo sapiens Neuropilin-1 Proteins 0.000 description 1
- 101000897042 Homo sapiens Nucleotide pyrophosphatase Proteins 0.000 description 1
- 101001071312 Homo sapiens Platelet glycoprotein IX Proteins 0.000 description 1
- 101001070790 Homo sapiens Platelet glycoprotein Ib alpha chain Proteins 0.000 description 1
- 101001070786 Homo sapiens Platelet glycoprotein Ib beta chain Proteins 0.000 description 1
- 101001033026 Homo sapiens Platelet glycoprotein V Proteins 0.000 description 1
- 101001126417 Homo sapiens Platelet-derived growth factor receptor alpha Proteins 0.000 description 1
- 101000692455 Homo sapiens Platelet-derived growth factor receptor beta Proteins 0.000 description 1
- 101001043564 Homo sapiens Prolow-density lipoprotein receptor-related protein 1 Proteins 0.000 description 1
- 101001136981 Homo sapiens Proteasome subunit beta type-9 Proteins 0.000 description 1
- 101001062222 Homo sapiens Receptor-binding cancer antigen expressed on SiSo cells Proteins 0.000 description 1
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 1
- 101000633778 Homo sapiens SLAM family member 5 Proteins 0.000 description 1
- 101000863900 Homo sapiens Sialic acid-binding Ig-like lectin 5 Proteins 0.000 description 1
- 101000868472 Homo sapiens Sialoadhesin Proteins 0.000 description 1
- 101001133085 Homo sapiens Sialomucin core protein 24 Proteins 0.000 description 1
- 101000884271 Homo sapiens Signal transducer CD24 Proteins 0.000 description 1
- 101000709256 Homo sapiens Signal-regulatory protein beta-1 Proteins 0.000 description 1
- 101000709188 Homo sapiens Signal-regulatory protein beta-1 isoform 3 Proteins 0.000 description 1
- 101000835928 Homo sapiens Signal-regulatory protein gamma Proteins 0.000 description 1
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 101000809875 Homo sapiens TYRO protein tyrosine kinase-binding protein Proteins 0.000 description 1
- 101000800116 Homo sapiens Thy-1 membrane glycoprotein Proteins 0.000 description 1
- 101000835093 Homo sapiens Transferrin receptor protein 1 Proteins 0.000 description 1
- 101000798700 Homo sapiens Transmembrane protease serine 3 Proteins 0.000 description 1
- 101000798702 Homo sapiens Transmembrane protease serine 4 Proteins 0.000 description 1
- 101000801228 Homo sapiens Tumor necrosis factor receptor superfamily member 1A Proteins 0.000 description 1
- 101000801232 Homo sapiens Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 description 1
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 1
- 101000863873 Homo sapiens Tyrosine-protein phosphatase non-receptor type substrate 1 Proteins 0.000 description 1
- 101000760337 Homo sapiens Urokinase plasminogen activator surface receptor Proteins 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- 241000701109 Human adenovirus 2 Species 0.000 description 1
- 102100027735 Hyaluronan mediated motility receptor Human genes 0.000 description 1
- 102100034980 ICOS ligand Human genes 0.000 description 1
- 108700002232 Immediate-Early Genes Proteins 0.000 description 1
- 102000012745 Immunoglobulin Subunits Human genes 0.000 description 1
- 108010079585 Immunoglobulin Subunits Proteins 0.000 description 1
- 108010067060 Immunoglobulin Variable Region Proteins 0.000 description 1
- 102000017727 Immunoglobulin Variable Region Human genes 0.000 description 1
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 description 1
- 102100022516 Immunoglobulin superfamily member 2 Human genes 0.000 description 1
- 102100036489 Immunoglobulin superfamily member 8 Human genes 0.000 description 1
- 102100021317 Inducible T-cell costimulator Human genes 0.000 description 1
- 102100036721 Insulin receptor Human genes 0.000 description 1
- 102100039688 Insulin-like growth factor 1 receptor Human genes 0.000 description 1
- 102100025323 Integrin alpha-1 Human genes 0.000 description 1
- 102100025305 Integrin alpha-2 Human genes 0.000 description 1
- 102100032819 Integrin alpha-3 Human genes 0.000 description 1
- 102100032818 Integrin alpha-4 Human genes 0.000 description 1
- 102100032817 Integrin alpha-5 Human genes 0.000 description 1
- 102100032816 Integrin alpha-6 Human genes 0.000 description 1
- 102100039904 Integrin alpha-D Human genes 0.000 description 1
- 102100022341 Integrin alpha-E Human genes 0.000 description 1
- 102100022337 Integrin alpha-V Human genes 0.000 description 1
- 102100025304 Integrin beta-1 Human genes 0.000 description 1
- 102100025390 Integrin beta-2 Human genes 0.000 description 1
- 102100033000 Integrin beta-4 Human genes 0.000 description 1
- 102100037877 Intercellular adhesion molecule 1 Human genes 0.000 description 1
- 102100037872 Intercellular adhesion molecule 2 Human genes 0.000 description 1
- 102100037871 Intercellular adhesion molecule 3 Human genes 0.000 description 1
- 102100037874 Intercellular adhesion molecule 4 Human genes 0.000 description 1
- 102100035678 Interferon gamma receptor 1 Human genes 0.000 description 1
- 102100040021 Interferon-induced transmembrane protein 1 Human genes 0.000 description 1
- 102100027268 Interferon-stimulated gene 20 kDa protein Human genes 0.000 description 1
- 102000014150 Interferons Human genes 0.000 description 1
- 108010050904 Interferons Proteins 0.000 description 1
- 102100030236 Interleukin-10 receptor subunit alpha Human genes 0.000 description 1
- 102100020790 Interleukin-12 receptor subunit beta-1 Human genes 0.000 description 1
- 102100020791 Interleukin-13 receptor subunit alpha-1 Human genes 0.000 description 1
- 102100020793 Interleukin-13 receptor subunit alpha-2 Human genes 0.000 description 1
- 102100020789 Interleukin-15 receptor subunit alpha Human genes 0.000 description 1
- 102100035018 Interleukin-17 receptor A Human genes 0.000 description 1
- 102100039340 Interleukin-18 receptor 1 Human genes 0.000 description 1
- 102100035010 Interleukin-18 receptor accessory protein Human genes 0.000 description 1
- 102100026879 Interleukin-2 receptor subunit beta Human genes 0.000 description 1
- 102100030699 Interleukin-21 receptor Human genes 0.000 description 1
- 102100039078 Interleukin-4 receptor subunit alpha Human genes 0.000 description 1
- 102100039881 Interleukin-5 receptor subunit alpha Human genes 0.000 description 1
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 1
- 102100037795 Interleukin-6 receptor subunit beta Human genes 0.000 description 1
- 102100021593 Interleukin-7 receptor subunit alpha Human genes 0.000 description 1
- 102100026244 Interleukin-9 receptor Human genes 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 102100022304 Junctional adhesion molecule A Human genes 0.000 description 1
- 102100023430 Junctional adhesion molecule B Human genes 0.000 description 1
- 239000007836 KH2PO4 Substances 0.000 description 1
- 101150069255 KLRC1 gene Proteins 0.000 description 1
- 101150074862 KLRC3 gene Proteins 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- 102100021447 Kell blood group glycoprotein Human genes 0.000 description 1
- 102100033599 Killer cell immunoglobulin-like receptor 2DL2 Human genes 0.000 description 1
- 102100023678 Killer cell lectin-like receptor subfamily B member 1 Human genes 0.000 description 1
- 102100021458 Killer cell lectin-like receptor subfamily F member 1 Human genes 0.000 description 1
- 102100021457 Killer cell lectin-like receptor subfamily G member 1 Human genes 0.000 description 1
- 101710150988 Killer cell lectin-like receptor subfamily G member 1 Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- 102100033467 L-selectin Human genes 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- 108010001831 LDL receptors Proteins 0.000 description 1
- 108700042652 LMP-2 Proteins 0.000 description 1
- 206010023825 Laryngeal cancer Diseases 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 208000018142 Leiomyosarcoma Diseases 0.000 description 1
- 102100031775 Leptin receptor Human genes 0.000 description 1
- 102100021747 Leukemia inhibitory factor receptor Human genes 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 102100032913 Leukocyte surface antigen CD47 Human genes 0.000 description 1
- 102100024221 Leukocyte surface antigen CD53 Human genes 0.000 description 1
- 102100020943 Leukocyte-associated immunoglobulin-like receptor 1 Human genes 0.000 description 1
- 102100039564 Leukosialin Human genes 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 102100024640 Low-density lipoprotein receptor Human genes 0.000 description 1
- 102100033486 Lymphocyte antigen 75 Human genes 0.000 description 1
- 102100030984 Lymphocyte function-associated antigen 3 Human genes 0.000 description 1
- 206010025323 Lymphomas Diseases 0.000 description 1
- 102100035133 Lysosome-associated membrane glycoprotein 1 Human genes 0.000 description 1
- 102100038225 Lysosome-associated membrane glycoprotein 2 Human genes 0.000 description 1
- 108010031034 MHC class I-related chain A Proteins 0.000 description 1
- 108010086911 MICB antigen Proteins 0.000 description 1
- 241000282553 Macaca Species 0.000 description 1
- 101100404845 Macaca mulatta NKG2A gene Proteins 0.000 description 1
- 102100028198 Macrophage colony-stimulating factor 1 receptor Human genes 0.000 description 1
- 102100025354 Macrophage mannose receptor 1 Human genes 0.000 description 1
- 102100021435 Macrophage-stimulating protein receptor Human genes 0.000 description 1
- 102100025136 Macrosialin Human genes 0.000 description 1
- 102100025818 Major prion protein Human genes 0.000 description 1
- 102100027754 Mast/stem cell growth factor receptor Kit Human genes 0.000 description 1
- 208000007054 Medullary Carcinoma Diseases 0.000 description 1
- 241001420629 Melanodes Species 0.000 description 1
- 102100032239 Melanotransferrin Human genes 0.000 description 1
- 102100039373 Membrane cofactor protein Human genes 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 206010057269 Mucoepidermoid carcinoma Diseases 0.000 description 1
- 241000714177 Murine leukemia virus Species 0.000 description 1
- 101000985498 Mus musculus Hermansky-Pudlak syndrome 4 protein homolog Proteins 0.000 description 1
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 241000063939 Myelois Species 0.000 description 1
- 206010073137 Myxoid liposarcoma Diseases 0.000 description 1
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 description 1
- 102100022701 NKG2-E type II integral membrane protein Human genes 0.000 description 1
- 102000010648 Natural Killer Cell Receptors Human genes 0.000 description 1
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 description 1
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 description 1
- 102100032852 Natural cytotoxicity triggering receptor 3 Human genes 0.000 description 1
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 description 1
- 102100023064 Nectin-1 Human genes 0.000 description 1
- 102100035488 Nectin-2 Human genes 0.000 description 1
- 102100035487 Nectin-3 Human genes 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 102100024964 Neural cell adhesion molecule L1 Human genes 0.000 description 1
- 206010029260 Neuroblastoma Diseases 0.000 description 1
- 102100028762 Neuropilin-1 Human genes 0.000 description 1
- 208000010505 Nose Neoplasms Diseases 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 102100021969 Nucleotide pyrophosphatase Human genes 0.000 description 1
- 102100037589 OX-2 membrane glycoprotein Human genes 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 241000282579 Pan Species 0.000 description 1
- 206010033799 Paralysis Diseases 0.000 description 1
- 235000019483 Peanut oil Nutrition 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108010043958 Peptoids Proteins 0.000 description 1
- 102100024616 Platelet endothelial cell adhesion molecule Human genes 0.000 description 1
- 102100036851 Platelet glycoprotein IX Human genes 0.000 description 1
- 102100034173 Platelet glycoprotein Ib alpha chain Human genes 0.000 description 1
- 102100034168 Platelet glycoprotein Ib beta chain Human genes 0.000 description 1
- 102100038411 Platelet glycoprotein V Human genes 0.000 description 1
- 102100030485 Platelet-derived growth factor receptor alpha Human genes 0.000 description 1
- 102100026547 Platelet-derived growth factor receptor beta Human genes 0.000 description 1
- 102100035381 Plexin-C1 Human genes 0.000 description 1
- 102100029740 Poliovirus receptor Human genes 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 1
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 1
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 1
- 102100021923 Prolow-density lipoprotein receptor-related protein 1 Human genes 0.000 description 1
- 102100040120 Prominin-1 Human genes 0.000 description 1
- 102100024218 Prostaglandin D2 receptor 2 Human genes 0.000 description 1
- 102100020864 Prostaglandin F2 receptor negative regulator Human genes 0.000 description 1
- 102100035764 Proteasome subunit beta type-9 Human genes 0.000 description 1
- 102100032702 Protein jagged-1 Human genes 0.000 description 1
- 208000001671 Pulmonary Adenomatosis Diseases 0.000 description 1
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 1
- 102100029165 Receptor-binding cancer antigen expressed on SiSo cells Human genes 0.000 description 1
- 102100020718 Receptor-type tyrosine-protein kinase FLT3 Human genes 0.000 description 1
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 1
- 102100039808 Receptor-type tyrosine-protein phosphatase eta Human genes 0.000 description 1
- 206010038272 Refractory anaemia with ringed sideroblasts Diseases 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 201000000582 Retinoblastoma Diseases 0.000 description 1
- 101710124228 Retinoic acid early-inducible protein 1-alpha Proteins 0.000 description 1
- 101710167561 Retinoic acid early-inducible protein 1-beta Proteins 0.000 description 1
- 101710150606 Retinoic acid early-inducible protein 1-delta Proteins 0.000 description 1
- 101710089703 Retinoic acid early-inducible protein 1-epsilon Proteins 0.000 description 1
- 101710114260 Retinoic acid early-inducible protein 1-gamma Proteins 0.000 description 1
- 108091028664 Ribonucleotide Proteins 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 102100029216 SLAM family member 5 Human genes 0.000 description 1
- 102100029197 SLAM family member 6 Human genes 0.000 description 1
- 102100029198 SLAM family member 7 Human genes 0.000 description 1
- 102100029214 SLAM family member 8 Human genes 0.000 description 1
- 108091006629 SLC13A2 Proteins 0.000 description 1
- 102100025831 Scavenger receptor cysteine-rich type 1 protein M130 Human genes 0.000 description 1
- 201000001542 Schneiderian carcinoma Diseases 0.000 description 1
- 102100027744 Semaphorin-4D Human genes 0.000 description 1
- 102100037545 Semaphorin-7A Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 102100029957 Sialic acid-binding Ig-like lectin 5 Human genes 0.000 description 1
- 102100029947 Sialic acid-binding Ig-like lectin 6 Human genes 0.000 description 1
- 102100029946 Sialic acid-binding Ig-like lectin 7 Human genes 0.000 description 1
- 102100029965 Sialic acid-binding Ig-like lectin 9 Human genes 0.000 description 1
- 102100032855 Sialoadhesin Human genes 0.000 description 1
- 102100034258 Sialomucin core protein 24 Human genes 0.000 description 1
- 102100038081 Signal transducer CD24 Human genes 0.000 description 1
- 102100032770 Signal-regulatory protein beta-1 isoform 3 Human genes 0.000 description 1
- 102100025795 Signal-regulatory protein gamma Human genes 0.000 description 1
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 1
- 208000003252 Signet Ring Cell Carcinoma Diseases 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 208000000453 Skin Neoplasms Diseases 0.000 description 1
- 206010041067 Small cell lung cancer Diseases 0.000 description 1
- 102100022792 Sodium/potassium-transporting ATPase subunit beta-3 Human genes 0.000 description 1
- 206010042658 Sweat gland tumour Diseases 0.000 description 1
- 102100035721 Syndecan-1 Human genes 0.000 description 1
- 208000000389 T-cell leukemia Diseases 0.000 description 1
- 208000028530 T-cell lymphoblastic leukemia/lymphoma Diseases 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000027585 T-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 102100037906 T-cell surface glycoprotein CD3 zeta chain Human genes 0.000 description 1
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 102100033447 T-lymphocyte surface antigen Ly-9 Human genes 0.000 description 1
- 102100038717 TYRO protein tyrosine kinase-binding protein Human genes 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 102100040952 Tetraspanin-7 Human genes 0.000 description 1
- 238000012338 Therapeutic targeting Methods 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 206010043515 Throat cancer Diseases 0.000 description 1
- 208000005485 Thrombocytosis Diseases 0.000 description 1
- 102100026966 Thrombomodulin Human genes 0.000 description 1
- 102100034196 Thrombopoietin receptor Human genes 0.000 description 1
- 102100033523 Thy-1 membrane glycoprotein Human genes 0.000 description 1
- 102000006601 Thymidine Kinase Human genes 0.000 description 1
- 108020004440 Thymidine kinase Proteins 0.000 description 1
- 102100033504 Thyroglobulin Human genes 0.000 description 1
- 108010034949 Thyroglobulin Proteins 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 102100030859 Tissue factor Human genes 0.000 description 1
- 102100027010 Toll-like receptor 1 Human genes 0.000 description 1
- 102100027009 Toll-like receptor 10 Human genes 0.000 description 1
- 102100024333 Toll-like receptor 2 Human genes 0.000 description 1
- 102100024324 Toll-like receptor 3 Human genes 0.000 description 1
- 102100039360 Toll-like receptor 4 Human genes 0.000 description 1
- 102100039387 Toll-like receptor 6 Human genes 0.000 description 1
- 102100033110 Toll-like receptor 8 Human genes 0.000 description 1
- 102100033117 Toll-like receptor 9 Human genes 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- 108020004566 Transfer RNA Proteins 0.000 description 1
- 102100026144 Transferrin receptor protein 1 Human genes 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 102100032454 Transmembrane protease serine 3 Human genes 0.000 description 1
- 102100029681 Triggering receptor expressed on myeloid cells 1 Human genes 0.000 description 1
- 244000250129 Trigonella foenum graecum Species 0.000 description 1
- 235000001484 Trigonella foenum graecum Nutrition 0.000 description 1
- 101710162629 Trypsin inhibitor Proteins 0.000 description 1
- 229940122618 Trypsin inhibitor Drugs 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102100024598 Tumor necrosis factor ligand superfamily member 10 Human genes 0.000 description 1
- 102100024568 Tumor necrosis factor ligand superfamily member 11 Human genes 0.000 description 1
- 102100024585 Tumor necrosis factor ligand superfamily member 13 Human genes 0.000 description 1
- 102100036922 Tumor necrosis factor ligand superfamily member 13B Human genes 0.000 description 1
- 102100024586 Tumor necrosis factor ligand superfamily member 14 Human genes 0.000 description 1
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 description 1
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 1
- 102100040113 Tumor necrosis factor receptor superfamily member 10A Human genes 0.000 description 1
- 102100040112 Tumor necrosis factor receptor superfamily member 10B Human genes 0.000 description 1
- 102100040115 Tumor necrosis factor receptor superfamily member 10C Human genes 0.000 description 1
- 102100040110 Tumor necrosis factor receptor superfamily member 10D Human genes 0.000 description 1
- 102100028787 Tumor necrosis factor receptor superfamily member 11A Human genes 0.000 description 1
- 102100028786 Tumor necrosis factor receptor superfamily member 12A Human genes 0.000 description 1
- 102100029675 Tumor necrosis factor receptor superfamily member 13B Human genes 0.000 description 1
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 1
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 description 1
- 102100033725 Tumor necrosis factor receptor superfamily member 16 Human genes 0.000 description 1
- 102100033726 Tumor necrosis factor receptor superfamily member 17 Human genes 0.000 description 1
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 description 1
- 102100033732 Tumor necrosis factor receptor superfamily member 1A Human genes 0.000 description 1
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 1
- 102100022205 Tumor necrosis factor receptor superfamily member 21 Human genes 0.000 description 1
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 description 1
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 1
- 102100040403 Tumor necrosis factor receptor superfamily member 6 Human genes 0.000 description 1
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 1
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 description 1
- 108091005956 Type II transmembrane proteins Proteins 0.000 description 1
- 102100029948 Tyrosine-protein phosphatase non-receptor type substrate 1 Human genes 0.000 description 1
- 102100038932 Unconventional myosin-XVIIIa Human genes 0.000 description 1
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 1
- 102100024689 Urokinase plasminogen activator surface receptor Human genes 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 208000002495 Uterine Neoplasms Diseases 0.000 description 1
- 102100023543 Vascular cell adhesion protein 1 Human genes 0.000 description 1
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 208000012018 Yolk sac tumor Diseases 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000005856 abnormality Effects 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 208000006336 acinar cell carcinoma Diseases 0.000 description 1
- 208000013685 acquired idiopathic sideroblastic anemia Diseases 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- 108091005764 adaptor proteins Proteins 0.000 description 1
- 102000035181 adaptor proteins Human genes 0.000 description 1
- 210000002534 adenoid Anatomy 0.000 description 1
- 208000002517 adenoid cystic carcinoma Diseases 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 208000018234 adnexal spiradenoma/cylindroma of a sweat gland Diseases 0.000 description 1
- 208000020990 adrenal cortex carcinoma Diseases 0.000 description 1
- 239000003463 adsorbent Substances 0.000 description 1
- 230000009824 affinity maturation Effects 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 230000000172 allergic effect Effects 0.000 description 1
- 210000002203 alpha-beta t lymphocyte Anatomy 0.000 description 1
- 208000008524 alveolar soft part sarcoma Diseases 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000011230 antibody-based therapy Methods 0.000 description 1
- 210000000628 antibody-producing cell Anatomy 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 238000003556 assay Methods 0.000 description 1
- 208000010668 atopic eczema Diseases 0.000 description 1
- 208000016894 basaloid carcinoma Diseases 0.000 description 1
- 201000000450 basaloid squamous cell carcinoma Diseases 0.000 description 1
- 208000003373 basosquamous carcinoma Diseases 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 201000009036 biliary tract cancer Diseases 0.000 description 1
- 208000020790 biliary tract neoplasm Diseases 0.000 description 1
- 239000011230 binding agent Substances 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 229960003008 blinatumomab Drugs 0.000 description 1
- 210000000601 blood cell Anatomy 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 229940098773 bovine serum albumin Drugs 0.000 description 1
- 210000000481 breast Anatomy 0.000 description 1
- 201000008275 breast carcinoma Diseases 0.000 description 1
- 201000010983 breast ductal carcinoma Diseases 0.000 description 1
- 208000003362 bronchogenic carcinoma Diseases 0.000 description 1
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 1
- 229930195731 calicheamicin Natural products 0.000 description 1
- 125000000837 carbohydrate group Chemical group 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000007910 cell fusion Effects 0.000 description 1
- 230000011748 cell maturation Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 150000005829 chemical entities Chemical class 0.000 description 1
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 1
- 150000001841 cholesterols Chemical class 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000002759 chromosomal effect Effects 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 201000000292 clear cell sarcoma Diseases 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 238000000749 co-immunoprecipitation Methods 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 239000003086 colorant Substances 0.000 description 1
- 201000011050 comedo carcinoma Diseases 0.000 description 1
- 230000004154 complement system Effects 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 235000021310 complex sugar Nutrition 0.000 description 1
- 201000010918 connective tissue cancer Diseases 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000000875 corresponding effect Effects 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 208000035250 cutaneous malignant susceptibility to 1 melanoma Diseases 0.000 description 1
- 230000001461 cytolytic effect Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 1
- 108010025838 dectin 1 Proteins 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000006735 deficit Effects 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 239000005547 deoxyribonucleotide Substances 0.000 description 1
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 1
- 230000000994 depressogenic effect Effects 0.000 description 1
- 230000001627 detrimental effect Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- BFMYDTVEBKDAKJ-UHFFFAOYSA-L disodium;(2',7'-dibromo-3',6'-dioxido-3-oxospiro[2-benzofuran-1,9'-xanthene]-4'-yl)mercury;hydrate Chemical compound O.[Na+].[Na+].O1C(=O)C2=CC=CC=C2C21C1=CC(Br)=C([O-])C([Hg])=C1OC1=C2C=C(Br)C([O-])=C1 BFMYDTVEBKDAKJ-UHFFFAOYSA-L 0.000 description 1
- 208000002173 dizziness Diseases 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 241001493065 dsRNA viruses Species 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 208000031083 ear cancer Diseases 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 239000008393 encapsulating agent Substances 0.000 description 1
- 208000001991 endodermal sinus tumor Diseases 0.000 description 1
- 210000004696 endometrium Anatomy 0.000 description 1
- 210000002889 endothelial cell Anatomy 0.000 description 1
- 230000010502 episomal replication Effects 0.000 description 1
- 210000000981 epithelium Anatomy 0.000 description 1
- 239000006167 equilibration buffer Substances 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 1
- 210000001808 exosome Anatomy 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 208000024519 eye neoplasm Diseases 0.000 description 1
- 125000004030 farnesyl group Chemical group [H]C([*])([H])C([H])=C(C([H])([H])[H])C([H])([H])C([H])([H])C([H])=C(C([H])([H])[H])C([H])([H])C([H])([H])C([H])=C(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000006126 farnesylation Effects 0.000 description 1
- 125000005313 fatty acid group Chemical group 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 239000012091 fetal bovine serum Substances 0.000 description 1
- 210000002950 fibroblast Anatomy 0.000 description 1
- 206010016629 fibroma Diseases 0.000 description 1
- 201000008825 fibrosarcoma of bone Diseases 0.000 description 1
- 238000009459 flexible packaging Methods 0.000 description 1
- 230000022244 formylation Effects 0.000 description 1
- 238000006170 formylation reaction Methods 0.000 description 1
- 238000007306 functionalization reaction Methods 0.000 description 1
- 201000011243 gastrointestinal stromal tumor Diseases 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 230000006130 geranylgeranylation Effects 0.000 description 1
- 230000000762 glandular Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 210000002503 granulosa cell Anatomy 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 230000003394 haemopoietic effect Effects 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 210000002064 heart cell Anatomy 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 201000005787 hematologic cancer Diseases 0.000 description 1
- 208000014951 hematologic disease Diseases 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 102000057658 human KLRC2 Human genes 0.000 description 1
- 210000004276 hyalin Anatomy 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 230000033444 hydroxylation Effects 0.000 description 1
- 238000005805 hydroxylation reaction Methods 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 230000002519 immonomodulatory effect Effects 0.000 description 1
- 230000005746 immune checkpoint blockade Effects 0.000 description 1
- 230000017555 immunoglobulin mediated immune response Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 238000011368 intensive chemotherapy Methods 0.000 description 1
- 229940079322 interferon Drugs 0.000 description 1
- 238000003046 intermediate neglect of differential overlap Methods 0.000 description 1
- 230000000968 intestinal effect Effects 0.000 description 1
- 208000020082 intraepithelial neoplasia Diseases 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 201000010985 invasive ductal carcinoma Diseases 0.000 description 1
- 230000006122 isoprenylation Effects 0.000 description 1
- 210000003125 jurkat cell Anatomy 0.000 description 1
- 210000002510 keratinocyte Anatomy 0.000 description 1
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 206010023841 laryngeal neoplasm Diseases 0.000 description 1
- 201000004962 larynx cancer Diseases 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 230000000503 lectinlike effect Effects 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 210000000088 lip Anatomy 0.000 description 1
- 150000002634 lipophilic molecules Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 230000006144 lipoylation Effects 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 201000007270 liver cancer Diseases 0.000 description 1
- 208000014018 liver neoplasm Diseases 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 238000001325 log-rank test Methods 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 201000000014 lung giant cell carcinoma Diseases 0.000 description 1
- 201000000966 lung oat cell carcinoma Diseases 0.000 description 1
- 208000012804 lymphangiosarcoma Diseases 0.000 description 1
- 201000010953 lymphoepithelioma-like carcinoma Diseases 0.000 description 1
- 125000003588 lysine group Chemical group [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 238000011418 maintenance treatment Methods 0.000 description 1
- 208000022924 malignant ear neoplasm Diseases 0.000 description 1
- 201000006812 malignant histiocytosis Diseases 0.000 description 1
- 201000009020 malignant peripheral nerve sheath tumor Diseases 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 208000000516 mast-cell leukemia Diseases 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 208000023356 medullary thyroid gland carcinoma Diseases 0.000 description 1
- 230000000684 melanotic effect Effects 0.000 description 1
- 210000003071 memory t lymphocyte Anatomy 0.000 description 1
- 201000008806 mesenchymal cell neoplasm Diseases 0.000 description 1
- 230000011987 methylation Effects 0.000 description 1
- 238000007069 methylation reaction Methods 0.000 description 1
- 239000011325 microbead Substances 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 229910000402 monopotassium phosphate Inorganic materials 0.000 description 1
- 235000019796 monopotassium phosphate Nutrition 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 210000000214 mouth Anatomy 0.000 description 1
- 210000000663 muscle cell Anatomy 0.000 description 1
- 208000025113 myeloid leukemia Diseases 0.000 description 1
- 230000007498 myristoylation Effects 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- 208000014761 nasopharyngeal type undifferentiated carcinoma Diseases 0.000 description 1
- 210000000581 natural killer T-cell Anatomy 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 208000029809 non-keratinizing sinonasal squamous cell carcinoma Diseases 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 201000008106 ocular cancer Diseases 0.000 description 1
- 239000003921 oil Substances 0.000 description 1
- 235000019198 oils Nutrition 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 239000004006 olive oil Substances 0.000 description 1
- 235000008390 olive oil Nutrition 0.000 description 1
- 108091008819 oncoproteins Proteins 0.000 description 1
- 102000027450 oncoproteins Human genes 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 201000005443 oral cavity cancer Diseases 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000026792 palmitoylation Effects 0.000 description 1
- 201000010198 papillary carcinoma Diseases 0.000 description 1
- 239000000312 peanut oil Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 239000000816 peptidomimetic Substances 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 210000003800 pharynx Anatomy 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 238000009520 phase I clinical trial Methods 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 239000006187 pill Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- GNSKLFRGEWLPPA-UHFFFAOYSA-M potassium dihydrogen phosphate Chemical compound [K+].OP(O)([O-])=O GNSKLFRGEWLPPA-UHFFFAOYSA-M 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 230000013823 prenylation Effects 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 201000001514 prostate carcinoma Diseases 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 239000013636 protein dimer Substances 0.000 description 1
- 108020001580 protein domains Proteins 0.000 description 1
- 208000029817 pulmonary adenocarcinoma in situ Diseases 0.000 description 1
- 238000011002 quantification Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000003127 radioimmunoassay Methods 0.000 description 1
- 208000015347 renal cell adenocarcinoma Diseases 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 210000002345 respiratory system Anatomy 0.000 description 1
- 230000004043 responsiveness Effects 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 239000002336 ribonucleotide Substances 0.000 description 1
- 125000002652 ribonucleotide group Chemical group 0.000 description 1
- 108020004418 ribosomal RNA Proteins 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 201000007416 salivary gland adenoid cystic carcinoma Diseases 0.000 description 1
- 208000014212 sarcomatoid carcinoma Diseases 0.000 description 1
- 208000004259 scirrhous adenocarcinoma Diseases 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000009758 senescence Effects 0.000 description 1
- 210000002966 serum Anatomy 0.000 description 1
- 239000008159 sesame oil Substances 0.000 description 1
- 235000011803 sesame oil Nutrition 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 201000008123 signet ring cell adenocarcinoma Diseases 0.000 description 1
- 238000009097 single-agent therapy Methods 0.000 description 1
- 201000000849 skin cancer Diseases 0.000 description 1
- 210000004872 soft tissue Anatomy 0.000 description 1
- 239000007909 solid dosage form Substances 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 239000003549 soybean oil Substances 0.000 description 1
- 235000012424 soybean oil Nutrition 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 238000011255 standard chemotherapy Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 208000028210 stromal sarcoma Diseases 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 229940014800 succinic anhydride Drugs 0.000 description 1
- 230000035322 succinylation Effects 0.000 description 1
- 238000010613 succinylation reaction Methods 0.000 description 1
- 230000019635 sulfation Effects 0.000 description 1
- 238000005670 sulfation reaction Methods 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 210000000225 synapse Anatomy 0.000 description 1
- 206010042863 synovial sarcoma Diseases 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 229960002175 thyroglobulin Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- 210000002105 tongue Anatomy 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 230000002103 transcriptional effect Effects 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 206010044412 transitional cell carcinoma Diseases 0.000 description 1
- 230000001960 triggered effect Effects 0.000 description 1
- 239000013638 trimer Substances 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 239000002753 trypsin inhibitor Substances 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 230000005909 tumor killing Effects 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241000701447 unidentified baculovirus Species 0.000 description 1
- 201000005112 urinary bladder cancer Diseases 0.000 description 1
- 230000002485 urinary effect Effects 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 238000010200 validation analysis Methods 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000005167 vascular cell Anatomy 0.000 description 1
- 235000013311 vegetables Nutrition 0.000 description 1
- 208000008662 verrucous carcinoma Diseases 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 230000004580 weight loss Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
Landscapes
- Peptides Or Proteins (AREA)
Abstract
Disclosed herein are engineered heterodimer or heterotrimer proteins which use a non- naturally occurring polypeptide domain comprising 1 -5 alpha helices connected by amino acid linkers and an IgG2 hinge domain either alone or in conjunction with an IgG2 Fc domain. The heterodimer and heterotrimer proteins can further comprise an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a polypeptide that binds to a molecule expressed on an immune cell (e.g., natural killer cell) and/or a polypeptide that binds to a molecule expressed on another type of immune cell (e.g., T cells). Also disclosed herein are nucleic acids encoding the proteins, vectors comprising the nucleic acids, compositions, and methods of treatment.
Description
POLYFUNCTIONAL ORTHOGONAL PROTEIN CHIMERAS
CROSS-REFERENCE TO RELATED APPLICATIONS
The present application claims priority to U.S. Provisional Patent Application Nos.
63/047,938 filed July 3, 2020, 63/050,346 filed July 10, 2020, 63/075,388 filed September 8, 2020, 63/145,083 filed February 3,2021, and 63/189,412 filed May 17, 2021, all of which are incorporated herein by reference in its entirety.
SEQUENCE LISTING
The instant application contains a sequence listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety.
BACKGROUND
Presented on most acute myeloid leukemia (AML) leukemic cells, CD33 is an appealing target for immunotherapy, and represents a target population for which existing therapies are underperforming. Gerntuzurnab ozogarn ic in, a drug fusing a monoclonal antibody to CD33 with a DNA-scission cytotoxic calicheamicin. was available for patients after first AML relapse between 2000 to 2010 before being pulled for increasing patient death rate without discernible benefit (Lowenburg et al. 2010). In 2017, it was reintroduced to market tor primary CD33+ AML with modestly improved median survival in combination with cytosine arabinoside and daunorubicin, DNA intercalators that prevent DNA synthesis. As a monotherapy, it does not improve outcomes (Renneville et al. 2014). Bi-specific T-cell engagers (BiTE) which are currently in Phase I clinical trials, target CD33+
AML to CD3+ T-cells (Krupka et al. 2014). BiTEs, including those approved for B-cell malignancies such as blinatumomab which targets CD19+ B-cells for destruction via CD3+ T-cells, have such low bioavailability that they are injected continuously for weeks at a time, repeating for several months, prompting the need for alternative approaches to immune therapy (Nanbakhsh et al.
2014).
Many malignancies, including AML, are linked to decreased activity of the natural killer (NK) cytotoxic response. Expression of NK-activating ligands such as ULBP1 are positively correlated with survival but known to have depressed expression in AML even in conditions that would normally upregulate it (Elias et al. 2014). CD48, a ligand of the NK
receptor 2B4, is downregulated on the surface of AML cells expressing fusion proteins such as AML1-ETO (Mastaglio et al. 2018). Conversely, NK-inhibiting ligands such as PD-L2 are upregulated (Dulphy et al. 2016). AML has in some cases been shown to dysregulate maturation of NK cells, as well as "distracting" NK cells with soluble or cxosomc-bound ligands of receptors such as NKG2D (Mundy-Bosse et al. 2014). Suppression of NK
maturation, noted by low numbers of CD11b+CD27+ NK cells, is more potent with increasing AML burden (Stringaris et al. 2014). The activating-inhibiting balance of NK
cells where cytotoxic function depends on expression of and engagement of inhibitory and activating receptors on NK cells¨is frequently disturbed by AML, reducing surface expression of activating receptors and increasing expression of inhibiting receptors such as (Orleans-Lindsay et al. 2001). In the case of exosomes or soluble ligands, NK
cells struggle to find appropriate targets, revealing a therapeutic opportunity if a method can be developed that utilizes the NK cytotoxic response without relying on natural ligands on the surface of leukemic cells.
T-cells and NK cells alike have reduced function in AML contexts. Both primary blasts and AML cell lines like HL60 have demonstrated capacity to suppress the growth of T- and NK cells without affecting cytolytic activity or causing the death of these cells (LeDieu et al.
2009). A more comprehensive screen of patients suggested that T-cells in circulation greatly increase without an increase in activity, and others note increased proportion of T-regulatory cells in particular (Shenghui et al. 2011; Schnoffeil et al. 2015). Shifts toward memory T-cells, correlated with elevated PD-1 expression, have been demonstrated that once again do not suggest impairment in activity or in "exhaustion" of cytotoxic T-cells (Chamuleau et al. 2008).
Breakdown of tryptophan and arginine via indoleamine 2,3-dioxygenase and arginase II, upregulated in some AMLs also contribute to poor proliferation and activation of T-cells, and may serve as a useful serum indicator of immune avoidance by myeloid malignancies (Thorsson et al. 2018). The inflammatory landscape is also implicated in AML's escape from T-cell activity, but the predictive and therapeutic potential of specific interactions has not been harnessed (Benci et al. 2016; Chen et al. 2019). Ultimately, the methods by which myeloid blasts avoid immune clearance ___________________________________________________ modulating immune sub-populations, inhibiting cytotoxicity, and masking themselves¨are widely varied and difficult to predict.
Currently, new approaches are needed for diseases such as acute myeloid leukemia (AML) in which the outcomes, especially in older patients who are unable to receive intensive chemotherapy, the current standard of care, remains very poor, with a median survival of only 5 to 10 months (Dohner et al. 2015).
CROSS-REFERENCE TO RELATED APPLICATIONS
The present application claims priority to U.S. Provisional Patent Application Nos.
63/047,938 filed July 3, 2020, 63/050,346 filed July 10, 2020, 63/075,388 filed September 8, 2020, 63/145,083 filed February 3,2021, and 63/189,412 filed May 17, 2021, all of which are incorporated herein by reference in its entirety.
SEQUENCE LISTING
The instant application contains a sequence listing which has been submitted electronically in ASCII format and is hereby incorporated by reference in its entirety.
BACKGROUND
Presented on most acute myeloid leukemia (AML) leukemic cells, CD33 is an appealing target for immunotherapy, and represents a target population for which existing therapies are underperforming. Gerntuzurnab ozogarn ic in, a drug fusing a monoclonal antibody to CD33 with a DNA-scission cytotoxic calicheamicin. was available for patients after first AML relapse between 2000 to 2010 before being pulled for increasing patient death rate without discernible benefit (Lowenburg et al. 2010). In 2017, it was reintroduced to market tor primary CD33+ AML with modestly improved median survival in combination with cytosine arabinoside and daunorubicin, DNA intercalators that prevent DNA synthesis. As a monotherapy, it does not improve outcomes (Renneville et al. 2014). Bi-specific T-cell engagers (BiTE) which are currently in Phase I clinical trials, target CD33+
AML to CD3+ T-cells (Krupka et al. 2014). BiTEs, including those approved for B-cell malignancies such as blinatumomab which targets CD19+ B-cells for destruction via CD3+ T-cells, have such low bioavailability that they are injected continuously for weeks at a time, repeating for several months, prompting the need for alternative approaches to immune therapy (Nanbakhsh et al.
2014).
Many malignancies, including AML, are linked to decreased activity of the natural killer (NK) cytotoxic response. Expression of NK-activating ligands such as ULBP1 are positively correlated with survival but known to have depressed expression in AML even in conditions that would normally upregulate it (Elias et al. 2014). CD48, a ligand of the NK
receptor 2B4, is downregulated on the surface of AML cells expressing fusion proteins such as AML1-ETO (Mastaglio et al. 2018). Conversely, NK-inhibiting ligands such as PD-L2 are upregulated (Dulphy et al. 2016). AML has in some cases been shown to dysregulate maturation of NK cells, as well as "distracting" NK cells with soluble or cxosomc-bound ligands of receptors such as NKG2D (Mundy-Bosse et al. 2014). Suppression of NK
maturation, noted by low numbers of CD11b+CD27+ NK cells, is more potent with increasing AML burden (Stringaris et al. 2014). The activating-inhibiting balance of NK
cells where cytotoxic function depends on expression of and engagement of inhibitory and activating receptors on NK cells¨is frequently disturbed by AML, reducing surface expression of activating receptors and increasing expression of inhibiting receptors such as (Orleans-Lindsay et al. 2001). In the case of exosomes or soluble ligands, NK
cells struggle to find appropriate targets, revealing a therapeutic opportunity if a method can be developed that utilizes the NK cytotoxic response without relying on natural ligands on the surface of leukemic cells.
T-cells and NK cells alike have reduced function in AML contexts. Both primary blasts and AML cell lines like HL60 have demonstrated capacity to suppress the growth of T- and NK cells without affecting cytolytic activity or causing the death of these cells (LeDieu et al.
2009). A more comprehensive screen of patients suggested that T-cells in circulation greatly increase without an increase in activity, and others note increased proportion of T-regulatory cells in particular (Shenghui et al. 2011; Schnoffeil et al. 2015). Shifts toward memory T-cells, correlated with elevated PD-1 expression, have been demonstrated that once again do not suggest impairment in activity or in "exhaustion" of cytotoxic T-cells (Chamuleau et al. 2008).
Breakdown of tryptophan and arginine via indoleamine 2,3-dioxygenase and arginase II, upregulated in some AMLs also contribute to poor proliferation and activation of T-cells, and may serve as a useful serum indicator of immune avoidance by myeloid malignancies (Thorsson et al. 2018). The inflammatory landscape is also implicated in AML's escape from T-cell activity, but the predictive and therapeutic potential of specific interactions has not been harnessed (Benci et al. 2016; Chen et al. 2019). Ultimately, the methods by which myeloid blasts avoid immune clearance ___________________________________________________ modulating immune sub-populations, inhibiting cytotoxicity, and masking themselves¨are widely varied and difficult to predict.
Currently, new approaches are needed for diseases such as acute myeloid leukemia (AML) in which the outcomes, especially in older patients who are unable to receive intensive chemotherapy, the current standard of care, remains very poor, with a median survival of only 5 to 10 months (Dohner et al. 2015).
2 SUMMARY
The present disclosure provides for engineered proteins or polyfunctional orthogonal protein chimeras.
Polyspecific or polyfunctional proteins are biomolecules that can simultaneously engage two or more different types of agents (proteins, DNA, RNA or cells) based on the specificity of interaction and affinity to each of these agents.
For example, bispecific or bifunctional antibodies genetically engineered from two different monoclonal antibodies, one with specificity to an immune cell (e.g., T or NK) and other with specificity towards a cancer cell, are being used to enhance tumor killing.
Traditionally, these polyspecific proteins are made as a fusion protein but such fusion proteins may be rendered nonfunctional due to steric inhibition of engaging sites.
Recent advances in synthetic biology enabled creation of synthetic polypeptides that allow for creation of orthogonal protein heterodimers formed via non-covalent interaction based on hydrogen bonding, similar to that observed between two anti-parallel strands of DNA.
Shown herein are improved polyspecific or polyfunctional or hetero or heterodimer or heterotrimer proteins which use a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and an IgG2 hinge domain either alone or in conjunction with an IgG2 Fe domain. These polyfunctional proteins show improved properties over the previously described polyfunctional proteins. For one, the use of the IgG sequences allows for the formation of covalent disulfide bonds making the proteins more stable. These polyfunctional proteins have antibody-like properties and engage the body's complement system via the Fe domain. Furthermore, these polyfunctional proteins, like antibodies, are not easily destroyed in the body. Additionally, because these proteins arc antibody-like, there are less immunogenic and have better pharmacokinetics than the standard, previously disclosed bispecifi c proteins.
While there are engineered proteins exemplified herein, the innovative use of the non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and an IgG2 hinge domain either alone or in conjunction with an IgG2 Fe domain can be expanded to construct engineered proteins with other specificities that also have superior binding and cytotoxic properties. These engineered proteins can comprise an antigen-binding fragment or other moiety which binds any lineage-specific cell surface antigen or other antigens expressed and/or over-expressed by cancer and tumor cells, and any polypeptide which binds to a molecule expressed on immune cells.
The present disclosure provides for engineered proteins or polyfunctional orthogonal protein chimeras.
Polyspecific or polyfunctional proteins are biomolecules that can simultaneously engage two or more different types of agents (proteins, DNA, RNA or cells) based on the specificity of interaction and affinity to each of these agents.
For example, bispecific or bifunctional antibodies genetically engineered from two different monoclonal antibodies, one with specificity to an immune cell (e.g., T or NK) and other with specificity towards a cancer cell, are being used to enhance tumor killing.
Traditionally, these polyspecific proteins are made as a fusion protein but such fusion proteins may be rendered nonfunctional due to steric inhibition of engaging sites.
Recent advances in synthetic biology enabled creation of synthetic polypeptides that allow for creation of orthogonal protein heterodimers formed via non-covalent interaction based on hydrogen bonding, similar to that observed between two anti-parallel strands of DNA.
Shown herein are improved polyspecific or polyfunctional or hetero or heterodimer or heterotrimer proteins which use a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and an IgG2 hinge domain either alone or in conjunction with an IgG2 Fe domain. These polyfunctional proteins show improved properties over the previously described polyfunctional proteins. For one, the use of the IgG sequences allows for the formation of covalent disulfide bonds making the proteins more stable. These polyfunctional proteins have antibody-like properties and engage the body's complement system via the Fe domain. Furthermore, these polyfunctional proteins, like antibodies, are not easily destroyed in the body. Additionally, because these proteins arc antibody-like, there are less immunogenic and have better pharmacokinetics than the standard, previously disclosed bispecifi c proteins.
While there are engineered proteins exemplified herein, the innovative use of the non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and an IgG2 hinge domain either alone or in conjunction with an IgG2 Fe domain can be expanded to construct engineered proteins with other specificities that also have superior binding and cytotoxic properties. These engineered proteins can comprise an antigen-binding fragment or other moiety which binds any lineage-specific cell surface antigen or other antigens expressed and/or over-expressed by cancer and tumor cells, and any polypeptide which binds to a molecule expressed on immune cells.
3
4 Exemplified herein is a heterodimer bispecific protein using a NKG2D binding domain of a protein ULBP1 to create a heterodimer with antigen recognition domain of monoclonal antibody that bind a CD33 protein (present on myeloid cells), to engage a NK
cell with a myeloid cell. See Figures 1, 2 and 10.
Also, exemplified herein is a heterodimer bispecific protein using an antigen recognition domain of monoclonal antibodies that binds CD3 protein (present on T cells) and a CD33 protein (present on myeloid cells) to engage a T-cell with a myeloid cell. See Figures 1,2 and 10.
Also exemplified herein is a heterodimer bispecific protein using an antigen recognition domain of monoclonal antibodies that binds CD16 protein (present on NK cells) to create a heterodimer with antigen recognition domain of monoclonal antibody that bind a CD33 protein (present on myeloid cells), to engage a NK cell with a myeloid cell. See Figure 23.
While the engineered proteins exemplified herein utilize an antigen-binding fragment or other moiety which hinds a lineage-specific cell surface antigen (e.g., CD33), the disclosure includes engineered proteins comprising an antigen-binding fragment or other moiety which recognizes other antigens expressed and/or over-expressed by cancer and tumor cells. The disclosure also includes engineered proteins comprising polypeptides which bind to other molecules expressed on immune cells.
These exemplified heterodimer proteins comprise an IgG2 hinge domain. See Figures lA and 23A.
Also shown herein are the exemplified heterodimer proteins comprising an IgG2 hinge domain and an IgG2 Fc domain (CH2 and CH3 domains). See Figure 1B and 23B.
Polyfunctional proteins can also be constructcd comprising more than two polypeptides. These proteins can be formed by combining the monomer a of each heterodimer X, Y or Z with a linker and monomer h fused to a target binding domain. While this schematic shows a trispecific protein, tetraspecific proteins as well as engineered proteins comprising more than four can be constructed as shown in the schematic and methods herein. See Figure 9.
The utility of these synthetic molecules includes therapeutic targeting, gene editing, diagnostics, pathway manipulation by activating and or deactivating two or more signals simultaneously.
The present disclosure provides for an engineered heterodimer protein. In some embodiments, a first engineered heterodimer protein comprises: a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and wherein the first and second polypeptides are covalently bonded through the covalent dimerization domain.
In some embodiments, a second engineered heterodimer protein comprises: a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and a second polypeptide comprising a polypeptide that binds a molecule expressed on T cells, a non-naturally occurring polypeptide domain comprising 7-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and wherein the first and second polypeptides are coval en tl y bonded through the covalent dimerization domain.
In some embodiments, the non-naturally occurring polypeptide domain comprising
cell with a myeloid cell. See Figures 1, 2 and 10.
Also, exemplified herein is a heterodimer bispecific protein using an antigen recognition domain of monoclonal antibodies that binds CD3 protein (present on T cells) and a CD33 protein (present on myeloid cells) to engage a T-cell with a myeloid cell. See Figures 1,2 and 10.
Also exemplified herein is a heterodimer bispecific protein using an antigen recognition domain of monoclonal antibodies that binds CD16 protein (present on NK cells) to create a heterodimer with antigen recognition domain of monoclonal antibody that bind a CD33 protein (present on myeloid cells), to engage a NK cell with a myeloid cell. See Figure 23.
While the engineered proteins exemplified herein utilize an antigen-binding fragment or other moiety which hinds a lineage-specific cell surface antigen (e.g., CD33), the disclosure includes engineered proteins comprising an antigen-binding fragment or other moiety which recognizes other antigens expressed and/or over-expressed by cancer and tumor cells. The disclosure also includes engineered proteins comprising polypeptides which bind to other molecules expressed on immune cells.
These exemplified heterodimer proteins comprise an IgG2 hinge domain. See Figures lA and 23A.
Also shown herein are the exemplified heterodimer proteins comprising an IgG2 hinge domain and an IgG2 Fc domain (CH2 and CH3 domains). See Figure 1B and 23B.
Polyfunctional proteins can also be constructcd comprising more than two polypeptides. These proteins can be formed by combining the monomer a of each heterodimer X, Y or Z with a linker and monomer h fused to a target binding domain. While this schematic shows a trispecific protein, tetraspecific proteins as well as engineered proteins comprising more than four can be constructed as shown in the schematic and methods herein. See Figure 9.
The utility of these synthetic molecules includes therapeutic targeting, gene editing, diagnostics, pathway manipulation by activating and or deactivating two or more signals simultaneously.
The present disclosure provides for an engineered heterodimer protein. In some embodiments, a first engineered heterodimer protein comprises: a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and wherein the first and second polypeptides are covalently bonded through the covalent dimerization domain.
In some embodiments, a second engineered heterodimer protein comprises: a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and a second polypeptide comprising a polypeptide that binds a molecule expressed on T cells, a non-naturally occurring polypeptide domain comprising 7-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and wherein the first and second polypeptides are coval en tl y bonded through the covalent dimerization domain.
In some embodiments, the non-naturally occurring polypeptide domain comprising
5 alpha helices connected by amino acid linkers in the first polypeptide and the second polypeptide are chosen from the group consisting of 6DMPb and 6DMPa.
In some embodiments, the first covalent dimerization domain and/or the second covalent dimerization domain comprise an IgG2 hinge domain. In some embodiments, the first covalent dimerization domain and/or the second covalent dimerization domain further comprise an IgG2 Fe domain.
In some embodiments, the lineage-specific cell-surface antigen may be CD33, CD19, or any of the lineage-specific cell-surface antigens described herein.
In some embodiments, the molecule expressed on the NK cells may be NKG2D, and the polypeptide that hinds a molecule expressed on NK cells is ULBP1 , ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or mutants or fragments thereof. In some embodiments, the polypeptide that binds a molecule expressed on NK cells is an ectodomain of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB.
In some embodiments, the molecule expressed on NK cells is CD16, and the polypeptide that binds a molecule expressed on NK cells is a monoclonal antibody of CD16.
In some embodiments, the molecule expressed on T cells is CD3, and the polypeptide that binds a molecule expressed on T cells is a monoclonal antibody of CD3.
In some embodiments, the antigen-binding fragment is a single-chain antibody fragment (scFv).
The present disclosure also provides for an engineered heterotrimer protein comprising three polypeptides, or an engineered protein comprising more than three polypeptides, comprising four polypeptides, comprising five polypeptides, comprising six polypeptides, or comprising more than six polypeptides, wherein the engineered hetero proteins comprise an additional polypeptide with binding domains to each of the other polypeptides in the engineered protein.
In some embodiments, the engineered heterotrimer protein comprises: a first polypeptide comprising a polypeptide that binds a molecule expressed on T
cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (al), and a first covalent dimerization domain; a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (b 1), and a second covalent dimerization domain; a third polypeptide comprising a polypeptide that hinds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (c 1), and a third covalent dimerization domain; and a fourth polypeptide comprising three non-naturally occurring polypeptide domains comprising 1-5 alpha helices connected by amino acid linkers, wherein each domain is the binding domain of al, bl and cl (a2, b2 and c2), and a fourth, fifth and sixth covalent dimerization domain; and wherein the first and second and third and fourth polypeptides are covalently bonded through the covalent dimerization domain.
In some embodiments, the non-naturally occurring polypeptide domain comprising 5 alpha helices connected by amino acid linkers in the first polypeptide, the second polypeptide, the third polypeptidc and the fourth polypeptide arc chosen from the group consisting of 6DMPb and 6DMPa.
In some embodiments, the first covalent dimerization domain, the second covalent dimerization domain, the third covalent dimerization domain, the fourth covalent dimerization domain, the fifth covalent dimerization domain, and/or the sixth covalent dimerization domain comprise an IgG2 hinge domain. In some embodiments, one or more covalent dimerization domains further comprise an IgG2 Fc domain.
In some embodiments, the lineage-specific cell-surface antigen may be CD33, CD19, or any of the lineage-specific cell-surface antigens described herein.
In some embodiments, the molecule expressed on the NK cells may be NKG2D, and the polypeptide that binds a molecule expressed on NK cells is ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or mutants or fragments thereof. In some
In some embodiments, the first covalent dimerization domain and/or the second covalent dimerization domain comprise an IgG2 hinge domain. In some embodiments, the first covalent dimerization domain and/or the second covalent dimerization domain further comprise an IgG2 Fe domain.
In some embodiments, the lineage-specific cell-surface antigen may be CD33, CD19, or any of the lineage-specific cell-surface antigens described herein.
In some embodiments, the molecule expressed on the NK cells may be NKG2D, and the polypeptide that hinds a molecule expressed on NK cells is ULBP1 , ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or mutants or fragments thereof. In some embodiments, the polypeptide that binds a molecule expressed on NK cells is an ectodomain of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB.
In some embodiments, the molecule expressed on NK cells is CD16, and the polypeptide that binds a molecule expressed on NK cells is a monoclonal antibody of CD16.
In some embodiments, the molecule expressed on T cells is CD3, and the polypeptide that binds a molecule expressed on T cells is a monoclonal antibody of CD3.
In some embodiments, the antigen-binding fragment is a single-chain antibody fragment (scFv).
The present disclosure also provides for an engineered heterotrimer protein comprising three polypeptides, or an engineered protein comprising more than three polypeptides, comprising four polypeptides, comprising five polypeptides, comprising six polypeptides, or comprising more than six polypeptides, wherein the engineered hetero proteins comprise an additional polypeptide with binding domains to each of the other polypeptides in the engineered protein.
In some embodiments, the engineered heterotrimer protein comprises: a first polypeptide comprising a polypeptide that binds a molecule expressed on T
cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (al), and a first covalent dimerization domain; a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (b 1), and a second covalent dimerization domain; a third polypeptide comprising a polypeptide that hinds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (c 1), and a third covalent dimerization domain; and a fourth polypeptide comprising three non-naturally occurring polypeptide domains comprising 1-5 alpha helices connected by amino acid linkers, wherein each domain is the binding domain of al, bl and cl (a2, b2 and c2), and a fourth, fifth and sixth covalent dimerization domain; and wherein the first and second and third and fourth polypeptides are covalently bonded through the covalent dimerization domain.
In some embodiments, the non-naturally occurring polypeptide domain comprising 5 alpha helices connected by amino acid linkers in the first polypeptide, the second polypeptide, the third polypeptidc and the fourth polypeptide arc chosen from the group consisting of 6DMPb and 6DMPa.
In some embodiments, the first covalent dimerization domain, the second covalent dimerization domain, the third covalent dimerization domain, the fourth covalent dimerization domain, the fifth covalent dimerization domain, and/or the sixth covalent dimerization domain comprise an IgG2 hinge domain. In some embodiments, one or more covalent dimerization domains further comprise an IgG2 Fc domain.
In some embodiments, the lineage-specific cell-surface antigen may be CD33, CD19, or any of the lineage-specific cell-surface antigens described herein.
In some embodiments, the molecule expressed on the NK cells may be NKG2D, and the polypeptide that binds a molecule expressed on NK cells is ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or mutants or fragments thereof. In some
6 embodiments, the polypeptide that binds a molecule expressed on NK cells is an ectodomain of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB.
In some embodiments, the molecule expressed on the NK cells may be CD16 and the polypeptide that binds a molecule expressed on T cells is a monoclonal antibody of CD16.
In some embodiments, the molecule expressed on T cells is CD3, and the polypeptide that binds a molecule expressed on T cells is a monoclonal antibody of CD3.
In some embodiments, the third polypeptide is a chemokine or cytokine protein, which increases the immune response. The chemokine or cytokine protein includes but is not limited to CXCLs including CXCL14, GCSF, and interleukins, including IL2 and IL16.
In some embodiments, the antigen-binding fragment is a single-chain antibody fragment (scFv).
In certain embodiments, the first polypeptide in the first and second and third engineered heterodimer proteins comprises an amino acid at least 80% or at least 90% identical to SEQ ID NO: 1 (Figure 3). In some embodiments, the first polypeptide in the engineered heterodimer proteins comprises an amino acid at least 80% or at least 90%
identical to SEQ ID
NO: 4 (Figure 6).
In certain embodiments, the second polypeptide in the first engineered heterodimer comprises an amino acid at least 80% or at least 90% identical to SEQ Ill NO:
2 (Figure 4). In some embodiments, the second polypeptide in the first engineered heterodimer protein comprises an amino acid at least 80% or at least 90% identical to SEQ ID NO: 5 (Figure 7).
In certain embodiments, the second polypeptide in the second engineered heterodimer protein comprises an amino acid at least 80% or at least 90% identical to SEQ
ID NO: 3 (Figure 5). In some embodiments, the second polypeptide in the second engineered heterodimer protein comprises an amino acid at least 80% or at least 90% identical to SEQ ID NO: 6 (Figure 8).
In certain embodiments, the second polypeptide in the third engineered heterodimer protein comprises an amino acid at least 80% or at least 90% identical to SEQ
ID NO: 26 (Figure 23A). In some embodiments, the second polypeptide in the second engineered heterodimer protein comprises an amino acid at least 80% or at least 90%
identical to SEQ ID
NO: 27 (Figure 23B).
The present disclosure provides for a composition comprising any of the engineered proteins, or a nucleic acid molecule encoding any of the engineered proteins.
The present disclosure also provides for a nucleic acid molecule encoding a first engineered heterodimer protein. The engineered dimer protein may comprise: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface
In some embodiments, the molecule expressed on the NK cells may be CD16 and the polypeptide that binds a molecule expressed on T cells is a monoclonal antibody of CD16.
In some embodiments, the molecule expressed on T cells is CD3, and the polypeptide that binds a molecule expressed on T cells is a monoclonal antibody of CD3.
In some embodiments, the third polypeptide is a chemokine or cytokine protein, which increases the immune response. The chemokine or cytokine protein includes but is not limited to CXCLs including CXCL14, GCSF, and interleukins, including IL2 and IL16.
In some embodiments, the antigen-binding fragment is a single-chain antibody fragment (scFv).
In certain embodiments, the first polypeptide in the first and second and third engineered heterodimer proteins comprises an amino acid at least 80% or at least 90% identical to SEQ ID NO: 1 (Figure 3). In some embodiments, the first polypeptide in the engineered heterodimer proteins comprises an amino acid at least 80% or at least 90%
identical to SEQ ID
NO: 4 (Figure 6).
In certain embodiments, the second polypeptide in the first engineered heterodimer comprises an amino acid at least 80% or at least 90% identical to SEQ Ill NO:
2 (Figure 4). In some embodiments, the second polypeptide in the first engineered heterodimer protein comprises an amino acid at least 80% or at least 90% identical to SEQ ID NO: 5 (Figure 7).
In certain embodiments, the second polypeptide in the second engineered heterodimer protein comprises an amino acid at least 80% or at least 90% identical to SEQ
ID NO: 3 (Figure 5). In some embodiments, the second polypeptide in the second engineered heterodimer protein comprises an amino acid at least 80% or at least 90% identical to SEQ ID NO: 6 (Figure 8).
In certain embodiments, the second polypeptide in the third engineered heterodimer protein comprises an amino acid at least 80% or at least 90% identical to SEQ
ID NO: 26 (Figure 23A). In some embodiments, the second polypeptide in the second engineered heterodimer protein comprises an amino acid at least 80% or at least 90%
identical to SEQ ID
NO: 27 (Figure 23B).
The present disclosure provides for a composition comprising any of the engineered proteins, or a nucleic acid molecule encoding any of the engineered proteins.
The present disclosure also provides for a nucleic acid molecule encoding a first engineered heterodimer protein. The engineered dimer protein may comprise: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface
7 antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
The present disclosure also provides for a nucleic acid molecule encoding a second engineered heterodimer protein. The engineered dimer protein may comprise: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprises a polypeptide that binds a molecule expressed on T cells, a non-naturally occurring polypeptide domain comprising 7-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
The present disclosure also provides for a nucleic acid molecule encoding a third engineered heterodimer protein. The engineered dimer protein may comprise: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
The present disclosure also provides for a nucleic acid molecule encoding an engineered trimer protein. The engineered heterotrimer protein may comprise:
(i) a first polypeptide comprises a polypeptide that binds a molecule expressed on T
cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain an antigen-binding fragment that binds a lineage-specific cell-surface antigen; and (ii) a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (iii) a third polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and (iv) a fourth polypeptide comprising three non-naturally occurring polypeptide domains comprising 1-5 alpha helices connected by amino acid linkers, wherein
The present disclosure also provides for a nucleic acid molecule encoding a second engineered heterodimer protein. The engineered dimer protein may comprise: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprises a polypeptide that binds a molecule expressed on T cells, a non-naturally occurring polypeptide domain comprising 7-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
The present disclosure also provides for a nucleic acid molecule encoding a third engineered heterodimer protein. The engineered dimer protein may comprise: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
The present disclosure also provides for a nucleic acid molecule encoding an engineered trimer protein. The engineered heterotrimer protein may comprise:
(i) a first polypeptide comprises a polypeptide that binds a molecule expressed on T
cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain an antigen-binding fragment that binds a lineage-specific cell-surface antigen; and (ii) a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (iii) a third polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and (iv) a fourth polypeptide comprising three non-naturally occurring polypeptide domains comprising 1-5 alpha helices connected by amino acid linkers, wherein
8 each domain is the binding domain of al, b 1 and el (a2, b2 and c2), and a fourth, fifth and sixth covalent dimerization domain, as described herein.
The present disclosure provides for a vector comprising any of the present nucleic acid molecules, or a composition comprising any of the present nucleic acid molecules.
The present disclosure provides for a cell comprising the present vectors or nucleic acid molecules.
The present disclosure provides for a composition comprising at least one vector encoding: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occun-ing polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
The present disclosure provides for a composition comprising at least one vector encoding: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypcptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprises a polypeptide that binds a molecule expressed on T cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
The present disclosure provides for a composition comprising at least one vector encoding: (i) a first polypeptide comprises a polypeptide that binds a molecule expressed on T
cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain an antigen-binding fragment that binds a lineage-specific cell-surface antigen; and (ii) a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain and (iii) a third polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and (iv) a fourth polypeptide comprising three non-naturally occurring polypeptide domains comprising 1-5 alpha helices connected by amino acid
The present disclosure provides for a vector comprising any of the present nucleic acid molecules, or a composition comprising any of the present nucleic acid molecules.
The present disclosure provides for a cell comprising the present vectors or nucleic acid molecules.
The present disclosure provides for a composition comprising at least one vector encoding: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occun-ing polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
The present disclosure provides for a composition comprising at least one vector encoding: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypcptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprises a polypeptide that binds a molecule expressed on T cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
The present disclosure provides for a composition comprising at least one vector encoding: (i) a first polypeptide comprises a polypeptide that binds a molecule expressed on T
cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain an antigen-binding fragment that binds a lineage-specific cell-surface antigen; and (ii) a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain and (iii) a third polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and (iv) a fourth polypeptide comprising three non-naturally occurring polypeptide domains comprising 1-5 alpha helices connected by amino acid
9 linkers, wherein each domain is the binding domain of al, bl and cl (a2, b2 and c2), and a fourth, fifth and sixth covalent dimerization domain, as described herein.
The present disclosure provides for a composition comprising any of the engineered proteins, any of the nucleic acid molecules, any of the present vectors, and/or any of the present cells.
Also encompassed by the present disclosure is a kit comprising any of the engineered proteins, any of the nucleic acid molecules, any of the present vectors, any of the present cells and/or any of the present compositions.
The present disclosure provides for a method of treating cancer in a subject, comprising administering to the subject an effective amount of any of the engineered proteins, any of the nucleic acid molecules, any of the present vectors, any of the present cells and/or any of the present compositions disclosed or described herein.
The present disclosure provides for a method of treating a hematopoietic malignancy in a subject, comprising administering to the subject an effective amount of any of the engineered proteins, any of the nucleic acid molecules, any of the present vectors, any of the present cells and/or any of the present compositions disclosed or described herein.
The hematopoictic malignancy may be a myeloid malignancy.
The hematopoietic malignancy may be Hodgkin' s lymphoma, non-Hodgkin's lymphoma, leukemia, or multiple myeloma.
The hematopoietic malignancy may be acute myeloid leukemia, chronic myelogenous leukemia, acute lymphoblastic leukemia, or chronic lymphoblastic leukemia.
BRIEF DESCRIPTION OF THE FIGURES
For the purpose of illustrating the invention, there are depicted in drawings certain embodiments of the invention. However, the invention is not limited to the precise arrangements and instrumentalities of the embodiments depicted in the drawings.
Figure 1 are schematics of the various binding proteins. Figure lA is a schematic of the anti-CD33, anti-CD3, and NKG2D binding proteins with the IgG2 hinge domain only used in the engineered proteins. Figure 1B is a schematic of the anti-CD33, anti-CD3, and NKG2D
binding proteins with both IgG2 hinge and IgG2 Fc domains used in the engineered proteins.
Figure 2 is a schematic of the bifunctional protein dimers engaging immune cells with cancer cells.
Figure 3 is the amino acid sequence of the anti-CD33 construct with the IgG2 hinge domain only (SEQ ID NO: 1).
Figure 4 is the amino acid sequence of the ULBP1 construct with the IgG2 hinge domain only (SEQ ID NO: 2).
Figure 5 is the amino acid sequence of the anti-CD3 construct with the IgG2 hinge domain only (SEQ ID NO: 3).
Figure 6 is the amino acid sequence of the anti-CD33 construct with both IgG2 hinge and IgG2 Fc domains (SEQ ID NO: 4).
Figure 7 is the amino acid sequence of the ULBP1 construct with both IgG2 hinge and IgG2 Fe domains (SEQ ID NO: 5).
Figure 8 is the amino acid sequence of the anti-CD3 construct with both IgG2 hinge and IgG2 Fe domains (SEQ ID NO: 6).
Figure 9 is a schematic of an engineered heterotrimer protein.
Figure 10 are schematics of the engineered heterodimer proteins with the IgG2-hinge and the 6DMPa/b heterodimerizing structure. Figure 10A is an anti-CD33/anti-heterodimer protein. Figure 10B is an anti -CD33/ULPB 1 heterodimer protein.
Figure 11 are plasmid maps of the expression vectors used in the studies.
Figure 11A
is a map of the aCD33-6DMPa-Hinge expression vector. Figure 11B is a map of the 1.JLBP1-6DMPb-Hinge expression vector. Figure 11C is a map of the aCD3-6DMPb expression vector.
Figure 12 are immunoblots showing the expression and purification of the anti-CD33/ULBP engineered protein in 293T cells transfected with anti-CD33-ULBP1 chimeras 1 and 2 plasmids. Figure 12A shows the expression in cells. Figure 12B shows the expression and purification in supernatant.
Figure 13 is an immunoblot showing the expression and purification of hinge-based constructs in CHO cells. The proteins arc secreted into supernatant and can be 6xHis-purified using cobalt-resin and elution with imidazole.
Figure 14 shows FACS plots of HL-60 cells incubated with either anti-CD33 construct alone or with one of the engineered heterodimer proteins. Figure 14A shows co-incubation with an anti-FLAG antibody. Figure 14B shows co-incubation with an anti-MYC
antibody.
Figure 15 is a table summarizing binding experiments of the engineered heterodimer proteins to HL-60 cells.
Figure 16 is a table summarizing binding experiments of the engineered heterodimer proteins to Jurkat cells.
Figure 17 is a table summarizing binding experiments of the engineered heterodimer proteins to PMBCs.
Figure 18 shows the result of a cytotoxicity assay using M0LM14 cells and the anti-CD33/anti-CD3 engineered heterodimer protein. Figure 18A is a representative dot plot demonstrating flow cytometry gating scheme. Single dTomato+ (MOLM14) cells are gated, and % specific cells killed is assessed as total % of dTomato+ cells that are also DAPI+. Figure 18B is a graph of the results of a cytotoxicity in MOLM14 cells using the anti-C1133/anti-CD3 engineered heterodimer protein.
Figure 19 shows the result of a cytotoxicity assay using HL60 cells and the anti-CD33/anti-CD3 engineered heterodimer protein. Figure 19A is a representative dot plot demonstrating flow cytometry gating scheme. Single CellTrace Violet+ (HL-60) cells are gated, and % specific cells killed is assessed as total % of CellTrace Violet+
cells that are also DAPI+. Figure 19B is a graph showing the results of a cytotoxicity assay in HL-60 cells using the anti-CD33/anti-CD3 engineered heterodimer protein.
Figure 20 is a graph showing further results of a cytotoxicity assay in HL-60 cells using the anti-CD33/anti-CD3 engineered heterodimer protein as compared to monomers.
Figure 21 is a graph showing results of a dose dependent cytotoxicity assay using protein titration (i.e., increase in the anti-CD33/anti-CD3 engineered heterodimer protein) in HL-60 cells.
Figure 22 is a graph showing results of a dose dependent cytotoxicity assay using effector titration (i.e., increase in the effector/target ratio) in HL-60 cells.
Figure 23 are the amino acid sequences of the anti-CD16 construct. Figure 23A
is the amino acid sequence of the anti-CD16 construct with IgG2 hinge domain only (SEQ ID NO:
26). Figure 23B is the amino acid sequence of the anti-CD16 construct with both IgG2 hinge and IgG2 Fe domains (SEQ ID NO: 27).
Figure 24 shows the results of the in vivo anti-tumor activity of anti-CD33-anti-CD3 engineered heterodimer protein. Figure 24A is a schematic of the experiment.
Figure 24B are images of bioluminescence imaging (BLI) used to monitor the growth of FFluc-dtomato transduced MOLM14. Figure 24C is a graph of the quantification of BLI in mice treated with MOLM14 alone, unloaded T cells or anti-CD33-anti-CD3 engineered heterodimer protein loaded T cells. Figure 24D is a Kaplan-Meier survival plot. Mice treated with anti-CD33-anti-CD3 engineered heterodimer protein loaded T cells have better survival than the 2 control groups (no treatment or unloaded T cells). Log-rank test *p <0.05.
DETAILED DESCRIPTION
Definitions The term -engineered protein" or -engineered heterodimer protein" or "engineered heterotrimer protein" or "engineered hetero protein" or "polyfunctional protein" or "polyfunctional orthogonal protein chimera" or "protein chimera" or the like as used herein refers to a hybrid polypeptide which comprises protein domains from at least two different proteins. One domain may be located at the amino-terminal (N-terminal) portion of the fusion protein or at the carboxy-terminal (C-terminal) portion of the fusion protein.
Any of the proteins provided herein may be produced by any method known in the art. For example, the proteins provided herein may be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker.
Methods for recombinant protein expression and purification are well known, and include those described by Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)), the entire contents of which are incorporated herein by reference.
The terms "protein," "peptide," and "polypeptide" are used interchangeably herein, and refer to a polymer of amino acid residues linked together by peptide (amide) bonds. The terms refer to a protein, peptide, or polypeptide of any size, structure, Or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long. A protein, peptide, or polypeptide may refer to an individual protein or a collection of proteins.
One or more of the amino acids in a protein, peptide, or polypeptide may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modification, etc. A protein, peptide, or polypeptide may also be a single molecule or may be a multi-molecular complex. A protein, peptide, or polypeptide may be just a fragment of a naturally occurring protein or peptide. A protein, peptide, or polypeptide may be naturally occurring, recombinant, or synthetic, or any combination thereof.
The terms "subject," "individual," and "patient" are used interchangeably, and refer to a vertebrate, preferably a mammal such as a human. Mammals include, but are not limited to, human primates, non-human primates or murine, bovine, equine, canine or feline species. In the context of the present disclosure, the term "subject" also encompasses tissues and cells that can be cultured in vitro or ex vivo or manipulated in vivo. The term "subject"
can be used interchangeably with the term "organism".
The terms "polynucleotide", "nucleotide", "nucleotide sequence", "nucleic acid" and "oligonucleotide" are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Examples of polynucleotides include, but are not limited to, coding or non-coding regions of a gene or gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. One or more nucleotides within a polynucleotide can further be modified. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may also be modified after polymerization, such as by conjugation with a labeling agent.
The term "hybridization" refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner. The complex may comprise two strands forming a duplex structure, three or more strands forming a multi-stranded complex, a single self-hybridizing strand, or any combination of these. A hybridization reaction may constitute a step in a more extensive process, such as the initiation of PCR, or the cleavage of a polynucleotide by an enzyme. A sequence capable of hybridizing with a given sequence is referred to as the "complement" of the given sequence.
The terms "vector", "cloning vector" and "expression vector" mean the vehicle by which a DNA or RNA sequence (e.g., a foreign gene) can be introduced into a host cell, so as to transform the host and promote expression (e.g., transcription and translation) of the introduced sequence. Vectors include, but are not limited to, plasmids, phages, and viruses.
Vectors typically comprise the DNA of a transmissible agent, into which foreign DNA is inserted. A common way to insert one segment of DNA into another segment of DNA involves the use of enzymes called _restriction enzymes that cleave DNA at specific sites (specific groups of nucleotides) called restriction sites. A "cassette" refers to a DNA coding sequence or segment of DNA which codes for an expression product that can be inserted into a vector at defined restriction sites. The cassette restriction sites are designed to ensure insertion of the cassette in the proper reading frame. Generally, foreign DNA is inserted at one or more restriction sites of the vector DNA, and then is carried by the vector into a host cell along with the transmissible vector DNA. A segment or sequence of DNA having inserted or added DNA, such as an expression vector, can also be called a "DNA construct" or "gene construct." A
common type of vector is a "plasmid", which generally is a self-contained molecule of double-stranded DNA, usually of bacterial origin, that can readily accept additional (foreign) DNA
and which can readily introduced into a suitable host cell. A plasmid vector often contains coding DNA and promoter DNA and has one or more restriction sites suitable for inserting foreign DNA. Coding DNA is a DNA sequence that encodes a particular amino acid sequence for a particular protein or enzyme. Promoter DNA is a DNA sequence which initiates, regulates, or otherwise mediates or controls the expression of the coding DNA.
Promoter DNA
and coding DNA may be from the same gene or from different genes and may be from the same or different organisms. A large number of vectors, including plasmid and fungal vectors, have been described for replication and/or expression in a variety of eukaryotic and prokaryotic hosts. Non-limiting examples include pKK plasmids (Clonetech), pUC plasmids, pET
plasmids (Novagen, Inc., Madison, WI), pRSET or pREP plasmids (Invitrogen, San Diego, CA), or pMAL plasmids (New England Biolabs, Beverly, MA), and many appropriate host cells, using methods disclosed or cited herein or otherwise known to those skilled in the relevant art. Recombinant cloning vectors will often include one or more replication systems for cloning or expression, one or more markers for selection in the host, e.g., antibiotic resistance, and one or more expression cassettes.
The term "recombinant expression vector" means a genetically modified oligonucleotide or polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell. The vectors of the present disclosure are not naturally occurring as a whole.
Parts of the vectors can be naturally occurring. The non-naturally occurring recombinant expression vectors of the present disclosure can comprise any type of nucleotides, including, but not limited to DNA and RNA, which can be single-stranded or double-stranded, synthesized or obtained in part from natural sources, and which can contain natural, non-natural or altered nucleotides.
"Transfection," "transformation," or "transduction," as used herein, refer to the introduction of one or more exogenous polynucleotides into a host cell by using physical or chemical methods.
"Antibody," "fragment of an antibody," "antibody fragment," "functional fragment of an antibody," or "antigen-binding portion" are used interchangeably to mean one or more fragments or portions of an antibody that retain the ability to specifically bind to a specific antigen (Holliger et al., Nat. Biotech. (2005) 23(9): 1126). The present antibodies may be antibodies and/or fragments thereof. Antibody fragments include Fab, F(ab')2, scFv, disulfide linked Fv, Fc, or variants and/or mixtures. The antibodies may be chimeric, humanized, single chain, or hi-specific. All antibody isotypes are encompassed by the present disclosure, including, IgA, 1gD, IgE, IgG, and IgM. Suitable IgG subtypes include 1gGl, IgG2, IgG3 and IgG4. An antibody light or heavy chain variable region consists of a framework region interrupted by three hypervariable regions, referred to as complementarity determining regions (CDRs). The CDRs of the present antibodies or antigen-binding portions can be from a non-human or a human source. The framework of the present antibodies or antigen-binding portions can be human, humanized, non-human (e.g., a murine framework modified to decrease antigenicity in humans), or a synthetic framework (e.g., a consensus sequence).
The present antibodies or antigen-binding portions can specifically bind with a dissociation constant (Ku) of less than about 10-7 M, less than about 10-8M, less than about 10-9 M, less than about 10-1 M, less than about 10-11 M, or less than about 10-12 M. Affinities of the antibodies according to the present disclosure can be readily determined using conventional techniques (see, e.g., Scatchard et al., Ann. N.Y. Acad. Sci. (1949) 51:660;
and U.S. Patent Nos.
5,283,173, 5,468,614, or the equivalent).
The antigen recognition moiety of the engineered protein encoded by the nucleic acid sequence can contain any lineage antigen-specific, antigen-binding antibody fragment. The antibody fragment can comprise one or more CDRs, the variable region (or portions thereof), the constant region (or portions thereof), or combinations of any of the foregoing.
The term ''host cell" means any cell of any organism that is selected, modified, transformed, grown, used or manipulated in any way, for the production of a substance by the cell, for example, the expression by the cell of a gene, a DNA or RNA
sequence, a protein or an enzyme. Host cells can further he used for screening or other assays, as described herein.
The term "cell lineage" refers to cells with a common ancestry and developing from the same type of identifiable cell into specific identifiable/functioning cells.
The cell lineages used herein include, but are not limited to, respiratory, prostatic, pancreatic, mammary, renal, intestinal, neural, skeletal, vascular, hepatic, hematopoietic, muscle or cardiac cell lineages.
The term "inhibition" when used in reference to gene expression Or function of a lineage specific antigen refers to a decrease in the level of gene expression or function of the lineage specific antigen, where the inhibition is a result of interference with gene expression or function. The inhibition may be complete, in which case there is no detectable expression or function, or it may be partial. Partial inhibition can range from near complete inhibition to a near absence of inhibition.
The terms -treat", -treatment", and the like refer to a means to slow down, relieve, ameliorate or alleviate at least one of the symptoms of the disease, or reverse the disease after its onset.
"Treating" or "treatment" of a state, disorder or condition includes:
(1) preventing or delaying the appearance of clinical symptoms of the state, disorder, or condition developing in a person who may be afflicted with or predisposed to the state, disorder or condition but does not yet experience or display clinical symptoms of the state, disorder or condition; or (2) inhibiting the state, disorder or condition, i.e., arresting, reducing or delaying the development of the disease or a relapse thereof (in case of maintenance treatment) or at least one clinical symptom, sign, or test, thereof; or (3) relieving the disease, i.e., causing regression of the state, disorder or condition or at least one of its clinical or sub-clinical symptoms or signs.
The benefit to a subject to be treated is either statistically significant or at least perceptible to the patient or to the physician.
The terms -prevent", "prevention", and the like refer to acting prior to overt disease onset, to prevent the disease from developing or minimize the extent of the disease or slow its course of development.
An "immune response" refers to the development in the host of a cellular and/or antibody-mediated immune response to a composition or vaccine of interest.
Such a response usually consists of the subject producing antibodies, B cells, helper T cells, suppressor T cells, regulatory T cells, and/or cytotoxic T cells directed specifically to an antigen or antigens included in the composition or vaccine of interest.
A "therapeutically effective amount" or "effective amount" means the amount of a compound or agent that, when administered to an animal for treating a state, disorder or condition, is sufficient to affect such treatment. The "therapeutically effective amount" will vary depending on the compound, the disease and its severity and the age, weight, physical condition and responsiveness of the animal to be treated.
The compositions disclosed herein may include a -therapeutically effective amount" or a "prophylactically effective amount" of a compound described herein. A
"therapeutically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result. A therapeutically effective amount of an antibody or antibody portion may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the compound are outweighed by the therapeutically beneficial effects.
A "prophylactically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
While it is possible to use a composition provided by the present disclosure for therapy as is, it may be preferable to administer it in a pharmaceutical formulation, e.g., in admixture with a suitable pharmaceutical excipient, diluent or carrier selected with regard to the intended route of administration and standard pharmaceutical practice. Accordingly, in one aspect, the present disclosure provides a pharmaceutical composition or formulation comprising at least one active composition, or a pharmaceutically acceptable derivative thereof, in association with a pharmaceutically acceptable excipient, diluent and/or carrier. The excipient, diluent and/or carrier must be "acceptable" in the sense of being compatible with the other ingredients of the formulation and not deleterious to the recipient thereof.
The compositions of the disclosure can be formulated for administration in any convenient way for use in human or veterinary medicine. The invention therefore includes within its scope pharmaceutical compositions comprising a product of the present invention that is adapted for use in human or veterinary medicine.
The term "pharmaceutical composition," as used herein, refers to a composition that can be administrated to a subject in the context of treatment and/or prevention of a disease or disorder. In some embodiments, a pharmaceutical composition comprises an active ingredient, e.g., the present fusion pol ypepti de, nucleic acid molecule, vector, agent, etc., and optionally a pharmaceutically acceptable excipient, diluent and/or carrier.
Acceptable excipients, diluents, and carriers for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington: The Science and Practice of Pharmacy. Lippincott Williams & Wilkins (A. R. Gennaro edit. 2005). The choice of pharmaceutical excipient, diluent, and carrier can be selected with regard to the intended route of administration and standard pharmaceutical practice.
As used herein, the phrase "pharmaceutically acceptable" refers to molecular entities and compositions that are "generally regarded as safe", e.g., that are physiologically tolerable and do not typically produce an allergic or similar untoward reaction, such as gastric upset, dizziness and the like, when administered to a human. Preferably, as used herein, the term "pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopoeia or other generally recognized pharmacopeias for use in animals, and more particularly in humans.
The dosage of the therapeutic formulation will vary widely, depending upon the nature of the disease, the patient's medical history, the frequency of administration, the manner of administration, the clearance of the agent from the host, and the like. The initial dose may be larger, followed by smaller maintenance doses. The dose may be administered as infrequently as weekly or biweekly, or fractionated into smaller doses and administered daily, semi-weekly, etc., to maintain an effective dosage level. In some cases, oral administration will require a higher dose than if administered intravenously. In some cases, topical administration will include application several times a day, as needed, for a number of days or weeks in order to provide an effective topical dose.
The term "carrier" refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, olive oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Alternatively, the carrier can be a solid dosage form carrier, including but not limited to one or more of a binder (for compressed pills), a glidant, an encapsulating agent, a tlavorant, and a colorant. Suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin.
The term "agent" as used herein means a substance that produces or is capable of producing an effect and would include, but is not limited to, chemicals, pharmaceuticals, biologics, small organic molecules, antibodies, nucleic acids, peptides, and proteins.
The term "about" or "approximately" means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system, i.e., the degree of precision required for a particular purpose, such as a pharmaceutical formulation.
For example, "about" can mean within 1 or more than 1 standard deviations, per the practice in the art. Alternatively, "about" can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value.
Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated, the term "about" meaning within an acceptable error range for the particular value should be assumed.
General techniques The practice of the present disclosure will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature, such as Molecular Cloning: A
Laboratory Manual, second edition (Sambrook, et al., 1989) Cold Spring Harbor Press;
Oligonucleoticie Synthesis (M. J. Gait, ed. 1984); Methods in Molecular Biology, Humana Press; Cell Biology: A Laboratory Notebook (J. E. Cellis, ed., 1989) Academic Press; Animal Cell Culture (R. I. Freshney, ed. 1987); Introduction to Cell and Tissue Culture (J. P. Mather and P. E. Roberts, 1998) Plenum Press; Cell and Tissue Culture: Laboratory Procedures (A.
Doyle, J. B. Griffiths, and D. G. Newell, eds. 1993-8) J. Wiley and Sons;
Methods in Enzymology (Academic Press, Inc.); Handbook of Experimental Immunology (D. M.
Weir and C. C. Blackwell, eds.): Gene Transfer Vectors for Mammalian Cells (J. M.
Miller and M. P.
Cabs, eds., 1987); Current Protocols in Molecular Biology (F. M. Ausubel, et al. eds. 1987);
PCR: The Polymerase Chain Reaction, (Mullis, et al., eds. 1994); Current Protocols in Immunology (J. E. Coligan et al., eds., 1991); Short Protocols in Molecular Biology (Wiley and Sons, 1999); Immunobiology (C. A. Janeway and P. Travers, 1997);
Antibodies (P. Finch, 1997); Antibodies: a practice approach (D. Catty., ed., IRL Press, 1988-1989);
Monoclonal antibodies: a practical approach (P. Shepherd and C. Dean, eds., Oxford University Press, 2000); Using antibodies: a laboratory manual (E. Harlow and D. Lane (Cold Spring Harbor Laboratory Press, 1999): The Antibodies (M. Zanetti and J. D. Capra, cds.
Harwood Academic Publishers, 1995); DNA Cloning: A practical Approach, Volumes I and II (D.N.
Glover ed.
1985); Nucleic Acid Hybridization (B.D. Hames & S.J. Higgins eds.(1985);
Transcription and Translation (B.D. Hames & S.J. Higgins, eds. (1984 ; Animal Cell Culture (R.I.
Freshney, ed.
(1986 ; Immobilized Cells and Enzymes (1RL Press, (1986).
The present disclosure provides for agents comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33) which can cause cell death of the cells expressing the lineage-specific cell-surface antigen. Immunotherapies involving the combination of an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33), and a polypeptide that binds a molecule expressed on an immune cell such as a natural killer (NK) cell and/or a T cell, would provide an efficacious method of treatment for hematopoietic malignancies.
The present disclosure provides for a first and a third engineered heterodimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds a molecule expressed on immune cells. In some embodiments, the immune cells are natural killer (NK) cells. In some embodiments, the molecule is ULBP. In some embodiments, the molecule is CD16.
The present disclosure provides for a second engineered heterodimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds a molecule expressed on T cells. In some embodiments, the molecule is CD3.
The present disclosure further provides for an engineered heterotrimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds to immune cells (e.g., NK cells); and (iii) a polypeptide that binds a molecule expressed on T cells (e.g., CD3).
See Figures 2, 9, and 10.
The present compositions and methods may help activate NKG2D-bearing immune effector cells, such as natural killer (NK) cells and/or CD8+ T cells. The present compositions and methods may enhance or prompt a cellular immune response against diseased cells (such as tumor cells) that may induce cytotoxicity (e.g., culminate in the death of the diseased cells such as tumor cells). The present compositions and methods may enhance a subject's immune response, including, but not limited to one or more of the following:
upregulation of natural killer (NK) cell; upregulation of T cell (e.g., gamma delta T cell, alpha beta T cell) function;
upregulation of natural killer T (NKT) cell function; and upregulation of B
cell function. In some embodiments, upregulation of one or more of NK cell, T cell, natural killer T (NKT) cell, and B cell function includes enhancement and/or endowment of activity capable of inhibiting or decreasing cancer progression.
In some embodiments, inhibiting cancer progression may be accomplished by cytolysis of tumor cells, e.g., by direct induction of tumor cell apoptosis, induction of tumor cell cytolysis through stimulation of intrinsic host antitumor responses, induction of tumor cell apoptosis through stimulation of intrinsic host antitumor responses, inhibition of tumor cell metastasis, inhibition of tumor cell proliferation, and induction of senescence in the tumor cell.
The present disclosure also provides one or more nucleic acid (polynucleotide) molecules encoding the present engineered proteins, agents or compositions.
Other aspects of the present disclosure provide vectors comprising any of the nucleic acid (or polynucleotide) molecules provided herein. Also, within the scope of the present disclosure are polynucleotides encoded by the nucleic acids described herein and cells expressing such polynucleotides.
In some embodiments, the cells can be obtained from a patient having a hematopoietic malignancy. In some embodiments, the cell is a hematopoietic cell, such as a hematopoietic stem cell (e.g., CD34 ). In some embodiments, cells are provided, e.g., for recombinant expression and purification of the engineered proteins provided herein. The cells include any cell suitable for recombinant protein expression, for example, cells comprising a genetic construct or vector expressing or capable of expressing an engineered proteins (e.g., cells that have been transformed or transfected with one or more vectors described herein, or cells having genomic modifications, for example, those that express a protein provided herein). Methods for transforming cells, genetically modifying cells, and expressing genes and proteins in such cells are well known in the art, and include those provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)) and Friedman and Rossi, Gene Transfer:
Delivery and Expression of DNA and RNA, A Laboratory Manual (1st ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2006)).
Further, the present disclosure provides pharmaceutical compositions comprising the present agents, polypeptides, nucleic acid (or polynucleotide) molecules, vectors, cells, and/or compositions.
The present disclosure also provides for a method of treating a hematopoietic malignancy. The method may comprise administering to a subject in need thereof an effective amount of any of the disclosed engineered proteins or a polynucleotide encoding the engineered proteins. The method may comprise administering to a subject in need thereof an effective amount of the present agents or composition, or a polynucleotide encoding the agents (e.g., a combination of polypeptides) or compositions.
Another aspect of the present disclosure provides a method for treating a hematopoietic malignancy (or a hematological neoplasm), the method comprising administering to a subject in need thereof an effective amount of any of the disclosed engineered proteins or a polynucleotide encoding the engineered proteins. The method may comprise administering to a subject in need thereof an effective amount of the present agents or composition, or a polynucleotide encoding the agents (e.g., a combination of polypeptides) or compositions.
The present disclosure also relates to methods of using the engineered proteins to treat hematopoietic malignancies such as myeloid malignancies.
Also, within the scope of the present disclosure are kits comprising the present agents, polypeptides, nucleic acid (or polynucleotide) molecules, vectors, cells, and/or compositions.
Engineered Hetero Proteins The current disclosure provides for engineered hetero proteins.
In one embodiment, the present disclosure provides for a first and third engineered heterodimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds a molecule expressed on immune cells. In some embodiments, the immune cells are natural killer (NK) cells. In some embodiments, the molecule is ULB P. in some embodiments, the molecule is CD16.
In a further embodiment, the present disclosure provides for a second engineered heterodimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds a molecule expressed on T cells. In some embodiments, the molecule is CD3.
In yet a further embodiment, the present disclosure provides for an engineered heterotrimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g..
CD33); and (ii) a polypeptide that binds to immune cells (e.g., NK cells); and (iii) a polypeptide that binds a molecule expressed on T cells (e.g., CD3).
In some embodiments, the third polypeptide is a chemokine or cytokine protein, which increases the immune response. The chemokine or cytokine protein includes but is not limited to CXCLs including CXCL14, GCSF, and interleukins, including IL2 and IL16.
In some embodiments, the antigen-binding fragment binds a lineage-specific cell-surface antigen that is a type 2 lineage-specific cell-surface antigen (e.g., CD33). In some embodiments, the antigen-binding fragment binds a lineage-specific cell-surface antigen that is a type 1 lineage-specific cell-surface antigen (e.g., CD19). In some embodiments, the antigen-binding fragment binds an antigen expressed or over-expressed by cancer and/or tumor cells.
The polypeptide that binds a molecule expressed on natural killer (NK) cells may be a fragment of fragment of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b , H60c, or HCMV UL18, homologs thereof, mutants thereof, or fragments thereof. The polypeptide that binds a molecule expressed on natural killer (NK) cells may be an ectodomain of ULBP1. ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, HCMV
UL18, homologs thereof, mutants thereof, or fragments thereof.
In certain embodiments, the fragment of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, or HCMV
comprises an ectodomain of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, or HCMV UL18. In certain embodiments, the fragment of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, or HCMV UL18 comprises an ectodomain of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, HCMV UL18, homologs thereof, mutants thereof, or fragments thereof.
In some embodiments, the polypeptidc binds a molecule expressed on NK cells is an antibody of a cell surface marker of NK cells. In some embodiments, the cell surface marker is CD16. In some embodiments, the antibody is a monoclonal antibody.
In certain embodiments, the polypeptide that binds a molecule expressed on T
cells is an antibody of a cell surface marker of T cells. In some embodiments, the cell surface marker is CD3. In sonic embodiments, the antibody is a monoclonal antibody.
In certain embodiments, the first engineered heterodimer protein comprises:
(i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non -naturally occun-ing polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein. See Figures 1 and 10B.
In certain embodiments, antigen-binding fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (bi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment, an isolated CDR, diabodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. In some embodiments, scFv comprises a heavy chain variable region (Vii), and a light chain variable region (VL).
In some embodiments, the non-naturally occurring polypeptide domain comprising alpha helices is 6DMPa (Chen et al. 2019). In some embodiments, the non-naturally 5 occurring polypeptide domain comprising 1-5 alpha helices is 6DMPb (Chen et al. 2019).
In some embodiments, the covalent dimerization domains are IgG2 hinge domains.
In some embodiments, the covalent dimerization domains are IgG2 domains and IgG2 Fc domains. In some embodiments, the Fe domains are CH2 and CH3 domains.
The first engineered heterodimer protein can be designed to place the functional moieties (an antigen-binding fragment that binds a lineage-specific cell-surface antigen, and a polypeptide that binds a molecule expressed on NK cells) in any order. In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen is located at the N-terminus or C-terminus of the fusion polypeptide. In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells is located at the C-terminus or N-terminus of the fusion polypeptide.
In some embodiments, the first engineered heterodimer protein comprises, from N-terminus to C-terminus, a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19), and an ectodomain of ULBP1 (or an ectodomain of ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB). In some embodiments, the fusion polypeptide comprises, from N terminus to C terminus, an ectodomain of ULBP1 (or an ectodomain of ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB), and a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19).
The first engineered heterodimer protein may further comprise a signal sequence, and/or one or more linkers. In the fusion polypeptide, these functional moieties may be coval en tl y li gated continuously or non-continuously (e.g., they may be separated by 1 i nkers).
The linker may have up to 50, up to 40, up to 30, up to 20, up to 18, up to 15, up to 12, up to 11, or up to 10, amino acid residues in length. In certain embodiments, the linker has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10-20, 8-10, 8-12, 8-15, 8-20, or 8-30 amino acid residues in length. In certain embodiments, the linker has about 7-10, 7-12, 7-15, 7-20, or 7-30 amino acid residues in length.
One type of derivatized protein is produced by crosslinking two or more polypeptides (of the same type or of different types). Suitable crosslinkers include those that are heterobifunctional, having two distinct reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Useful detectable agents with which a protein can be derivatized (or labeled) include fluorescent agents, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, and radioactive materials. Non-limiting, exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, and phycoerythrin.
A polypeptide can also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, beta-galactosidase, acetylcholinesterase, glucose oxidase and the like. A
polypeptide can also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
The first engineered heterodimer protein can be derivatized or linked to another functional molecule. For example, first engineered heterodimer protein can be functionally linked (by chemical coupling, genetic fusion, noncovalent interaction) to one or more other molecular entities, such as an antibody or antibody fragment, a detectable agent, an immunosuppressant, a cytotoxic agent, a pharmaceutical agent, a protein or peptide that can mediate association with another molecule (such as a streptavidin core region or a polyhistidine tag), amino acid linkers, signal sequences, immunogenic carriers, or ligands useful in protein purification, such as glutathione-S-transferase, histidine tag, and staphylococcal protein A.
Cytotoxic agents may include radioactive isotopes, chemotherapeutic agents, and toxins such as enzymatically active toxins of bacterial, fungal, plant, or animal origin, and fragments thereof.
The first engineered heterodimer protein may further comprise a fragment (e.g., a tag) useful for polypeptide production and/or detection, including, but not limited to, poly-histidine (e.g., six histidine residues), a maltose binding protein, GST, green fluorescent protein (GFP), hemagglutinin, or alkaline phosphatasc, secretion signal peptides (e.g., preprotyrypsin signal sequence), Myc, and/or FLAG.
In one embodiment, the first engineered heterodimer protein comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 1 (Figure 3) and SEQ ID NO: 2 (Figure 4) or SEQ ID NO: 4 (Figure 6) and SEQ ID NO: 5 (Figure 7).
In one embodiment, the first engineered heterodimer protein comprises a signal sequence comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 966/9, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to an IL2 secretory signal sequence: MYRMQLLSCIALSLALVTNS (SEQ
ID NO:7) (Figures 3, 4, 6 and 8).
In one embodiment, the first engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to Myc: EQKLISEEDL (SEQ ID NO: 8) (Figures 3 and 6).
In one embodiment, the first engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to FLAG: DYKDDDDK (SEQ ID NO: 14) (Figures 4 and 7) In one embodiment, the first engineered heterodimer protein comprises an anti-scFv comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the anti-CD33 scEv disclosed in U.S. Patent Publication No.
20130078241.
In one embodiment, the first engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a light chain variable region (VI) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 9 (Figures 3 and 6).
Anti-CD33 Light Chain variable region (VI) (SEQ ID NO: 9):
EIVLTQS PGSLAVSPGERVTMSC KS S QSVFFS SS QKNYLAWYQQIPGQSPRLLIYWAS
TRESGVPDRFTGSGSGTDFTLTISSVQPEDLAIYYCHQYLSSRTFGQGTKLEIKR
In one embodiment, the first engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a heavy chain variable region (VH) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 10 (Figures 3 and 6):
Anti-CD33 Heavy Chain variable region (VH) (SEQ ID NO: 10):
QVQLQQPGAEVVKPGASVKMSCKASGYTFTSYYIHWIKQTPGQGLEWVGVIYPGND
DISYNQKFQGKATLTADKSSTTAYMQLSSLTSEDSAVYYCAREVRLRYFDVWGQGT
TVTVSSSSSA
In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of the full-length, or a fragment, of wildtype ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or HCMV UL18 (including human ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or HCMV UL18), or of the full-length, or a fragment, of the human homolog of Raetl a, Raetl h, Raet lc, Raetld, Raetle, H60b, H60c.
In one embodiment, human ULBP1 has a UniProt accession number Q9BZM6. In one embodiment, an ectodomain human ULBP1 comprises (or consists essentially of, or consists of) amino acid residues 27 to 216 of Q9BZM6-1.
In one embodiment, the first engineered heterodimer protein comprises a ULBP1 ectodomain comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 15 (Figures 4 and 7):
ULBP1 ectodomain (27 to 216 aa of Q9BZM6-1) (SEQ ID NO: 15):
WVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVN
VTKTWEE QTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMS CEHEAHGHGRGSW
QFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMW
LEEFLMYWEQMLDPTKPPSLAPG
In one embodiment, the first engineered heterodimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 12 (Figures 3 and 6).
6DMPa (SEQ ID NO: 12):
GTKEDILERQRKIIERAQEIHRRQQEILEELERIIRKPGSSEEAMKRMLKLLEESLRLLK
ELLELSEE S A QLLYEQR
In one embodiment, the first engineered heterodimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 16 (Figures 4 and 7).
6DMPb (SEQ TD NO: 16):
TEKRLLEEAERAHREQKEIIKKAQELHRRLEEIVRQSGSSEEAKKEAKKILEEIRELSK
RSLELLREILYLSQEQKGSLVPR
In one embodiment, the first engineered heterodimer protein comprises one or more covalent dimerization IgG2 hinge domains comprising (or consisting essentially of or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to IgG2 hinge:
ERKCCVECPPCP
(SEQ ID NO: 13) (Figures 3, 4, 6, and 7).
In one embodiment, the first engineered heterodimer protein comprises one or more covalent dimerization IgG2 Fe domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 19 (Figures 6 and 7).
IgG2 Fe Domain (SEQ ID NO: 19):
APPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA
KTKPREEQFNS TFRVVS VLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTIS KTKGQPR
EPQ V YTLPPSREEMTKN QV SLTCLV KGFYPSDIS V EWESNGQPENN Y KTTPPMLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
In one embodiment, the first engineered heterodimer protein comprises one or more linkers comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 11: GGGGSGGGGSGGGGS (Figures 3, 4, 6, and 7).
In further embodiments, the first engineered heterodimer protein comprises a His6 tag (HHHHHH; SEQ ID NO: 20).
In certain embodiments, the second engineered heterodimer protein comprises:
(i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on T
cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
In certain embodiments, antigen-binding fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (bi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment, an isolated CDR, diabodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. In some embodiments, scFv comprises a heavy chain variable region (VH), and a light chain variable region (VL).
In some embodiments, the non-naturally occurring polypeptide domain comprising 5 alpha helices is 6DMPa (Chen et al. 2019). In some embodiments, the non-naturally occurring polypeptide domain comprising 1-5 alpha helices is 6DMPh (Chen et al. 2019).
In some embodiments, the covalent dimerization domains are IgG2 hinge domains.
In some embodiments, the covalent dimerization domains are IgG2 domains and IgG2 Fe domains. In some embodiments, the Fe domains are CH2 and CH3 domains.
The second engineered heterodimer protein can be designed to place the functional moieties (an antigen-binding fragment that binds a lineage-specific cell-surface antigen, and a polypeptide that binds a molecule expressed on T cells) in any order. In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen is located at the N-terminus or C-terminus of the fusion polypeptide. In certain embodiments, the polypeptide that binds a molecule expressed on T cells is located at the C-terminus or N-terminus of the fusion polypeptide.
In some embodiments, the second engineered heterodimer protein comprises, from N-terminus to C-terminus, a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19), and a polypeptide that binds a molecule expressed on T cells (e.g., an anti-CD3 monoclonal antibody). In some embodiments, the fusion polypeptide comprises, from N
terminus to C terminus, a polypeptide that binds a molecule expressed on T
cells (e.g., an anti-CD3 mono clonal antibody). and a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19).
The second engineered heterodimer protein may further comprise a signal sequence, and/or one or more linkers. In the second engineered heterodimer, these functional moieties may be covalently ligated continuously or non-continuously (e.g., they may be separated by linkers). The linker may have up to 50, up to 40, up to 30, up to 20, up to 18, up to 15, up to 12, up to 11, or up to 10, amino acid residues in length. In certain embodiments, the linker has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10-20, 8-10, 8-12, 8-15, 8-20, or 8-30 amino acid residues in length. In certain embodiments, the linker has about 7-10, 7-12, 7-15, 7-20, or 7-30 amino acid residues in length.
One type of derivatized protein is produced by crosslinking two or more polypeptides (of the same type or of different types). Suitable crosslinkers include those that are heterobifunctional, having two distinct reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Useful detectable agents with which a protein can be derivatized (or labeled) include fluorescent agents, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, and radioactive materials. Non-limiting, exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, and, phycoerythrin. A polypeptide can also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, beta-galactosidase, acetylcholinesterase, glucose oxidase and the like. A
polypeptide can also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
The second engineered heterodimer protein can be derivatized or linked to another functional molecule. For example, second engineered heterodimer protein can be functionally linked (by chemical coupling, genetic fusion, noncovalent interaction, etc.) to one or more other molecular entities, such as an antibody or antibody fragment, a detectable agent, an immunosuppressant, a cytotoxic agent, a pharmaceutical agent, a protein or peptide that can mediate association with another molecule (such as a streptavidin core region or a polyhistidine tag), amino acid linkers, signal sequences, immunogenic carriers, or ligands useful in protein purification, such as glutathione-S-transferase, histidine tag, and staphylococcal protein A.
Cytotoxic agents may include radioactive isotopes, chemotherapeutic agents, and toxins such as enzymatically active toxins of bacterial, fungal, plant, or animal origin, and fragments thereof.
The second engineered heterodimer protein may further comprise a fragment (e.g., a tag) useful for polypeptide production and/or detection, including, but not limited to, poly-histidine (e.g., six histidine residues), a maltose binding protein, GST, green fluorescent protein (GFP), hemagglutinin, or alkaline phosphatase, secretion signal peptides (e.g., preprotyrypsin signal sequence). Myc, and/or FLAG.
In one embodiment, the second engineered heterodimer protein comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
Ill NO: 1 (Figure 3) and SEQ ID NO: 3 (Figure 5) or SEQ ID NO: 4 (Figure 6) and SEQ ID NO: 6 (Figure 8).
In one embodiment, the second engineered heterodimer protein comprises a signal sequence comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to an IL2 secretory signal sequence: MYRMQLLSCIALSLALVTNS (SEQ
ID NO:7) (Figures 3, 5, 6 and 8).
In one embodiment, the second engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to Myc: EQKLISEEDL (SEQ ID NO: 8) (Figures 3 and 6).
In one embodiment, the second engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to FLAG: DYKDDDDK (SEQ ID NO: 14) (Figures 5 and 8) In one embodiment, the second engineered heterodimer protein comprises an anti-CD33 scFv comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the anti-CD33 scFv disclosed in U.S. Patent Publication No.
20130078241.
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a light chain variable region (VI) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 9 (Figures 3 and 6).
Anti-CD33 Light Chain variable region (VL) (SEQ ID NO: 9):
EIVLTQSPGSLAVSPGERVTMSCKSSQSVFFSSSQKNYLAWYQQIPGQSPRLLIYWAS
TRESGVPDRFTGSGSGTDFTLTISSVQPEDLAIYYCHQYLSSRTFGQGTKLEIKR
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a heavy chain variable region (VH) comprising (or consisting essentially of, at consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%. at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 10 (Figures 3 and 6):
Anti-CD33 Heavy Chain variable region (VH) (SEQ ID NO: 10):
QVQLQQPGAEVVKPGASVKMSCKASGYTFTSYYTHWIKQTPGQGLEWVGVIYPGND
DISYNQKFQGKATLTADKSSTTAYMQLSSLTSEDSAVYYCAREVRLRYFDVWGQGT
TVTVSSSSSA
In certain embodiments, the polypeptide that binds a molecule expressed on T
cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of SEQ ID NOs: 17 and 18.
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD3, where the antigen-binding fragment comprises a heavy chain variable region (VH) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 17 (Figures 5 and 8):
Anti-CD3 Heavy Chain variable region (VH) (SEQ ID NO: 17):
DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLGLEWIGYINPS
RGYTNYNQKFKDKATLTTD KSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYW
GQGTTLTVSS
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD3, where the antigen-binding fragment comprises a light chain variable region (VL) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 18 (Figures 5 and 8):
Anti-CD3 Light Chain variable region (VII) (SEQ ID NO: 18):
DIQLTQSPAIMSASPGGKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASG
VPYRFTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
In one embodiment, the second engineered heterodimer protein comprises one or more non-naturally occurring pol ypepti de domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 12 (Figures 3 and 6).
6DMPa (SEQ ID NO: 12):
GTKEDILERQRKIIER A QEIHRR QQEILEELERIIRKPGSSEEAMKRMLKLLEESLRLLK
ELLELSEESAQLLYEQR
In one embodiment, the second engineered heterodimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 16 (Figures 5 and 8).
6DMPb (SEQ Ill NO: 16):
TEKRLLEEAERAHREQKEIIKKAQELHRRLEEIVRQSGSSEEAKKEAKKILEEIRELSK
RS LELLREILYLS QEQ KGSLVPR
In one embodiment, the second engineered heterodimer protein comprises one or more covalent dimerization IgG2 hinge domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to IgG2 hinge:
ERKCCVECPPCP
(SEQ Ill NO: 13) (Figures 3, 5, 6 and 8).
In one embodiment, the second engineered heterodimer protein comprises one or more covalent dimerization IgG2 Fc domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 19. (Figures 6 and 8).
IgG2 Fe Domain (SEQ ID NO: 19):
APPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA
KTKPREEQFNS TFRVVS VLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTIS KTKGQPR
EPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIS VEWESNGQPENNYKTTPPMLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALIINHYTQKSLSLSPGK
In one embodiment, the second engineered heterodimer protein comprises one or more linkers comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 966/9, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 11: GGGGSGGGGSGGGGS (Figures 3-8) or to SEQ ID
NO: 21: GGSGGSGGSGGSGG (Figures 5 and 8, CD3 VH-VL linker) or to SEQ ID NO:
22:
SGSGSG (Figures 5 and 8, linker within in CD3-VL) In further embodiments, the second engineered heterodimer protein comprises a His6 tag (HHHHHH; SEQ ID NO: 20).
In certain embodiments, the disclosure provides for a third engineered heterodimer protein which comprises: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein. See Figure 23.
In certain embodiments, antigen-binding fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (bi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment, an isolated CDR, diabodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. In some embodiments, scFv comprises a heavy chain variable region (Vn), and a light chain variable region (VL).
In some embodiments, the non-naturally occurring polypeptide domain comprising 5 alpha helices is 6DMPa (Chen et al. 2019). In some embodiments, the non-naturally occurring polypeptide domain comprising 1-5 alpha helices is 6DMPb (Chen et al. 2019).
In some embodiments, the covalent dimerization domains are IgG2 hinge domains.
In some embodiments, the covalent dimerization domains are IgG2 domains and IgG2 Fc domains. In some embodiments, the Fe domains are CH2 and CH3 domains.
The third engineered heterodimer protein can be designed to place the functional moieties (an antigen-binding fragment that binds a lineage-specific cell-surface antigen, and a polypeptide that binds a molecule expressed on NK cells) in any order. In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen is located at the N-terminus or C-terminus of the fusion polypeptide. In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells is located at the C-terminus or N-S terminus of the fusion polypeptide.
In some embodiments, the third engineered heterodimer protein comprises, from N-terminus to C-terminus, a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19), and a polypeptide that binds a molecule expressed on NK cells (e.g., an anti-CD16 monoclonal antibody). In some embodiments, the fusion polypeptide comprises, from N terminus to C terminus, a polypeptide that binds a molecule expressed on NK
cells (e.g., an anti-CD16 monoclonal antibody) and a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD] 9).
The third engineered heterodimer protein may further comprise a signal sequence, and/or one or more linkers. In the fusion polypeptide, these functional moieties may be covalently ligated continuously or non-continuously (e.g., they may be separated by linkers).
The linker may have up to 50, up to 40, up to 30, up to 20, up to 18, up to 15, up to 12, up to 11, or up to 10, amino acid residues in length. In certain embodiments, the linker has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10-20, 8-10, 8-12, 8-15, 8-20, or 8-30 amino acid residues in length. In certain embodiments, the linker has about 7-10, 7-12, 7-15, 7-20, or 7-30 amino acid residues in length.
One type of derivatized protein is produced by crosslinking two or more polypeptides (of the same type or of different types). Suitable crosslinkers include those that are heterobifunctional, having two distinct reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Useful detectable agents with which a protein can be derivatized (or labeled) include fluorescent agents, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, and radioactive materials. Non-limiting, exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, and phycoerythrin.
A polypeptide can also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, beta-galactosidase, acetylcholinesterase, glucose oxidase and the like. A
polypeptide can also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
The third engineered heterodimer protein can be derivatized or linked to another functional molecule. For example, the third engineered heterodimer protein can be functionally linked (by chemical coupling, genetic fusion, noncovalent interaction) to one or more other molecular entities, such as an antibody or antibody fragment, a detectable agent, an immunosuppressant, a cytotoxic agent, a pharmaceutical agent, a protein or peptide that can mediate association with another molecule (such as a streptavidin core region or a polyhistidine tag), amino acid linkers, signal sequences, immunogenic carriers, or ligands useful in protein purification, such as glutathione-S-transferase, histidine tag, and staphylococcal protein A.
Cytotoxic agents may include radioactive isotopes, chemotherapeutic agents, and toxins such as enzymatically active toxins of bacterial, fungal, plant, or animal origin, and fragments thereof.
The third engineered heterodimer protein may further comprise a fragment (e.g., a tag) useful for polypeptide production and/or detection, including, but not limited to, poly-histidine (e.g., six histidine residues), a maltose binding protein, GST, green fluorescent protein (GFP), hemagglutinin, or alkaline phosphatase, secretion signal peptides preprotyrypsin signal sequence), Myc, and/or FLAG.
In one embodiment, the third engineered heterodimer protein comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 500/c, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 1 (Figure 3) and SEQ ID NO: 26 (Figure 23A) or SEQ ID NO: 4 (Figure 6) and SEQ ID NO: 27 (Figure 23B).
Tn one embodiment, the third engineered heterodimer protein comprises a signal sequence comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to an IL2 secretory signal sequence: MYRMQLLSCIALSLALVTNS (SEQ
ID NO:7) (Figures 3, 4, and 23).
In one embodiment, the third engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 990/c, or about 100%, identical to Myc: EQKLISEEDL (SEQ ID NO: 8) (Figures 3 and 6).
In one embodiment, the third engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to FLAG: DYKDDDDK (SEQ Ill NO: 14) (Figure 23) In one embodiment, the third engineered heterodimer protein comprises an anti-scFv comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the anti-CD33 scFv disclosed in U.S. Patent Publication No.
20130078241.
In one embodiment, the third engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a light chain variable region (VL) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 9 (Figures 3 and 6).
Anti-CD33 Light Chain variable region (VL) (SEQ Ill NO: 9):
EIVLIQSPGSLAVSPGERVTMSCKSSQSVFFSSSQKNYLAWYQQIPGQSPRLLIYWAS
TRESGVPDRFTGSGSGTDFTLTISSVQPEDLAIYYCHQYLSSRTFGQGTKLEIKR
In one embodiment, the third engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a heavy chain variable region (Vri) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ Ill NO: 10 (Figures 3 and 6):
Anti-CD33 Heavy Chain variable region (VI)) (SEQ ID NO: 10):
QVQLQQPGAEVVKPGASVKMSCKASGYTFTSYYTHWIKQTPGQGLEWVGVIYPGND
DISYNQKFQGKATLTADKSSTTAYMQLSSLTSEDSAVYYCAREVRLRYFDVWGQGT
TVTVSSSSSA
In certain embodiments, the polypeptide that hinds a molecule expressed on NK
cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of SEQ ID NOs: 28 and 29.
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD16, where the antigen-binding fragment comprises a heavy chain variable region (VII) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 28 (Figure 23):
Anti-CD16 Heavy Chain variable region (VI)) (SEQ ID NO: 28):
EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNG
GSTGYADSVKGRFTISRDNAKNSLYLQMNSLR AEDT AVYYCARGRSLLFDYWGQG
TLVTVSR
In one embodiment, the third engineered heterodimer protein comprises an antigen-binding fragment that binds CD16, where the antigen-binding fragment comprises a light chain variable region (VL) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 29 (Figure 23).
Anti-CD16 Light Chain variable region (Vii) (SEQ ID NO: 29):
SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGI
PDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVG
In one embodiment, the third engineered heterodimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 12 (Figures 3 and 6).
6DMPa (SEQ ID NO: 12):
GTKEDILERQRKIIERAQEIHRRQQEILEELERIIRKPGSSEEAMKRMLKLLEESLRLLK
ELLELSEESAQLLYEQR
In one embodiment, the third engineered heterodimer protein comprises one or more non-naturally occurring pol ypepti de domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 16 (Figure 23).
6DMPb (SEQ ID NO: 16):
TEKRLLEEAER AHREQKEIIKK A QELHRRLEEIVR QSGS SEEA KKEA KKTLEETRELSK
RSLELLREILYLSQEQKGSLVPR
In one embodiment, the third engineered heterodimer protein comprises one or more covalent dimerization IgG2 hinge domains comprising (or consisting essentially of. or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to IgG2 hinge:
ERKCCVECPPCP
(SEQ ID NO: 13) (Figures 3 and 23).
In one embodiment, the third engineered heterodimer protein comprises one or more covalent dimerization IgG2 Fc domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 19 (Figures 6 and 23).
IgG2 Fc Domain (SEQ ID NO: 19):
APPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA
KTKPREEQFNS TFRVVS VLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTIS KTKGQPR
EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIS VEWE SNGQPENNYKTTPPMLD SD
GSEELYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
In one embodiment, the third engineered heterodimer protein comprises one or more linkers comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 11: GGGGSGGGGSGGGGS (Figures 3, 6, and 23) or to SEQ
ID NO: 30: GGGGSGGGGSGGGGSGGGGS (Figure 23, CD16 VH-VL linker).
In further embodiments, the third engineered heterodimer protein comprises a His6 tag (HHHHHH; SEQ ID NO: 20).
In certain embodiments, the engineered heterotrimer protein comprises: (i) a first polypeptide comprising a polypeptide that binds a molecule expressed on T
cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (al), and a first covalent dimerization domain; and (ii) a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (b1) and a second covalent dimerization domain; and (iii) a third polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (cl), and a third second covalent dimerization domain and (iv) a fourth polypeptide comprising three non- naturally occurring polypeptide domains comprising 1-5 alpha helices connected by amino acid linkers, wherein each domain is the binding domain of al, bl and cl (a2, b2 and c2), and a fourth, fifth and sixth covalent dimerization domain as described herein.
In certain embodiments, antigen-binding fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (hi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment, an isolated CDR, diabodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. In some embodiments, scFv comprises a heavy chain variable region (VH), and a light chain variable region (VL).
In some embodiments, the non-naturally occurring polypeptide domain comprising 5 alpha helices is 6DMPa (Chen et al. 2019). In sonic embodiments, the non-naturally occurring polypeptide domain comprising 1-5 alpha helices is 6DMPb (Chen et al. 2019).
In some embodiments, the covalent dimerization domains are IgG2 hinge domains.
In some embodiments, the covalent dimerization domains are IgG2 domains and IgG2 Fc domains. In some embodiments, the Fc domains are CH2 and CH3 domains.
The engineered heterotrimer protein can be designed to place the functional moieties (an antigen-binding fragment that binds a lineage-specific cell-surface antigen, and a polypeptide that binds a molecule expressed on NK cells, and a polypeptide that binds a molecule expressed on T cells) in any order. In certain embodiments, the polypeptide that binds a molecule expressed on T cells antigen-binding fragment is located at the N-terminus or C-terminus of the fusion polypeptide. In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells is located at the C-terminus or N-terminus of the fusion polypeptide.
In some embodiments, the engineered heterotrimer protein comprises, from N-terminus to C-terminus, a polypeptide that binds a molecule expressed on T cells, a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19) and an ectodomain of ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB) or a polypeptide that binds CD16.
In some embodiments, the fusion polypeptide comprises, from N terminus to C
terminus, an ectodomain of ULBP1 (or an ectodomain of ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB), a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19) and a polypeptide that binds a molecule expressed on T cells.
The engineered heterotrimer protein may further comprise a signal sequence, and/or one or more linkers. In the fusion polypeptide, these functional moieties may be covalently ligated continuously or non-continuously (e.g., they may be separated by linkers (e.g., linker amino acid residues)). The linker may have up to 50, up to 40, up to 30, up to 20, up to 18, up to 15, up to 12, up to 11, or up to 10, amino acid residues in length. In certain embodiments, the linker has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10-20, 8-10, 8-12, 8-15, 8-20, or 8-30 amino acid residues in length. In certain embodiments, the linker has about 7-10, 7-12, 7-15, 7-20, or 7-30 amino acid residues in length.
One type of derivatized protein is produced by crosslinking two or more polypeptides (of the same type or of different types). Suitable crosslinkers include those that are h eterobi fun cti on al , having two distinct reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Useful detectable agents with which a protein can be derivatized (or labeled) include fluorescent agents, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, and radioactive materials. Non-limiting, exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, and, phycoerythrin. A polypeptide can also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, beta-galactosidase, acetylcholinesterase, glucose oxidase and the like. A
polypeptide can also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
The engineered heterotrimer protein can be derivatized or linked to another functional molecule. For example, heterotrimer protein can be functionally linked (by chemical coupling, genetic fusion, noncovalent interaction, etc.) to one or more other molecular entities, such as an antibody or antibody fragment, a detectable agent, an inamunosuppressant, a cytotoxic agent, a pharmaceutical agent, a protein or peptide that can mediate association with another molecule (such as a streptavidin core region or a polyhistidine tag), amino acid linkers, signal sequences, immunogenic carriers, or ligands useful in protein purification, such as glutathione-S-transferase. histidine tag, and staphylococcal protein A. Cytotoxic agents may include radioactive isotopes, chemotherapeutic agents, and toxins such as enzymatically active toxins of bacterial, fungal, plant, or animal origin, and fragments thereof.
The engineered heterotrimer protein may further comprise a fragment (e.g., a tag) useful for polypeptide production and/or detection, including, but not limited to, poly-histidine (e.g., six histidine residues), a maltose binding protein, GST, green fluorescent protein (GFP), hemagglutinin, or alkaline phosphatase, secretion signal peptides (e.g., preprotyrypsin signal sequence), Myc, and/or FLAG.
In one embodiment, the engineered heterotrimer protein comprises one or more signal sequences comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to an 1L2 secretory signal sequence: MYRMQLLSCIALSLALVTNS (SEQ
ID NO:7) (Figures 3-8).
In one embodiment, the engineered heterotrimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to Myc: EQKLISEEDL (SEQ ID NO: 8) (Figures 3 and 6).
In one embodiment, the engineered heterotrimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%. at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to FLAG: DYKDDDDK (SEQ ID NO: 14) (Figures 4, 5, 7 and 8) In one embodiment, the engineered heterotrimer protein comprises a ULBP1 ectodomain comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 15 (Figures 4 and 7).
In one embodiment, the engineered heterotrimer protein comprises an anti-CD33 scFv comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the anti-CD33 scFv disclosed in U.S. Patent Publication No.
20130078241.
In certain embodiments, the polypeptide that binds a molecule expressed on NK
cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of SEQ ID NOs: 28 and 29 (Figure 23).
In one embodiment, the engineered heterotrimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a light chain variable region (VL) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 9 (Figures 3 and 6).
In one embodiment, the engineered heterotrimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a heavy chain variable region (VH) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 820/c, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 10 (Figures 3 and 6):
In certain embodiments, the polypeptide that binds a molecule expressed on T
cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of SEQ ID NOs: 17 and 18 (Figures 5 and 8).
In one embodiment, the engineered heterotrimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least at about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 12 (Figures 3 and 6).
In one embodiment, the engineered heterotrimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 16 (Figures 5 and 8).
In one embodiment, the engineered heterotrimer protein comprises one or more covalent dimerization IgG2 hinge domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to IgG2 hinge:
ERKCCVECPPCP
(SEQ Ill NO: 13) (Figures 3-8).
In one embodiment, the engineered heterotrimer protein comprises one or more covalent dimerization IgG2 Fc domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 19. (Figures 6-8).
In one embodiment, the engineered heterotrimer protein comprises one or more linkers comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%. at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 11 GGGGSGGGGSGGGGS (Figures 3, 5, 6, and 8) or to SEQ
ID
NO: 21 GGGGGSGGSGGSGG or to SEQ ID NO: 22 SGSGSG (Figures 5 and 8) In further embodiments, the engineered heterotrimer protein comprises a His6 tag (HHHHHH; SEQ Ill NO: 20).
In some embodiments, the third polypeptide is a chemokine or cytokine protein, which increases the immune response. The chemokine or cytokine protein includes but is not limited to CXCLs including CXCL14, GCSF, and interleukins, including IL2 and ILI 6.
Shown herein is that the disclosed engineered proteins bind to and are cytotoxic against cells expressing CD33, such as HL60 and MOLM cells. Also shown is that when expression is increased in a cell, the binding efficiency of the engineered protein increases.
Additionally, the cytotoxicity of the engineered protein increases in cells such as MOLM, where CD33 expression is increased.
In certain embodiments, the antigen-binding fragment that hinds a lineage-specific cell-surface antigen (e.g., CD33) is a derivative, or a modified form, or a variant, of a fragment of the wildtype antigen-binding fragment.
In certain embodiments, the polypeptidc that binds a molecule expressed on natural killer (N K) cells is a derivative, or a modified form, or a variant, of a fragment of the wildtype polypeptide.
In certain embodiments, the polypeptide that binds a molecule expressed on T
cells is a derivative, or a modified form, or a variant, of a fragment of the wildtype polypeptide.
As used herein, the term variant also denotes any peptide, pseudopeptide (peptide incorporating non-biochemical elements) or protein differing from the wildtype protein or peptide, obtained by one or more genetic and/or chemical modifications.
Genetic and/or chemical modification may he understood to mean any mutation, substitution, deletion, addition and/or modification of one or more residues of the protein or peptide considered.
Chemical modification may refer to any modification of the peptide or protein generated by chemical reaction or by chemical grafting of biological or non-biological molecule(s) onto any number of residues of the protein.
The present polypeptides or peptides may include variants, analogs, orthologs, homologs and derivatives of amino acids or peptides. The present polypeptides or peptides may contain one or more analogs of amino acids (including, for example, non-naturally occurring amino acids, amino acids which only occur naturally in an unrelated biological system, modified amino acids etc.), peptides with substituted linkages, as well as other modifications known in the art. The present polypeptides or peptides may comprise a peptidomimetic, such as a peptoid. The present polypeptides or peptides may contain one or more amino acid residues modified by, e.g., glycosylation, acylation (e.g., acetylation, formylation, myristoylation, palmitoylation, lipoylation), alkylation (e.g., methylation), isoprenylation or prenylation (e.g., farnesylation, geranylgeranylation), sulfation, amidation, hydroxylation, succinylation, etc. The present polypeptides and agents may be glycosylated, sulfonated and/or phosphorylated and/or grafted to complex sugars or to a lipophilic compound such as, for example, a polycarbon chain or a cholesterol derivative.
Lineage-Specific Cell-Surface Antigens Aspects of the disclosure provide agents targeting a lineage-specific cell-surface antigen, for example on a target cancer cell. Such an agent may comprise an antigen-binding fragment that binds and targets the lineage-specific cell-surface antigen. In some instances, the antigen-binding fragment can be a single chain antibody (scFv) specifically binding to the lineage-specific antigen. As used herein, the terms "lineage-specific cell-surface antigen"
and "cell-surface lineage-specific antigen" may be used interchangeably and refer to any antigen that is sufficiently present on the surface of a cell and is associated with one or more populations of cell lineage(s). For example, the antigen may be present on one or more populations of cell lineage(s) and absent (or at reduced levels) on the cell-surface of other cell populations.
In general, lineage-specific cell-surface antigens can be classified based on a number of factors such as whether the antigen and/or the populations of cells that present the antigen are required for survival and/or development of the host organism. A summary of exemplary types of lineage-specific antigens is provide in Table 1 below.
Table 1. Classification of Lineage Specific Antigens Type of Lineage Characteristics of the Lineage Specific Antigen Specific Antigen Type 0 a) antigen is required for survival of an organism and b) cell type carrying type 0 antigen is required for survival of an organism and is not unique to a tumor, or tumor-associated virus Type 1 a) antigen is not required for survival of an organism and b) cell type carrying type 1 antigen is not required for survival of an organism Type 2 a) antigen is not required for survival of an organism and b) cell type carrying type 2 antigen is required for the survival of an organism Type 3 a) antigen is not required for the survival of an organism and b) cell type carrying antigen is not required for survival of an organism c) The antigen is unique to a tumor, or a tumor associated virus.
An example is the LMP-2 antigen in EBV infected cells, including EBV infected tumor cells (Nasopharyngeal carcinoma and Burldtts Lymphoma) Lineage specific antigens of type 1 class may be expressed in a wide variety of different tissues, including, ovaries, testes, prostate, breast, endometrium, and pancreas. In some embodiments, the agent targets a cell-surface lineage-specific antigen that is a type 1 antigen.
In some embodiments, the agent targets a cell-surface lineage-specific antigen that is a type 2 antigen. For example, CD33 is a type 2 antigen expressed in both normal myeloid cells as well as in Acute Myeloid Leukemia (AML) cells (Dohner et al.2015).
A wide variety of antigens may be targeted by the methods and compositions of the present disclosure. Monoclonal antibodies to these antigens may be purchased commercially or generated using standard techniques, including immunization of an animal with the antigen of interest followed by conventional monoclonal antibody methodologies, e.g., the standard somatic cell hybridization technique of Kohler and Milstein, Nature (1975) 256: 495, as discussed above. The antibodies or nucleic acids encoding for the antibodies may be sequenced using any standard DNA or protein sequencing techniques.
In some embodiments, the cell-surface lineage-specific antigen that is targeted using the methods and compositions described herein is a cell-surface lineage-specific antigen of leukocytes or a subpopulation of leukocytes. In some embodiments, the cell-surface lineage-specific antigen is an antigen that is associated with myeloid cells. In some embodiments, the cell-surface lineage-specific antigen is a cluster of differentiation antigens (CDs). Examples of CD antigens include, without limitation, CD1a, CD1b, CD1c, CD1d, CD1e, CD2, CD3, CD3d, CD3e, CD3g, CD4, CD5, CD6, CD7, CD8a, CD8b, CD9, CD10, CD11a, CD11b, CD1 lc, CD11d, Cllw12, CD13, CD14, CD15, CD16, CD16b, CD17, CD18, CD19, C1120, CD21, CD22, CD23, CD24, CD25, CD26, CD27, CD28, CD29, CD30, CD31, CD32a, CD32b, CD32e, CD33, CD34, CD35, CD36, CD37, CD38, CD39, CD40, CD41, CD42a, CD42b, CD42c, CD42d, CD43, CD44, CD45, CD45RA, CD45RB, CD45RC, CD45RO, CD46, CD47, CD48, CD49a, CD49b, CD49c, CD49d, CD49e, CD49f, CD50, CD51, CD52, CD53, CD54, CD55, CD56, CD57, CD58, CD59, CD60a, CD61, CD62E, CD62L, CD62P, CD63, CD64a, CD65, CD65s, CD66a, CD66b, CD66c, CD66F, CD68, CD69, CD70, CD71, CD72, CD73, CD74, CD75, CD75S, CD77, CD79a, CD79b, CD80, CD81, CD82, CD83, CD84, CD85A, CD85C, CD85D, CD85E, CD85F, CD85G, CD85H, CD85I, CD85J, CD85K, CD86, CD87, CD88, CD89, CD90, CD91 , CD92, CD93, CD94, CD95. CD96, CD97, CD98, CD99, CD99R, CD100, CD101, CD102, CD103, CD104, CD105, CD106, CD107a, CD107b, CD108, CD109, CD110, CD111, CD112, CD113, CD114, CD115, CD116, CD117, CD118, CD119, CD120a, CD120b, CD121a, CD121b, CD121a, CD121b, CD122, CD123, CD124, CD125, CD126, CD127, CD129, CD130, CD131, CD132, CD133, CD134, CD135, CD136, CD137, CD138, CD139, CD140a, CD140b, CD141, CD142, CD143, CD144, CDw145, CD146, CD147, CD148, CD150, CD152, CD152, CD153, CD154, CD155, CD156a, CD156b, CD156c, CD157, CD158b1, CD158b2, CD158d, CD158e1/e2, CD158f, CD158g, CD158h, CD158i, CD158j, CD158k, CD159a, CD159c, CD160, CD161, CD163, CD164, CD165, CD166, CD167a, CD168, CD169, CD170, CD171, CD172a, CD172b, CD172g, CD173, CD174, CD175, CD175s, CD176, CD177, CD178, CD179a, CD179b, CD180, CD181, CD182, CD183, CD184, CD185, CD186, CD191, CD192, CD193, CD194, CD195, CD196, CD197, CDw198, CDw199, CD200, CD201, CD202b, CD203c, CD204, CD205, CD206, CD207, CD208, CD209, CD210a, CDw210b, CD212, CD213a1, CD213a2, CD215, CD217, CD218a, CD218b, CD220, CD221, CD222, CD223, CD224, CD225, CD226, CD227, CD228, CD229, CD230, CD231, CD232, CD233, CD234, CD235a, CD235b, CD236, CD236R, CD238, CD239, CD240, CD241, CD242, CD243, CD244, CD245, CD246, CD247, CD248, CD249, CD252, CD253, CD254, CD256, CD257, CD258, CD261, CD262, CD263, CD264, CD265, CD266, CD267, CD268, CD269, CD270, CD271, CD272, CD273, CD274, CD275, CD276, CD277, CD278, CD279, CD280, CD281, CD282, CD283, CD284, CD286, CD288, CD289, CD290, CD292, CDw293, CD294, CD295, CD296, CD297, CD298, CD299, CD300a, CD300c, CD300e, CD301, CD302, CD303, CD304, CD305, 306, CD307a, CD307b, CD307c, D307d, CD307e, CD309, CD312, CD314, CD315, CD316, CD317, CD318, CD319, CD320, CD321, CD322, CD324, CD325, CD326, CD327, CD328, CD329, CD331, CD332, CD333, CD334, CD335, CD336, CD337, CD338, CD339, CD340, CD344, CD349, CD350, CD351, CD352, CD353, CD354, CD355, CD357, CD358, CD359, CD360, CD361, CD362 and CD363.
In some embodiments, the cell-surface lineage-specific antigen is CD19, CD20, CD11, CD123, CD56, CD34, CD14, CD33, CD66b, CD41, CD61, CD62, CD235a, CD146, CD326, LMP2, CD22, CD52, CD10, CD3/TCR, CD79/BCR, and CD26. In some embodiments, the cell-surface lineage-specific antigen is CD33 or CD19.
Alternatively or in addition, the cell-surface lineage-specific antigen may be a cancer antigen, for example a cell-surface lineage-specific antigen that is differentially present on cancer cells. In some embodiments, the cancer antigen is an antigen that is specific to a tissue or cell lineage. Examples of cell -surface lineage-specific antigen that are associated with a specific type of cancer include, without limitation. CD20, CD22 (Non-Hodgkin's lymphoma, B-cell lymphoma, chronic lymphocytic leukemia (CLL)), CD52 (B-cell CLL), CD33 (Acute myelogenous leukemia (AML)). CD10 (gp100) (Common (pre-B) acute lymphocytic leukemia and malignant melanoma), CD3/T-cell receptor (TCR) (T-cell lymphoma and leukemia), CD79/B-cell receptor (BCR) (B-cell lymphoma and leukemia), CD26 (epithelial and lymphoid malignancies), human leukocyte antigen (HLA)-DR, HLA-DP, and HLA-DQ (lymphoid malignancies), CD307e and BCMA (myeloma), RCAS1 (gynecological carcinomas, biliary adenocarcinomas and ductal adenocarcinomas of the pancreas), C1audin3, TMPRSS3 and Her2 (ovarian cancer), Hcr2 (breast cancer) as well as prostate specific membrane antigen. In some embodiments, the cell-surface antigen CD33 and is associated with AML cells.
In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33) has up to or about 500, up to or about 490, up to or about 480, up to or about 470, up to or about 460, up to or about 450, up to or about 440, up to at about 430, up to or about 420, up to or about 410, up to or about 400, up to or about 390, up to or about 380, up to or about 370, up to or about 360, up to or about 350, up to or about 340, up to or about 330, up to or about 320, up to or about 310, up to or about 200, up to or about 190, up to or about 180, up to or about 170, up to or about 160, up to or about 150, up to or about 140, up to or about 130, up to or about 120, up to or about 110, up to or about 100, up to or about 90, up to or about 80, up to or about 70, up to or about 60, up to or about 50, up to or about 40, up to or about 30, up to or about 20, up to or about 15, or up to or about 10, amino acid residues in length. In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33) has about 100-200, 80-210, 80-250, 150-250, 100-30, 50-200, 150-250, 150-300, 300-400, 200-400, 400-500, or 150-190 amino acid residues in length.
NK cell surface receptor-bindin2 peptides In certain embodiments, the present fusion polypeptide or composition comprises a polypeptide that binds to a molecule expressed on natural killer (NK) cells, such as a C-type lectin-like receptor (e.g., NKG2D).
A C-type lectin-like NK cell receptor may be a receptor expressed on the surface of natural killer cells. Exemplary NK cell receptors of this type include, but are not limited to, NKG2D (GENBANK accession number BC039836), Dectin-1 (GENBANK accession number AJ312373 or AJ312372), Mast cell function-associated antigen (GENBANK
accession number AF097358), HNKR-PlA (GENBANK accession number U11276), LLT1 (GENBANK
accession number AF133299), CD69 (GENBANK accession number NM_001781), CD69 homolog, CD72 (GENBANK accession number NM_001782), CD94 (GENBANK accession number NM_002262 or NM_007334), KLRF1 (GENBANK accession number NM_016523), Oxidised LDL receptor (GENBANK accession number NM 002543), CLEC-1, CLEC-2 (GENBANK accession number NM 016509), NKG2C (GENBANK accession number AJ001684), NKG2A (GENBANK accession number AF461812), NKG2E (GENBANK
accession number AF461157), WUGSC:H_DJ0701016.2. or Myeloid DAP12-associating lectin (MDL-1; GENBANK accession number AJ271684). In particular embodiments, the NK
cell receptor is human NKG2D or human NKG2C.
As used herein, the terms "Natural Killer Group 2D", "NKG2D" and "NKG2D
receptor", also known as KLRK1, refer to an activating cell surface molecule that is found on numerous types of immune cells, particularly NK cells, CD8+ T cells, some CD4+
T cells, and gamma delta T cells. The terms NKG2D and NKG2D receptor include variants, isoforms, and homologs of human NKG2D receptor (see, e.g., the isoforms described in Diefenbach et al., Nat Immunol. (2002) 3(12):1142-9). NKG2D is a type II transmembrane protein with an extracellular C-type (i.e., Ca2'-binding) lectin-like domain but lacking the Ca2 binding site. It can form heterodimers with adapter proteins such as DAP10 Or DAP12, and recognizes protein ligands that include, but are not limited to, MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, and ULBP6.
In certain embodiments, the NKG2D-binding peptide is an agonist of NKG2D. In certain embodiments, the NKG2D-binding peptide is an antagonist of NKG2D. In certain embodiments, the NKG2D-binding peptide is neither an antagonist nor an agonist of NKG2D.
The polypeptide that binds a molecule expressed on NK cells may be a ligand for a NK
cell surface receptor, such as a ligand for the N KG2D cell surface receptor.
Non-limiting examples of the ligands for NKG2D (or the NKG2D ligands) include, an MHC class I chain-related (MIC) antigen such as MICA and MICB. a UL16 binding protein (ULBP) such as ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, and the like (Bahram Adv. Immunol.
(2000) 76:1-60; Cerwenka and Lanier Immunol. Rev. (2001) 181:158-169; Cosman, et al.
Immunity (2001) 14:123-133; Kubin, et al. Eur. J. Immunol. (2001) 31:1428-1437). Murine NKG2D ligands include, for example, the retinoic acid early inducible-1 gene products (RAE-1) and minor hi stocompatibility antigen peptide H60. NK cells can be regulated by interaction of immunomodulating polypeptide ligands with receptors on the NK cell surface.
For example, ligands for the NKG2D receptor that can regulate NK cell activity, include chemokines such as muCCL21, and stress-inducible polypeptide ligands such as MHC class I chain-related antigens and ULL16 binding proteins. Murine H60 minor histocompatibility antigen peptide is reported to bind to the NKG2D receptor, as well. See, e.g., Robertson et al.
Cell Immunol.
(2000) 199(1):8-14; Choi et al. Immunity (2002) 17(5):593-603, and Farag et al., Blood. (2002) 100(6):1935-1947. As used herein, the term "NKG2D ligand" refers to a binding partner that binds specifically to an NKG2D receptor. Exemplary ligands include MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBPS, ULBP6, and functional fragments thereof, such as soluble forms of MIC and ULBP proteins.
Table 2 lists exemplary NKG2D binding proteins and domains.
Table 2. NKG2D binding proteins and domains Protein Gene names Uniport NKG2D
ID binding domain*
UL16-binding protein ULBP1/RAET1I Q9BZM6 27-216 UL16-binding protein ULBP2/RAET1H Q9BZM5 26-217 UL16-binding protein ULBP3/RAET1N Q9BZM4 30-217 UL16-binding protein ULBP4/RAET1E Q8TD07 31-225 UL-16 binding protein ULBP5/RAET1G Q6H3X3 26-223 UL16-binding protein ULBP6/RAET1L Q5VY80 26-218 MHC class I MICA Q29983 24-307 polypeptide-related sequence A
MHC class I MICB Q29980 23-309 polypeptide-related sequence B
Retinoic acid early-inducible protein 1-alpha Raet 1 a 008602 29-229 Retinoic acid early-inducible protein 1-beta Raetlb 008603 29-229 Retinoic acid early-inducible protein 1-gamma Ractic 008604 29-227 Retinoic acid early-inducible protein 1-delta Raetld Q9JI58 29-225 Retinoic acid early-inducible protein 1-epsilon Raetle Q9CZQ6 29-225 Histocompatibility antigen 60h H60b B1B212 25-251 Histocompatibility antigen 60c H60c B1B213 18-177 * The start and end amino acids numbers are based on the sequence of protein identified by the uniport ID.
The MIC and ULBP proteins act as ligands that bind to C-type lectin-like activating receptor Natural Killer Group 2D (NKG2D) on immune effector cells, including NK cells, NKT cells, alpha beta CD8+ T cells, and gamma delta CD8+ T cells.
As used herein, the term "ULBP protein" refers to members of the MHC class I-related molecules having a characteristic organization for the unprocessed protein that includes a N-terminal signal sequence, centrally located alpha-1 and alpha-2 domains, and a C-terminal cell membrane association domain, which can be a glycosylphosphatidylinositol (GPI) anchoring domain or a transmembrane domain. Some species of ULBP protein have a cytoplasmic domain. Generally, ULBP proteins have weak amino acid sequence identity to MI
C A/MICB
proteins. ULBP family members are ligands for the effector cell receptor NKG2D, and are known to activate NK cells. As used herein. "ULBP protein" includes active variants, isoforms, and species homologs of human ULBP protein, and includes fragments having receptor binding activity.
As used herein, the term "ULBP1", also described as "retinoie acid early transcript 1 protein" or "RAET1", refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP1. The protein functions as a ligand for receptor NKG2D. ULBP1 protein activates multiple signaling pathways in primary NK cells.
The C terminal membrane association domain in ULBP1 comprises a GPI domain.
ULBP1 is weakly homologous with MICA and MICB and has about 55% to 60% amino acid sequence identity to ULBP2 and ULBP3. Exemplary sequence of human ULBP1 is available as NCBI
accession no. NP_079494.1. DNA and protein sequences for human ULBP1 have been reported by Cosman et al., Immunity (2001) 14(2):123-133, DNA Accession No.
AF304377 in the EMBL database of the European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK.
As used herein, the term "ULBP2", also described as "retinoic acid early transcript 1H
protein" or "RAET1H", refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP2. The protein functions acts as a ligand for receptor NKG2D. ULBP2 activates multiple signaling pathways in primary NK
cells. The C
terminal membrane association domain in ULBP2 comprises a GPI domain. ULBP2 is weakly homologous with MICA and MICB and has about 55% and 60% amino acid sequence identity to ULBP1 and ULBP3. Exemplary sequence of human ULBP2 is available as NCBI
accession no. NP_079493.1. DNA and protein sequences for human ULBP2 have been reported by Cosman et al., Immunity (2001) 14(2):123-133, DNA Accession No. AF304378 in the EMBL
database of the European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK.
As used herein, the term "ULBP3", also described as "retinoic acid early transcript 1N
protein" or "RAET1N", refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP3. The protein functions as a ligand for receptor NKG2D. The C terminal membrane association domain in ULBP2 comprises a GPI
anchoring domain. ULBP3 activates multiple signaling pathways in primary NK
cells. ULBP3 is weakly homologous with MICA and MICB. Exemplary sequence of human ULBP3 is available as NCBI accession no. NP_078794.1. DNA and protein sequences for ULBP3 have been reported by Cosman et al., Immunity (2001) 14(2):123-133, DNA Accession No.
AF304379 in the EMBL database of the European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK.
As used herein, the term "ULBP4", also described as "retinoic acid early transcript lE
protein" or "RAET1E'', refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP4. The protein functions as a ligand for receptor NKG2D. The C terminal region of ULBP4 comprises a transmembrane domain and a cytoplasmic domain, (see, e.g., U.S. patent publication US20090274699). ULBP4 is involved in activating NK cells through its binding to receptor NKG2D and induces NK-mediated lysis (see, e.g., Kong et al., Blood (2009) 114(2):310-17). ULBP4 has higher sequence identity to ULBP3 than ULBP1 and ULBP2. Exemplary amino acid sequences of human ULBP4 are available as NCBI accession nos. NP_001230254.1; NP 001230256.1; NP
001230257.1; and NP 631904.1. As used herein, the term "ULBP5", also described as ''retinoic acid early transcript 1G protein" or "RAET1G", refers to a member of the MHC class I
family, including variants, isoforms, and species homologs of human ULBP5. The C-terminal region of the protein has a transmembrane domain and a cytoplasmic domain. ULBP5 is involved in activating NK cells and NK cell-mediated cytotoxicity through its binding to receptor NKG2D.
Exemplary sequence of human ULBP5 is available as NCBI accession no.
NP_001001788.2.
As used herein, the term "ULBP6", also described as "retinoic acid early transcript 1L
protein" or "RAET1L'', refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP6. ULBP6 contains a GPI anchoring domain, similar to ULBP1, ULBP2, and ULBP3. ULBP6 is involved in activating NK cells and NK
cell mediated cytotoxicity through its binding to receptor NKG2D. Exemplary sequence of human ULBP6 is available as NCBI accession no. NP_570970.2.
As with MICA and MICB, a known function of ULBP proteins is binding to NKG2D
receptor and activating NK cell activity.
MICA is MHC class 1 chain-related gene A protein (MICA), including variants, isoforms, and homologs of human MICA, and includes fragments of MICA having functional MICA activity. MICA protein comprises three extracellular Ig-like domains, i.e., alpha-1, alpha-2 and alpha-3, a transmembrane domain, and an intracellular domain. The protein is expressed at low levels in cells of the gastric epithelium, endothelial cells and fibroblasts and in the cytoplasm of keratinocytes and monocytes. An exemplary sequence of MICA
is available as NCBI Accession Nos. NP_000238.1. Other exemplary MICA sequences can be found in U.S. patent publication 20110311561.
MICB is MHC class I chain-related gene B protein (MICB), including variants, isoforms, and homologs of human MICB, and includes fragments of MICE having functional MICB activity. MICB has about 84% sequence identity to MICA. MICB protein comprises three extracellular Ig-like domains, i.e., alpha-1, alpha-2 and alpha-3, a transmembrane domain, and an intracellular domain. An exemplary sequence of MICB is available as UniProtKB accession number Q29980.1. Other exemplary MICB sequences can be found in U.S. patent publication 20110311561.
The NKG2D ligands (ligands for the NKG2D receptor) may also include an anti-NKG2D antibody or its fragment (e.g., an antigen-binding portion or fragment thereof), including, but not limited to, all or part of antibody that specifically recognizes or binds to NKG2D. Such antibodies can be monoclonal or polyclonal antibodies. Antibodies can also be variant antibodies, such as chimeric antibodies, humanized antibodies, single chain antibodies, and hybrid antibodies comprising immunoglobulin chains capable of binding NKG2D. in particular embodiments, the antibody comprises a single chain variable fragment. In particular embodiments, the antibody is 16F16, 16F31, MS, or 21F2, as set forth in U.S.
Pat. No.
7,879,985, which is hereby incorporated by reference. The antibody fragment can be any suitable fragment as discussed herein.
In certain embodiments, the hetero protein or composition comprises a polypeptide that binds to a molecule expressed on natural killer (NK) cells that is CD16.
Such a polypeptide may comprise an antigen-binding fragment that binds and targets the molecule expressed on NK cells. In some instances, the antigen-binding fragment can be a single chain antibody (scFv) specifically binding to the molecule expressed on NK cells A wide variety of antigens may be targeted by the methods and compositions of the present disclosure. Monoclonal antibodies to these antigens may be purchased commercially or generated using standard techniques, including immunization of an animal with the antigen of interest followed by conventional monoclonal antibody methodologies, e.g., the standard somatic cell hybridization technique of Kohler and Milstein, Nature (1975) 256: 495, as discussed above. The antibodies or nucleic acids encoding for the antibodies may be sequenced using any standard DNA or protein sequencing techniques.
In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells has up to or about 500, up to or about 490, up to or about 480, up to or about 470, up to or about 460, up to or about 450, up to or about 440, up to or about 430, up to or about 420, up to or about 410, up to or about 400, up to or about 390, up to or about 380, up to or about 370, up to or about 360, up to or about 350, up to or about 340, up to or about 330, up to or about 320, up to or about 310, up to or about 200, up to or about 190, up to or about 180, up to or about 170, up to or about 160, up to or about 150, up to or about 140, up to or about 130, up to or about 120, up to or about 110, up to or about 100, up to or about 90, up to or about 80, up to or about 70, up to or about 60, up to or about 50, up to or about 40, up to or about 30, up to or about 20, up to or about 15, or up to or about 10, amino acid residues in length. In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells has about 100-200, 80-210, 80-250, 150-250, 100-30, 50-200, 150-250, 150-300, or 150-190 amino acid residues in length.
Molecules Expressed on T cells Aspects of the disclosure provide agents targeting a molecule expressed on T
cells.
Such an agent may comprise an antigen-binding fragment that binds and targets the molecule expressed on T cells. In some instances, the antigen-binding fragment can be a single chain antibody (scFv) specifically binding to the molecule expressed on T cells A wide variety of antigens may be targeted by the methods and compositions of the present disclosure. Monoclonal antibodies to these antigens may be purchased commercially or generated using standard techniques, including immunization of an animal with the antigen of interest followed by conventional monoclonal antibody methodologies, e.g., the standard somatic cell hybridization technique of Kohler and Milstein, Nature (1975) 256: 495, as discussed above. The antibodies or nucleic acids encoding for the antibodies may be sequenced using any standard DNA or protein sequencing techniques.
In certain embodiments, the antigen-binding fragment that binds a molecule expressed on T cells lineage-specific cell-surface antigen (e.g., CD3) has up to or about 500, up to or about 490, up to or about 480, up to or about 470, up to or about 460, up to or about 450, up to or about 440, up to or about 430, up to or about 420, up to or about 410, up to or about 400, up to or about 390, up to or about 380, up to or about 370, up to or about 360, up to or about 350, up to or about 340, up to or about 330, up to or about 320, up to or about 310, up to or about 200, up to or about 190, up to or about 180, up to or about 170, up to or about 160, up to or about 150, up to or about 140, up to or about 130, up to or about 120, up to or about 110, up to or about 100, up to or about 90, up to or about 80, up to or about 70, up to or about 60, up to or about 50, up to or about 40, up to or about 30, up to or about 20, up to or about 15, or up to or about 10, amino acid residues in length. In certain embodiments, the antigen-binding fragment that binds a molecule expressed on T cells (e.g., CD3) has about 100-200, 80-210, 80-250, 150-250, 100-30, 50-200, 150-250, 150-300, 300-400, 200-400, 400-500, or 150-190 amino acid residues in length.
Non-Naturally Occurring Polypeptide Domain Aspects of the disclosure use a 6DMP heterodimer approach which is based on four helices _________________________________________________________________________ in some heterodimer designs, each protein monomer has two helices, in others, 3-to-1-which create four binding networks along the helix that ultimately favor only a heterodimer forming this network. The 6DMP heterodimerization network generates three hydrogen-bond networks and one hydrophobic core. The four helices are separated into two protein sequences, with each contributing two helices. The highly-specific four-helix structure forms only heterodimers between its partner proteins. It is known to be useful in facilitating intranuclear processes but has not been tested as a facilitator of cell-to-cell interactions.
In some embodiments, the non-naturally occurring polypcptide domain comprising 5 alpha helices is 6DMPa (SEQ ID NO: 12). In some embodiments, the non-naturally occurring polypeptide domain comprising 1-5 alpha helices is 6DMPh (SEQ ID NO:
16).
See Chen et al. 2019, incorporated in its entirety by reference herein.
Antigen-Binding Fragment The antigen-binding fragment may be an antibody fragment. The antibody or antibody fragment may be any of the immunoglobulin classes (e.g., IgA, IgD, IgE, IgG, and IgM) and subclasses, so long as they are capable of binding. In certain embodiments, the antibody fragment has an antigen-binding portion. In certain embodiments, antibody fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (bi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment (e.g., Ward et al., Nature, (1989) 341:544-546), an isolated CDR, diabodies, affibodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. Single chain antibodies produced by joining antibody fragments using recombinant methods, or a synthetic linker, are also encompassed by the present disclosure. Bird et al. Science, (1988), 242:423-426. Huston et al., Proc. Natl. Acad. Sci. USA. (1988), 85:5879-5883. Antibody fragments comprise only a portion of an intact antibody, generally including an antigen binding site of the intact antibody and thus retaining the ability to bind antigen. Examples of antibody fragments encompassed by the present invention include: the Fab fragment, having a light chain variable domain (VL), light chain constant domain (CL), heavy chain variable domain (VH), and heavy chain constant domain (CH); the Fab' fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the Cu domain; the Fd fragment having VH and Cu domains;
the Fd' fragment having VH and CH domains and one or more cysteine residues at the C-terminus of the CH domain; the Fv fragment having the VL and VH domains of a single arm of an antibody;
the dAb fragment (Ward et al., Nature (1989) 341:544-546) which consists of a VH domain;
isolated CDR regions; F(ab')2 fragments, a bivalent fragment including two Fab' fragments linked by a disulphide bridge at the hinge region; single chain antibody molecules (Bird et al., Science (1988) 242:423-426; and Huston et al., PNAS (1988) 85:5879-5883;
diabodies with two antigen binding sites, comprising a VH domain connected to a VL domain in the same polypeptide chain (see, e.g., WO 93/11161 to Whitlow et al. and Hollinger et al., PNAS (1993) 90:6444-6448; affibodies which are triple helix high affinity peptides (see, e.g., Nygren, "FEBS
Journal (2008) 275:2668-2676,), and linear antibodies comprising a pair of tandem Fd segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., Protein Eng. (1995) 8(10):1057-1062;
U.S. Patent No. 5,641,870; U.S. Patent No. 8,580,755).
Any antibody or an antigen-binding fragment thereof can he used for constructing the agent that targets a lineage-specific cell-surface antigen as described herein. Such an antibody or antigen-binding fragment can be prepared by a conventional method, for example, the hybridoma technology or recombinant technology.
For example, antibodies specific to a lineage-specific antigen of interest can be made by the conventional hybridoma technology. The lineage-specific antigen, which may be coupled to a carrier protein such as KLH, can be used to immunize a host animal for generating antibodies binding to that complex. The route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein. General techniques for production of mouse, humanized, and human antibodies are known in the art and are described herein.
It is contemplated that any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human hybridoma cell lines. Typically, the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of immunogen, including as described herein.
Hybridomas can be prepared from the lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C. (1975) Nature 256:495-497 or as modified by Buck, et al., In Vitro, (1982)18:377-381.
Available myeloma lines, including but not limited to X63-Ag8.653 and those from the Salk Institute, Cell Distribution Center, San Diego, Calif., USA, may be used in the hybridization. Generally, the technique involves fusing myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art. After the fusion, the cells are separated from the fusion medium and grown in a selective growth medium, such as hypoxanthine-aminopterin-thymidine (HAT) medium, to eliminate unhybridized parent cells. Any of the media described herein, supplemented with or without scrum, can be used for culturing hybridomas that secrete monoclonal antibodies. As another alternative to the cell fusion technique, EB V immortalized B cells may be used to produce the TCR-like monoclonal antibodies described herein. The hybridomas are expanded and subcloned, if desired, and supernatants are assayed for anti-immunogen activity by conventional immunoassay procedures (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).
Hybridomas that may be used as source of antibodies encompass all derivatives, progeny cells of the parent hybridomas that produce monoclonal antibodies capable of binding to a lineage-specific antigen. Hyhridomas that produce such antibodies may be grown in vitro or in vivo using known procedures. The monoclonal antibodies may be isolated from the culture media or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired. Undesired activity if present, can be removed, for example, by running the preparation over adsorbents made of the immunogen attached to a solid phase and eluting or releasing the desired antibodies off the immunogen. Immunization of a host animal with a target antigen or a fragment containing the target amino acid sequence conjugated to a protein that is immunogenic in the species to be immunized, e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor using a bifunctional or derivatizing agent, for example maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, succinic anhydride, SOC1, or R1N=C=NR, where R and R1 are different alkyl groups, can yield a population of antibodies (e.g., monoclonal antibodies).
If desired, an antibody of interest (e.g., produced by a hybridoma) may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation. The sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use. In an alternative, the polynucleotide sequence may be used for genetic manipulation to "humanize"
the antibody or to improve the affinity (affinity maturation), or other characteristics of the antibody. For example, the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans. It may be desirable to genetically manipulate the antibody sequence to obtain greater affinity to the lineage-specific antigen. It will be apparent to one of skill in the art that one or more polynucleotide changes can be made to the antibody and still maintain its binding specificity to the target antigen.
In other embodiments, fully human antibodies can be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins.
Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are XenomouseRTM from Amgen, Inc.
(Fremont, Calif.) and HuMAb-MouseRTm and TC MouseTm from Medarex, Inc. (Princeton, N.J.). In another alternative, antibodies may be made recombinantly by phage display or yeast technology. See, for example, U.S. Pat. Nos. 5,565,332; 5,580,717; 5,733,743;
and 6,265,150;
and Winter et al., A nnu. Rev. Itninunol. (1994) 12:433-455. Alternatively, the ph age display technology (McCafferty et al., Nature (1990) 348:552-553) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
Antigen-binding fragments of an intact antibody (full-length antibody) can be prepared via routine methods. For example, F(ab')2 fragments can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab')2 fragments.
Genetically engineered antibodies, such as humanized antibodies, chimeric antibodies, single-chain antibodies, and bi-specific antibodies, can be produced via, e.g., conventional recombinant technology. In one example, DNA encoding a monoclonal antibody specific to a target antigen can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies). The hybridoma cells serve as a preferred source of such DNA. Once isolated, the DNA may be placed into one or more expression vectors, which are then transfected into host cells such as E. call cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. See, e.g., PCT Publication No. WO 87/04462. The DNA can then be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al., Proc.
Nat. Acad. Sci.
(1984) 81:6851, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. In that manner, genetically engineered antibodies, such as "chimeric" or "hybrid" antibodies; can be prepared that have the binding specificity of a target antigen.
Techniques developed for the production of "chimeric antibodies" are well known in the art. See, e.g., Morrison et al. Proc. Natl. Acad. Sci. USA (1984) 81:6851;
Neuberger et al.
Nature (1984) 312:604; and Takeda et al. Nature (1984) 314:452.
Methods for constructing humanized antibodies are also well known in the art.
See, e.g., Queen et al., Proc. Natl. Acad. Sci. USA. (1989) 86:10029-10033. In one example, variable regions VI) and VL of a parent non-human antibody are subjected to three-dimensional molecular modeling analysis following methods known in the art. Next, framework amino acid residues predicted to be important for the formation of the correct CDR
structures are identified using the same molecular modeling analysis. In parallel, human Vu and VI_ chains having amino acid sequences that are homologous to those of the parent non-human antibody are identified from any antibody gene database using the parent WI and VL
sequences as search queries. Human VH and VL acceptor genes are then selected.
The CDR regions within the selected human acceptor genes can be replaced with the CDR regions from the parent non-human antibody or functional variants thereof.
When necessary, residues within the framework regions of the parent chain that are predicted to be important in interacting with the CDR regions (see above description) can be used to substitute for the corresponding residues in the human acceptor genes.
A single-chain antibody can be prepared via recombinant technology by linking a nucleotide sequence coding for a heavy chain variable region and a nucleotide sequence coding for a light chain variable region. Preferably, a flexible linker is incorporated between the two variable regions. Alternatively, techniques described for the production of single chain antibodies (U.S. Patent Nos. 4,946,778 and 4,704,692) can be adapted to produce a phage or yeast scFv library and scFv clones specific to a lineage-specific antigen can be identified from the library following routine procedures. Positive clones can be subjected to further screening to identify those that bind lineage-specific antigen.
The "percent identity" of two amino acid sequences is determined using the algorithm of Karlin and Altschul Proc. Natl. Acad. Sci. USA (1990) 87:2264-68, modified as in Karlin and Altschul Proc. Natl. Acad. Sci. USA (1993) 90:5873-77. Such an algorithm is incorporated into the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. J. Mol.
Biol. (1990) 215:403-10. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to the protein molecules of the present disclosure. Where gaps exist between two sequences, Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. (1997) 25(17):3389-3402.
When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.
Nucleic Acids and Vectors The present disclosure provides for a nucleic acid/polynucleotide encoding any of the disclosed polypeptides, engineered proteins or agents. For example, polynucleotides encoding any of the proteins described herein are provided, e.g., for recombinant expression and purification. In some embodiments, an isolated polynucleotide comprises one or more sequences encoding the fusion proteins or agents. The nucleic acid may be deoxyribonucleic acid (DNA), ribonucleic acid (RNA) or a DNA/RNA hybrid. The nucleic acid may be linear or circular (such as a plasmid). The nucleic acid may be single-stranded, double-stranded, branched or modified by the ligation of non-nucleic acid molecules. The nucleic acids include nucleic acids produced by recombinant technology.
In certain embodiments, the nucleic acid encoding the disclosed engineered proteins is codon optimized. Methods for codon optimization are known in the art.
In certain embodiments, the nucleic acid encoding the aCD33-6DMPa-Hinge polypeptide has a nucleic acid sequence that is at least 70% identical to SEQ
ID NO: 23 (e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence in SEQ ID NO:
23).
In certain embodiments, the nucleic acid encoding the polypeptide ULBP1-6DMPb-Hinge has a nucleic acid sequence that is at least 70% identical to SEQ ID NO:
24 (e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence in SEQ Ill NO:
24).
In certain embodiments, the nucleic acid encoding the aCD3-6DMPb polypeptide has a nucleic acid sequence that is at least 70% identical to SEQ ID NO: 25 (e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence in SEQ ID NO: 25).
In certain embodiments, the nucleic acid is a plasmid DNA including a coding sequence for the disclosed polypeptide or agents, together with flanking regulatory sequences effective to cause the expression of the fusion polypeptide or agents in cells. Examples of flanking regulatory sequences are a promoter sequence sufficient to initiate transcription and a terminator sequence sufficient to terminate the gene product, by termination of transcription or translation. Suitable transcriptional or translational enhancers can be included in the vector to further assist the expression of the fusion polypeptide or agents.
In some embodiments, vectors encoding any of the engineered proteins described herein are provided, e.g., for recombinant expression and purification. In some embodiments, the vector comprises or is engineered to include an isolated polynucleotide, e.g., those described herein. Typically, the vector comprises a sequence encoding the engineered polypeptide or protein or agents operably linked to a promoter, such that the engineered protein (or agents) is (are) expressed in a host cell.
The nucleic acid may be contained within an expression vector. Thus, for example, a nucleic acid sequence may he included in any one of a variety of expression vectors for expressing one or more polypeptides, and more than one nucleic acid may be included in one expression vector. Alternatively, parts of one gene or nucleic acid may be included in separate vectors. In some embodiments, vectors include, but are not limited to, chromosomal, nonchromosomal and synthetic DNA sequences (e.g., derivatives of SV40, bacterial plasmids, phage DNA; baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and derivatives of viral DNA).
Vectors of the present disclosure can drive the expression of one or more sequences in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, Nature (1987) 329:840) and pMT2PC (Kaufman, et al., EMBO
T. (1987) 6:187). When used in mammalian cells, the expression vector's control functions are typically provided by one or more regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et at., MOLECULAR CLONING: A LABORATORY MANUAL. 2nd eds., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
The vectors of the present disclosure may direct expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Such regulatory elements include promoters that may be tissue-specific or cell type-specific. The term "tissue-specific" as it applies to a promoter refers to a promoter that is capable of directing selective expression of a nucleotide sequence of interest to a specific type of tissue in the relative absence of expression of the same nucleotide sequence of interest in a different type of tissue. The term "cell type-specific" as applied to a promoter refers to a promoter that is capable of directing selective expression of a nucleotide sequence of interest in a specific type of cell in the relative absence of expression of the same nucleotide sequence of interest in a different type of cell within the same tissue. The term "cell type-specific" when applied to a promoter also means a promoter capable of promoting selective expression of a nucleotide sequence of interest in a region within a single tissue. Cell type specificity of a promoter may be assessed using methods well known in the art, e.g., immunohistochemical staining.
Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids in mammalian cells or target tissues. Such methods can be used to administer nucleic acids encoding the present agents/polypeptides to cells in culture, or in a subject. Non-viral vector delivery systems include DNA plasmids, RNA (e.g., a transcript of a vector described herein), naked nucleic acid, and nucleic acid complexed with a delivery vehicle.
Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell.
Viral vectors can be administered directly to patients (in vivo) or they can be used to manipulate cells in vitro or ex vivo, where the modified cells may be administered to patients.
In one embodiment, the present disclosure utilizes viral based systems including, but not limited to retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Furthermore, the present disclosure provides vectors capable of integration in the host genome, such as retrovirus or lentivirus.
The vectors of the present disclosure may be delivered to the eukaryotic cell in a subject.
Any of the chimeric proteins described herein can be prepared by routine methods, such as recombinant technology. Methods for preparing the chimeric proteins herein involve generation of a nucleic acid that encodes a polypeptide comprising each of the fragments/domains/moieties of the chimeric proteins, including the antigen-binding fragment and the polypeptide that binds a molecule expressed on natural killer (NK) cells.
In some embodiments, a nucleic acid encoding each of the components of chimeric protein are joined together using recombinant technology.
Sequences of each of the components of the engineered proteins may be obtained via routine technology, e.g., PCR amplification from any one of a variety of sources known in the art. In some embodiments, sequences of one or more of the components of the chimeric proteins are obtained from a human cell. Alternatively, the sequences of one or more components of the chimeric proteins can be synthesized. Sequences of each of the components (e.g., fragments/domains/moieties) can he joined directly or indirectly (e.g., using a nucleic acid sequence encoding a peptide linker) to form a nucleic acid sequence encoding the chimeric protein, using methods such as PCR amplification or ligation.
Alternatively, the nucleic acid encoding the chimeric protein may be synthesized. In sonic embodiments, the nucleic acid is DNA. In other embodiments, the nucleic acid is RNA.
Mutation of one or more residues within one or more of the components of the chimeric protein (e.g., the antigen-binding fragment, etc.), prior to or after joining the sequences of each of the components. In some embodiments, one or more mutations in a component of the engineered protein may be made to modulate (increase or decrease) the affinity of the component for a target (e.g., the antigen-binding fragment for the target antigen) and/or modulate the activity of the component.
Any of the engineered proteins described herein can he introduced into a suitable cell for expression via conventional technology.
To express the engineered proteins, expression vectors for stable or transient expression of the engineered proteins may be constructed via conventional methods as described herein.
For example, nucleic acids encoding the chimeric proteins may be cloned into a suitable expression vector, such as a viral vector in operable linkage to a suitable promoter. The nucleic acids and the vector may be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined with a ligase. Alternatively, synthetic nucleic acid linkers can be ligated to the termini of the nucleic acid encoding the engineered proteins. The synthetic linkers may contain nucleic acid sequences that correspond to a particular restriction site in the vector. The selection of expression vectors/plasmids/viral vectors would depend on the type of host cells for expression of the chimeric proteins, but should be suitable for integration and replication in eukaryotic cells.
A variety of promoters can be used for expression of the engineered proteins described herein, including, without limitation, cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR, Maloney murine leukemia virus (MMLV) LTR, myeoloproliferative sarcoma virus (MPSV) LTR, spleen focus-forming virus (SFFV) LTR, the simian virus 40 (SV40) early promoter, herpes simplex tk virus promoter, elongation factor 1-alpha (EF1-a) promoter with or without the EF1-a intron.
Additional promoters for expression of the chimeric proteins include any constitutively active promoter. Alternatively, any regulatahle promoter may be used, such that its expression can be modulated.
Additionally, the vector may contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene for selection of stable or transient transfectants in host cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; transcription termination and RNA
processing signals from S V40 for naRNA stability; 5'-and 3' -untranslated regions for inRNA stability and translation efficiency from highly-expressed genes like a-globin or f3-globin;
SV40 polyoma origins of replication and ColE1 for proper episomal replication; internal ribosome binding sites (IRESes), versatile multiple cloning sites; T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA; a "suicide switch" or "suicide gene"
which when triggered causes cells carrying the vector to die (e.g., HSV thymidine kinase, an inducible caspase such as iCasp9), and reporter gene for assessing expression of the chimeric protein.
See section VI below. Suitable vectors and methods for producing vectors containing transgenes are well known and available in the art. Examples of the preparation of vectors for expression of chimeric proteins can be found, for example, in US2014/0106449.
In some embodiments, the engineered protein or the nucleic acid encoding said engineered protein is a DNA molecule. In some embodiments, the nucleic acid encoding said engineered protein is a DNA vector. In some embodiments, the nucleic acid encoding the engineered protein is an RNA molecule.
Any of the vectors comprising a nucleic acid sequence that encodes an engineered protein described herein is also within the scope of the present disclosure.
Such a vector may be delivered into host cells by a suitable method. Methods of delivering vectors to cells are well known in the art and may include DNA, RNA, or transposon electroporation, transfection reagents such as liposomes or nanoparticles to delivery DNA, RNA, or transposons; delivery of DNA, RNA, or transposons or protein by mechanical deformation (see, e.g., Sharei et al.
Proc. Natl. Acad. Sci. USA (2013) 110(6):2082-2087); or viral transduction. In some embodiments, the vectors for expression of the chimeric proteins are delivered to host cells by viral transduction. Exemplary viral methods for delivery include, but are not limited to, recombinant retroviruses (see. e.g., PCT Publication Nos. WO 90/07936; WO
94/03622; WO
93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Pat. Nos.
5,219,740 and 4,777,127; GB Patent No. 2,200,651; and EP Patent No. 0 345 242), alphavirus-based vectors, and adeno-associated virus (AAV) vectors (see, e.g., PCT
Publication Nos. WO
94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655).
In some embodiments, the vectors for expression are retroviruses. In some embodiments, the vectors for expression are lentiviruses. In some embodiments, the vectors for expression are adeno-associated viruses.
In examples in which the vectors encoding engineered proteins are introduced to the host cells using a viral vector, viral particles that are capable of infecting the cells and carry the vector may be produced by any method known in the art and can be found, for example in PCT
Application No. WO 1991/002805A2, WO 1998/009271 Al, and U.S. Patent 6,194,191. The viral particles are harvested from the cell culture supernatant and may be isolated and/or purified prior to contacting the viral particles with the cells.
Therapeutic methods Any of the disclosed engineered proteins may be administered to a subject to treat a condition such as hematopoietic malignancy. Additionally, any of the nucleic acids/polynucleotides/vectors encoding the disclosed engineered proteins may he administered to a subject to treat a condition such as hematopoietic malignancy.
Additionally, any compositions or pharmaceutical compositions comprising any of the disclosed engineered proteins or nucleic acids/polynucleotides/vectors encoding the disclosed engineered proteins may be administered to a subject to treat a condition such as hematopoietic malignancy. As used herein, "subject," "individual," and "patient" are used interchangeably, and refer to a vertebrate, preferably a mammal such as a human. Mammals include, but are not limited to, human primates, non-human primates or murine, bovine, equine, canine or feline species. In some embodiments, the subject is a human patient having a hematopoietic malignancy.
In some embodiments, the present vectors, engineered proteins or agents may be mixed with a pharmaceutically acceptable carrier to form a pharmaceutical composition, which is also within the scope of the present disclosure.
The present disclosure provides for a vaccine suitable for eliciting an immune response against cancer cells. Method of inhibiting tumor growth by administering the vaccine of the invention to a mammal is also described.
The present composition may be delivered to, or administered to be in contact with, any suitable types of cells. The cell may a eukaryotic cell. The cell may a mammalian cell, such as a human cell or a non-human mammalian cell (e.g., a non-human primate cell).
These include a number of cell lines that can be obtained from American Tissue Culture Collection. In certain embodiments, the cell is a tumor cell.
In certain embodiments, the cell is present in a subject (e.g., a mammal). The mammal can be a human or a non-human primate. Non-human primates include, but are not limited to, chimpanzees, cyn omol ogous monkeys, spider monkeys, and macaques, e.g., Rhesus.
In certain embodiments, the cell may be removed and maintained in tissue culture in a primary, secondary, immortalized or transformed state. In certain embodiments, the cells are cultured cells or cells freshly obtained from a source (e.g., a tissue, an organ, a subject, etc.).
The mammalian cell can be primary or secondary which means that it has been maintained in culture for a relatively short time after being obtained from an animal tissue.
To perform the methods described herein, an effective amount of the present composition may be administered to a subject in need of the treatment. As used herein the term "effective amount" may be used interchangeably with the term "therapeutically effective amount" and refers to that quantity of a vector, an engineered protein, an agent, or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof. Within the context of the present disclosure, the term "effective amount" refers to that quantity of a vector, an engineered protein, an agent, or pharmaceutical composition that is sufficient to delay the manifestation, arrest the progression, relieve or alleviate at least one symptom of a disorder treated by the methods of the present disclosure.
Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. In some embodiments, the effective amount alleviates, relieves, ameliorates, improves, reduces the symptoms, or delays the progression of any disease or disorder in the subject.
In some embodiments, the subject is a human. In some embodiments, the subject is a human patient having a hematopoietic malignancy.
In some embodiments, the present composition is administered to a subject in an amount effective in to reduce the number of target cells (e.g., cancer cells) by least 20%, e.g., 50%, 80%, 100%, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or more.
In one embodiment, the present composition is administered to a subject (e.g., human patient) as an initial dose. One or more subsequent administrations of the present composition may be provided to the patient at intervals of 15 days, 14, 13, 12, 11, 10, 9, 8,7, 6, 5,4, 3, or 2 days after the previous administration. More than one dose of the present composition can be administered to the subject per week, e.g., 2, 3, 4, or more administrations of the agent. The subject may receive more than one doses of the present composition per week, followed by a week of no administration of the agent, and finally followed by one or more additional doses of the present composition (e.g., more than one administration of the present composition per week). The present composition may be administered every other day for 3 administrations per week for two, three, four, five, six, seven, eight or more weeks.
In the context of the present disclosure insofar as it relates to any of the disease conditions recited herein, the terms "treat," "treatment," and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression of such condition. Within the meaning of the present disclosure, the term "treat"
also denotes to arrest, delay the onset (i.e., the period prior to clinical manifestation of a disease) and/or reduce the risk of developing or worsening a disease. For example, in connection with cancer the term "treat" may mean eliminate or reduce a patient's tumor burden, or prevent, delay or inhibit metastasis.
In some embodiments, the present engineered proteins fusion recognizes (hinds) a target cell expressing the cell-surface lineage-specific antigen for targeting killing.
The efficacy of the present therapeutic methods may be assessed by any method known in the art and would be evident to a skilled medical professional. For example, the efficacy of the therapy may be assessed by survival of the subject or cancer burden in the subject or tissue or sample thereof. In some embodiments, the efficacy of the therapy is assessed by quantifying the number of cells belonging to a particular population or lineage of cells.
In some embodiments, the efficacy of the therapy is assessed by quantifying the number of cells presenting the cell-surface lineage-specific antigen.
The present composition may be administered to a subject in combination with a second therapy. The present composition may be administered prior to administration of the second therapy. In some embodiments, the present composition is administered at least about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 3 months, 4 months, 5 months, 6 months or more prior to administration of the second therapy.
In some embodiments, the second therapy is administered prior to the administration of the present composition. In some embodiments, the second therapy is administered at least about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 3 months, 4 months, 5 months, 6 months or more prior to administration of the present composition.
In some embodiments, the present composition and the second therapy are administered at substantially the same time. In some embodiments, the present composition is administered, and the patient is assessed for a period of time, after which the second therapy is administered.
In some embodiments, the second therapy is administered, and the patient is assessed for a period of time, after which the present composition is administered.
Also within the scope of the present disclosure are multiple administrations (e.g., doses) of the present composition. In some embodiments, the present composition is administered to the subject once. In some embodiments, the present composition is administered to the subject more than once (e.g., at least 2, 3, 4, 5, or more times). In some embodiments, the present composition is administered to the subject at a regular interval, e.g., every six months.
In some embodiments, the subject is a human subject having a hematopoietic malignancy or hematological neoplasm. As used herein a hematopoietic malignancy refers to a malignant abnormality involving hematopoietic cells (e.g., blood cells, including progenitor and stem cells). Examples of hematopoietic malignancies include, without limitation, Hodgkin's lymphoma, non-Hodgkin's lymphoma, leukemia, or multiple myeloma.
Leukemias include acute myeloid leukemia, acute lymphoid leukemia, chronic myelogenous leukemia, acute lymphoblastic leukemia or chronic lymphoblastic leukemia, and chronic lymphoid leukemia.
Hematological malignancies or neoplasms include but not limited to, myeloid malignancies, lymphatic malignancies, malignant histiocytosis and mast cell leukemia.
The hematopoietic malignancy may be a myeloid malignancy wherein the myeloid malignancies include but not limited to myeloproliferative disorders (MPD), myelodysplastic syndrome (MDS), myelodysplastic/myeloproliferative disorders (MD/MPD) and acute myeloid leukemia (AML).
In certain embodiments, myeloid malignancies refer to a condition associated with a defect in the proliferation of a hematopoietic cell. In certain embodiments, myeloid malignancies refer to clonal hematological diseases affecting the myeloid blood lineages, including chronic and acute conditions. Myeloid malignancies include myeloproliferative neoplasms, myelodysplastic syndromes and acute myeloid leukemias. A
myeloproliferative neoplasm may be primary myelofibrosis (PMF), or essential thrombocythemia (ET). A
myelodysplastic syndrome may be refractory anemia with ringed sideroblasts and thrombocythemia (RARS-T). Myeloid malignancies include, but are not limited to, myeloproliferative disorders (MPD), myelodysplastic syndrome (MDS), myelodyspl astic/myeloprol ferati ve disorders (MD/M PD), and acute myeloi d leukemi a (AML).
Lymphatic malignancies include, but are not limited to, T/NK cell tumor, B
cell tumor and Hodgkin's disease.
In some embodiments, the leukemia is acute myeloid leukemia (AML). AML is characterized as a heterogeneous, clonal, neoplastic disease that originates from transformed cells that have progressively acquired critical genetic changes that disrupt key differentiation and growth-regulatory pathways. (Dohner et al. 2015). CD33 glycoprotein is expressed on the majority of myeloid leukemia cells as well as on normal myeloid and monocytic precursors and has been considered to be an attractive target for AML therapy (Laszlo et al., Blood Rev.
(2014) 28(4):143-53). While clinical trials using anti-CD33 monoclonal antibody based therapy have shown improved survival in a subset of AML patients when combined with standard chemotherapy, these effects were also accompanied by safety and efficacy concerns.
Alternatively or in addition, the methods described herein may he used to treat non-hematopoietic cancers, including without limitation: lung cancer; ear, nose and throat cancer;
colon cancer; melanoma; pancreatic cancer; mammary cancer; prostate cancer;
breast cancer;
ovarian cancer; basal cell carcinoma; biliary tract cancer; bladder cancer;
bone cancer; breast cancer; cervical cancer; choriocarcinoma; colon and rectum cancer; connective tissue cancer;
cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer; intra-epithelial neoplasm; kidney cancer;
larynx cancer; liver cancer; fibroma, neuroblastoma; oral cavity cancer (e.g., lip, tongue, mouth, and pharynx);
ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma;
rhabdomyosarcoma; rectal cancer; renal cancer; cancer of the respiratory system; sarcoma; skin cancer;
stomach cancer;
testicular cancer; thyroid cancer; uterine cancer; cancer of the urinary system, as well as other carcinomas and sarcomas.
Carcinomas are cancers of epithelial origin. Carcinomas intended for treatment with the methods of the present disclosure include, but are not limited to, acinar carcinoma, acinous carcinoma, alveolar adenocarcinoma (also called adenocystic carcinoma, adenomyoepithelioina, cribriform carcinoma and cylindroma), carcinoma adenomatosum, adenocarcinoma, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma (also called bronchiolar carcinoma, alveolar cell tumor and pulmonary adenomatosis), basal cell carcinoma, carcinoma basocellulare (also called basaloma, or basiloma, and hair matrix carcinoma), basaloid carcinoma, basosquamous cell carcinoma, breast carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma (also called cholangioma and cholangiocarcinoma), chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epibulbar carcinoma, epidermoid carcinoma, carcinoma epitheliale adenoides, carcinoma exulcere, carcinoma fibrosum, gclatiniform carcinoma, gelatinous carcinoma, giant cell carcinoma, gigantocellulare, glandular carcinoma, granulosa cell carcinoma, hair-matrix carcinoma, hematoid carcinoma, hepatocellular carcinoma (also called hepatoma, malignant hepatoma and hepatocarcinoma), Huirthle cell carcinoma, hyaline carcinoma, hypernephroid carcinoma, infantile embryonal carcinoma, carcinoma in situ, intraepidermal carcinoma, intraepithelial carcinoma, Krompecher's carcinoma, Kulchitzky-cell carcinoma, lenticular carcinoma, carcinoma lenticulare, lipomatous carcinoma, lymphoepithelial carcinoma, carcinoma mastitoides, carcinoma medullare, medullary carcinoma, carcinoma melanodes, melanotic carcinoma, mucinous carcinoma, carcinoma muciparum, carcinoma mucocellulare, mucoepidermoid carcinoma, carcinoma mucosum, mucous carcinoma, carcinoma rnyxomatodes, nasopharyngeal carcinoma, carcinoma nigruni, oat cell carcinoma, carcinoma ossificans, osteoid carcinoma, ovarian carcinoma, papillary carcinoma, periportal carcinoma, preinvasive carcinoma, prostate carcinoma, renal cell carcinoma of kidney (also called adenocarcinoma of kidney and hypemephoroid carcinoma), reserve cell carcinoma.
carcinoma sarcomatodes, scheinderian carcinoma, scirrhous carcinoma, carcinoma scroti, signet-ring cell carcinoma, carcinoma simplex, small-cell carcinoma, solanoid carcinoma, spheroidal cell carcinoma, spindle cell carcinoma, carcinoma spongiosum, squamous carcinoma, squamous cell carcinoma, string carcinoma, carcinoma telangiectaticum, carcinoma telangiectodes, transitional cell carcinoma, carcinoma tuberosum, tuberous carcinoma, verrucous carcinoma, carcinoma vilosum.
Sarcomas are mesenchymal neoplasms that arise in bone and soft tissues.
Different types of sarcomas are recognized and these include: liposarcomas (including myxoid liposarcomas and pleiomorphic liposarcomas), leiomyosarcomas, rhabdomyosarcomas, malignant peripheral nerve sheath tumors (also called malignant schwannomas, neurofibrosarcomas, or neurogenic sarcomas), Ewing's tumors (including Ewing's sarcoma of bone, extraskeletal (i.e., non-bone) Ewing's sarcoma, and primitive neuroectodermal tumor [PNET]), synovial sarcoma, angiosarcomas, hemangiosarcomas, lymphangiosarcomas, Kaposi's sarcoma, hemangioendothelioma, fibrosarcoma, desmoid tumor (also called aggressive fibromatosis), dermatofibrosarcoma protuberans (DFSP), malignant fibrous h isti oc ytom a (MFH) , hem angioperi cytom a, malignant m esenchymom a, alveolar soft-part sarcoma, epithelioid sarcoma, clear cell sarcoma, desmoplastic small cell tumor, gastrointestinal stromal tumor (GIST) (also known as GI stromal sarcoma), osteosarcoma (also known as osteogenic sarcoma)-skeletal and extraskeletal, and chondrosarcoma.
In some embodiments, the cancer to be treated can be a refractory cancer. A
"refractory cancer," as used herein, is a cancer that is resistant to the standard of care prescribed. These cancers may appear initially responsive to a treatment (and then recur), or they may be completely non-responsive to the treatment. The ordinary standard of care will vary depending upon the cancer type, and the degree of progression in the subject. It may be a chemotherapy, or surgery, or radiation, or a combination thereof. Those of ordinary skill in the art are aware of such standards of care. Subjects being treated according to the present disclosure for a refractory cancer therefore may have already been exposed to another treatment for their cancer. Alternatively, if the cancer is likely to be refractory (e.g., given an analysis of the cancer cells or history of the subject), then the subject may not have already been exposed to another treatment. Examples of refractory cancers include, but are not limited to, leukemia, melanomas, renal cell carcinomas, colon cancer, liver (hepatic) cancers, pancreatic cancer, Non-Hodgkin's lymphoma and lung cancer.
Any of the present vectors, engineered proteins or agents described herein may be administered in a pharmaceutically acceptable carrier or excipient as a pharmaceutical composition.
The phrase "pharmaceutically acceptable," as used in connection with compositions and/or cells of the present disclosure, refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a mammal (e.g., a human). Preferably, as used herein, the term "pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans. "Acceptable" means that the carrier is compatible with the active ingredient of the composition (e.g., the nucleic acids, vectors, cells, or therapeutic antibodies) and does not negatively affect the subject to which the composition(s) are administered. Any of the pharmaceutical compositions and/or cells to be used in the present methods can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formations or aqueous solutions.
Pharmaceutically acceptable carriers, including buffers, are well known in the art, and may comprise phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methi nine ; preservatives; low molecular weight polypepti des ;
proteins, such as serum albumin, gelatin, or immunoglobulins; amino acids; hydrophobic polymers;
monosaccharides;
disaccharides; and other carbohydrates; metal complexes; and/or non-ionic surfactants. See, e.g. Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover.
Kits Also within the scope of the present disclosure are kits for use of the present engineered proteins, agents, vectors, and/or compositions. Such kits may include one or more containers comprising present engineered proteins, agents, vectors, and/or compositions.
Some aspects of this disclosure provide kits comprising the present engineered proteins or agents. In some embodiments, the kit comprises a polynucleotide encoding the present engineered proteins. In some embodiments, the kit comprises a vector for recombinant protein expression, wherein the vector comprises a polynucleotide encoding the present engineered proteins. In some embodiments, the kit comprises a cell that comprises a genetic construct for expressing the present engineered proteins. In some embodiments, the kit comprises an excipient and instructions for using the kit. In some embodiments, the excipient is a pharmaceutically acceptable excipient.
In some embodiments, the kit can comprise instructions for use in any of the methods described herein. The included instructions can comprise a description of administration of the pharmaceutical compositions to a subject to achieve the intended activity in a subject. The kit may further comprise a description of selecting a subject suitable for treatment based on identifying whether the subject is in need of the treatment. In some embodiments, the instructions comprise a description of administering the pharmaceutical composition to a subject who is in need of the treatment.
The instructions relating to the use of the pharmaceutical composition described herein generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the disclosure are typically written instructions on a label or package insert. The label or package insert indicates that the pharmaceutical compositions are used for treating, delaying the onset, and/or alleviating a disease or disorder in a subject.
The kits provided herein are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging, and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device, or an infusion device. A kit may have a sterile access port (for example, the container may be an intravenous solution hag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port.
In some embodiment, the disclosure provides articles of manufacture comprising contents of the kits described above.
In some embodiments, the individual components of the formulation can be provided in one container. Alternatively, it can be desirable to provide the components of the formulation separately in two or more containers. The different components can be combined, e.g., according to instructions provided with the kit. The components can be combined according to a method described herein, e.g., to prepare and administer a pharmaceutical composition.
The present engineered proteins, agents, vectors, or compositions can be provided in any form, e.g., liquid, dried or lyophilized form.
EXAMPLES
The present invention may be better understood by reference to the following non-limiting examples, which are presented in order to more fully illustrate the preferred embodiments of the invention. They should in no way be construed to limit the broad scope of the invention.
Example 1- Construction of the Engineered Heterodimer Proteins Initially, pcDNA3.1 expression vectors were used for the aCD33-ULBP1 engineered heterodimer proteins. All constructs utilized an N-terminal IL-2 secretory signal to trigger export of the completed protein to cell supernatant, and C-terminal tnyc- and 6xHis-tags to facilitate purification and labeling. In two constructs, ULBP1 immediately follows the IL-2 signal, followed by a linker and then the VH and VL regions of aCD33. In another construct, aCD33 precedes ULBP1, in order to determine whether one orientation is favorable.
Additionally, constructs have been developed for the aCD33-scFV or 1.1LBP I
alone.
Expression via Mirus TransIT-293 transfection reagent was confirmed using Western blot probing for Myc following purification of 6xHis-tagged proteins in supernatant of transfected HEK-293T cells, as well as Myc probing of cellular protein. See Example 2 and Figure 12.
The 6DMPa-monomer was fused to anti-CD33, GFP, and the associated tags (6xHis and myc) listed above. The 6DMPb monomer was fused to UPBP1, RFP, and 6xHis and FLAG tags to facilitate purification independently of the 6DMPa-myc (and to allow for separate co-immunoprecipitation experiments).
peDNA3.1 plasmids were also created that encode for the engineered protein that attaches anti-CD3 to 6DMPb, with tags to match those of the ULBP1-6DMPb construct (Figure 10). In this approach, CD3+ T-cells replaced NK cells as the relevant effector cell, and thus 6DMPb was attached in order to bind the anti-CD3 facilitator to the anti-CD33 targeting moiety. The anti-CD3 sequence was taken from the Amgen CD3-CD19 BiTE
blinotumomab, and fused to 6DMPb via the same linkers used previously (Kufer et al.
2017). This was co-expressed with aCD33-6DMPa and co-immunoprecipitated to verify heterodimerization. The construct was cloned into bacterial or lentiviral vectors to generate high-output protein expression methods as noted above.
The latest modification to these designs included the hinge region of IgG2.
With four cysteine residues creating four disulfide bridges in the span of 12 total residues, hinge regions added to the C-terminus of 6DMP-based chimeras were expected to enhance the binding of heterodimers and prevent dissociation (Wypych et al. 2008). An identical IgG2-hinge was thus added to each construct, following the 6DMPa/b and preceding purification tags (Figures 1 and 10). Constructs have been designed that add this hinge directly or add this hinge after a short linker.
All constructs were expressed from pcDNA3.4-TOPO vectors with ampicillin resistance, codon-optimized for expression in Cricetulus griseus (Chinese hamster). See Figure 11.
To express the polypeptides/proteins, the amino acid sequences were back translated to obtain the DNA sequences which were then codon optimized (SEQ ID NOs: 23-25).
Proteins were expressed according to a modified version of the manufacturer protocol using Lipofectamine 3000.
= aCD33-6DMPa-Hinge was co-expressed in the same dish with aCD3-6DMPb-Hinge or ULBP1-6DMPb-Hinge = Proteins were produced CHO-Kl cells in 15-cm tissue-culture treated dishes
The present disclosure provides for a composition comprising any of the engineered proteins, any of the nucleic acid molecules, any of the present vectors, and/or any of the present cells.
Also encompassed by the present disclosure is a kit comprising any of the engineered proteins, any of the nucleic acid molecules, any of the present vectors, any of the present cells and/or any of the present compositions.
The present disclosure provides for a method of treating cancer in a subject, comprising administering to the subject an effective amount of any of the engineered proteins, any of the nucleic acid molecules, any of the present vectors, any of the present cells and/or any of the present compositions disclosed or described herein.
The present disclosure provides for a method of treating a hematopoietic malignancy in a subject, comprising administering to the subject an effective amount of any of the engineered proteins, any of the nucleic acid molecules, any of the present vectors, any of the present cells and/or any of the present compositions disclosed or described herein.
The hematopoictic malignancy may be a myeloid malignancy.
The hematopoietic malignancy may be Hodgkin' s lymphoma, non-Hodgkin's lymphoma, leukemia, or multiple myeloma.
The hematopoietic malignancy may be acute myeloid leukemia, chronic myelogenous leukemia, acute lymphoblastic leukemia, or chronic lymphoblastic leukemia.
BRIEF DESCRIPTION OF THE FIGURES
For the purpose of illustrating the invention, there are depicted in drawings certain embodiments of the invention. However, the invention is not limited to the precise arrangements and instrumentalities of the embodiments depicted in the drawings.
Figure 1 are schematics of the various binding proteins. Figure lA is a schematic of the anti-CD33, anti-CD3, and NKG2D binding proteins with the IgG2 hinge domain only used in the engineered proteins. Figure 1B is a schematic of the anti-CD33, anti-CD3, and NKG2D
binding proteins with both IgG2 hinge and IgG2 Fc domains used in the engineered proteins.
Figure 2 is a schematic of the bifunctional protein dimers engaging immune cells with cancer cells.
Figure 3 is the amino acid sequence of the anti-CD33 construct with the IgG2 hinge domain only (SEQ ID NO: 1).
Figure 4 is the amino acid sequence of the ULBP1 construct with the IgG2 hinge domain only (SEQ ID NO: 2).
Figure 5 is the amino acid sequence of the anti-CD3 construct with the IgG2 hinge domain only (SEQ ID NO: 3).
Figure 6 is the amino acid sequence of the anti-CD33 construct with both IgG2 hinge and IgG2 Fc domains (SEQ ID NO: 4).
Figure 7 is the amino acid sequence of the ULBP1 construct with both IgG2 hinge and IgG2 Fe domains (SEQ ID NO: 5).
Figure 8 is the amino acid sequence of the anti-CD3 construct with both IgG2 hinge and IgG2 Fe domains (SEQ ID NO: 6).
Figure 9 is a schematic of an engineered heterotrimer protein.
Figure 10 are schematics of the engineered heterodimer proteins with the IgG2-hinge and the 6DMPa/b heterodimerizing structure. Figure 10A is an anti-CD33/anti-heterodimer protein. Figure 10B is an anti -CD33/ULPB 1 heterodimer protein.
Figure 11 are plasmid maps of the expression vectors used in the studies.
Figure 11A
is a map of the aCD33-6DMPa-Hinge expression vector. Figure 11B is a map of the 1.JLBP1-6DMPb-Hinge expression vector. Figure 11C is a map of the aCD3-6DMPb expression vector.
Figure 12 are immunoblots showing the expression and purification of the anti-CD33/ULBP engineered protein in 293T cells transfected with anti-CD33-ULBP1 chimeras 1 and 2 plasmids. Figure 12A shows the expression in cells. Figure 12B shows the expression and purification in supernatant.
Figure 13 is an immunoblot showing the expression and purification of hinge-based constructs in CHO cells. The proteins arc secreted into supernatant and can be 6xHis-purified using cobalt-resin and elution with imidazole.
Figure 14 shows FACS plots of HL-60 cells incubated with either anti-CD33 construct alone or with one of the engineered heterodimer proteins. Figure 14A shows co-incubation with an anti-FLAG antibody. Figure 14B shows co-incubation with an anti-MYC
antibody.
Figure 15 is a table summarizing binding experiments of the engineered heterodimer proteins to HL-60 cells.
Figure 16 is a table summarizing binding experiments of the engineered heterodimer proteins to Jurkat cells.
Figure 17 is a table summarizing binding experiments of the engineered heterodimer proteins to PMBCs.
Figure 18 shows the result of a cytotoxicity assay using M0LM14 cells and the anti-CD33/anti-CD3 engineered heterodimer protein. Figure 18A is a representative dot plot demonstrating flow cytometry gating scheme. Single dTomato+ (MOLM14) cells are gated, and % specific cells killed is assessed as total % of dTomato+ cells that are also DAPI+. Figure 18B is a graph of the results of a cytotoxicity in MOLM14 cells using the anti-C1133/anti-CD3 engineered heterodimer protein.
Figure 19 shows the result of a cytotoxicity assay using HL60 cells and the anti-CD33/anti-CD3 engineered heterodimer protein. Figure 19A is a representative dot plot demonstrating flow cytometry gating scheme. Single CellTrace Violet+ (HL-60) cells are gated, and % specific cells killed is assessed as total % of CellTrace Violet+
cells that are also DAPI+. Figure 19B is a graph showing the results of a cytotoxicity assay in HL-60 cells using the anti-CD33/anti-CD3 engineered heterodimer protein.
Figure 20 is a graph showing further results of a cytotoxicity assay in HL-60 cells using the anti-CD33/anti-CD3 engineered heterodimer protein as compared to monomers.
Figure 21 is a graph showing results of a dose dependent cytotoxicity assay using protein titration (i.e., increase in the anti-CD33/anti-CD3 engineered heterodimer protein) in HL-60 cells.
Figure 22 is a graph showing results of a dose dependent cytotoxicity assay using effector titration (i.e., increase in the effector/target ratio) in HL-60 cells.
Figure 23 are the amino acid sequences of the anti-CD16 construct. Figure 23A
is the amino acid sequence of the anti-CD16 construct with IgG2 hinge domain only (SEQ ID NO:
26). Figure 23B is the amino acid sequence of the anti-CD16 construct with both IgG2 hinge and IgG2 Fe domains (SEQ ID NO: 27).
Figure 24 shows the results of the in vivo anti-tumor activity of anti-CD33-anti-CD3 engineered heterodimer protein. Figure 24A is a schematic of the experiment.
Figure 24B are images of bioluminescence imaging (BLI) used to monitor the growth of FFluc-dtomato transduced MOLM14. Figure 24C is a graph of the quantification of BLI in mice treated with MOLM14 alone, unloaded T cells or anti-CD33-anti-CD3 engineered heterodimer protein loaded T cells. Figure 24D is a Kaplan-Meier survival plot. Mice treated with anti-CD33-anti-CD3 engineered heterodimer protein loaded T cells have better survival than the 2 control groups (no treatment or unloaded T cells). Log-rank test *p <0.05.
DETAILED DESCRIPTION
Definitions The term -engineered protein" or -engineered heterodimer protein" or "engineered heterotrimer protein" or "engineered hetero protein" or "polyfunctional protein" or "polyfunctional orthogonal protein chimera" or "protein chimera" or the like as used herein refers to a hybrid polypeptide which comprises protein domains from at least two different proteins. One domain may be located at the amino-terminal (N-terminal) portion of the fusion protein or at the carboxy-terminal (C-terminal) portion of the fusion protein.
Any of the proteins provided herein may be produced by any method known in the art. For example, the proteins provided herein may be produced via recombinant protein expression and purification, which is especially suited for fusion proteins comprising a peptide linker.
Methods for recombinant protein expression and purification are well known, and include those described by Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)), the entire contents of which are incorporated herein by reference.
The terms "protein," "peptide," and "polypeptide" are used interchangeably herein, and refer to a polymer of amino acid residues linked together by peptide (amide) bonds. The terms refer to a protein, peptide, or polypeptide of any size, structure, Or function. Typically, a protein, peptide, or polypeptide will be at least three amino acids long. A protein, peptide, or polypeptide may refer to an individual protein or a collection of proteins.
One or more of the amino acids in a protein, peptide, or polypeptide may be modified, for example, by the addition of a chemical entity such as a carbohydrate group, a hydroxyl group, a phosphate group, a farnesyl group, an isofarnesyl group, a fatty acid group, a linker for conjugation, functionalization, or other modification, etc. A protein, peptide, or polypeptide may also be a single molecule or may be a multi-molecular complex. A protein, peptide, or polypeptide may be just a fragment of a naturally occurring protein or peptide. A protein, peptide, or polypeptide may be naturally occurring, recombinant, or synthetic, or any combination thereof.
The terms "subject," "individual," and "patient" are used interchangeably, and refer to a vertebrate, preferably a mammal such as a human. Mammals include, but are not limited to, human primates, non-human primates or murine, bovine, equine, canine or feline species. In the context of the present disclosure, the term "subject" also encompasses tissues and cells that can be cultured in vitro or ex vivo or manipulated in vivo. The term "subject"
can be used interchangeably with the term "organism".
The terms "polynucleotide", "nucleotide", "nucleotide sequence", "nucleic acid" and "oligonucleotide" are used interchangeably. They refer to a polymeric form of nucleotides of any length, either deoxyribonucleotides or ribonucleotides, or analogs thereof. Examples of polynucleotides include, but are not limited to, coding or non-coding regions of a gene or gene fragment, exons, introns, messenger RNA (mRNA), transfer RNA, ribosomal RNA, short interfering RNA (siRNA), short-hairpin RNA (shRNA), micro-RNA (miRNA), ribozymes, cDNA, recombinant polynucleotides, branched polynucleotides, plasmids, vectors, isolated DNA of any sequence, isolated RNA of any sequence, nucleic acid probes, and primers. One or more nucleotides within a polynucleotide can further be modified. The sequence of nucleotides may be interrupted by non-nucleotide components. A polynucleotide may also be modified after polymerization, such as by conjugation with a labeling agent.
The term "hybridization" refers to a reaction in which one or more polynucleotides react to form a complex that is stabilized via hydrogen bonding between the bases of the nucleotide residues. The hydrogen bonding may occur by Watson Crick base pairing, Hoogstein binding, or in any other sequence specific manner. The complex may comprise two strands forming a duplex structure, three or more strands forming a multi-stranded complex, a single self-hybridizing strand, or any combination of these. A hybridization reaction may constitute a step in a more extensive process, such as the initiation of PCR, or the cleavage of a polynucleotide by an enzyme. A sequence capable of hybridizing with a given sequence is referred to as the "complement" of the given sequence.
The terms "vector", "cloning vector" and "expression vector" mean the vehicle by which a DNA or RNA sequence (e.g., a foreign gene) can be introduced into a host cell, so as to transform the host and promote expression (e.g., transcription and translation) of the introduced sequence. Vectors include, but are not limited to, plasmids, phages, and viruses.
Vectors typically comprise the DNA of a transmissible agent, into which foreign DNA is inserted. A common way to insert one segment of DNA into another segment of DNA involves the use of enzymes called _restriction enzymes that cleave DNA at specific sites (specific groups of nucleotides) called restriction sites. A "cassette" refers to a DNA coding sequence or segment of DNA which codes for an expression product that can be inserted into a vector at defined restriction sites. The cassette restriction sites are designed to ensure insertion of the cassette in the proper reading frame. Generally, foreign DNA is inserted at one or more restriction sites of the vector DNA, and then is carried by the vector into a host cell along with the transmissible vector DNA. A segment or sequence of DNA having inserted or added DNA, such as an expression vector, can also be called a "DNA construct" or "gene construct." A
common type of vector is a "plasmid", which generally is a self-contained molecule of double-stranded DNA, usually of bacterial origin, that can readily accept additional (foreign) DNA
and which can readily introduced into a suitable host cell. A plasmid vector often contains coding DNA and promoter DNA and has one or more restriction sites suitable for inserting foreign DNA. Coding DNA is a DNA sequence that encodes a particular amino acid sequence for a particular protein or enzyme. Promoter DNA is a DNA sequence which initiates, regulates, or otherwise mediates or controls the expression of the coding DNA.
Promoter DNA
and coding DNA may be from the same gene or from different genes and may be from the same or different organisms. A large number of vectors, including plasmid and fungal vectors, have been described for replication and/or expression in a variety of eukaryotic and prokaryotic hosts. Non-limiting examples include pKK plasmids (Clonetech), pUC plasmids, pET
plasmids (Novagen, Inc., Madison, WI), pRSET or pREP plasmids (Invitrogen, San Diego, CA), or pMAL plasmids (New England Biolabs, Beverly, MA), and many appropriate host cells, using methods disclosed or cited herein or otherwise known to those skilled in the relevant art. Recombinant cloning vectors will often include one or more replication systems for cloning or expression, one or more markers for selection in the host, e.g., antibiotic resistance, and one or more expression cassettes.
The term "recombinant expression vector" means a genetically modified oligonucleotide or polynucleotide construct that permits the expression of an mRNA, protein, polypeptide, or peptide by a host cell, when the construct comprises a nucleotide sequence encoding the mRNA, protein, polypeptide, or peptide, and the vector is contacted with the cell under conditions sufficient to have the mRNA, protein, polypeptide, or peptide expressed within the cell. The vectors of the present disclosure are not naturally occurring as a whole.
Parts of the vectors can be naturally occurring. The non-naturally occurring recombinant expression vectors of the present disclosure can comprise any type of nucleotides, including, but not limited to DNA and RNA, which can be single-stranded or double-stranded, synthesized or obtained in part from natural sources, and which can contain natural, non-natural or altered nucleotides.
"Transfection," "transformation," or "transduction," as used herein, refer to the introduction of one or more exogenous polynucleotides into a host cell by using physical or chemical methods.
"Antibody," "fragment of an antibody," "antibody fragment," "functional fragment of an antibody," or "antigen-binding portion" are used interchangeably to mean one or more fragments or portions of an antibody that retain the ability to specifically bind to a specific antigen (Holliger et al., Nat. Biotech. (2005) 23(9): 1126). The present antibodies may be antibodies and/or fragments thereof. Antibody fragments include Fab, F(ab')2, scFv, disulfide linked Fv, Fc, or variants and/or mixtures. The antibodies may be chimeric, humanized, single chain, or hi-specific. All antibody isotypes are encompassed by the present disclosure, including, IgA, 1gD, IgE, IgG, and IgM. Suitable IgG subtypes include 1gGl, IgG2, IgG3 and IgG4. An antibody light or heavy chain variable region consists of a framework region interrupted by three hypervariable regions, referred to as complementarity determining regions (CDRs). The CDRs of the present antibodies or antigen-binding portions can be from a non-human or a human source. The framework of the present antibodies or antigen-binding portions can be human, humanized, non-human (e.g., a murine framework modified to decrease antigenicity in humans), or a synthetic framework (e.g., a consensus sequence).
The present antibodies or antigen-binding portions can specifically bind with a dissociation constant (Ku) of less than about 10-7 M, less than about 10-8M, less than about 10-9 M, less than about 10-1 M, less than about 10-11 M, or less than about 10-12 M. Affinities of the antibodies according to the present disclosure can be readily determined using conventional techniques (see, e.g., Scatchard et al., Ann. N.Y. Acad. Sci. (1949) 51:660;
and U.S. Patent Nos.
5,283,173, 5,468,614, or the equivalent).
The antigen recognition moiety of the engineered protein encoded by the nucleic acid sequence can contain any lineage antigen-specific, antigen-binding antibody fragment. The antibody fragment can comprise one or more CDRs, the variable region (or portions thereof), the constant region (or portions thereof), or combinations of any of the foregoing.
The term ''host cell" means any cell of any organism that is selected, modified, transformed, grown, used or manipulated in any way, for the production of a substance by the cell, for example, the expression by the cell of a gene, a DNA or RNA
sequence, a protein or an enzyme. Host cells can further he used for screening or other assays, as described herein.
The term "cell lineage" refers to cells with a common ancestry and developing from the same type of identifiable cell into specific identifiable/functioning cells.
The cell lineages used herein include, but are not limited to, respiratory, prostatic, pancreatic, mammary, renal, intestinal, neural, skeletal, vascular, hepatic, hematopoietic, muscle or cardiac cell lineages.
The term "inhibition" when used in reference to gene expression Or function of a lineage specific antigen refers to a decrease in the level of gene expression or function of the lineage specific antigen, where the inhibition is a result of interference with gene expression or function. The inhibition may be complete, in which case there is no detectable expression or function, or it may be partial. Partial inhibition can range from near complete inhibition to a near absence of inhibition.
The terms -treat", -treatment", and the like refer to a means to slow down, relieve, ameliorate or alleviate at least one of the symptoms of the disease, or reverse the disease after its onset.
"Treating" or "treatment" of a state, disorder or condition includes:
(1) preventing or delaying the appearance of clinical symptoms of the state, disorder, or condition developing in a person who may be afflicted with or predisposed to the state, disorder or condition but does not yet experience or display clinical symptoms of the state, disorder or condition; or (2) inhibiting the state, disorder or condition, i.e., arresting, reducing or delaying the development of the disease or a relapse thereof (in case of maintenance treatment) or at least one clinical symptom, sign, or test, thereof; or (3) relieving the disease, i.e., causing regression of the state, disorder or condition or at least one of its clinical or sub-clinical symptoms or signs.
The benefit to a subject to be treated is either statistically significant or at least perceptible to the patient or to the physician.
The terms -prevent", "prevention", and the like refer to acting prior to overt disease onset, to prevent the disease from developing or minimize the extent of the disease or slow its course of development.
An "immune response" refers to the development in the host of a cellular and/or antibody-mediated immune response to a composition or vaccine of interest.
Such a response usually consists of the subject producing antibodies, B cells, helper T cells, suppressor T cells, regulatory T cells, and/or cytotoxic T cells directed specifically to an antigen or antigens included in the composition or vaccine of interest.
A "therapeutically effective amount" or "effective amount" means the amount of a compound or agent that, when administered to an animal for treating a state, disorder or condition, is sufficient to affect such treatment. The "therapeutically effective amount" will vary depending on the compound, the disease and its severity and the age, weight, physical condition and responsiveness of the animal to be treated.
The compositions disclosed herein may include a -therapeutically effective amount" or a "prophylactically effective amount" of a compound described herein. A
"therapeutically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired therapeutic result. A therapeutically effective amount of an antibody or antibody portion may vary according to factors such as the disease state, age, sex, and weight of the individual, and the ability of the antibody or antibody portion to elicit a desired response in the individual. A therapeutically effective amount is also one in which any toxic or detrimental effects of the compound are outweighed by the therapeutically beneficial effects.
A "prophylactically effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
While it is possible to use a composition provided by the present disclosure for therapy as is, it may be preferable to administer it in a pharmaceutical formulation, e.g., in admixture with a suitable pharmaceutical excipient, diluent or carrier selected with regard to the intended route of administration and standard pharmaceutical practice. Accordingly, in one aspect, the present disclosure provides a pharmaceutical composition or formulation comprising at least one active composition, or a pharmaceutically acceptable derivative thereof, in association with a pharmaceutically acceptable excipient, diluent and/or carrier. The excipient, diluent and/or carrier must be "acceptable" in the sense of being compatible with the other ingredients of the formulation and not deleterious to the recipient thereof.
The compositions of the disclosure can be formulated for administration in any convenient way for use in human or veterinary medicine. The invention therefore includes within its scope pharmaceutical compositions comprising a product of the present invention that is adapted for use in human or veterinary medicine.
The term "pharmaceutical composition," as used herein, refers to a composition that can be administrated to a subject in the context of treatment and/or prevention of a disease or disorder. In some embodiments, a pharmaceutical composition comprises an active ingredient, e.g., the present fusion pol ypepti de, nucleic acid molecule, vector, agent, etc., and optionally a pharmaceutically acceptable excipient, diluent and/or carrier.
Acceptable excipients, diluents, and carriers for therapeutic use are well known in the pharmaceutical art, and are described, for example, in Remington: The Science and Practice of Pharmacy. Lippincott Williams & Wilkins (A. R. Gennaro edit. 2005). The choice of pharmaceutical excipient, diluent, and carrier can be selected with regard to the intended route of administration and standard pharmaceutical practice.
As used herein, the phrase "pharmaceutically acceptable" refers to molecular entities and compositions that are "generally regarded as safe", e.g., that are physiologically tolerable and do not typically produce an allergic or similar untoward reaction, such as gastric upset, dizziness and the like, when administered to a human. Preferably, as used herein, the term "pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopoeia or other generally recognized pharmacopeias for use in animals, and more particularly in humans.
The dosage of the therapeutic formulation will vary widely, depending upon the nature of the disease, the patient's medical history, the frequency of administration, the manner of administration, the clearance of the agent from the host, and the like. The initial dose may be larger, followed by smaller maintenance doses. The dose may be administered as infrequently as weekly or biweekly, or fractionated into smaller doses and administered daily, semi-weekly, etc., to maintain an effective dosage level. In some cases, oral administration will require a higher dose than if administered intravenously. In some cases, topical administration will include application several times a day, as needed, for a number of days or weeks in order to provide an effective topical dose.
The term "carrier" refers to a diluent, adjuvant, excipient, or vehicle with which the compound is administered. Such pharmaceutical carriers can be sterile liquids, such as water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, olive oil, sesame oil and the like. Water or aqueous solution saline solutions and aqueous dextrose and glycerol solutions are preferably employed as carriers, particularly for injectable solutions. Alternatively, the carrier can be a solid dosage form carrier, including but not limited to one or more of a binder (for compressed pills), a glidant, an encapsulating agent, a tlavorant, and a colorant. Suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin.
The term "agent" as used herein means a substance that produces or is capable of producing an effect and would include, but is not limited to, chemicals, pharmaceuticals, biologics, small organic molecules, antibodies, nucleic acids, peptides, and proteins.
The term "about" or "approximately" means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system, i.e., the degree of precision required for a particular purpose, such as a pharmaceutical formulation.
For example, "about" can mean within 1 or more than 1 standard deviations, per the practice in the art. Alternatively, "about" can mean a range of up to 20%, preferably up to 10%, more preferably up to 5%, and more preferably still up to 1% of a given value.
Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 5-fold, and more preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated, the term "about" meaning within an acceptable error range for the particular value should be assumed.
General techniques The practice of the present disclosure will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature, such as Molecular Cloning: A
Laboratory Manual, second edition (Sambrook, et al., 1989) Cold Spring Harbor Press;
Oligonucleoticie Synthesis (M. J. Gait, ed. 1984); Methods in Molecular Biology, Humana Press; Cell Biology: A Laboratory Notebook (J. E. Cellis, ed., 1989) Academic Press; Animal Cell Culture (R. I. Freshney, ed. 1987); Introduction to Cell and Tissue Culture (J. P. Mather and P. E. Roberts, 1998) Plenum Press; Cell and Tissue Culture: Laboratory Procedures (A.
Doyle, J. B. Griffiths, and D. G. Newell, eds. 1993-8) J. Wiley and Sons;
Methods in Enzymology (Academic Press, Inc.); Handbook of Experimental Immunology (D. M.
Weir and C. C. Blackwell, eds.): Gene Transfer Vectors for Mammalian Cells (J. M.
Miller and M. P.
Cabs, eds., 1987); Current Protocols in Molecular Biology (F. M. Ausubel, et al. eds. 1987);
PCR: The Polymerase Chain Reaction, (Mullis, et al., eds. 1994); Current Protocols in Immunology (J. E. Coligan et al., eds., 1991); Short Protocols in Molecular Biology (Wiley and Sons, 1999); Immunobiology (C. A. Janeway and P. Travers, 1997);
Antibodies (P. Finch, 1997); Antibodies: a practice approach (D. Catty., ed., IRL Press, 1988-1989);
Monoclonal antibodies: a practical approach (P. Shepherd and C. Dean, eds., Oxford University Press, 2000); Using antibodies: a laboratory manual (E. Harlow and D. Lane (Cold Spring Harbor Laboratory Press, 1999): The Antibodies (M. Zanetti and J. D. Capra, cds.
Harwood Academic Publishers, 1995); DNA Cloning: A practical Approach, Volumes I and II (D.N.
Glover ed.
1985); Nucleic Acid Hybridization (B.D. Hames & S.J. Higgins eds.(1985);
Transcription and Translation (B.D. Hames & S.J. Higgins, eds. (1984 ; Animal Cell Culture (R.I.
Freshney, ed.
(1986 ; Immobilized Cells and Enzymes (1RL Press, (1986).
The present disclosure provides for agents comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33) which can cause cell death of the cells expressing the lineage-specific cell-surface antigen. Immunotherapies involving the combination of an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33), and a polypeptide that binds a molecule expressed on an immune cell such as a natural killer (NK) cell and/or a T cell, would provide an efficacious method of treatment for hematopoietic malignancies.
The present disclosure provides for a first and a third engineered heterodimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds a molecule expressed on immune cells. In some embodiments, the immune cells are natural killer (NK) cells. In some embodiments, the molecule is ULBP. In some embodiments, the molecule is CD16.
The present disclosure provides for a second engineered heterodimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds a molecule expressed on T cells. In some embodiments, the molecule is CD3.
The present disclosure further provides for an engineered heterotrimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds to immune cells (e.g., NK cells); and (iii) a polypeptide that binds a molecule expressed on T cells (e.g., CD3).
See Figures 2, 9, and 10.
The present compositions and methods may help activate NKG2D-bearing immune effector cells, such as natural killer (NK) cells and/or CD8+ T cells. The present compositions and methods may enhance or prompt a cellular immune response against diseased cells (such as tumor cells) that may induce cytotoxicity (e.g., culminate in the death of the diseased cells such as tumor cells). The present compositions and methods may enhance a subject's immune response, including, but not limited to one or more of the following:
upregulation of natural killer (NK) cell; upregulation of T cell (e.g., gamma delta T cell, alpha beta T cell) function;
upregulation of natural killer T (NKT) cell function; and upregulation of B
cell function. In some embodiments, upregulation of one or more of NK cell, T cell, natural killer T (NKT) cell, and B cell function includes enhancement and/or endowment of activity capable of inhibiting or decreasing cancer progression.
In some embodiments, inhibiting cancer progression may be accomplished by cytolysis of tumor cells, e.g., by direct induction of tumor cell apoptosis, induction of tumor cell cytolysis through stimulation of intrinsic host antitumor responses, induction of tumor cell apoptosis through stimulation of intrinsic host antitumor responses, inhibition of tumor cell metastasis, inhibition of tumor cell proliferation, and induction of senescence in the tumor cell.
The present disclosure also provides one or more nucleic acid (polynucleotide) molecules encoding the present engineered proteins, agents or compositions.
Other aspects of the present disclosure provide vectors comprising any of the nucleic acid (or polynucleotide) molecules provided herein. Also, within the scope of the present disclosure are polynucleotides encoded by the nucleic acids described herein and cells expressing such polynucleotides.
In some embodiments, the cells can be obtained from a patient having a hematopoietic malignancy. In some embodiments, the cell is a hematopoietic cell, such as a hematopoietic stem cell (e.g., CD34 ). In some embodiments, cells are provided, e.g., for recombinant expression and purification of the engineered proteins provided herein. The cells include any cell suitable for recombinant protein expression, for example, cells comprising a genetic construct or vector expressing or capable of expressing an engineered proteins (e.g., cells that have been transformed or transfected with one or more vectors described herein, or cells having genomic modifications, for example, those that express a protein provided herein). Methods for transforming cells, genetically modifying cells, and expressing genes and proteins in such cells are well known in the art, and include those provided by, for example, Green and Sambrook, Molecular Cloning: A Laboratory Manual (4th ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2012)) and Friedman and Rossi, Gene Transfer:
Delivery and Expression of DNA and RNA, A Laboratory Manual (1st ed., Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (2006)).
Further, the present disclosure provides pharmaceutical compositions comprising the present agents, polypeptides, nucleic acid (or polynucleotide) molecules, vectors, cells, and/or compositions.
The present disclosure also provides for a method of treating a hematopoietic malignancy. The method may comprise administering to a subject in need thereof an effective amount of any of the disclosed engineered proteins or a polynucleotide encoding the engineered proteins. The method may comprise administering to a subject in need thereof an effective amount of the present agents or composition, or a polynucleotide encoding the agents (e.g., a combination of polypeptides) or compositions.
Another aspect of the present disclosure provides a method for treating a hematopoietic malignancy (or a hematological neoplasm), the method comprising administering to a subject in need thereof an effective amount of any of the disclosed engineered proteins or a polynucleotide encoding the engineered proteins. The method may comprise administering to a subject in need thereof an effective amount of the present agents or composition, or a polynucleotide encoding the agents (e.g., a combination of polypeptides) or compositions.
The present disclosure also relates to methods of using the engineered proteins to treat hematopoietic malignancies such as myeloid malignancies.
Also, within the scope of the present disclosure are kits comprising the present agents, polypeptides, nucleic acid (or polynucleotide) molecules, vectors, cells, and/or compositions.
Engineered Hetero Proteins The current disclosure provides for engineered hetero proteins.
In one embodiment, the present disclosure provides for a first and third engineered heterodimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds a molecule expressed on immune cells. In some embodiments, the immune cells are natural killer (NK) cells. In some embodiments, the molecule is ULB P. in some embodiments, the molecule is CD16.
In a further embodiment, the present disclosure provides for a second engineered heterodimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33); and (ii) a polypeptide that binds a molecule expressed on T cells. In some embodiments, the molecule is CD3.
In yet a further embodiment, the present disclosure provides for an engineered heterotrimer protein, comprising (or consisting essentially of, or consisting of): (i) an antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g..
CD33); and (ii) a polypeptide that binds to immune cells (e.g., NK cells); and (iii) a polypeptide that binds a molecule expressed on T cells (e.g., CD3).
In some embodiments, the third polypeptide is a chemokine or cytokine protein, which increases the immune response. The chemokine or cytokine protein includes but is not limited to CXCLs including CXCL14, GCSF, and interleukins, including IL2 and IL16.
In some embodiments, the antigen-binding fragment binds a lineage-specific cell-surface antigen that is a type 2 lineage-specific cell-surface antigen (e.g., CD33). In some embodiments, the antigen-binding fragment binds a lineage-specific cell-surface antigen that is a type 1 lineage-specific cell-surface antigen (e.g., CD19). In some embodiments, the antigen-binding fragment binds an antigen expressed or over-expressed by cancer and/or tumor cells.
The polypeptide that binds a molecule expressed on natural killer (NK) cells may be a fragment of fragment of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b , H60c, or HCMV UL18, homologs thereof, mutants thereof, or fragments thereof. The polypeptide that binds a molecule expressed on natural killer (NK) cells may be an ectodomain of ULBP1. ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, HCMV
UL18, homologs thereof, mutants thereof, or fragments thereof.
In certain embodiments, the fragment of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, or HCMV
comprises an ectodomain of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, or HCMV UL18. In certain embodiments, the fragment of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, or HCMV UL18 comprises an ectodomain of ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, Raetla, Raetlb, Raetic, Raetld, Raetle, H60b, H60c, HCMV UL18, homologs thereof, mutants thereof, or fragments thereof.
In some embodiments, the polypeptidc binds a molecule expressed on NK cells is an antibody of a cell surface marker of NK cells. In some embodiments, the cell surface marker is CD16. In some embodiments, the antibody is a monoclonal antibody.
In certain embodiments, the polypeptide that binds a molecule expressed on T
cells is an antibody of a cell surface marker of T cells. In some embodiments, the cell surface marker is CD3. In sonic embodiments, the antibody is a monoclonal antibody.
In certain embodiments, the first engineered heterodimer protein comprises:
(i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non -naturally occun-ing polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein. See Figures 1 and 10B.
In certain embodiments, antigen-binding fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (bi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment, an isolated CDR, diabodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. In some embodiments, scFv comprises a heavy chain variable region (Vii), and a light chain variable region (VL).
In some embodiments, the non-naturally occurring polypeptide domain comprising alpha helices is 6DMPa (Chen et al. 2019). In some embodiments, the non-naturally 5 occurring polypeptide domain comprising 1-5 alpha helices is 6DMPb (Chen et al. 2019).
In some embodiments, the covalent dimerization domains are IgG2 hinge domains.
In some embodiments, the covalent dimerization domains are IgG2 domains and IgG2 Fc domains. In some embodiments, the Fe domains are CH2 and CH3 domains.
The first engineered heterodimer protein can be designed to place the functional moieties (an antigen-binding fragment that binds a lineage-specific cell-surface antigen, and a polypeptide that binds a molecule expressed on NK cells) in any order. In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen is located at the N-terminus or C-terminus of the fusion polypeptide. In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells is located at the C-terminus or N-terminus of the fusion polypeptide.
In some embodiments, the first engineered heterodimer protein comprises, from N-terminus to C-terminus, a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19), and an ectodomain of ULBP1 (or an ectodomain of ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB). In some embodiments, the fusion polypeptide comprises, from N terminus to C terminus, an ectodomain of ULBP1 (or an ectodomain of ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB), and a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19).
The first engineered heterodimer protein may further comprise a signal sequence, and/or one or more linkers. In the fusion polypeptide, these functional moieties may be coval en tl y li gated continuously or non-continuously (e.g., they may be separated by 1 i nkers).
The linker may have up to 50, up to 40, up to 30, up to 20, up to 18, up to 15, up to 12, up to 11, or up to 10, amino acid residues in length. In certain embodiments, the linker has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10-20, 8-10, 8-12, 8-15, 8-20, or 8-30 amino acid residues in length. In certain embodiments, the linker has about 7-10, 7-12, 7-15, 7-20, or 7-30 amino acid residues in length.
One type of derivatized protein is produced by crosslinking two or more polypeptides (of the same type or of different types). Suitable crosslinkers include those that are heterobifunctional, having two distinct reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Useful detectable agents with which a protein can be derivatized (or labeled) include fluorescent agents, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, and radioactive materials. Non-limiting, exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, and phycoerythrin.
A polypeptide can also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, beta-galactosidase, acetylcholinesterase, glucose oxidase and the like. A
polypeptide can also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
The first engineered heterodimer protein can be derivatized or linked to another functional molecule. For example, first engineered heterodimer protein can be functionally linked (by chemical coupling, genetic fusion, noncovalent interaction) to one or more other molecular entities, such as an antibody or antibody fragment, a detectable agent, an immunosuppressant, a cytotoxic agent, a pharmaceutical agent, a protein or peptide that can mediate association with another molecule (such as a streptavidin core region or a polyhistidine tag), amino acid linkers, signal sequences, immunogenic carriers, or ligands useful in protein purification, such as glutathione-S-transferase, histidine tag, and staphylococcal protein A.
Cytotoxic agents may include radioactive isotopes, chemotherapeutic agents, and toxins such as enzymatically active toxins of bacterial, fungal, plant, or animal origin, and fragments thereof.
The first engineered heterodimer protein may further comprise a fragment (e.g., a tag) useful for polypeptide production and/or detection, including, but not limited to, poly-histidine (e.g., six histidine residues), a maltose binding protein, GST, green fluorescent protein (GFP), hemagglutinin, or alkaline phosphatasc, secretion signal peptides (e.g., preprotyrypsin signal sequence), Myc, and/or FLAG.
In one embodiment, the first engineered heterodimer protein comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 1 (Figure 3) and SEQ ID NO: 2 (Figure 4) or SEQ ID NO: 4 (Figure 6) and SEQ ID NO: 5 (Figure 7).
In one embodiment, the first engineered heterodimer protein comprises a signal sequence comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 966/9, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to an IL2 secretory signal sequence: MYRMQLLSCIALSLALVTNS (SEQ
ID NO:7) (Figures 3, 4, 6 and 8).
In one embodiment, the first engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to Myc: EQKLISEEDL (SEQ ID NO: 8) (Figures 3 and 6).
In one embodiment, the first engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to FLAG: DYKDDDDK (SEQ ID NO: 14) (Figures 4 and 7) In one embodiment, the first engineered heterodimer protein comprises an anti-scFv comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the anti-CD33 scEv disclosed in U.S. Patent Publication No.
20130078241.
In one embodiment, the first engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a light chain variable region (VI) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 9 (Figures 3 and 6).
Anti-CD33 Light Chain variable region (VI) (SEQ ID NO: 9):
EIVLTQS PGSLAVSPGERVTMSC KS S QSVFFS SS QKNYLAWYQQIPGQSPRLLIYWAS
TRESGVPDRFTGSGSGTDFTLTISSVQPEDLAIYYCHQYLSSRTFGQGTKLEIKR
In one embodiment, the first engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a heavy chain variable region (VH) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 10 (Figures 3 and 6):
Anti-CD33 Heavy Chain variable region (VH) (SEQ ID NO: 10):
QVQLQQPGAEVVKPGASVKMSCKASGYTFTSYYIHWIKQTPGQGLEWVGVIYPGND
DISYNQKFQGKATLTADKSSTTAYMQLSSLTSEDSAVYYCAREVRLRYFDVWGQGT
TVTVSSSSSA
In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of the full-length, or a fragment, of wildtype ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or HCMV UL18 (including human ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or HCMV UL18), or of the full-length, or a fragment, of the human homolog of Raetl a, Raetl h, Raet lc, Raetld, Raetle, H60b, H60c.
In one embodiment, human ULBP1 has a UniProt accession number Q9BZM6. In one embodiment, an ectodomain human ULBP1 comprises (or consists essentially of, or consists of) amino acid residues 27 to 216 of Q9BZM6-1.
In one embodiment, the first engineered heterodimer protein comprises a ULBP1 ectodomain comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 15 (Figures 4 and 7):
ULBP1 ectodomain (27 to 216 aa of Q9BZM6-1) (SEQ ID NO: 15):
WVDTHCLCYDFIITPKSRPEPQWCEVQGLVDERPFLHYDCVNHKAKAFASLGKKVN
VTKTWEE QTETLRDVVDFLKGQLLDIQVENLIPIEPLTLQARMS CEHEAHGHGRGSW
QFLFNGQKFLLFDSNNRKWTALHPGAKKMTEKWEKNRDVTMFFQKISLGDCKMW
LEEFLMYWEQMLDPTKPPSLAPG
In one embodiment, the first engineered heterodimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 12 (Figures 3 and 6).
6DMPa (SEQ ID NO: 12):
GTKEDILERQRKIIERAQEIHRRQQEILEELERIIRKPGSSEEAMKRMLKLLEESLRLLK
ELLELSEE S A QLLYEQR
In one embodiment, the first engineered heterodimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 16 (Figures 4 and 7).
6DMPb (SEQ TD NO: 16):
TEKRLLEEAERAHREQKEIIKKAQELHRRLEEIVRQSGSSEEAKKEAKKILEEIRELSK
RSLELLREILYLSQEQKGSLVPR
In one embodiment, the first engineered heterodimer protein comprises one or more covalent dimerization IgG2 hinge domains comprising (or consisting essentially of or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to IgG2 hinge:
ERKCCVECPPCP
(SEQ ID NO: 13) (Figures 3, 4, 6, and 7).
In one embodiment, the first engineered heterodimer protein comprises one or more covalent dimerization IgG2 Fe domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 19 (Figures 6 and 7).
IgG2 Fe Domain (SEQ ID NO: 19):
APPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA
KTKPREEQFNS TFRVVS VLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTIS KTKGQPR
EPQ V YTLPPSREEMTKN QV SLTCLV KGFYPSDIS V EWESNGQPENN Y KTTPPMLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALHNHYTQKSLSLSPGK
In one embodiment, the first engineered heterodimer protein comprises one or more linkers comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 11: GGGGSGGGGSGGGGS (Figures 3, 4, 6, and 7).
In further embodiments, the first engineered heterodimer protein comprises a His6 tag (HHHHHH; SEQ ID NO: 20).
In certain embodiments, the second engineered heterodimer protein comprises:
(i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on T
cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein.
In certain embodiments, antigen-binding fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (bi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment, an isolated CDR, diabodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. In some embodiments, scFv comprises a heavy chain variable region (VH), and a light chain variable region (VL).
In some embodiments, the non-naturally occurring polypeptide domain comprising 5 alpha helices is 6DMPa (Chen et al. 2019). In some embodiments, the non-naturally occurring polypeptide domain comprising 1-5 alpha helices is 6DMPh (Chen et al. 2019).
In some embodiments, the covalent dimerization domains are IgG2 hinge domains.
In some embodiments, the covalent dimerization domains are IgG2 domains and IgG2 Fe domains. In some embodiments, the Fe domains are CH2 and CH3 domains.
The second engineered heterodimer protein can be designed to place the functional moieties (an antigen-binding fragment that binds a lineage-specific cell-surface antigen, and a polypeptide that binds a molecule expressed on T cells) in any order. In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen is located at the N-terminus or C-terminus of the fusion polypeptide. In certain embodiments, the polypeptide that binds a molecule expressed on T cells is located at the C-terminus or N-terminus of the fusion polypeptide.
In some embodiments, the second engineered heterodimer protein comprises, from N-terminus to C-terminus, a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19), and a polypeptide that binds a molecule expressed on T cells (e.g., an anti-CD3 monoclonal antibody). In some embodiments, the fusion polypeptide comprises, from N
terminus to C terminus, a polypeptide that binds a molecule expressed on T
cells (e.g., an anti-CD3 mono clonal antibody). and a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19).
The second engineered heterodimer protein may further comprise a signal sequence, and/or one or more linkers. In the second engineered heterodimer, these functional moieties may be covalently ligated continuously or non-continuously (e.g., they may be separated by linkers). The linker may have up to 50, up to 40, up to 30, up to 20, up to 18, up to 15, up to 12, up to 11, or up to 10, amino acid residues in length. In certain embodiments, the linker has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10-20, 8-10, 8-12, 8-15, 8-20, or 8-30 amino acid residues in length. In certain embodiments, the linker has about 7-10, 7-12, 7-15, 7-20, or 7-30 amino acid residues in length.
One type of derivatized protein is produced by crosslinking two or more polypeptides (of the same type or of different types). Suitable crosslinkers include those that are heterobifunctional, having two distinct reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Useful detectable agents with which a protein can be derivatized (or labeled) include fluorescent agents, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, and radioactive materials. Non-limiting, exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, and, phycoerythrin. A polypeptide can also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, beta-galactosidase, acetylcholinesterase, glucose oxidase and the like. A
polypeptide can also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
The second engineered heterodimer protein can be derivatized or linked to another functional molecule. For example, second engineered heterodimer protein can be functionally linked (by chemical coupling, genetic fusion, noncovalent interaction, etc.) to one or more other molecular entities, such as an antibody or antibody fragment, a detectable agent, an immunosuppressant, a cytotoxic agent, a pharmaceutical agent, a protein or peptide that can mediate association with another molecule (such as a streptavidin core region or a polyhistidine tag), amino acid linkers, signal sequences, immunogenic carriers, or ligands useful in protein purification, such as glutathione-S-transferase, histidine tag, and staphylococcal protein A.
Cytotoxic agents may include radioactive isotopes, chemotherapeutic agents, and toxins such as enzymatically active toxins of bacterial, fungal, plant, or animal origin, and fragments thereof.
The second engineered heterodimer protein may further comprise a fragment (e.g., a tag) useful for polypeptide production and/or detection, including, but not limited to, poly-histidine (e.g., six histidine residues), a maltose binding protein, GST, green fluorescent protein (GFP), hemagglutinin, or alkaline phosphatase, secretion signal peptides (e.g., preprotyrypsin signal sequence). Myc, and/or FLAG.
In one embodiment, the second engineered heterodimer protein comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
Ill NO: 1 (Figure 3) and SEQ ID NO: 3 (Figure 5) or SEQ ID NO: 4 (Figure 6) and SEQ ID NO: 6 (Figure 8).
In one embodiment, the second engineered heterodimer protein comprises a signal sequence comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to an IL2 secretory signal sequence: MYRMQLLSCIALSLALVTNS (SEQ
ID NO:7) (Figures 3, 5, 6 and 8).
In one embodiment, the second engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to Myc: EQKLISEEDL (SEQ ID NO: 8) (Figures 3 and 6).
In one embodiment, the second engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to FLAG: DYKDDDDK (SEQ ID NO: 14) (Figures 5 and 8) In one embodiment, the second engineered heterodimer protein comprises an anti-CD33 scFv comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the anti-CD33 scFv disclosed in U.S. Patent Publication No.
20130078241.
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a light chain variable region (VI) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 9 (Figures 3 and 6).
Anti-CD33 Light Chain variable region (VL) (SEQ ID NO: 9):
EIVLTQSPGSLAVSPGERVTMSCKSSQSVFFSSSQKNYLAWYQQIPGQSPRLLIYWAS
TRESGVPDRFTGSGSGTDFTLTISSVQPEDLAIYYCHQYLSSRTFGQGTKLEIKR
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a heavy chain variable region (VH) comprising (or consisting essentially of, at consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%. at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 10 (Figures 3 and 6):
Anti-CD33 Heavy Chain variable region (VH) (SEQ ID NO: 10):
QVQLQQPGAEVVKPGASVKMSCKASGYTFTSYYTHWIKQTPGQGLEWVGVIYPGND
DISYNQKFQGKATLTADKSSTTAYMQLSSLTSEDSAVYYCAREVRLRYFDVWGQGT
TVTVSSSSSA
In certain embodiments, the polypeptide that binds a molecule expressed on T
cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of SEQ ID NOs: 17 and 18.
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD3, where the antigen-binding fragment comprises a heavy chain variable region (VH) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 17 (Figures 5 and 8):
Anti-CD3 Heavy Chain variable region (VH) (SEQ ID NO: 17):
DIKLQQSGAELARPGASVKMSCKTSGYTFTRYTMHWVKQRPGQGLGLEWIGYINPS
RGYTNYNQKFKDKATLTTD KSSSTAYMQLSSLTSEDSAVYYCARYYDDHYCLDYW
GQGTTLTVSS
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD3, where the antigen-binding fragment comprises a light chain variable region (VL) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 18 (Figures 5 and 8):
Anti-CD3 Light Chain variable region (VII) (SEQ ID NO: 18):
DIQLTQSPAIMSASPGGKVTMTCRASSSVSYMNWYQQKSGTSPKRWIYDTSKVASG
VPYRFTSYSLTISSMEAEDAATYYCQQWSSNPLTFGAGTKLELK
In one embodiment, the second engineered heterodimer protein comprises one or more non-naturally occurring pol ypepti de domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 12 (Figures 3 and 6).
6DMPa (SEQ ID NO: 12):
GTKEDILERQRKIIER A QEIHRR QQEILEELERIIRKPGSSEEAMKRMLKLLEESLRLLK
ELLELSEESAQLLYEQR
In one embodiment, the second engineered heterodimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 16 (Figures 5 and 8).
6DMPb (SEQ Ill NO: 16):
TEKRLLEEAERAHREQKEIIKKAQELHRRLEEIVRQSGSSEEAKKEAKKILEEIRELSK
RS LELLREILYLS QEQ KGSLVPR
In one embodiment, the second engineered heterodimer protein comprises one or more covalent dimerization IgG2 hinge domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to IgG2 hinge:
ERKCCVECPPCP
(SEQ Ill NO: 13) (Figures 3, 5, 6 and 8).
In one embodiment, the second engineered heterodimer protein comprises one or more covalent dimerization IgG2 Fc domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 19. (Figures 6 and 8).
IgG2 Fe Domain (SEQ ID NO: 19):
APPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA
KTKPREEQFNS TFRVVS VLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTIS KTKGQPR
EPQVYTLPPSREEMTKNQVSLTC LVKGFYPSDIS VEWESNGQPENNYKTTPPMLDSD
GSFFLYSKLTVDKSRWQQGNVFSCSVMHEALIINHYTQKSLSLSPGK
In one embodiment, the second engineered heterodimer protein comprises one or more linkers comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 966/9, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 11: GGGGSGGGGSGGGGS (Figures 3-8) or to SEQ ID
NO: 21: GGSGGSGGSGGSGG (Figures 5 and 8, CD3 VH-VL linker) or to SEQ ID NO:
22:
SGSGSG (Figures 5 and 8, linker within in CD3-VL) In further embodiments, the second engineered heterodimer protein comprises a His6 tag (HHHHHH; SEQ ID NO: 20).
In certain embodiments, the disclosure provides for a third engineered heterodimer protein which comprises: (i) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (ii) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain as described herein. See Figure 23.
In certain embodiments, antigen-binding fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (bi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment, an isolated CDR, diabodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. In some embodiments, scFv comprises a heavy chain variable region (Vn), and a light chain variable region (VL).
In some embodiments, the non-naturally occurring polypeptide domain comprising 5 alpha helices is 6DMPa (Chen et al. 2019). In some embodiments, the non-naturally occurring polypeptide domain comprising 1-5 alpha helices is 6DMPb (Chen et al. 2019).
In some embodiments, the covalent dimerization domains are IgG2 hinge domains.
In some embodiments, the covalent dimerization domains are IgG2 domains and IgG2 Fc domains. In some embodiments, the Fe domains are CH2 and CH3 domains.
The third engineered heterodimer protein can be designed to place the functional moieties (an antigen-binding fragment that binds a lineage-specific cell-surface antigen, and a polypeptide that binds a molecule expressed on NK cells) in any order. In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen is located at the N-terminus or C-terminus of the fusion polypeptide. In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells is located at the C-terminus or N-S terminus of the fusion polypeptide.
In some embodiments, the third engineered heterodimer protein comprises, from N-terminus to C-terminus, a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19), and a polypeptide that binds a molecule expressed on NK cells (e.g., an anti-CD16 monoclonal antibody). In some embodiments, the fusion polypeptide comprises, from N terminus to C terminus, a polypeptide that binds a molecule expressed on NK
cells (e.g., an anti-CD16 monoclonal antibody) and a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD] 9).
The third engineered heterodimer protein may further comprise a signal sequence, and/or one or more linkers. In the fusion polypeptide, these functional moieties may be covalently ligated continuously or non-continuously (e.g., they may be separated by linkers).
The linker may have up to 50, up to 40, up to 30, up to 20, up to 18, up to 15, up to 12, up to 11, or up to 10, amino acid residues in length. In certain embodiments, the linker has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10-20, 8-10, 8-12, 8-15, 8-20, or 8-30 amino acid residues in length. In certain embodiments, the linker has about 7-10, 7-12, 7-15, 7-20, or 7-30 amino acid residues in length.
One type of derivatized protein is produced by crosslinking two or more polypeptides (of the same type or of different types). Suitable crosslinkers include those that are heterobifunctional, having two distinct reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Useful detectable agents with which a protein can be derivatized (or labeled) include fluorescent agents, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, and radioactive materials. Non-limiting, exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, and phycoerythrin.
A polypeptide can also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, beta-galactosidase, acetylcholinesterase, glucose oxidase and the like. A
polypeptide can also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
The third engineered heterodimer protein can be derivatized or linked to another functional molecule. For example, the third engineered heterodimer protein can be functionally linked (by chemical coupling, genetic fusion, noncovalent interaction) to one or more other molecular entities, such as an antibody or antibody fragment, a detectable agent, an immunosuppressant, a cytotoxic agent, a pharmaceutical agent, a protein or peptide that can mediate association with another molecule (such as a streptavidin core region or a polyhistidine tag), amino acid linkers, signal sequences, immunogenic carriers, or ligands useful in protein purification, such as glutathione-S-transferase, histidine tag, and staphylococcal protein A.
Cytotoxic agents may include radioactive isotopes, chemotherapeutic agents, and toxins such as enzymatically active toxins of bacterial, fungal, plant, or animal origin, and fragments thereof.
The third engineered heterodimer protein may further comprise a fragment (e.g., a tag) useful for polypeptide production and/or detection, including, but not limited to, poly-histidine (e.g., six histidine residues), a maltose binding protein, GST, green fluorescent protein (GFP), hemagglutinin, or alkaline phosphatase, secretion signal peptides preprotyrypsin signal sequence), Myc, and/or FLAG.
In one embodiment, the third engineered heterodimer protein comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 500/c, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 1 (Figure 3) and SEQ ID NO: 26 (Figure 23A) or SEQ ID NO: 4 (Figure 6) and SEQ ID NO: 27 (Figure 23B).
Tn one embodiment, the third engineered heterodimer protein comprises a signal sequence comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to an IL2 secretory signal sequence: MYRMQLLSCIALSLALVTNS (SEQ
ID NO:7) (Figures 3, 4, and 23).
In one embodiment, the third engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 990/c, or about 100%, identical to Myc: EQKLISEEDL (SEQ ID NO: 8) (Figures 3 and 6).
In one embodiment, the third engineered heterodimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to FLAG: DYKDDDDK (SEQ Ill NO: 14) (Figure 23) In one embodiment, the third engineered heterodimer protein comprises an anti-scFv comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the anti-CD33 scFv disclosed in U.S. Patent Publication No.
20130078241.
In one embodiment, the third engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a light chain variable region (VL) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 9 (Figures 3 and 6).
Anti-CD33 Light Chain variable region (VL) (SEQ Ill NO: 9):
EIVLIQSPGSLAVSPGERVTMSCKSSQSVFFSSSQKNYLAWYQQIPGQSPRLLIYWAS
TRESGVPDRFTGSGSGTDFTLTISSVQPEDLAIYYCHQYLSSRTFGQGTKLEIKR
In one embodiment, the third engineered heterodimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a heavy chain variable region (Vri) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ Ill NO: 10 (Figures 3 and 6):
Anti-CD33 Heavy Chain variable region (VI)) (SEQ ID NO: 10):
QVQLQQPGAEVVKPGASVKMSCKASGYTFTSYYTHWIKQTPGQGLEWVGVIYPGND
DISYNQKFQGKATLTADKSSTTAYMQLSSLTSEDSAVYYCAREVRLRYFDVWGQGT
TVTVSSSSSA
In certain embodiments, the polypeptide that hinds a molecule expressed on NK
cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of SEQ ID NOs: 28 and 29.
In one embodiment, the second engineered heterodimer protein comprises an antigen-binding fragment that binds CD16, where the antigen-binding fragment comprises a heavy chain variable region (VII) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 28 (Figure 23):
Anti-CD16 Heavy Chain variable region (VI)) (SEQ ID NO: 28):
EVQLVESGGGVVRPGGSLRLSCAASGFTFDDYGMSWVRQAPGKGLEWVSGINWNG
GSTGYADSVKGRFTISRDNAKNSLYLQMNSLR AEDT AVYYCARGRSLLFDYWGQG
TLVTVSR
In one embodiment, the third engineered heterodimer protein comprises an antigen-binding fragment that binds CD16, where the antigen-binding fragment comprises a light chain variable region (VL) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 29 (Figure 23).
Anti-CD16 Light Chain variable region (Vii) (SEQ ID NO: 29):
SSELTQDPAVSVALGQTVRITCQGDSLRSYYASWYQQKPGQAPVLVIYGKNNRPSGI
PDRFSGSSSGNTASLTITGAQAEDEADYYCNSRDSSGNHVVFGGGTKLTVG
In one embodiment, the third engineered heterodimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 12 (Figures 3 and 6).
6DMPa (SEQ ID NO: 12):
GTKEDILERQRKIIERAQEIHRRQQEILEELERIIRKPGSSEEAMKRMLKLLEESLRLLK
ELLELSEESAQLLYEQR
In one embodiment, the third engineered heterodimer protein comprises one or more non-naturally occurring pol ypepti de domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ
ID NO: 16 (Figure 23).
6DMPb (SEQ ID NO: 16):
TEKRLLEEAER AHREQKEIIKK A QELHRRLEEIVR QSGS SEEA KKEA KKTLEETRELSK
RSLELLREILYLSQEQKGSLVPR
In one embodiment, the third engineered heterodimer protein comprises one or more covalent dimerization IgG2 hinge domains comprising (or consisting essentially of. or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to IgG2 hinge:
ERKCCVECPPCP
(SEQ ID NO: 13) (Figures 3 and 23).
In one embodiment, the third engineered heterodimer protein comprises one or more covalent dimerization IgG2 Fc domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 19 (Figures 6 and 23).
IgG2 Fc Domain (SEQ ID NO: 19):
APPVAGPSVFLFPPKPKDTLMISRTPEVTCVVVDVSHEDPEVQFNWYVDGVEVHNA
KTKPREEQFNS TFRVVS VLTVVHQDWLNGKEYKCKVSNKGLPAPIEKTIS KTKGQPR
EPQVYTLPPSREEMTKNQVSLTCLVKGFYPSDIS VEWE SNGQPENNYKTTPPMLD SD
GSEELYSKLTVDKSRWQQGN VFSCSVMHEALHNHYTQKSLSLSPGK
In one embodiment, the third engineered heterodimer protein comprises one or more linkers comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 11: GGGGSGGGGSGGGGS (Figures 3, 6, and 23) or to SEQ
ID NO: 30: GGGGSGGGGSGGGGSGGGGS (Figure 23, CD16 VH-VL linker).
In further embodiments, the third engineered heterodimer protein comprises a His6 tag (HHHHHH; SEQ ID NO: 20).
In certain embodiments, the engineered heterotrimer protein comprises: (i) a first polypeptide comprising a polypeptide that binds a molecule expressed on T
cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (al), and a first covalent dimerization domain; and (ii) a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (b1) and a second covalent dimerization domain; and (iii) a third polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (cl), and a third second covalent dimerization domain and (iv) a fourth polypeptide comprising three non- naturally occurring polypeptide domains comprising 1-5 alpha helices connected by amino acid linkers, wherein each domain is the binding domain of al, bl and cl (a2, b2 and c2), and a fourth, fifth and sixth covalent dimerization domain as described herein.
In certain embodiments, antigen-binding fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (hi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment, an isolated CDR, diabodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. In some embodiments, scFv comprises a heavy chain variable region (VH), and a light chain variable region (VL).
In some embodiments, the non-naturally occurring polypeptide domain comprising 5 alpha helices is 6DMPa (Chen et al. 2019). In sonic embodiments, the non-naturally occurring polypeptide domain comprising 1-5 alpha helices is 6DMPb (Chen et al. 2019).
In some embodiments, the covalent dimerization domains are IgG2 hinge domains.
In some embodiments, the covalent dimerization domains are IgG2 domains and IgG2 Fc domains. In some embodiments, the Fc domains are CH2 and CH3 domains.
The engineered heterotrimer protein can be designed to place the functional moieties (an antigen-binding fragment that binds a lineage-specific cell-surface antigen, and a polypeptide that binds a molecule expressed on NK cells, and a polypeptide that binds a molecule expressed on T cells) in any order. In certain embodiments, the polypeptide that binds a molecule expressed on T cells antigen-binding fragment is located at the N-terminus or C-terminus of the fusion polypeptide. In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells is located at the C-terminus or N-terminus of the fusion polypeptide.
In some embodiments, the engineered heterotrimer protein comprises, from N-terminus to C-terminus, a polypeptide that binds a molecule expressed on T cells, a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19) and an ectodomain of ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB) or a polypeptide that binds CD16.
In some embodiments, the fusion polypeptide comprises, from N terminus to C
terminus, an ectodomain of ULBP1 (or an ectodomain of ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, or MICB), a scFv that binds to the lineage-specific cell-surface antigen (e.g., CD33 or CD19) and a polypeptide that binds a molecule expressed on T cells.
The engineered heterotrimer protein may further comprise a signal sequence, and/or one or more linkers. In the fusion polypeptide, these functional moieties may be covalently ligated continuously or non-continuously (e.g., they may be separated by linkers (e.g., linker amino acid residues)). The linker may have up to 50, up to 40, up to 30, up to 20, up to 18, up to 15, up to 12, up to 11, or up to 10, amino acid residues in length. In certain embodiments, the linker has about 1, 2, 3, 4, 5, 6, 7, 8, 9, 10-20, 8-10, 8-12, 8-15, 8-20, or 8-30 amino acid residues in length. In certain embodiments, the linker has about 7-10, 7-12, 7-15, 7-20, or 7-30 amino acid residues in length.
One type of derivatized protein is produced by crosslinking two or more polypeptides (of the same type or of different types). Suitable crosslinkers include those that are h eterobi fun cti on al , having two distinct reactive groups separated by an appropriate spacer (e.g., m-maleimidobenzoyl-N-hydroxysuccinimide ester) or homobifunctional (e.g., disuccinimidyl suberate). Useful detectable agents with which a protein can be derivatized (or labeled) include fluorescent agents, various enzymes, prosthetic groups, luminescent materials, bioluminescent materials, and radioactive materials. Non-limiting, exemplary fluorescent detectable agents include fluorescein, fluorescein isothiocyanate, rhodamine, and, phycoerythrin. A polypeptide can also be derivatized with detectable enzymes, such as alkaline phosphatase, horseradish peroxidase, beta-galactosidase, acetylcholinesterase, glucose oxidase and the like. A
polypeptide can also be derivatized with a prosthetic group (e.g., streptavidin/biotin and avidin/biotin).
The engineered heterotrimer protein can be derivatized or linked to another functional molecule. For example, heterotrimer protein can be functionally linked (by chemical coupling, genetic fusion, noncovalent interaction, etc.) to one or more other molecular entities, such as an antibody or antibody fragment, a detectable agent, an inamunosuppressant, a cytotoxic agent, a pharmaceutical agent, a protein or peptide that can mediate association with another molecule (such as a streptavidin core region or a polyhistidine tag), amino acid linkers, signal sequences, immunogenic carriers, or ligands useful in protein purification, such as glutathione-S-transferase. histidine tag, and staphylococcal protein A. Cytotoxic agents may include radioactive isotopes, chemotherapeutic agents, and toxins such as enzymatically active toxins of bacterial, fungal, plant, or animal origin, and fragments thereof.
The engineered heterotrimer protein may further comprise a fragment (e.g., a tag) useful for polypeptide production and/or detection, including, but not limited to, poly-histidine (e.g., six histidine residues), a maltose binding protein, GST, green fluorescent protein (GFP), hemagglutinin, or alkaline phosphatase, secretion signal peptides (e.g., preprotyrypsin signal sequence), Myc, and/or FLAG.
In one embodiment, the engineered heterotrimer protein comprises one or more signal sequences comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to an 1L2 secretory signal sequence: MYRMQLLSCIALSLALVTNS (SEQ
ID NO:7) (Figures 3-8).
In one embodiment, the engineered heterotrimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to Myc: EQKLISEEDL (SEQ ID NO: 8) (Figures 3 and 6).
In one embodiment, the engineered heterotrimer protein comprises one or more tags comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%. at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to FLAG: DYKDDDDK (SEQ ID NO: 14) (Figures 4, 5, 7 and 8) In one embodiment, the engineered heterotrimer protein comprises a ULBP1 ectodomain comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 15 (Figures 4 and 7).
In one embodiment, the engineered heterotrimer protein comprises an anti-CD33 scFv comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the anti-CD33 scFv disclosed in U.S. Patent Publication No.
20130078241.
In certain embodiments, the polypeptide that binds a molecule expressed on NK
cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of SEQ ID NOs: 28 and 29 (Figure 23).
In one embodiment, the engineered heterotrimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a light chain variable region (VL) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 9 (Figures 3 and 6).
In one embodiment, the engineered heterotrimer protein comprises an antigen-binding fragment that binds CD33, where the antigen-binding fragment comprises a heavy chain variable region (VH) comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 820/c, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 10 (Figures 3 and 6):
In certain embodiments, the polypeptide that binds a molecule expressed on T
cells comprises (or consists essentially of, or consists of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to the amino acid sequence of SEQ ID NOs: 17 and 18 (Figures 5 and 8).
In one embodiment, the engineered heterotrimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least at about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 12 (Figures 3 and 6).
In one embodiment, the engineered heterotrimer protein comprises one or more non-naturally occurring polypeptide domain comprising 1-5 alpha helices comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 16 (Figures 5 and 8).
In one embodiment, the engineered heterotrimer protein comprises one or more covalent dimerization IgG2 hinge domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to IgG2 hinge:
ERKCCVECPPCP
(SEQ Ill NO: 13) (Figures 3-8).
In one embodiment, the engineered heterotrimer protein comprises one or more covalent dimerization IgG2 Fc domains comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%, at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 19. (Figures 6-8).
In one embodiment, the engineered heterotrimer protein comprises one or more linkers comprising (or consisting essentially of, or consisting of) an amino acid sequence at least or about 50%. at least about 55%, at least or about 60%, at least or about 70%, at least or about 75%, at least or about 80%, at least or about 81%, at least or about 82%, at least or about 83%, at least or about 84%, at least or about 85%, at least or about 86%, at least or about 87%, at least or about 88%, at least or about 89%, at least or about 90%, at least or about 91%, at least or about 92%, at least or about 93%, at least or about 94%, at least or about 95%, at least or about 96%, at least or about 97%, at least or about 98%, at least or about 99%, or about 100%, identical to SEQ ID NO: 11 GGGGSGGGGSGGGGS (Figures 3, 5, 6, and 8) or to SEQ
ID
NO: 21 GGGGGSGGSGGSGG or to SEQ ID NO: 22 SGSGSG (Figures 5 and 8) In further embodiments, the engineered heterotrimer protein comprises a His6 tag (HHHHHH; SEQ Ill NO: 20).
In some embodiments, the third polypeptide is a chemokine or cytokine protein, which increases the immune response. The chemokine or cytokine protein includes but is not limited to CXCLs including CXCL14, GCSF, and interleukins, including IL2 and ILI 6.
Shown herein is that the disclosed engineered proteins bind to and are cytotoxic against cells expressing CD33, such as HL60 and MOLM cells. Also shown is that when expression is increased in a cell, the binding efficiency of the engineered protein increases.
Additionally, the cytotoxicity of the engineered protein increases in cells such as MOLM, where CD33 expression is increased.
In certain embodiments, the antigen-binding fragment that hinds a lineage-specific cell-surface antigen (e.g., CD33) is a derivative, or a modified form, or a variant, of a fragment of the wildtype antigen-binding fragment.
In certain embodiments, the polypeptidc that binds a molecule expressed on natural killer (N K) cells is a derivative, or a modified form, or a variant, of a fragment of the wildtype polypeptide.
In certain embodiments, the polypeptide that binds a molecule expressed on T
cells is a derivative, or a modified form, or a variant, of a fragment of the wildtype polypeptide.
As used herein, the term variant also denotes any peptide, pseudopeptide (peptide incorporating non-biochemical elements) or protein differing from the wildtype protein or peptide, obtained by one or more genetic and/or chemical modifications.
Genetic and/or chemical modification may he understood to mean any mutation, substitution, deletion, addition and/or modification of one or more residues of the protein or peptide considered.
Chemical modification may refer to any modification of the peptide or protein generated by chemical reaction or by chemical grafting of biological or non-biological molecule(s) onto any number of residues of the protein.
The present polypeptides or peptides may include variants, analogs, orthologs, homologs and derivatives of amino acids or peptides. The present polypeptides or peptides may contain one or more analogs of amino acids (including, for example, non-naturally occurring amino acids, amino acids which only occur naturally in an unrelated biological system, modified amino acids etc.), peptides with substituted linkages, as well as other modifications known in the art. The present polypeptides or peptides may comprise a peptidomimetic, such as a peptoid. The present polypeptides or peptides may contain one or more amino acid residues modified by, e.g., glycosylation, acylation (e.g., acetylation, formylation, myristoylation, palmitoylation, lipoylation), alkylation (e.g., methylation), isoprenylation or prenylation (e.g., farnesylation, geranylgeranylation), sulfation, amidation, hydroxylation, succinylation, etc. The present polypeptides and agents may be glycosylated, sulfonated and/or phosphorylated and/or grafted to complex sugars or to a lipophilic compound such as, for example, a polycarbon chain or a cholesterol derivative.
Lineage-Specific Cell-Surface Antigens Aspects of the disclosure provide agents targeting a lineage-specific cell-surface antigen, for example on a target cancer cell. Such an agent may comprise an antigen-binding fragment that binds and targets the lineage-specific cell-surface antigen. In some instances, the antigen-binding fragment can be a single chain antibody (scFv) specifically binding to the lineage-specific antigen. As used herein, the terms "lineage-specific cell-surface antigen"
and "cell-surface lineage-specific antigen" may be used interchangeably and refer to any antigen that is sufficiently present on the surface of a cell and is associated with one or more populations of cell lineage(s). For example, the antigen may be present on one or more populations of cell lineage(s) and absent (or at reduced levels) on the cell-surface of other cell populations.
In general, lineage-specific cell-surface antigens can be classified based on a number of factors such as whether the antigen and/or the populations of cells that present the antigen are required for survival and/or development of the host organism. A summary of exemplary types of lineage-specific antigens is provide in Table 1 below.
Table 1. Classification of Lineage Specific Antigens Type of Lineage Characteristics of the Lineage Specific Antigen Specific Antigen Type 0 a) antigen is required for survival of an organism and b) cell type carrying type 0 antigen is required for survival of an organism and is not unique to a tumor, or tumor-associated virus Type 1 a) antigen is not required for survival of an organism and b) cell type carrying type 1 antigen is not required for survival of an organism Type 2 a) antigen is not required for survival of an organism and b) cell type carrying type 2 antigen is required for the survival of an organism Type 3 a) antigen is not required for the survival of an organism and b) cell type carrying antigen is not required for survival of an organism c) The antigen is unique to a tumor, or a tumor associated virus.
An example is the LMP-2 antigen in EBV infected cells, including EBV infected tumor cells (Nasopharyngeal carcinoma and Burldtts Lymphoma) Lineage specific antigens of type 1 class may be expressed in a wide variety of different tissues, including, ovaries, testes, prostate, breast, endometrium, and pancreas. In some embodiments, the agent targets a cell-surface lineage-specific antigen that is a type 1 antigen.
In some embodiments, the agent targets a cell-surface lineage-specific antigen that is a type 2 antigen. For example, CD33 is a type 2 antigen expressed in both normal myeloid cells as well as in Acute Myeloid Leukemia (AML) cells (Dohner et al.2015).
A wide variety of antigens may be targeted by the methods and compositions of the present disclosure. Monoclonal antibodies to these antigens may be purchased commercially or generated using standard techniques, including immunization of an animal with the antigen of interest followed by conventional monoclonal antibody methodologies, e.g., the standard somatic cell hybridization technique of Kohler and Milstein, Nature (1975) 256: 495, as discussed above. The antibodies or nucleic acids encoding for the antibodies may be sequenced using any standard DNA or protein sequencing techniques.
In some embodiments, the cell-surface lineage-specific antigen that is targeted using the methods and compositions described herein is a cell-surface lineage-specific antigen of leukocytes or a subpopulation of leukocytes. In some embodiments, the cell-surface lineage-specific antigen is an antigen that is associated with myeloid cells. In some embodiments, the cell-surface lineage-specific antigen is a cluster of differentiation antigens (CDs). Examples of CD antigens include, without limitation, CD1a, CD1b, CD1c, CD1d, CD1e, CD2, CD3, CD3d, CD3e, CD3g, CD4, CD5, CD6, CD7, CD8a, CD8b, CD9, CD10, CD11a, CD11b, CD1 lc, CD11d, Cllw12, CD13, CD14, CD15, CD16, CD16b, CD17, CD18, CD19, C1120, CD21, CD22, CD23, CD24, CD25, CD26, CD27, CD28, CD29, CD30, CD31, CD32a, CD32b, CD32e, CD33, CD34, CD35, CD36, CD37, CD38, CD39, CD40, CD41, CD42a, CD42b, CD42c, CD42d, CD43, CD44, CD45, CD45RA, CD45RB, CD45RC, CD45RO, CD46, CD47, CD48, CD49a, CD49b, CD49c, CD49d, CD49e, CD49f, CD50, CD51, CD52, CD53, CD54, CD55, CD56, CD57, CD58, CD59, CD60a, CD61, CD62E, CD62L, CD62P, CD63, CD64a, CD65, CD65s, CD66a, CD66b, CD66c, CD66F, CD68, CD69, CD70, CD71, CD72, CD73, CD74, CD75, CD75S, CD77, CD79a, CD79b, CD80, CD81, CD82, CD83, CD84, CD85A, CD85C, CD85D, CD85E, CD85F, CD85G, CD85H, CD85I, CD85J, CD85K, CD86, CD87, CD88, CD89, CD90, CD91 , CD92, CD93, CD94, CD95. CD96, CD97, CD98, CD99, CD99R, CD100, CD101, CD102, CD103, CD104, CD105, CD106, CD107a, CD107b, CD108, CD109, CD110, CD111, CD112, CD113, CD114, CD115, CD116, CD117, CD118, CD119, CD120a, CD120b, CD121a, CD121b, CD121a, CD121b, CD122, CD123, CD124, CD125, CD126, CD127, CD129, CD130, CD131, CD132, CD133, CD134, CD135, CD136, CD137, CD138, CD139, CD140a, CD140b, CD141, CD142, CD143, CD144, CDw145, CD146, CD147, CD148, CD150, CD152, CD152, CD153, CD154, CD155, CD156a, CD156b, CD156c, CD157, CD158b1, CD158b2, CD158d, CD158e1/e2, CD158f, CD158g, CD158h, CD158i, CD158j, CD158k, CD159a, CD159c, CD160, CD161, CD163, CD164, CD165, CD166, CD167a, CD168, CD169, CD170, CD171, CD172a, CD172b, CD172g, CD173, CD174, CD175, CD175s, CD176, CD177, CD178, CD179a, CD179b, CD180, CD181, CD182, CD183, CD184, CD185, CD186, CD191, CD192, CD193, CD194, CD195, CD196, CD197, CDw198, CDw199, CD200, CD201, CD202b, CD203c, CD204, CD205, CD206, CD207, CD208, CD209, CD210a, CDw210b, CD212, CD213a1, CD213a2, CD215, CD217, CD218a, CD218b, CD220, CD221, CD222, CD223, CD224, CD225, CD226, CD227, CD228, CD229, CD230, CD231, CD232, CD233, CD234, CD235a, CD235b, CD236, CD236R, CD238, CD239, CD240, CD241, CD242, CD243, CD244, CD245, CD246, CD247, CD248, CD249, CD252, CD253, CD254, CD256, CD257, CD258, CD261, CD262, CD263, CD264, CD265, CD266, CD267, CD268, CD269, CD270, CD271, CD272, CD273, CD274, CD275, CD276, CD277, CD278, CD279, CD280, CD281, CD282, CD283, CD284, CD286, CD288, CD289, CD290, CD292, CDw293, CD294, CD295, CD296, CD297, CD298, CD299, CD300a, CD300c, CD300e, CD301, CD302, CD303, CD304, CD305, 306, CD307a, CD307b, CD307c, D307d, CD307e, CD309, CD312, CD314, CD315, CD316, CD317, CD318, CD319, CD320, CD321, CD322, CD324, CD325, CD326, CD327, CD328, CD329, CD331, CD332, CD333, CD334, CD335, CD336, CD337, CD338, CD339, CD340, CD344, CD349, CD350, CD351, CD352, CD353, CD354, CD355, CD357, CD358, CD359, CD360, CD361, CD362 and CD363.
In some embodiments, the cell-surface lineage-specific antigen is CD19, CD20, CD11, CD123, CD56, CD34, CD14, CD33, CD66b, CD41, CD61, CD62, CD235a, CD146, CD326, LMP2, CD22, CD52, CD10, CD3/TCR, CD79/BCR, and CD26. In some embodiments, the cell-surface lineage-specific antigen is CD33 or CD19.
Alternatively or in addition, the cell-surface lineage-specific antigen may be a cancer antigen, for example a cell-surface lineage-specific antigen that is differentially present on cancer cells. In some embodiments, the cancer antigen is an antigen that is specific to a tissue or cell lineage. Examples of cell -surface lineage-specific antigen that are associated with a specific type of cancer include, without limitation. CD20, CD22 (Non-Hodgkin's lymphoma, B-cell lymphoma, chronic lymphocytic leukemia (CLL)), CD52 (B-cell CLL), CD33 (Acute myelogenous leukemia (AML)). CD10 (gp100) (Common (pre-B) acute lymphocytic leukemia and malignant melanoma), CD3/T-cell receptor (TCR) (T-cell lymphoma and leukemia), CD79/B-cell receptor (BCR) (B-cell lymphoma and leukemia), CD26 (epithelial and lymphoid malignancies), human leukocyte antigen (HLA)-DR, HLA-DP, and HLA-DQ (lymphoid malignancies), CD307e and BCMA (myeloma), RCAS1 (gynecological carcinomas, biliary adenocarcinomas and ductal adenocarcinomas of the pancreas), C1audin3, TMPRSS3 and Her2 (ovarian cancer), Hcr2 (breast cancer) as well as prostate specific membrane antigen. In some embodiments, the cell-surface antigen CD33 and is associated with AML cells.
In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33) has up to or about 500, up to or about 490, up to or about 480, up to or about 470, up to or about 460, up to or about 450, up to or about 440, up to at about 430, up to or about 420, up to or about 410, up to or about 400, up to or about 390, up to or about 380, up to or about 370, up to or about 360, up to or about 350, up to or about 340, up to or about 330, up to or about 320, up to or about 310, up to or about 200, up to or about 190, up to or about 180, up to or about 170, up to or about 160, up to or about 150, up to or about 140, up to or about 130, up to or about 120, up to or about 110, up to or about 100, up to or about 90, up to or about 80, up to or about 70, up to or about 60, up to or about 50, up to or about 40, up to or about 30, up to or about 20, up to or about 15, or up to or about 10, amino acid residues in length. In certain embodiments, the antigen-binding fragment that binds a lineage-specific cell-surface antigen (e.g., CD33) has about 100-200, 80-210, 80-250, 150-250, 100-30, 50-200, 150-250, 150-300, 300-400, 200-400, 400-500, or 150-190 amino acid residues in length.
NK cell surface receptor-bindin2 peptides In certain embodiments, the present fusion polypeptide or composition comprises a polypeptide that binds to a molecule expressed on natural killer (NK) cells, such as a C-type lectin-like receptor (e.g., NKG2D).
A C-type lectin-like NK cell receptor may be a receptor expressed on the surface of natural killer cells. Exemplary NK cell receptors of this type include, but are not limited to, NKG2D (GENBANK accession number BC039836), Dectin-1 (GENBANK accession number AJ312373 or AJ312372), Mast cell function-associated antigen (GENBANK
accession number AF097358), HNKR-PlA (GENBANK accession number U11276), LLT1 (GENBANK
accession number AF133299), CD69 (GENBANK accession number NM_001781), CD69 homolog, CD72 (GENBANK accession number NM_001782), CD94 (GENBANK accession number NM_002262 or NM_007334), KLRF1 (GENBANK accession number NM_016523), Oxidised LDL receptor (GENBANK accession number NM 002543), CLEC-1, CLEC-2 (GENBANK accession number NM 016509), NKG2C (GENBANK accession number AJ001684), NKG2A (GENBANK accession number AF461812), NKG2E (GENBANK
accession number AF461157), WUGSC:H_DJ0701016.2. or Myeloid DAP12-associating lectin (MDL-1; GENBANK accession number AJ271684). In particular embodiments, the NK
cell receptor is human NKG2D or human NKG2C.
As used herein, the terms "Natural Killer Group 2D", "NKG2D" and "NKG2D
receptor", also known as KLRK1, refer to an activating cell surface molecule that is found on numerous types of immune cells, particularly NK cells, CD8+ T cells, some CD4+
T cells, and gamma delta T cells. The terms NKG2D and NKG2D receptor include variants, isoforms, and homologs of human NKG2D receptor (see, e.g., the isoforms described in Diefenbach et al., Nat Immunol. (2002) 3(12):1142-9). NKG2D is a type II transmembrane protein with an extracellular C-type (i.e., Ca2'-binding) lectin-like domain but lacking the Ca2 binding site. It can form heterodimers with adapter proteins such as DAP10 Or DAP12, and recognizes protein ligands that include, but are not limited to, MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, and ULBP6.
In certain embodiments, the NKG2D-binding peptide is an agonist of NKG2D. In certain embodiments, the NKG2D-binding peptide is an antagonist of NKG2D. In certain embodiments, the NKG2D-binding peptide is neither an antagonist nor an agonist of NKG2D.
The polypeptide that binds a molecule expressed on NK cells may be a ligand for a NK
cell surface receptor, such as a ligand for the N KG2D cell surface receptor.
Non-limiting examples of the ligands for NKG2D (or the NKG2D ligands) include, an MHC class I chain-related (MIC) antigen such as MICA and MICB. a UL16 binding protein (ULBP) such as ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, and the like (Bahram Adv. Immunol.
(2000) 76:1-60; Cerwenka and Lanier Immunol. Rev. (2001) 181:158-169; Cosman, et al.
Immunity (2001) 14:123-133; Kubin, et al. Eur. J. Immunol. (2001) 31:1428-1437). Murine NKG2D ligands include, for example, the retinoic acid early inducible-1 gene products (RAE-1) and minor hi stocompatibility antigen peptide H60. NK cells can be regulated by interaction of immunomodulating polypeptide ligands with receptors on the NK cell surface.
For example, ligands for the NKG2D receptor that can regulate NK cell activity, include chemokines such as muCCL21, and stress-inducible polypeptide ligands such as MHC class I chain-related antigens and ULL16 binding proteins. Murine H60 minor histocompatibility antigen peptide is reported to bind to the NKG2D receptor, as well. See, e.g., Robertson et al.
Cell Immunol.
(2000) 199(1):8-14; Choi et al. Immunity (2002) 17(5):593-603, and Farag et al., Blood. (2002) 100(6):1935-1947. As used herein, the term "NKG2D ligand" refers to a binding partner that binds specifically to an NKG2D receptor. Exemplary ligands include MICA, MICB, ULBP1, ULBP2, ULBP3, ULBP4, ULBPS, ULBP6, and functional fragments thereof, such as soluble forms of MIC and ULBP proteins.
Table 2 lists exemplary NKG2D binding proteins and domains.
Table 2. NKG2D binding proteins and domains Protein Gene names Uniport NKG2D
ID binding domain*
UL16-binding protein ULBP1/RAET1I Q9BZM6 27-216 UL16-binding protein ULBP2/RAET1H Q9BZM5 26-217 UL16-binding protein ULBP3/RAET1N Q9BZM4 30-217 UL16-binding protein ULBP4/RAET1E Q8TD07 31-225 UL-16 binding protein ULBP5/RAET1G Q6H3X3 26-223 UL16-binding protein ULBP6/RAET1L Q5VY80 26-218 MHC class I MICA Q29983 24-307 polypeptide-related sequence A
MHC class I MICB Q29980 23-309 polypeptide-related sequence B
Retinoic acid early-inducible protein 1-alpha Raet 1 a 008602 29-229 Retinoic acid early-inducible protein 1-beta Raetlb 008603 29-229 Retinoic acid early-inducible protein 1-gamma Ractic 008604 29-227 Retinoic acid early-inducible protein 1-delta Raetld Q9JI58 29-225 Retinoic acid early-inducible protein 1-epsilon Raetle Q9CZQ6 29-225 Histocompatibility antigen 60h H60b B1B212 25-251 Histocompatibility antigen 60c H60c B1B213 18-177 * The start and end amino acids numbers are based on the sequence of protein identified by the uniport ID.
The MIC and ULBP proteins act as ligands that bind to C-type lectin-like activating receptor Natural Killer Group 2D (NKG2D) on immune effector cells, including NK cells, NKT cells, alpha beta CD8+ T cells, and gamma delta CD8+ T cells.
As used herein, the term "ULBP protein" refers to members of the MHC class I-related molecules having a characteristic organization for the unprocessed protein that includes a N-terminal signal sequence, centrally located alpha-1 and alpha-2 domains, and a C-terminal cell membrane association domain, which can be a glycosylphosphatidylinositol (GPI) anchoring domain or a transmembrane domain. Some species of ULBP protein have a cytoplasmic domain. Generally, ULBP proteins have weak amino acid sequence identity to MI
C A/MICB
proteins. ULBP family members are ligands for the effector cell receptor NKG2D, and are known to activate NK cells. As used herein. "ULBP protein" includes active variants, isoforms, and species homologs of human ULBP protein, and includes fragments having receptor binding activity.
As used herein, the term "ULBP1", also described as "retinoie acid early transcript 1 protein" or "RAET1", refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP1. The protein functions as a ligand for receptor NKG2D. ULBP1 protein activates multiple signaling pathways in primary NK cells.
The C terminal membrane association domain in ULBP1 comprises a GPI domain.
ULBP1 is weakly homologous with MICA and MICB and has about 55% to 60% amino acid sequence identity to ULBP2 and ULBP3. Exemplary sequence of human ULBP1 is available as NCBI
accession no. NP_079494.1. DNA and protein sequences for human ULBP1 have been reported by Cosman et al., Immunity (2001) 14(2):123-133, DNA Accession No.
AF304377 in the EMBL database of the European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK.
As used herein, the term "ULBP2", also described as "retinoic acid early transcript 1H
protein" or "RAET1H", refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP2. The protein functions acts as a ligand for receptor NKG2D. ULBP2 activates multiple signaling pathways in primary NK
cells. The C
terminal membrane association domain in ULBP2 comprises a GPI domain. ULBP2 is weakly homologous with MICA and MICB and has about 55% and 60% amino acid sequence identity to ULBP1 and ULBP3. Exemplary sequence of human ULBP2 is available as NCBI
accession no. NP_079493.1. DNA and protein sequences for human ULBP2 have been reported by Cosman et al., Immunity (2001) 14(2):123-133, DNA Accession No. AF304378 in the EMBL
database of the European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK.
As used herein, the term "ULBP3", also described as "retinoic acid early transcript 1N
protein" or "RAET1N", refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP3. The protein functions as a ligand for receptor NKG2D. The C terminal membrane association domain in ULBP2 comprises a GPI
anchoring domain. ULBP3 activates multiple signaling pathways in primary NK
cells. ULBP3 is weakly homologous with MICA and MICB. Exemplary sequence of human ULBP3 is available as NCBI accession no. NP_078794.1. DNA and protein sequences for ULBP3 have been reported by Cosman et al., Immunity (2001) 14(2):123-133, DNA Accession No.
AF304379 in the EMBL database of the European Bioinformatics Institute, Wellcome Trust Genome Campus, Hinxton, Cambridge CB10 1SD, UK.
As used herein, the term "ULBP4", also described as "retinoic acid early transcript lE
protein" or "RAET1E'', refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP4. The protein functions as a ligand for receptor NKG2D. The C terminal region of ULBP4 comprises a transmembrane domain and a cytoplasmic domain, (see, e.g., U.S. patent publication US20090274699). ULBP4 is involved in activating NK cells through its binding to receptor NKG2D and induces NK-mediated lysis (see, e.g., Kong et al., Blood (2009) 114(2):310-17). ULBP4 has higher sequence identity to ULBP3 than ULBP1 and ULBP2. Exemplary amino acid sequences of human ULBP4 are available as NCBI accession nos. NP_001230254.1; NP 001230256.1; NP
001230257.1; and NP 631904.1. As used herein, the term "ULBP5", also described as ''retinoic acid early transcript 1G protein" or "RAET1G", refers to a member of the MHC class I
family, including variants, isoforms, and species homologs of human ULBP5. The C-terminal region of the protein has a transmembrane domain and a cytoplasmic domain. ULBP5 is involved in activating NK cells and NK cell-mediated cytotoxicity through its binding to receptor NKG2D.
Exemplary sequence of human ULBP5 is available as NCBI accession no.
NP_001001788.2.
As used herein, the term "ULBP6", also described as "retinoic acid early transcript 1L
protein" or "RAET1L'', refers to a member of the MHC class I family, including variants, isoforms, and species homologs of human ULBP6. ULBP6 contains a GPI anchoring domain, similar to ULBP1, ULBP2, and ULBP3. ULBP6 is involved in activating NK cells and NK
cell mediated cytotoxicity through its binding to receptor NKG2D. Exemplary sequence of human ULBP6 is available as NCBI accession no. NP_570970.2.
As with MICA and MICB, a known function of ULBP proteins is binding to NKG2D
receptor and activating NK cell activity.
MICA is MHC class 1 chain-related gene A protein (MICA), including variants, isoforms, and homologs of human MICA, and includes fragments of MICA having functional MICA activity. MICA protein comprises three extracellular Ig-like domains, i.e., alpha-1, alpha-2 and alpha-3, a transmembrane domain, and an intracellular domain. The protein is expressed at low levels in cells of the gastric epithelium, endothelial cells and fibroblasts and in the cytoplasm of keratinocytes and monocytes. An exemplary sequence of MICA
is available as NCBI Accession Nos. NP_000238.1. Other exemplary MICA sequences can be found in U.S. patent publication 20110311561.
MICB is MHC class I chain-related gene B protein (MICB), including variants, isoforms, and homologs of human MICB, and includes fragments of MICE having functional MICB activity. MICB has about 84% sequence identity to MICA. MICB protein comprises three extracellular Ig-like domains, i.e., alpha-1, alpha-2 and alpha-3, a transmembrane domain, and an intracellular domain. An exemplary sequence of MICB is available as UniProtKB accession number Q29980.1. Other exemplary MICB sequences can be found in U.S. patent publication 20110311561.
The NKG2D ligands (ligands for the NKG2D receptor) may also include an anti-NKG2D antibody or its fragment (e.g., an antigen-binding portion or fragment thereof), including, but not limited to, all or part of antibody that specifically recognizes or binds to NKG2D. Such antibodies can be monoclonal or polyclonal antibodies. Antibodies can also be variant antibodies, such as chimeric antibodies, humanized antibodies, single chain antibodies, and hybrid antibodies comprising immunoglobulin chains capable of binding NKG2D. in particular embodiments, the antibody comprises a single chain variable fragment. In particular embodiments, the antibody is 16F16, 16F31, MS, or 21F2, as set forth in U.S.
Pat. No.
7,879,985, which is hereby incorporated by reference. The antibody fragment can be any suitable fragment as discussed herein.
In certain embodiments, the hetero protein or composition comprises a polypeptide that binds to a molecule expressed on natural killer (NK) cells that is CD16.
Such a polypeptide may comprise an antigen-binding fragment that binds and targets the molecule expressed on NK cells. In some instances, the antigen-binding fragment can be a single chain antibody (scFv) specifically binding to the molecule expressed on NK cells A wide variety of antigens may be targeted by the methods and compositions of the present disclosure. Monoclonal antibodies to these antigens may be purchased commercially or generated using standard techniques, including immunization of an animal with the antigen of interest followed by conventional monoclonal antibody methodologies, e.g., the standard somatic cell hybridization technique of Kohler and Milstein, Nature (1975) 256: 495, as discussed above. The antibodies or nucleic acids encoding for the antibodies may be sequenced using any standard DNA or protein sequencing techniques.
In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells has up to or about 500, up to or about 490, up to or about 480, up to or about 470, up to or about 460, up to or about 450, up to or about 440, up to or about 430, up to or about 420, up to or about 410, up to or about 400, up to or about 390, up to or about 380, up to or about 370, up to or about 360, up to or about 350, up to or about 340, up to or about 330, up to or about 320, up to or about 310, up to or about 200, up to or about 190, up to or about 180, up to or about 170, up to or about 160, up to or about 150, up to or about 140, up to or about 130, up to or about 120, up to or about 110, up to or about 100, up to or about 90, up to or about 80, up to or about 70, up to or about 60, up to or about 50, up to or about 40, up to or about 30, up to or about 20, up to or about 15, or up to or about 10, amino acid residues in length. In certain embodiments, the polypeptide that binds a molecule expressed on natural killer (NK) cells has about 100-200, 80-210, 80-250, 150-250, 100-30, 50-200, 150-250, 150-300, or 150-190 amino acid residues in length.
Molecules Expressed on T cells Aspects of the disclosure provide agents targeting a molecule expressed on T
cells.
Such an agent may comprise an antigen-binding fragment that binds and targets the molecule expressed on T cells. In some instances, the antigen-binding fragment can be a single chain antibody (scFv) specifically binding to the molecule expressed on T cells A wide variety of antigens may be targeted by the methods and compositions of the present disclosure. Monoclonal antibodies to these antigens may be purchased commercially or generated using standard techniques, including immunization of an animal with the antigen of interest followed by conventional monoclonal antibody methodologies, e.g., the standard somatic cell hybridization technique of Kohler and Milstein, Nature (1975) 256: 495, as discussed above. The antibodies or nucleic acids encoding for the antibodies may be sequenced using any standard DNA or protein sequencing techniques.
In certain embodiments, the antigen-binding fragment that binds a molecule expressed on T cells lineage-specific cell-surface antigen (e.g., CD3) has up to or about 500, up to or about 490, up to or about 480, up to or about 470, up to or about 460, up to or about 450, up to or about 440, up to or about 430, up to or about 420, up to or about 410, up to or about 400, up to or about 390, up to or about 380, up to or about 370, up to or about 360, up to or about 350, up to or about 340, up to or about 330, up to or about 320, up to or about 310, up to or about 200, up to or about 190, up to or about 180, up to or about 170, up to or about 160, up to or about 150, up to or about 140, up to or about 130, up to or about 120, up to or about 110, up to or about 100, up to or about 90, up to or about 80, up to or about 70, up to or about 60, up to or about 50, up to or about 40, up to or about 30, up to or about 20, up to or about 15, or up to or about 10, amino acid residues in length. In certain embodiments, the antigen-binding fragment that binds a molecule expressed on T cells (e.g., CD3) has about 100-200, 80-210, 80-250, 150-250, 100-30, 50-200, 150-250, 150-300, 300-400, 200-400, 400-500, or 150-190 amino acid residues in length.
Non-Naturally Occurring Polypeptide Domain Aspects of the disclosure use a 6DMP heterodimer approach which is based on four helices _________________________________________________________________________ in some heterodimer designs, each protein monomer has two helices, in others, 3-to-1-which create four binding networks along the helix that ultimately favor only a heterodimer forming this network. The 6DMP heterodimerization network generates three hydrogen-bond networks and one hydrophobic core. The four helices are separated into two protein sequences, with each contributing two helices. The highly-specific four-helix structure forms only heterodimers between its partner proteins. It is known to be useful in facilitating intranuclear processes but has not been tested as a facilitator of cell-to-cell interactions.
In some embodiments, the non-naturally occurring polypcptide domain comprising 5 alpha helices is 6DMPa (SEQ ID NO: 12). In some embodiments, the non-naturally occurring polypeptide domain comprising 1-5 alpha helices is 6DMPh (SEQ ID NO:
16).
See Chen et al. 2019, incorporated in its entirety by reference herein.
Antigen-Binding Fragment The antigen-binding fragment may be an antibody fragment. The antibody or antibody fragment may be any of the immunoglobulin classes (e.g., IgA, IgD, IgE, IgG, and IgM) and subclasses, so long as they are capable of binding. In certain embodiments, the antibody fragment has an antigen-binding portion. In certain embodiments, antibody fragments include, but are not limited to, Fab, F(ab')2, Fab', F(ab)', Fv, a disulfide linked Fv, single chain Fv (scFv), bivalent scFv (bi-scFv), trivalent scFv (tri-scFv), Fd, dAb fragment (e.g., Ward et al., Nature, (1989) 341:544-546), an isolated CDR, diabodies, affibodies, triabodies, tetrabodies, linear antibodies, single-chain antibody molecules. Single chain antibodies produced by joining antibody fragments using recombinant methods, or a synthetic linker, are also encompassed by the present disclosure. Bird et al. Science, (1988), 242:423-426. Huston et al., Proc. Natl. Acad. Sci. USA. (1988), 85:5879-5883. Antibody fragments comprise only a portion of an intact antibody, generally including an antigen binding site of the intact antibody and thus retaining the ability to bind antigen. Examples of antibody fragments encompassed by the present invention include: the Fab fragment, having a light chain variable domain (VL), light chain constant domain (CL), heavy chain variable domain (VH), and heavy chain constant domain (CH); the Fab' fragment, which is a Fab fragment having one or more cysteine residues at the C-terminus of the Cu domain; the Fd fragment having VH and Cu domains;
the Fd' fragment having VH and CH domains and one or more cysteine residues at the C-terminus of the CH domain; the Fv fragment having the VL and VH domains of a single arm of an antibody;
the dAb fragment (Ward et al., Nature (1989) 341:544-546) which consists of a VH domain;
isolated CDR regions; F(ab')2 fragments, a bivalent fragment including two Fab' fragments linked by a disulphide bridge at the hinge region; single chain antibody molecules (Bird et al., Science (1988) 242:423-426; and Huston et al., PNAS (1988) 85:5879-5883;
diabodies with two antigen binding sites, comprising a VH domain connected to a VL domain in the same polypeptide chain (see, e.g., WO 93/11161 to Whitlow et al. and Hollinger et al., PNAS (1993) 90:6444-6448; affibodies which are triple helix high affinity peptides (see, e.g., Nygren, "FEBS
Journal (2008) 275:2668-2676,), and linear antibodies comprising a pair of tandem Fd segments (VH-CH1-VH-CH1) which, together with complementary light chain polypeptides, form a pair of antigen binding regions (Zapata et al., Protein Eng. (1995) 8(10):1057-1062;
U.S. Patent No. 5,641,870; U.S. Patent No. 8,580,755).
Any antibody or an antigen-binding fragment thereof can he used for constructing the agent that targets a lineage-specific cell-surface antigen as described herein. Such an antibody or antigen-binding fragment can be prepared by a conventional method, for example, the hybridoma technology or recombinant technology.
For example, antibodies specific to a lineage-specific antigen of interest can be made by the conventional hybridoma technology. The lineage-specific antigen, which may be coupled to a carrier protein such as KLH, can be used to immunize a host animal for generating antibodies binding to that complex. The route and schedule of immunization of the host animal are generally in keeping with established and conventional techniques for antibody stimulation and production, as further described herein. General techniques for production of mouse, humanized, and human antibodies are known in the art and are described herein.
It is contemplated that any mammalian subject including humans or antibody producing cells therefrom can be manipulated to serve as the basis for production of mammalian, including human hybridoma cell lines. Typically, the host animal is inoculated intraperitoneally, intramuscularly, orally, subcutaneously, intraplantar, and/or intradermally with an amount of immunogen, including as described herein.
Hybridomas can be prepared from the lymphocytes and immortalized myeloma cells using the general somatic cell hybridization technique of Kohler, B. and Milstein, C. (1975) Nature 256:495-497 or as modified by Buck, et al., In Vitro, (1982)18:377-381.
Available myeloma lines, including but not limited to X63-Ag8.653 and those from the Salk Institute, Cell Distribution Center, San Diego, Calif., USA, may be used in the hybridization. Generally, the technique involves fusing myeloma cells and lymphoid cells using a fusogen such as polyethylene glycol, or by electrical means well known to those skilled in the art. After the fusion, the cells are separated from the fusion medium and grown in a selective growth medium, such as hypoxanthine-aminopterin-thymidine (HAT) medium, to eliminate unhybridized parent cells. Any of the media described herein, supplemented with or without scrum, can be used for culturing hybridomas that secrete monoclonal antibodies. As another alternative to the cell fusion technique, EB V immortalized B cells may be used to produce the TCR-like monoclonal antibodies described herein. The hybridomas are expanded and subcloned, if desired, and supernatants are assayed for anti-immunogen activity by conventional immunoassay procedures (e.g., radioimmunoassay, enzyme immunoassay, or fluorescence immunoassay).
Hybridomas that may be used as source of antibodies encompass all derivatives, progeny cells of the parent hybridomas that produce monoclonal antibodies capable of binding to a lineage-specific antigen. Hyhridomas that produce such antibodies may be grown in vitro or in vivo using known procedures. The monoclonal antibodies may be isolated from the culture media or body fluids, by conventional immunoglobulin purification procedures such as ammonium sulfate precipitation, gel electrophoresis, dialysis, chromatography, and ultrafiltration, if desired. Undesired activity if present, can be removed, for example, by running the preparation over adsorbents made of the immunogen attached to a solid phase and eluting or releasing the desired antibodies off the immunogen. Immunization of a host animal with a target antigen or a fragment containing the target amino acid sequence conjugated to a protein that is immunogenic in the species to be immunized, e.g., keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, or soybean trypsin inhibitor using a bifunctional or derivatizing agent, for example maleimidobenzoyl sulfosuccinimide ester (conjugation through cysteine residues), N-hydroxysuccinimide (through lysine residues), glutaraldehyde, succinic anhydride, SOC1, or R1N=C=NR, where R and R1 are different alkyl groups, can yield a population of antibodies (e.g., monoclonal antibodies).
If desired, an antibody of interest (e.g., produced by a hybridoma) may be sequenced and the polynucleotide sequence may then be cloned into a vector for expression or propagation. The sequence encoding the antibody of interest may be maintained in vector in a host cell and the host cell can then be expanded and frozen for future use. In an alternative, the polynucleotide sequence may be used for genetic manipulation to "humanize"
the antibody or to improve the affinity (affinity maturation), or other characteristics of the antibody. For example, the constant region may be engineered to more resemble human constant regions to avoid immune response if the antibody is used in clinical trials and treatments in humans. It may be desirable to genetically manipulate the antibody sequence to obtain greater affinity to the lineage-specific antigen. It will be apparent to one of skill in the art that one or more polynucleotide changes can be made to the antibody and still maintain its binding specificity to the target antigen.
In other embodiments, fully human antibodies can be obtained by using commercially available mice that have been engineered to express specific human immunoglobulin proteins.
Transgenic animals that are designed to produce a more desirable (e.g., fully human antibodies) or more robust immune response may also be used for generation of humanized or human antibodies. Examples of such technology are XenomouseRTM from Amgen, Inc.
(Fremont, Calif.) and HuMAb-MouseRTm and TC MouseTm from Medarex, Inc. (Princeton, N.J.). In another alternative, antibodies may be made recombinantly by phage display or yeast technology. See, for example, U.S. Pat. Nos. 5,565,332; 5,580,717; 5,733,743;
and 6,265,150;
and Winter et al., A nnu. Rev. Itninunol. (1994) 12:433-455. Alternatively, the ph age display technology (McCafferty et al., Nature (1990) 348:552-553) can be used to produce human antibodies and antibody fragments in vitro, from immunoglobulin variable (V) domain gene repertoires from unimmunized donors.
Antigen-binding fragments of an intact antibody (full-length antibody) can be prepared via routine methods. For example, F(ab')2 fragments can be produced by pepsin digestion of an antibody molecule, and Fab fragments that can be generated by reducing the disulfide bridges of F(ab')2 fragments.
Genetically engineered antibodies, such as humanized antibodies, chimeric antibodies, single-chain antibodies, and bi-specific antibodies, can be produced via, e.g., conventional recombinant technology. In one example, DNA encoding a monoclonal antibody specific to a target antigen can be readily isolated and sequenced using conventional procedures (e.g., by using oligonucleotide probes that are capable of binding specifically to genes encoding the heavy and light chains of the monoclonal antibodies). The hybridoma cells serve as a preferred source of such DNA. Once isolated, the DNA may be placed into one or more expression vectors, which are then transfected into host cells such as E. call cells, simian COS cells, Chinese hamster ovary (CHO) cells, or myeloma cells that do not otherwise produce immunoglobulin protein, to obtain the synthesis of monoclonal antibodies in the recombinant host cells. See, e.g., PCT Publication No. WO 87/04462. The DNA can then be modified, for example, by substituting the coding sequence for human heavy and light chain constant domains in place of the homologous murine sequences, Morrison et al., Proc.
Nat. Acad. Sci.
(1984) 81:6851, or by covalently joining to the immunoglobulin coding sequence all or part of the coding sequence for a non-immunoglobulin polypeptide. In that manner, genetically engineered antibodies, such as "chimeric" or "hybrid" antibodies; can be prepared that have the binding specificity of a target antigen.
Techniques developed for the production of "chimeric antibodies" are well known in the art. See, e.g., Morrison et al. Proc. Natl. Acad. Sci. USA (1984) 81:6851;
Neuberger et al.
Nature (1984) 312:604; and Takeda et al. Nature (1984) 314:452.
Methods for constructing humanized antibodies are also well known in the art.
See, e.g., Queen et al., Proc. Natl. Acad. Sci. USA. (1989) 86:10029-10033. In one example, variable regions VI) and VL of a parent non-human antibody are subjected to three-dimensional molecular modeling analysis following methods known in the art. Next, framework amino acid residues predicted to be important for the formation of the correct CDR
structures are identified using the same molecular modeling analysis. In parallel, human Vu and VI_ chains having amino acid sequences that are homologous to those of the parent non-human antibody are identified from any antibody gene database using the parent WI and VL
sequences as search queries. Human VH and VL acceptor genes are then selected.
The CDR regions within the selected human acceptor genes can be replaced with the CDR regions from the parent non-human antibody or functional variants thereof.
When necessary, residues within the framework regions of the parent chain that are predicted to be important in interacting with the CDR regions (see above description) can be used to substitute for the corresponding residues in the human acceptor genes.
A single-chain antibody can be prepared via recombinant technology by linking a nucleotide sequence coding for a heavy chain variable region and a nucleotide sequence coding for a light chain variable region. Preferably, a flexible linker is incorporated between the two variable regions. Alternatively, techniques described for the production of single chain antibodies (U.S. Patent Nos. 4,946,778 and 4,704,692) can be adapted to produce a phage or yeast scFv library and scFv clones specific to a lineage-specific antigen can be identified from the library following routine procedures. Positive clones can be subjected to further screening to identify those that bind lineage-specific antigen.
The "percent identity" of two amino acid sequences is determined using the algorithm of Karlin and Altschul Proc. Natl. Acad. Sci. USA (1990) 87:2264-68, modified as in Karlin and Altschul Proc. Natl. Acad. Sci. USA (1993) 90:5873-77. Such an algorithm is incorporated into the NBLAST and XBLAST programs (version 2.0) of Altschul, et al. J. Mol.
Biol. (1990) 215:403-10. BLAST protein searches can be performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to the protein molecules of the present disclosure. Where gaps exist between two sequences, Gapped BLAST can be utilized as described in Altschul et al., Nucleic Acids Res. (1997) 25(17):3389-3402.
When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used.
Nucleic Acids and Vectors The present disclosure provides for a nucleic acid/polynucleotide encoding any of the disclosed polypeptides, engineered proteins or agents. For example, polynucleotides encoding any of the proteins described herein are provided, e.g., for recombinant expression and purification. In some embodiments, an isolated polynucleotide comprises one or more sequences encoding the fusion proteins or agents. The nucleic acid may be deoxyribonucleic acid (DNA), ribonucleic acid (RNA) or a DNA/RNA hybrid. The nucleic acid may be linear or circular (such as a plasmid). The nucleic acid may be single-stranded, double-stranded, branched or modified by the ligation of non-nucleic acid molecules. The nucleic acids include nucleic acids produced by recombinant technology.
In certain embodiments, the nucleic acid encoding the disclosed engineered proteins is codon optimized. Methods for codon optimization are known in the art.
In certain embodiments, the nucleic acid encoding the aCD33-6DMPa-Hinge polypeptide has a nucleic acid sequence that is at least 70% identical to SEQ
ID NO: 23 (e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence in SEQ ID NO:
23).
In certain embodiments, the nucleic acid encoding the polypeptide ULBP1-6DMPb-Hinge has a nucleic acid sequence that is at least 70% identical to SEQ ID NO:
24 (e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence in SEQ Ill NO:
24).
In certain embodiments, the nucleic acid encoding the aCD3-6DMPb polypeptide has a nucleic acid sequence that is at least 70% identical to SEQ ID NO: 25 (e.g., a nucleic acid sequence that is 70%, 71%, 72%, 73%, 74%, 75%, 76%, 77%, 78%, 79%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to the nucleic acid sequence in SEQ ID NO: 25).
In certain embodiments, the nucleic acid is a plasmid DNA including a coding sequence for the disclosed polypeptide or agents, together with flanking regulatory sequences effective to cause the expression of the fusion polypeptide or agents in cells. Examples of flanking regulatory sequences are a promoter sequence sufficient to initiate transcription and a terminator sequence sufficient to terminate the gene product, by termination of transcription or translation. Suitable transcriptional or translational enhancers can be included in the vector to further assist the expression of the fusion polypeptide or agents.
In some embodiments, vectors encoding any of the engineered proteins described herein are provided, e.g., for recombinant expression and purification. In some embodiments, the vector comprises or is engineered to include an isolated polynucleotide, e.g., those described herein. Typically, the vector comprises a sequence encoding the engineered polypeptide or protein or agents operably linked to a promoter, such that the engineered protein (or agents) is (are) expressed in a host cell.
The nucleic acid may be contained within an expression vector. Thus, for example, a nucleic acid sequence may he included in any one of a variety of expression vectors for expressing one or more polypeptides, and more than one nucleic acid may be included in one expression vector. Alternatively, parts of one gene or nucleic acid may be included in separate vectors. In some embodiments, vectors include, but are not limited to, chromosomal, nonchromosomal and synthetic DNA sequences (e.g., derivatives of SV40, bacterial plasmids, phage DNA; baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA, and derivatives of viral DNA).
Vectors of the present disclosure can drive the expression of one or more sequences in mammalian cells using a mammalian expression vector. Examples of mammalian expression vectors include pCDM8 (Seed, Nature (1987) 329:840) and pMT2PC (Kaufman, et al., EMBO
T. (1987) 6:187). When used in mammalian cells, the expression vector's control functions are typically provided by one or more regulatory elements. For example, commonly used promoters are derived from polyoma, adenovirus 2, cytomegalovirus, simian virus 40, and others disclosed herein and known in the art. For other suitable expression systems for both prokaryotic and eukaryotic cells see, e.g., Chapters 16 and 17 of Sambrook, et at., MOLECULAR CLONING: A LABORATORY MANUAL. 2nd eds., Cold Spring Harbor Laboratory, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y., 1989.
The vectors of the present disclosure may direct expression of the nucleic acid preferentially in a particular cell type (e.g., tissue-specific regulatory elements are used to express the nucleic acid). Such regulatory elements include promoters that may be tissue-specific or cell type-specific. The term "tissue-specific" as it applies to a promoter refers to a promoter that is capable of directing selective expression of a nucleotide sequence of interest to a specific type of tissue in the relative absence of expression of the same nucleotide sequence of interest in a different type of tissue. The term "cell type-specific" as applied to a promoter refers to a promoter that is capable of directing selective expression of a nucleotide sequence of interest in a specific type of cell in the relative absence of expression of the same nucleotide sequence of interest in a different type of cell within the same tissue. The term "cell type-specific" when applied to a promoter also means a promoter capable of promoting selective expression of a nucleotide sequence of interest in a region within a single tissue. Cell type specificity of a promoter may be assessed using methods well known in the art, e.g., immunohistochemical staining.
Conventional viral and non-viral based gene transfer methods can be used to introduce nucleic acids in mammalian cells or target tissues. Such methods can be used to administer nucleic acids encoding the present agents/polypeptides to cells in culture, or in a subject. Non-viral vector delivery systems include DNA plasmids, RNA (e.g., a transcript of a vector described herein), naked nucleic acid, and nucleic acid complexed with a delivery vehicle.
Viral vector delivery systems include DNA and RNA viruses, which have either episomal or integrated genomes after delivery to the cell.
Viral vectors can be administered directly to patients (in vivo) or they can be used to manipulate cells in vitro or ex vivo, where the modified cells may be administered to patients.
In one embodiment, the present disclosure utilizes viral based systems including, but not limited to retroviral, lentivirus, adenoviral, adeno-associated and herpes simplex virus vectors for gene transfer. Furthermore, the present disclosure provides vectors capable of integration in the host genome, such as retrovirus or lentivirus.
The vectors of the present disclosure may be delivered to the eukaryotic cell in a subject.
Any of the chimeric proteins described herein can be prepared by routine methods, such as recombinant technology. Methods for preparing the chimeric proteins herein involve generation of a nucleic acid that encodes a polypeptide comprising each of the fragments/domains/moieties of the chimeric proteins, including the antigen-binding fragment and the polypeptide that binds a molecule expressed on natural killer (NK) cells.
In some embodiments, a nucleic acid encoding each of the components of chimeric protein are joined together using recombinant technology.
Sequences of each of the components of the engineered proteins may be obtained via routine technology, e.g., PCR amplification from any one of a variety of sources known in the art. In some embodiments, sequences of one or more of the components of the chimeric proteins are obtained from a human cell. Alternatively, the sequences of one or more components of the chimeric proteins can be synthesized. Sequences of each of the components (e.g., fragments/domains/moieties) can he joined directly or indirectly (e.g., using a nucleic acid sequence encoding a peptide linker) to form a nucleic acid sequence encoding the chimeric protein, using methods such as PCR amplification or ligation.
Alternatively, the nucleic acid encoding the chimeric protein may be synthesized. In sonic embodiments, the nucleic acid is DNA. In other embodiments, the nucleic acid is RNA.
Mutation of one or more residues within one or more of the components of the chimeric protein (e.g., the antigen-binding fragment, etc.), prior to or after joining the sequences of each of the components. In some embodiments, one or more mutations in a component of the engineered protein may be made to modulate (increase or decrease) the affinity of the component for a target (e.g., the antigen-binding fragment for the target antigen) and/or modulate the activity of the component.
Any of the engineered proteins described herein can he introduced into a suitable cell for expression via conventional technology.
To express the engineered proteins, expression vectors for stable or transient expression of the engineered proteins may be constructed via conventional methods as described herein.
For example, nucleic acids encoding the chimeric proteins may be cloned into a suitable expression vector, such as a viral vector in operable linkage to a suitable promoter. The nucleic acids and the vector may be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined with a ligase. Alternatively, synthetic nucleic acid linkers can be ligated to the termini of the nucleic acid encoding the engineered proteins. The synthetic linkers may contain nucleic acid sequences that correspond to a particular restriction site in the vector. The selection of expression vectors/plasmids/viral vectors would depend on the type of host cells for expression of the chimeric proteins, but should be suitable for integration and replication in eukaryotic cells.
A variety of promoters can be used for expression of the engineered proteins described herein, including, without limitation, cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR, Maloney murine leukemia virus (MMLV) LTR, myeoloproliferative sarcoma virus (MPSV) LTR, spleen focus-forming virus (SFFV) LTR, the simian virus 40 (SV40) early promoter, herpes simplex tk virus promoter, elongation factor 1-alpha (EF1-a) promoter with or without the EF1-a intron.
Additional promoters for expression of the chimeric proteins include any constitutively active promoter. Alternatively, any regulatahle promoter may be used, such that its expression can be modulated.
Additionally, the vector may contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene for selection of stable or transient transfectants in host cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; transcription termination and RNA
processing signals from S V40 for naRNA stability; 5'-and 3' -untranslated regions for inRNA stability and translation efficiency from highly-expressed genes like a-globin or f3-globin;
SV40 polyoma origins of replication and ColE1 for proper episomal replication; internal ribosome binding sites (IRESes), versatile multiple cloning sites; T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA; a "suicide switch" or "suicide gene"
which when triggered causes cells carrying the vector to die (e.g., HSV thymidine kinase, an inducible caspase such as iCasp9), and reporter gene for assessing expression of the chimeric protein.
See section VI below. Suitable vectors and methods for producing vectors containing transgenes are well known and available in the art. Examples of the preparation of vectors for expression of chimeric proteins can be found, for example, in US2014/0106449.
In some embodiments, the engineered protein or the nucleic acid encoding said engineered protein is a DNA molecule. In some embodiments, the nucleic acid encoding said engineered protein is a DNA vector. In some embodiments, the nucleic acid encoding the engineered protein is an RNA molecule.
Any of the vectors comprising a nucleic acid sequence that encodes an engineered protein described herein is also within the scope of the present disclosure.
Such a vector may be delivered into host cells by a suitable method. Methods of delivering vectors to cells are well known in the art and may include DNA, RNA, or transposon electroporation, transfection reagents such as liposomes or nanoparticles to delivery DNA, RNA, or transposons; delivery of DNA, RNA, or transposons or protein by mechanical deformation (see, e.g., Sharei et al.
Proc. Natl. Acad. Sci. USA (2013) 110(6):2082-2087); or viral transduction. In some embodiments, the vectors for expression of the chimeric proteins are delivered to host cells by viral transduction. Exemplary viral methods for delivery include, but are not limited to, recombinant retroviruses (see. e.g., PCT Publication Nos. WO 90/07936; WO
94/03622; WO
93/25698; WO 93/25234; WO 93/11230; WO 93/10218; WO 91/02805; U.S. Pat. Nos.
5,219,740 and 4,777,127; GB Patent No. 2,200,651; and EP Patent No. 0 345 242), alphavirus-based vectors, and adeno-associated virus (AAV) vectors (see, e.g., PCT
Publication Nos. WO
94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984 and WO 95/00655).
In some embodiments, the vectors for expression are retroviruses. In some embodiments, the vectors for expression are lentiviruses. In some embodiments, the vectors for expression are adeno-associated viruses.
In examples in which the vectors encoding engineered proteins are introduced to the host cells using a viral vector, viral particles that are capable of infecting the cells and carry the vector may be produced by any method known in the art and can be found, for example in PCT
Application No. WO 1991/002805A2, WO 1998/009271 Al, and U.S. Patent 6,194,191. The viral particles are harvested from the cell culture supernatant and may be isolated and/or purified prior to contacting the viral particles with the cells.
Therapeutic methods Any of the disclosed engineered proteins may be administered to a subject to treat a condition such as hematopoietic malignancy. Additionally, any of the nucleic acids/polynucleotides/vectors encoding the disclosed engineered proteins may he administered to a subject to treat a condition such as hematopoietic malignancy.
Additionally, any compositions or pharmaceutical compositions comprising any of the disclosed engineered proteins or nucleic acids/polynucleotides/vectors encoding the disclosed engineered proteins may be administered to a subject to treat a condition such as hematopoietic malignancy. As used herein, "subject," "individual," and "patient" are used interchangeably, and refer to a vertebrate, preferably a mammal such as a human. Mammals include, but are not limited to, human primates, non-human primates or murine, bovine, equine, canine or feline species. In some embodiments, the subject is a human patient having a hematopoietic malignancy.
In some embodiments, the present vectors, engineered proteins or agents may be mixed with a pharmaceutically acceptable carrier to form a pharmaceutical composition, which is also within the scope of the present disclosure.
The present disclosure provides for a vaccine suitable for eliciting an immune response against cancer cells. Method of inhibiting tumor growth by administering the vaccine of the invention to a mammal is also described.
The present composition may be delivered to, or administered to be in contact with, any suitable types of cells. The cell may a eukaryotic cell. The cell may a mammalian cell, such as a human cell or a non-human mammalian cell (e.g., a non-human primate cell).
These include a number of cell lines that can be obtained from American Tissue Culture Collection. In certain embodiments, the cell is a tumor cell.
In certain embodiments, the cell is present in a subject (e.g., a mammal). The mammal can be a human or a non-human primate. Non-human primates include, but are not limited to, chimpanzees, cyn omol ogous monkeys, spider monkeys, and macaques, e.g., Rhesus.
In certain embodiments, the cell may be removed and maintained in tissue culture in a primary, secondary, immortalized or transformed state. In certain embodiments, the cells are cultured cells or cells freshly obtained from a source (e.g., a tissue, an organ, a subject, etc.).
The mammalian cell can be primary or secondary which means that it has been maintained in culture for a relatively short time after being obtained from an animal tissue.
To perform the methods described herein, an effective amount of the present composition may be administered to a subject in need of the treatment. As used herein the term "effective amount" may be used interchangeably with the term "therapeutically effective amount" and refers to that quantity of a vector, an engineered protein, an agent, or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof. Within the context of the present disclosure, the term "effective amount" refers to that quantity of a vector, an engineered protein, an agent, or pharmaceutical composition that is sufficient to delay the manifestation, arrest the progression, relieve or alleviate at least one symptom of a disorder treated by the methods of the present disclosure.
Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. In some embodiments, the effective amount alleviates, relieves, ameliorates, improves, reduces the symptoms, or delays the progression of any disease or disorder in the subject.
In some embodiments, the subject is a human. In some embodiments, the subject is a human patient having a hematopoietic malignancy.
In some embodiments, the present composition is administered to a subject in an amount effective in to reduce the number of target cells (e.g., cancer cells) by least 20%, e.g., 50%, 80%, 100%, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold or more.
In one embodiment, the present composition is administered to a subject (e.g., human patient) as an initial dose. One or more subsequent administrations of the present composition may be provided to the patient at intervals of 15 days, 14, 13, 12, 11, 10, 9, 8,7, 6, 5,4, 3, or 2 days after the previous administration. More than one dose of the present composition can be administered to the subject per week, e.g., 2, 3, 4, or more administrations of the agent. The subject may receive more than one doses of the present composition per week, followed by a week of no administration of the agent, and finally followed by one or more additional doses of the present composition (e.g., more than one administration of the present composition per week). The present composition may be administered every other day for 3 administrations per week for two, three, four, five, six, seven, eight or more weeks.
In the context of the present disclosure insofar as it relates to any of the disease conditions recited herein, the terms "treat," "treatment," and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression of such condition. Within the meaning of the present disclosure, the term "treat"
also denotes to arrest, delay the onset (i.e., the period prior to clinical manifestation of a disease) and/or reduce the risk of developing or worsening a disease. For example, in connection with cancer the term "treat" may mean eliminate or reduce a patient's tumor burden, or prevent, delay or inhibit metastasis.
In some embodiments, the present engineered proteins fusion recognizes (hinds) a target cell expressing the cell-surface lineage-specific antigen for targeting killing.
The efficacy of the present therapeutic methods may be assessed by any method known in the art and would be evident to a skilled medical professional. For example, the efficacy of the therapy may be assessed by survival of the subject or cancer burden in the subject or tissue or sample thereof. In some embodiments, the efficacy of the therapy is assessed by quantifying the number of cells belonging to a particular population or lineage of cells.
In some embodiments, the efficacy of the therapy is assessed by quantifying the number of cells presenting the cell-surface lineage-specific antigen.
The present composition may be administered to a subject in combination with a second therapy. The present composition may be administered prior to administration of the second therapy. In some embodiments, the present composition is administered at least about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 3 months, 4 months, 5 months, 6 months or more prior to administration of the second therapy.
In some embodiments, the second therapy is administered prior to the administration of the present composition. In some embodiments, the second therapy is administered at least about 1 day, 2 days, 3 days, 4 days, 5 days, 6 days, 1 week, 2 weeks, 3 weeks, 4 weeks, 5 weeks, 6 weeks, 7 weeks, 8 weeks, 9 weeks, 10 weeks, 11 weeks, 12 weeks, 3 months, 4 months, 5 months, 6 months or more prior to administration of the present composition.
In some embodiments, the present composition and the second therapy are administered at substantially the same time. In some embodiments, the present composition is administered, and the patient is assessed for a period of time, after which the second therapy is administered.
In some embodiments, the second therapy is administered, and the patient is assessed for a period of time, after which the present composition is administered.
Also within the scope of the present disclosure are multiple administrations (e.g., doses) of the present composition. In some embodiments, the present composition is administered to the subject once. In some embodiments, the present composition is administered to the subject more than once (e.g., at least 2, 3, 4, 5, or more times). In some embodiments, the present composition is administered to the subject at a regular interval, e.g., every six months.
In some embodiments, the subject is a human subject having a hematopoietic malignancy or hematological neoplasm. As used herein a hematopoietic malignancy refers to a malignant abnormality involving hematopoietic cells (e.g., blood cells, including progenitor and stem cells). Examples of hematopoietic malignancies include, without limitation, Hodgkin's lymphoma, non-Hodgkin's lymphoma, leukemia, or multiple myeloma.
Leukemias include acute myeloid leukemia, acute lymphoid leukemia, chronic myelogenous leukemia, acute lymphoblastic leukemia or chronic lymphoblastic leukemia, and chronic lymphoid leukemia.
Hematological malignancies or neoplasms include but not limited to, myeloid malignancies, lymphatic malignancies, malignant histiocytosis and mast cell leukemia.
The hematopoietic malignancy may be a myeloid malignancy wherein the myeloid malignancies include but not limited to myeloproliferative disorders (MPD), myelodysplastic syndrome (MDS), myelodysplastic/myeloproliferative disorders (MD/MPD) and acute myeloid leukemia (AML).
In certain embodiments, myeloid malignancies refer to a condition associated with a defect in the proliferation of a hematopoietic cell. In certain embodiments, myeloid malignancies refer to clonal hematological diseases affecting the myeloid blood lineages, including chronic and acute conditions. Myeloid malignancies include myeloproliferative neoplasms, myelodysplastic syndromes and acute myeloid leukemias. A
myeloproliferative neoplasm may be primary myelofibrosis (PMF), or essential thrombocythemia (ET). A
myelodysplastic syndrome may be refractory anemia with ringed sideroblasts and thrombocythemia (RARS-T). Myeloid malignancies include, but are not limited to, myeloproliferative disorders (MPD), myelodysplastic syndrome (MDS), myelodyspl astic/myeloprol ferati ve disorders (MD/M PD), and acute myeloi d leukemi a (AML).
Lymphatic malignancies include, but are not limited to, T/NK cell tumor, B
cell tumor and Hodgkin's disease.
In some embodiments, the leukemia is acute myeloid leukemia (AML). AML is characterized as a heterogeneous, clonal, neoplastic disease that originates from transformed cells that have progressively acquired critical genetic changes that disrupt key differentiation and growth-regulatory pathways. (Dohner et al. 2015). CD33 glycoprotein is expressed on the majority of myeloid leukemia cells as well as on normal myeloid and monocytic precursors and has been considered to be an attractive target for AML therapy (Laszlo et al., Blood Rev.
(2014) 28(4):143-53). While clinical trials using anti-CD33 monoclonal antibody based therapy have shown improved survival in a subset of AML patients when combined with standard chemotherapy, these effects were also accompanied by safety and efficacy concerns.
Alternatively or in addition, the methods described herein may he used to treat non-hematopoietic cancers, including without limitation: lung cancer; ear, nose and throat cancer;
colon cancer; melanoma; pancreatic cancer; mammary cancer; prostate cancer;
breast cancer;
ovarian cancer; basal cell carcinoma; biliary tract cancer; bladder cancer;
bone cancer; breast cancer; cervical cancer; choriocarcinoma; colon and rectum cancer; connective tissue cancer;
cancer of the digestive system; endometrial cancer; esophageal cancer; eye cancer; cancer of the head and neck; gastric cancer; intra-epithelial neoplasm; kidney cancer;
larynx cancer; liver cancer; fibroma, neuroblastoma; oral cavity cancer (e.g., lip, tongue, mouth, and pharynx);
ovarian cancer; pancreatic cancer; prostate cancer; retinoblastoma;
rhabdomyosarcoma; rectal cancer; renal cancer; cancer of the respiratory system; sarcoma; skin cancer;
stomach cancer;
testicular cancer; thyroid cancer; uterine cancer; cancer of the urinary system, as well as other carcinomas and sarcomas.
Carcinomas are cancers of epithelial origin. Carcinomas intended for treatment with the methods of the present disclosure include, but are not limited to, acinar carcinoma, acinous carcinoma, alveolar adenocarcinoma (also called adenocystic carcinoma, adenomyoepithelioina, cribriform carcinoma and cylindroma), carcinoma adenomatosum, adenocarcinoma, carcinoma of adrenal cortex, alveolar carcinoma, alveolar cell carcinoma (also called bronchiolar carcinoma, alveolar cell tumor and pulmonary adenomatosis), basal cell carcinoma, carcinoma basocellulare (also called basaloma, or basiloma, and hair matrix carcinoma), basaloid carcinoma, basosquamous cell carcinoma, breast carcinoma, bronchioalveolar carcinoma, bronchiolar carcinoma, bronchogenic carcinoma, cerebriform carcinoma, cholangiocellular carcinoma (also called cholangioma and cholangiocarcinoma), chorionic carcinoma, colloid carcinoma, comedo carcinoma, corpus carcinoma, cribriform carcinoma, carcinoma en cuirasse, carcinoma cutaneum, cylindrical carcinoma, cylindrical cell carcinoma, duct carcinoma, carcinoma durum, embryonal carcinoma, encephaloid carcinoma, epibulbar carcinoma, epidermoid carcinoma, carcinoma epitheliale adenoides, carcinoma exulcere, carcinoma fibrosum, gclatiniform carcinoma, gelatinous carcinoma, giant cell carcinoma, gigantocellulare, glandular carcinoma, granulosa cell carcinoma, hair-matrix carcinoma, hematoid carcinoma, hepatocellular carcinoma (also called hepatoma, malignant hepatoma and hepatocarcinoma), Huirthle cell carcinoma, hyaline carcinoma, hypernephroid carcinoma, infantile embryonal carcinoma, carcinoma in situ, intraepidermal carcinoma, intraepithelial carcinoma, Krompecher's carcinoma, Kulchitzky-cell carcinoma, lenticular carcinoma, carcinoma lenticulare, lipomatous carcinoma, lymphoepithelial carcinoma, carcinoma mastitoides, carcinoma medullare, medullary carcinoma, carcinoma melanodes, melanotic carcinoma, mucinous carcinoma, carcinoma muciparum, carcinoma mucocellulare, mucoepidermoid carcinoma, carcinoma mucosum, mucous carcinoma, carcinoma rnyxomatodes, nasopharyngeal carcinoma, carcinoma nigruni, oat cell carcinoma, carcinoma ossificans, osteoid carcinoma, ovarian carcinoma, papillary carcinoma, periportal carcinoma, preinvasive carcinoma, prostate carcinoma, renal cell carcinoma of kidney (also called adenocarcinoma of kidney and hypemephoroid carcinoma), reserve cell carcinoma.
carcinoma sarcomatodes, scheinderian carcinoma, scirrhous carcinoma, carcinoma scroti, signet-ring cell carcinoma, carcinoma simplex, small-cell carcinoma, solanoid carcinoma, spheroidal cell carcinoma, spindle cell carcinoma, carcinoma spongiosum, squamous carcinoma, squamous cell carcinoma, string carcinoma, carcinoma telangiectaticum, carcinoma telangiectodes, transitional cell carcinoma, carcinoma tuberosum, tuberous carcinoma, verrucous carcinoma, carcinoma vilosum.
Sarcomas are mesenchymal neoplasms that arise in bone and soft tissues.
Different types of sarcomas are recognized and these include: liposarcomas (including myxoid liposarcomas and pleiomorphic liposarcomas), leiomyosarcomas, rhabdomyosarcomas, malignant peripheral nerve sheath tumors (also called malignant schwannomas, neurofibrosarcomas, or neurogenic sarcomas), Ewing's tumors (including Ewing's sarcoma of bone, extraskeletal (i.e., non-bone) Ewing's sarcoma, and primitive neuroectodermal tumor [PNET]), synovial sarcoma, angiosarcomas, hemangiosarcomas, lymphangiosarcomas, Kaposi's sarcoma, hemangioendothelioma, fibrosarcoma, desmoid tumor (also called aggressive fibromatosis), dermatofibrosarcoma protuberans (DFSP), malignant fibrous h isti oc ytom a (MFH) , hem angioperi cytom a, malignant m esenchymom a, alveolar soft-part sarcoma, epithelioid sarcoma, clear cell sarcoma, desmoplastic small cell tumor, gastrointestinal stromal tumor (GIST) (also known as GI stromal sarcoma), osteosarcoma (also known as osteogenic sarcoma)-skeletal and extraskeletal, and chondrosarcoma.
In some embodiments, the cancer to be treated can be a refractory cancer. A
"refractory cancer," as used herein, is a cancer that is resistant to the standard of care prescribed. These cancers may appear initially responsive to a treatment (and then recur), or they may be completely non-responsive to the treatment. The ordinary standard of care will vary depending upon the cancer type, and the degree of progression in the subject. It may be a chemotherapy, or surgery, or radiation, or a combination thereof. Those of ordinary skill in the art are aware of such standards of care. Subjects being treated according to the present disclosure for a refractory cancer therefore may have already been exposed to another treatment for their cancer. Alternatively, if the cancer is likely to be refractory (e.g., given an analysis of the cancer cells or history of the subject), then the subject may not have already been exposed to another treatment. Examples of refractory cancers include, but are not limited to, leukemia, melanomas, renal cell carcinomas, colon cancer, liver (hepatic) cancers, pancreatic cancer, Non-Hodgkin's lymphoma and lung cancer.
Any of the present vectors, engineered proteins or agents described herein may be administered in a pharmaceutically acceptable carrier or excipient as a pharmaceutical composition.
The phrase "pharmaceutically acceptable," as used in connection with compositions and/or cells of the present disclosure, refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a mammal (e.g., a human). Preferably, as used herein, the term "pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans. "Acceptable" means that the carrier is compatible with the active ingredient of the composition (e.g., the nucleic acids, vectors, cells, or therapeutic antibodies) and does not negatively affect the subject to which the composition(s) are administered. Any of the pharmaceutical compositions and/or cells to be used in the present methods can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formations or aqueous solutions.
Pharmaceutically acceptable carriers, including buffers, are well known in the art, and may comprise phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methi nine ; preservatives; low molecular weight polypepti des ;
proteins, such as serum albumin, gelatin, or immunoglobulins; amino acids; hydrophobic polymers;
monosaccharides;
disaccharides; and other carbohydrates; metal complexes; and/or non-ionic surfactants. See, e.g. Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover.
Kits Also within the scope of the present disclosure are kits for use of the present engineered proteins, agents, vectors, and/or compositions. Such kits may include one or more containers comprising present engineered proteins, agents, vectors, and/or compositions.
Some aspects of this disclosure provide kits comprising the present engineered proteins or agents. In some embodiments, the kit comprises a polynucleotide encoding the present engineered proteins. In some embodiments, the kit comprises a vector for recombinant protein expression, wherein the vector comprises a polynucleotide encoding the present engineered proteins. In some embodiments, the kit comprises a cell that comprises a genetic construct for expressing the present engineered proteins. In some embodiments, the kit comprises an excipient and instructions for using the kit. In some embodiments, the excipient is a pharmaceutically acceptable excipient.
In some embodiments, the kit can comprise instructions for use in any of the methods described herein. The included instructions can comprise a description of administration of the pharmaceutical compositions to a subject to achieve the intended activity in a subject. The kit may further comprise a description of selecting a subject suitable for treatment based on identifying whether the subject is in need of the treatment. In some embodiments, the instructions comprise a description of administering the pharmaceutical composition to a subject who is in need of the treatment.
The instructions relating to the use of the pharmaceutical composition described herein generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub-unit doses. Instructions supplied in the kits of the disclosure are typically written instructions on a label or package insert. The label or package insert indicates that the pharmaceutical compositions are used for treating, delaying the onset, and/or alleviating a disease or disorder in a subject.
The kits provided herein are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging, and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device, or an infusion device. A kit may have a sterile access port (for example, the container may be an intravenous solution hag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port.
In some embodiment, the disclosure provides articles of manufacture comprising contents of the kits described above.
In some embodiments, the individual components of the formulation can be provided in one container. Alternatively, it can be desirable to provide the components of the formulation separately in two or more containers. The different components can be combined, e.g., according to instructions provided with the kit. The components can be combined according to a method described herein, e.g., to prepare and administer a pharmaceutical composition.
The present engineered proteins, agents, vectors, or compositions can be provided in any form, e.g., liquid, dried or lyophilized form.
EXAMPLES
The present invention may be better understood by reference to the following non-limiting examples, which are presented in order to more fully illustrate the preferred embodiments of the invention. They should in no way be construed to limit the broad scope of the invention.
Example 1- Construction of the Engineered Heterodimer Proteins Initially, pcDNA3.1 expression vectors were used for the aCD33-ULBP1 engineered heterodimer proteins. All constructs utilized an N-terminal IL-2 secretory signal to trigger export of the completed protein to cell supernatant, and C-terminal tnyc- and 6xHis-tags to facilitate purification and labeling. In two constructs, ULBP1 immediately follows the IL-2 signal, followed by a linker and then the VH and VL regions of aCD33. In another construct, aCD33 precedes ULBP1, in order to determine whether one orientation is favorable.
Additionally, constructs have been developed for the aCD33-scFV or 1.1LBP I
alone.
Expression via Mirus TransIT-293 transfection reagent was confirmed using Western blot probing for Myc following purification of 6xHis-tagged proteins in supernatant of transfected HEK-293T cells, as well as Myc probing of cellular protein. See Example 2 and Figure 12.
The 6DMPa-monomer was fused to anti-CD33, GFP, and the associated tags (6xHis and myc) listed above. The 6DMPb monomer was fused to UPBP1, RFP, and 6xHis and FLAG tags to facilitate purification independently of the 6DMPa-myc (and to allow for separate co-immunoprecipitation experiments).
peDNA3.1 plasmids were also created that encode for the engineered protein that attaches anti-CD3 to 6DMPb, with tags to match those of the ULBP1-6DMPb construct (Figure 10). In this approach, CD3+ T-cells replaced NK cells as the relevant effector cell, and thus 6DMPb was attached in order to bind the anti-CD3 facilitator to the anti-CD33 targeting moiety. The anti-CD3 sequence was taken from the Amgen CD3-CD19 BiTE
blinotumomab, and fused to 6DMPb via the same linkers used previously (Kufer et al.
2017). This was co-expressed with aCD33-6DMPa and co-immunoprecipitated to verify heterodimerization. The construct was cloned into bacterial or lentiviral vectors to generate high-output protein expression methods as noted above.
The latest modification to these designs included the hinge region of IgG2.
With four cysteine residues creating four disulfide bridges in the span of 12 total residues, hinge regions added to the C-terminus of 6DMP-based chimeras were expected to enhance the binding of heterodimers and prevent dissociation (Wypych et al. 2008). An identical IgG2-hinge was thus added to each construct, following the 6DMPa/b and preceding purification tags (Figures 1 and 10). Constructs have been designed that add this hinge directly or add this hinge after a short linker.
All constructs were expressed from pcDNA3.4-TOPO vectors with ampicillin resistance, codon-optimized for expression in Cricetulus griseus (Chinese hamster). See Figure 11.
To express the polypeptides/proteins, the amino acid sequences were back translated to obtain the DNA sequences which were then codon optimized (SEQ ID NOs: 23-25).
Proteins were expressed according to a modified version of the manufacturer protocol using Lipofectamine 3000.
= aCD33-6DMPa-Hinge was co-expressed in the same dish with aCD3-6DMPb-Hinge or ULBP1-6DMPb-Hinge = Proteins were produced CHO-Kl cells in 15-cm tissue-culture treated dishes
10-12 x 106 cells were cultured the day before transfection, 37 C 5% CO2 Reagent volumes per plate were as follows:
135uL Lipofectamine 3000 40ug of each plasmid (aCD33-6DMPa-Hinge and aCD3-6DMPb-Hinge) 16Oug P3000 reagent (2uL/ug DNA) Supernatant collected 3-4 days post-transfection = Cell culture supernatant was purified for His-tag containing proteins (aCD33-6DMPa-Hinge and aCD3-6DMPb-Hinge) using TALON Metal Affinity Reason (TaKaRa Bio) 400uL of suspended resin (200uL of pelleted resin) used per 20mL
supernatant Typically, 5 plates were used at once, resulting in two 50-mL
batches, each receiving 500uL of washed and equilibrated resin Manufacturer protocol was followed, using the following buffers in place of HisTALON buffers:
Wash buffer: TBST-Tris 20mM, NaCl 150mM, 0.1% Tween-20;
Equilibration buffer: Tris 20m1M, NaCl 150mM, 5mM imidazolc, 1mM PMSF;
Elution buffer: NaC1 150mM, 1mM KH2PO4, 3nrIM Na2HPO4-7H20, 150mM imidazole Supernatant and resin rotated 30minat 4degC before wash and elution = 500uL of dimer-bound beads were eluted 3x with Elution Buffer to a final volume ¨7.5mL
7.5mL of protein-containing elution buffer was diluted to 20rnL final volume with PBS
20mL of protein-containing buffer was concentrated using Pierce Protein Concentrator PES (30k MVVCO, 5-20mL size), following manufacturer protocol Following concentration, samples once again diluted with PBS to 10-20mL, and concentrated once more 30k MWCO cutoff is large enough to keep most of the dimer in upper chamber, but allows most of smaller monomers to pass to lower chamber to be discarded = Concentrated protein was quantified using Bio-Rad Protein Assay Samples diluted to 0.5mg/mL with PBS, and frozen at -20C until use Using the above protocol, a third engineered heterodimer protein is made using the constructs shown in Figures 3 and 23A, and Figures 5 and 23B.
Example 2 ¨ Expression of the Engineered Heterodimer Proteins The expression of anti-CD33-ULBP1 engineered heterodimer protein in 293T cells was tested using the following protocol. 293T cells mock transfected (No plasmid) or transfected with anti-CD33-ULBP1 chimeras 1 and 2 plasmids (as described in Example 1), and the cell pellets were lysed in 2X SDS gel loading buffer. The lysate were loaded on a SDS-PACE gel and protein separated was transferred to a nylon membrane. The membrane was probed with anti-MYC antibody to detect CD33-ULBP1 and anti-Beta Actin to detect the actin protein (loading control). The membrane was also probed with a fluoroclu-ome conjugated secondary antibody (red to detect anti-MYC; green to detect anti-beta actin) to detect the primary antibody.
As shown in Figure 12A, the lanes loaded with lysate from the transfected cells had detectable myc protein indicative of the heterodimer protein.
Expression of the anti-CD33-ULBP1 engineered heterodimer protein in the supernatant of the 293T cells was also tested used the following protocol. Supernatant of 2931 cells mock transfected (No plasmid) or transfected with anti-CD33-ULBP1 chimeras 1 and 2 plasmids were subjected to affinity purification using Talon beads. The input, flow-through, and the purified protein (Elute) was then separated on SDS-PAGE gel and transferred to a nylon membrane. The membrane was probed with ant-MYC antibody to detect. The membrane was also probed with a flurochrome conjugated secondary antibody (red to detect anti-MYC to detect the primary antibody. Again as shown in Figure 12B, the lanes loaded with supernatant from the transfected cells had detectable myc protein indicative of the heterodimer protein.
Cell culture supernatants or eluate from TALON resin from the CHO-Kl cells transfected with chimeras as listed and described in Example 1 were added to 2X SDS loading buffer, heated, and run on an SDS Page gel. Proteins were transferred to a PVDF membrane and probed with anti-myc antibody to detect anti-CD33-6DMPa-Hinge-MycHis, and anti-FLAG antibody to detect ULBP1 -6DMPb-Hinge -FLAG His or anti-CD3-6DMPb-Hinge-FLAGHis. Fluorochrome-conjugated secondary antibodies were used to probe for the antiMyc and antiFLAG antibodies (green and red respectively).
As shown in Figure 13, the cells had detectable myc or flag protein indicative of the heterodimer proteins.
Example 3- Binding Experiments The binding of the engineered heterodimer proteins was tested using the following protocol:
Resuspended 50k cells in 50uL FACS Buffer Add 50uL of engineered heterodimer protein, incubated 30 minutes Wash Resuspend in anti-MYC-FITC or anti-FLAG-PE, incubated 30 minutes Results showed that in HL60 cells incubated with the purified engineered heterodimer proteins and then with anti-FLAG FITC antibodies there was binding of both constructs (Figure 14A). When HL60 cells were incubated with the constructs and then anti-MYC FITC antibodies, over 99% of binding was seen for each construct as well as the CD33 construct alone, showing that the CD33 construct bound to the cell surface CD33 well and was not disrupted by the CD3 or ULBP conjugate (Figure 14B).
Similar results are summarized in Figures 15-17 for binding of the engineered proteins to HL60 cells, Jurkat cells and PMBCs.
Example 4- Cytotoxic Activity of the Engineered Heterodimer Proteins NK and CD3 in vitro cytotoxic activity of the engineered heterodimer proteins was evaluated using the following general protocol:
1. From frozen human PBMC, CD3+ cytotoxic T-cells were selected using REAlease CD3 MicroBead Kit (Miltenyi). Dynabeads Human T-activator CD3/CD28 are used immediately after to activate T-cells for one week.
2. One week after selection and activation, removed Dynabeads from T-cells.
3. Counted MOLM14-dTomato-luciferase cells (AML cell line) and T-cells (see above). Co-cultured in RPMI (+20% fetal bovine serum, 1% penicillin-streptomycin) at a ratio of 1:5 (10,000 MOLM14 cells with 50,000 T-cells).
4. Added freshly-thawed chimeric proteins to each well (e.g., various concentrations of anti-CD33-anti-CD3 engineered heterodimer) 5. Cultured overnight at 37 C, 5% CO2.
6. Spun plates (500rpm, 5min), remove supernatant.
7. Washed with 200uL FACS buffer (PBS with: 1% FES, 1mM EDTA) 8. Spun plates (500rpm, 5min), remove supernatant 9. Resuspended in 100uL FACS buffer, add DAPI to final concentration of 0 .lug/mL
10. Proceeded to FACS analysis; gate for single cells, and identify target cells as PE+DAPI+ (dTomato in MOLM14 AML cells in PE channel, dead cells in DAPI
channel) See Figure 18A.
135uL Lipofectamine 3000 40ug of each plasmid (aCD33-6DMPa-Hinge and aCD3-6DMPb-Hinge) 16Oug P3000 reagent (2uL/ug DNA) Supernatant collected 3-4 days post-transfection = Cell culture supernatant was purified for His-tag containing proteins (aCD33-6DMPa-Hinge and aCD3-6DMPb-Hinge) using TALON Metal Affinity Reason (TaKaRa Bio) 400uL of suspended resin (200uL of pelleted resin) used per 20mL
supernatant Typically, 5 plates were used at once, resulting in two 50-mL
batches, each receiving 500uL of washed and equilibrated resin Manufacturer protocol was followed, using the following buffers in place of HisTALON buffers:
Wash buffer: TBST-Tris 20mM, NaCl 150mM, 0.1% Tween-20;
Equilibration buffer: Tris 20m1M, NaCl 150mM, 5mM imidazolc, 1mM PMSF;
Elution buffer: NaC1 150mM, 1mM KH2PO4, 3nrIM Na2HPO4-7H20, 150mM imidazole Supernatant and resin rotated 30minat 4degC before wash and elution = 500uL of dimer-bound beads were eluted 3x with Elution Buffer to a final volume ¨7.5mL
7.5mL of protein-containing elution buffer was diluted to 20rnL final volume with PBS
20mL of protein-containing buffer was concentrated using Pierce Protein Concentrator PES (30k MVVCO, 5-20mL size), following manufacturer protocol Following concentration, samples once again diluted with PBS to 10-20mL, and concentrated once more 30k MWCO cutoff is large enough to keep most of the dimer in upper chamber, but allows most of smaller monomers to pass to lower chamber to be discarded = Concentrated protein was quantified using Bio-Rad Protein Assay Samples diluted to 0.5mg/mL with PBS, and frozen at -20C until use Using the above protocol, a third engineered heterodimer protein is made using the constructs shown in Figures 3 and 23A, and Figures 5 and 23B.
Example 2 ¨ Expression of the Engineered Heterodimer Proteins The expression of anti-CD33-ULBP1 engineered heterodimer protein in 293T cells was tested using the following protocol. 293T cells mock transfected (No plasmid) or transfected with anti-CD33-ULBP1 chimeras 1 and 2 plasmids (as described in Example 1), and the cell pellets were lysed in 2X SDS gel loading buffer. The lysate were loaded on a SDS-PACE gel and protein separated was transferred to a nylon membrane. The membrane was probed with anti-MYC antibody to detect CD33-ULBP1 and anti-Beta Actin to detect the actin protein (loading control). The membrane was also probed with a fluoroclu-ome conjugated secondary antibody (red to detect anti-MYC; green to detect anti-beta actin) to detect the primary antibody.
As shown in Figure 12A, the lanes loaded with lysate from the transfected cells had detectable myc protein indicative of the heterodimer protein.
Expression of the anti-CD33-ULBP1 engineered heterodimer protein in the supernatant of the 293T cells was also tested used the following protocol. Supernatant of 2931 cells mock transfected (No plasmid) or transfected with anti-CD33-ULBP1 chimeras 1 and 2 plasmids were subjected to affinity purification using Talon beads. The input, flow-through, and the purified protein (Elute) was then separated on SDS-PAGE gel and transferred to a nylon membrane. The membrane was probed with ant-MYC antibody to detect. The membrane was also probed with a flurochrome conjugated secondary antibody (red to detect anti-MYC to detect the primary antibody. Again as shown in Figure 12B, the lanes loaded with supernatant from the transfected cells had detectable myc protein indicative of the heterodimer protein.
Cell culture supernatants or eluate from TALON resin from the CHO-Kl cells transfected with chimeras as listed and described in Example 1 were added to 2X SDS loading buffer, heated, and run on an SDS Page gel. Proteins were transferred to a PVDF membrane and probed with anti-myc antibody to detect anti-CD33-6DMPa-Hinge-MycHis, and anti-FLAG antibody to detect ULBP1 -6DMPb-Hinge -FLAG His or anti-CD3-6DMPb-Hinge-FLAGHis. Fluorochrome-conjugated secondary antibodies were used to probe for the antiMyc and antiFLAG antibodies (green and red respectively).
As shown in Figure 13, the cells had detectable myc or flag protein indicative of the heterodimer proteins.
Example 3- Binding Experiments The binding of the engineered heterodimer proteins was tested using the following protocol:
Resuspended 50k cells in 50uL FACS Buffer Add 50uL of engineered heterodimer protein, incubated 30 minutes Wash Resuspend in anti-MYC-FITC or anti-FLAG-PE, incubated 30 minutes Results showed that in HL60 cells incubated with the purified engineered heterodimer proteins and then with anti-FLAG FITC antibodies there was binding of both constructs (Figure 14A). When HL60 cells were incubated with the constructs and then anti-MYC FITC antibodies, over 99% of binding was seen for each construct as well as the CD33 construct alone, showing that the CD33 construct bound to the cell surface CD33 well and was not disrupted by the CD3 or ULBP conjugate (Figure 14B).
Similar results are summarized in Figures 15-17 for binding of the engineered proteins to HL60 cells, Jurkat cells and PMBCs.
Example 4- Cytotoxic Activity of the Engineered Heterodimer Proteins NK and CD3 in vitro cytotoxic activity of the engineered heterodimer proteins was evaluated using the following general protocol:
1. From frozen human PBMC, CD3+ cytotoxic T-cells were selected using REAlease CD3 MicroBead Kit (Miltenyi). Dynabeads Human T-activator CD3/CD28 are used immediately after to activate T-cells for one week.
2. One week after selection and activation, removed Dynabeads from T-cells.
3. Counted MOLM14-dTomato-luciferase cells (AML cell line) and T-cells (see above). Co-cultured in RPMI (+20% fetal bovine serum, 1% penicillin-streptomycin) at a ratio of 1:5 (10,000 MOLM14 cells with 50,000 T-cells).
4. Added freshly-thawed chimeric proteins to each well (e.g., various concentrations of anti-CD33-anti-CD3 engineered heterodimer) 5. Cultured overnight at 37 C, 5% CO2.
6. Spun plates (500rpm, 5min), remove supernatant.
7. Washed with 200uL FACS buffer (PBS with: 1% FES, 1mM EDTA) 8. Spun plates (500rpm, 5min), remove supernatant 9. Resuspended in 100uL FACS buffer, add DAPI to final concentration of 0 .lug/mL
10. Proceeded to FACS analysis; gate for single cells, and identify target cells as PE+DAPI+ (dTomato in MOLM14 AML cells in PE channel, dead cells in DAPI
channel) See Figure 18A.
11. Compared % of DAPI+ cells among PE+ cells in the T-cell+dimer group, considering wells with MOLM14 and T-cells (without dimer) as baseline. % cell death was normalized to control group with T-cells and M0LM14 cells co-incubated without dimer treatment according to the formula below:
[ (death from T-cells and dimer) ¨ (death from T-cells alone) I / [ 100 ¨
(death from T-cells alone)] *100 In one experiment, MOLM14-dTomato cells were incubated with varying amount of anti-CD33-anti-CD3 heterodimer (10 ng, 100 ng, 1 lig and 10 g) with 5:1 ratio of T-cells (effector) as well as control (no heterodimer, no T cells) and incubation with 10 lag of heterodimer only and 5:1 T cells only for 24 hours.
As shown in Figure 18B, cytotoxicity was seen for all of the doses of heterodimer with the T cells (effector cells) as compared to the controls, dimer alone or T cells alone and anti-CD33-anti-CD3 heterodimer enhanced the killing of CD33-expressing target cells (MOLM14) by effector T-cells in a dose dependent manner.
In a further experiment using the protocol above. activated T-cells (CD3+) selected from PBMCs were co-incubated with CellTrace Violet CD33 expressing HL-60 target cells for 16 hours, in the presence of anti-CD33-anti-CD3 heterodimer at three concentrations.
Following incubation, cells were stained with 7-AAD viability dye and analyzed using flow cytometry. See Figure 19A. Percent (%) cell death was normalized to control group with T-cells and HL-60 cells co-incubated without dimer treatment according to the formula below:
[ (death from T-cells and dimer) ¨ (death from T-cells alone) / [ 100 ¨ (death from T-cells alone)] *100 As shown in Figure 19B, anti-CD33-anti-CD3 heterodimer enhances killing of CD33-expressing target cells (HL60) by effector T-cells in a dose dependent manner.
An additional cytotoxicity assay was performed as follows: AML cells (HL-60) were co-incubated with either monomer of CD3 or CD33 or with anti-CD33-anti-CD33 heterodimer with and without T-cells for 24 hours and viability was measured using live/dead staining using 7AAD and flow cytometry as described. Results in Figure 20 show that the heterodimers but not the monomers enhanced effector cells (T-cells) cytotoxic activity on AML cells.
A further dose dependent cytotoxicity assay was performed as follows: AML
cells (HL-60) were co-incubated with anti-CD3-anti-CD33 heterodimer at the indicated amounts (3, 30, 300 or 30000 rig of heterodimer) with or without T-cells for 24 hours and viability was measured using live/dead staining using 7AAD and flow cytometry as described.
Dose dependent enhancement of effector cell cytotoxic activity of the heterodimer on AML cells was seen. There was no appreciable increase in cytotoxicity with the anti-CD33-anti-CD3 heterodimer alone (no T-cells) between 3 and 3000 ng, suggesting the anti-CD33-anti-CD3 heterodimer does not show cytotoxic by itself and the cytotoxic effects are mediated via enhancement of T-cell function. See Figure 21.
Another dose dependent cytotoxicity assay was performed as follows: AML cells (HL-60) were incubated with 300 ng of anti-CD33-anti-CD3 heterodimer with varying ratios of T-cells (effector) (1:1, 2:1, 5:1, and 10:1 effector to target) for 24 hours and viability was measured using live/dead staining using 7AAD and flow cytometry as described.
A dose dependent increase in cytotoxicity was seen up to the 5:1 ratio of effector to target using 300 ng of heterodimer. There was no appreciable increase in cytotoxicity between the ratios of 5:1 and 10:1 effector to target, likely because a maximal cytotoxicity was reached. See Figure 22 All the above data suggest that heterodimer was functionally active and enhanced the T-cell cytotoxic function towards the AML cells. The data also shows that the cytotoxicity of the heterodimer is increase in cells which exhibit a higher expression of CD33, such as MOLM14 cells. See Figure 18B versus Figure 19B.
Example 5- In Vivo Anti-Tumor Activity of the Engineered Heterodimer Proteins The in vivo activity of the anti-CD33-anti-CD3 engineered heterodimer protein was tested in mice using the following protocol. All mice received 2x105 MOLM14-dTomato-luciferase cells (AML cell line), then at day 2 and following the below schedule, one group received no treatment, one group received unloaded T cells ("unloaded T
cells") and one group T cells loaded with the anti-CD33-anti-CD3 engineered heterodimer protein (Bite) ("loaded T cells").
Day 2: 10 million T cells with or without 100ugr anti-CD33-anti-CD3 engineered heterodimer protein;
Days 6 and 11: 20 million T cells with or without 200ugr anti-CD33-anti-CD3 engineered heterodimer protein Days 15 and 20: 40 million T cells with or without 400ugr anti-CD33-anti-CD3 engineered heterodimer protein.
Bioluminescence imaging (3LI) to monitor the growth of FFluc-dtomato transduced MOLM14 on days 7, 17 and 24. See Figure 24A.
Mice were sacked for analysis when one or more leukemia-related symptoms were observed such as hunch-backed, significant weight loss, ruffled coat, and limb paralysis.
As shown in Figures 24B and C, mice treated with loaded T cells had lower tumor burden at days 7 and 17.
Additionally, mice treated with the loaded T cells had better survival than the 2 control groups (no treatment or unloaded T cells). The Kaplan-Meier survival plot was made with starting date as the date of MOLM14 injection and end date as date of death/sacking for each mouse. See Figure 24D.
REFERENCES
Benci, et aL "Tumor Interferon Signaling Regulates a Multigenic Resistance Program to Immune Checkpoint Blockade." Cell. 167(6):1540-54. 2016.
Chamuleau, et al. "1-ligh INDO (indoleamine 2,3-dioxygenase) mRNA level in blasts of acute myeloid leukemic patients predicts poor clinical outcome."
Haematologica.
93(12):1894-8. 2008.
Chen, et al. "Programmable design of orthogonal protein heterodimers." Nature 565: 106-111.
2019.
Dohner et al., NEJM (2015) 373:1136.
Dulphy, et al. A. "Underground adaptation to a hostile environment: acute myeloid leukemia vs. natural killer cells." Front Immunol. 7(94):1-15. 2016.
Elias, et al. "Immune evasion by oncogenic proteins of acute myeloid leukemia." Blood 123(10):1535-43. 2014.
Krupka, et al. "CD33 target validation and sustained depletion of AML blasts in long-term cultures by the hi-specific T-cell-engaging antibody AMG 330." Blood. 123:356-365. 2014.
Kufer, et al. "Pharmaceutical compositions comprising bispccific anti-CD3, anti-CD19 antibody constructs for the treatment of B-cell related disorders." Patent CA2522586. 2017.
Le Dieu, et al. "Peripheral blood T cells in acute myeloid leukemia (AML) patients at diagnosis have abnormal phenotype and genotype and form defective immune synapses with AML
blasts." Blood 114(18):3909-16. 2009.
Lowenberg, et al. Dutch-Belgian Hemato-Oncology Cooperative Group (HOVON)., German Austrian AML Study Group (AMLSG)., Swiss Group for Clinical Cancer Research Collaborative Group (SAKK). "Gemtuzumab ozogamicin as postremission treatment in AML
at 60 years of age or more: results of a multicenter phase 3 study." Blood.
115(13):2586-91.
2010.
Mastaglio, et al. "Natural killer receptor ligand expression on acute myeloid leukemia impacts survival and relapse after chemotherapy". Blood Adv. 2(4):335-346. 2018.
Mundy-Bosse, et al. "Acute Myeloid Leukemia Alters Natural Killer Cell Maturation and Functional Activation." Blood. 124(21):754. 2014.
Nanbakhsh, et al. "c-Myc regulates expression of NKG2D ligands ULBP1/2/3 in AML and modulates their susceptibility to NK-mediated lysis". Immunobio. 123(23):3585-3596. 2014.
Orleans-Lindsay, et al. "Acute myeloid leukaemia cells secrete a soluble factor that inhibits T
and NK cell proliferation but not cytolytic function ¨ implications for the adoptive immunotherapy of leukaemia." Clin Exp Immunol. 126(3):403-11. 2001.
Renneville, et al. "Clinical impact of gene mutations and lesions detected by SNP-array karyotyping in acute myeloid leukemia patients in the context of gemtuzumab ozogamicin treatment: results of the ALFA-0701 trial." Oncotarget. 5(4):916-932. 2014.
Schnorfeil, et al. "T cells are functionally not impaired in AML: increased PD-1 expression is only seen at time of relapse and correlates with a shift towards the memory T
cell compartment." J Hematol Oncol. 8:93. 2015.
Shenghui, et al. "Elevated frequencies of CD4(+) CD25(+) CD12710 regulatory T
cells is associated to poor prognosis in patients with acute myeloid leukemia." Int J
Cancer.
129(6) :1373-81. 2011.
Stringaris, et al. "Leukemia-induced phenotypic and functional defects in natural killer cells predict failure to achieve remission in acute myeloid leukemia."
Haematologica. 99(5):836-47. 2014.
Thor sson, et al. ''The Immune Landscape of Cancer." Immunity. 48(4):812-30.
2018.
Wypych., et al. "Human IgG2 Antibodies Display Disulfide-mediated Structural Isoforms." J
Biol Chem. 283:16194-205. 2008.
[ (death from T-cells and dimer) ¨ (death from T-cells alone) I / [ 100 ¨
(death from T-cells alone)] *100 In one experiment, MOLM14-dTomato cells were incubated with varying amount of anti-CD33-anti-CD3 heterodimer (10 ng, 100 ng, 1 lig and 10 g) with 5:1 ratio of T-cells (effector) as well as control (no heterodimer, no T cells) and incubation with 10 lag of heterodimer only and 5:1 T cells only for 24 hours.
As shown in Figure 18B, cytotoxicity was seen for all of the doses of heterodimer with the T cells (effector cells) as compared to the controls, dimer alone or T cells alone and anti-CD33-anti-CD3 heterodimer enhanced the killing of CD33-expressing target cells (MOLM14) by effector T-cells in a dose dependent manner.
In a further experiment using the protocol above. activated T-cells (CD3+) selected from PBMCs were co-incubated with CellTrace Violet CD33 expressing HL-60 target cells for 16 hours, in the presence of anti-CD33-anti-CD3 heterodimer at three concentrations.
Following incubation, cells were stained with 7-AAD viability dye and analyzed using flow cytometry. See Figure 19A. Percent (%) cell death was normalized to control group with T-cells and HL-60 cells co-incubated without dimer treatment according to the formula below:
[ (death from T-cells and dimer) ¨ (death from T-cells alone) / [ 100 ¨ (death from T-cells alone)] *100 As shown in Figure 19B, anti-CD33-anti-CD3 heterodimer enhances killing of CD33-expressing target cells (HL60) by effector T-cells in a dose dependent manner.
An additional cytotoxicity assay was performed as follows: AML cells (HL-60) were co-incubated with either monomer of CD3 or CD33 or with anti-CD33-anti-CD33 heterodimer with and without T-cells for 24 hours and viability was measured using live/dead staining using 7AAD and flow cytometry as described. Results in Figure 20 show that the heterodimers but not the monomers enhanced effector cells (T-cells) cytotoxic activity on AML cells.
A further dose dependent cytotoxicity assay was performed as follows: AML
cells (HL-60) were co-incubated with anti-CD3-anti-CD33 heterodimer at the indicated amounts (3, 30, 300 or 30000 rig of heterodimer) with or without T-cells for 24 hours and viability was measured using live/dead staining using 7AAD and flow cytometry as described.
Dose dependent enhancement of effector cell cytotoxic activity of the heterodimer on AML cells was seen. There was no appreciable increase in cytotoxicity with the anti-CD33-anti-CD3 heterodimer alone (no T-cells) between 3 and 3000 ng, suggesting the anti-CD33-anti-CD3 heterodimer does not show cytotoxic by itself and the cytotoxic effects are mediated via enhancement of T-cell function. See Figure 21.
Another dose dependent cytotoxicity assay was performed as follows: AML cells (HL-60) were incubated with 300 ng of anti-CD33-anti-CD3 heterodimer with varying ratios of T-cells (effector) (1:1, 2:1, 5:1, and 10:1 effector to target) for 24 hours and viability was measured using live/dead staining using 7AAD and flow cytometry as described.
A dose dependent increase in cytotoxicity was seen up to the 5:1 ratio of effector to target using 300 ng of heterodimer. There was no appreciable increase in cytotoxicity between the ratios of 5:1 and 10:1 effector to target, likely because a maximal cytotoxicity was reached. See Figure 22 All the above data suggest that heterodimer was functionally active and enhanced the T-cell cytotoxic function towards the AML cells. The data also shows that the cytotoxicity of the heterodimer is increase in cells which exhibit a higher expression of CD33, such as MOLM14 cells. See Figure 18B versus Figure 19B.
Example 5- In Vivo Anti-Tumor Activity of the Engineered Heterodimer Proteins The in vivo activity of the anti-CD33-anti-CD3 engineered heterodimer protein was tested in mice using the following protocol. All mice received 2x105 MOLM14-dTomato-luciferase cells (AML cell line), then at day 2 and following the below schedule, one group received no treatment, one group received unloaded T cells ("unloaded T
cells") and one group T cells loaded with the anti-CD33-anti-CD3 engineered heterodimer protein (Bite) ("loaded T cells").
Day 2: 10 million T cells with or without 100ugr anti-CD33-anti-CD3 engineered heterodimer protein;
Days 6 and 11: 20 million T cells with or without 200ugr anti-CD33-anti-CD3 engineered heterodimer protein Days 15 and 20: 40 million T cells with or without 400ugr anti-CD33-anti-CD3 engineered heterodimer protein.
Bioluminescence imaging (3LI) to monitor the growth of FFluc-dtomato transduced MOLM14 on days 7, 17 and 24. See Figure 24A.
Mice were sacked for analysis when one or more leukemia-related symptoms were observed such as hunch-backed, significant weight loss, ruffled coat, and limb paralysis.
As shown in Figures 24B and C, mice treated with loaded T cells had lower tumor burden at days 7 and 17.
Additionally, mice treated with the loaded T cells had better survival than the 2 control groups (no treatment or unloaded T cells). The Kaplan-Meier survival plot was made with starting date as the date of MOLM14 injection and end date as date of death/sacking for each mouse. See Figure 24D.
REFERENCES
Benci, et aL "Tumor Interferon Signaling Regulates a Multigenic Resistance Program to Immune Checkpoint Blockade." Cell. 167(6):1540-54. 2016.
Chamuleau, et al. "1-ligh INDO (indoleamine 2,3-dioxygenase) mRNA level in blasts of acute myeloid leukemic patients predicts poor clinical outcome."
Haematologica.
93(12):1894-8. 2008.
Chen, et al. "Programmable design of orthogonal protein heterodimers." Nature 565: 106-111.
2019.
Dohner et al., NEJM (2015) 373:1136.
Dulphy, et al. A. "Underground adaptation to a hostile environment: acute myeloid leukemia vs. natural killer cells." Front Immunol. 7(94):1-15. 2016.
Elias, et al. "Immune evasion by oncogenic proteins of acute myeloid leukemia." Blood 123(10):1535-43. 2014.
Krupka, et al. "CD33 target validation and sustained depletion of AML blasts in long-term cultures by the hi-specific T-cell-engaging antibody AMG 330." Blood. 123:356-365. 2014.
Kufer, et al. "Pharmaceutical compositions comprising bispccific anti-CD3, anti-CD19 antibody constructs for the treatment of B-cell related disorders." Patent CA2522586. 2017.
Le Dieu, et al. "Peripheral blood T cells in acute myeloid leukemia (AML) patients at diagnosis have abnormal phenotype and genotype and form defective immune synapses with AML
blasts." Blood 114(18):3909-16. 2009.
Lowenberg, et al. Dutch-Belgian Hemato-Oncology Cooperative Group (HOVON)., German Austrian AML Study Group (AMLSG)., Swiss Group for Clinical Cancer Research Collaborative Group (SAKK). "Gemtuzumab ozogamicin as postremission treatment in AML
at 60 years of age or more: results of a multicenter phase 3 study." Blood.
115(13):2586-91.
2010.
Mastaglio, et al. "Natural killer receptor ligand expression on acute myeloid leukemia impacts survival and relapse after chemotherapy". Blood Adv. 2(4):335-346. 2018.
Mundy-Bosse, et al. "Acute Myeloid Leukemia Alters Natural Killer Cell Maturation and Functional Activation." Blood. 124(21):754. 2014.
Nanbakhsh, et al. "c-Myc regulates expression of NKG2D ligands ULBP1/2/3 in AML and modulates their susceptibility to NK-mediated lysis". Immunobio. 123(23):3585-3596. 2014.
Orleans-Lindsay, et al. "Acute myeloid leukaemia cells secrete a soluble factor that inhibits T
and NK cell proliferation but not cytolytic function ¨ implications for the adoptive immunotherapy of leukaemia." Clin Exp Immunol. 126(3):403-11. 2001.
Renneville, et al. "Clinical impact of gene mutations and lesions detected by SNP-array karyotyping in acute myeloid leukemia patients in the context of gemtuzumab ozogamicin treatment: results of the ALFA-0701 trial." Oncotarget. 5(4):916-932. 2014.
Schnorfeil, et al. "T cells are functionally not impaired in AML: increased PD-1 expression is only seen at time of relapse and correlates with a shift towards the memory T
cell compartment." J Hematol Oncol. 8:93. 2015.
Shenghui, et al. "Elevated frequencies of CD4(+) CD25(+) CD12710 regulatory T
cells is associated to poor prognosis in patients with acute myeloid leukemia." Int J
Cancer.
129(6) :1373-81. 2011.
Stringaris, et al. "Leukemia-induced phenotypic and functional defects in natural killer cells predict failure to achieve remission in acute myeloid leukemia."
Haematologica. 99(5):836-47. 2014.
Thor sson, et al. ''The Immune Landscape of Cancer." Immunity. 48(4):812-30.
2018.
Wypych., et al. "Human IgG2 Antibodies Display Disulfide-mediated Structural Isoforms." J
Biol Chem. 283:16194-205. 2008.
Claims (24)
1. An engineered heterodimer protein, comprising:
(a) a first polypeptide conlprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (b) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain;
and wherein the first and second polypeptides are covalently bonded through the covalent dimerization domain.
(a) a first polypeptide conlprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (b) a second polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain;
and wherein the first and second polypeptides are covalently bonded through the covalent dimerization domain.
2. The engineered heterodimer protein of claim 1, wherein the molecule expressed on NK
cells is NKG2D, and wherein the polypeptide that binds a molecule expressed on NK cells is ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or mutants or fragments thereof.
cells is NKG2D, and wherein the polypeptide that binds a molecule expressed on NK cells is ULBP1, ULBP2, ULBP3, ULBP4, ULBP5, ULBP6, MICA, MICB, or mutants or fragments thereof.
3. The engineered heterodimer protein of claim 2, wherein the polypeptide that binds a molecule expressed on NK cells is an ectodomain of ULBP1, ULBP2, ULBP3, ULBP4, ULB P5, ULBP6. MICA, or MICB.
4. The engineered heterodimer protein of claim 1, wherein the molecule expressed on NK
cells is CD16, and wherein the polypeptide that binds a molecule expressed on T cells is a mono clonal antibody of CD16.
cells is CD16, and wherein the polypeptide that binds a molecule expressed on T cells is a mono clonal antibody of CD16.
5. An engineered heterodimer protein, comprising:
(a) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (b) a second polypeptide comprises a polypeptide that binds a rnolecule expressed on T cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and wherein the first and second polypeptides are covalently bonded through the covalent dimerization domain.
(a) a first polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers and a first covalent dimerization domain; and (b) a second polypeptide comprises a polypeptide that binds a rnolecule expressed on T cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers, and a second covalent dimerization domain; and wherein the first and second polypeptides are covalently bonded through the covalent dimerization domain.
6. The engineered heterodimer protein of claim 5, wherein the molecule expressed on T cells is CD3, and wherein the polypeptide that binds a molecule expressed on T cells is a mono clonal antibody of CD3.
7. The engineered heterodimer protein of any of claims 1-6, wherein the first dimerization domain and/or the second dimerization domain comprise an IgG2 hinge domain.
8. The engineered heterodimer protein of claim 7, wherein the first dimerization domain and/or the second dimerization domain further comprise an IgG2 Fc domain.
9. The engineered heterodimer protein of any of claims 1-8, wherein the non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers in the first polypeptide and the second polypeptide comprise 6DMPa and 6DMPb, respectively.
10. The engineered heterodimer protein of any of claims 1-8, wherein the non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers in the first polypeptide and the second polypeptide cornprise 6DMPb and 6DMPa, respectively.
11. The engineered heterodimer protein of any of claims 1-10, wherein the lineage-specific cell-surface antigen is CD33.
12. The engineered heterodimer protein of any of claims 1-11, wherein the antigen-binding fragment is a single-chain antibody fragrnent (scFv).
13. A composition comprising at least one vector encoding the engineered heterodirner protein of claims 1-12.
14. A kit comprising the composition of claim 13.
15. A method of treating a hematopoietic malignancy in a subject, comprising administering to the subject an effective amount of the composition of claim 13.
16. An engineered heterotrimer protein. comprising:
(a) a first polypeptide comprising a polypeptide that binds a molecule expressed on T cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (a 1), and a first covalent dimerization domain;
(b) a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (bl), and a second covalent dimerization domain;
(c) a third polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (cl), and a third covalent dimerization domain; and (d) a fourth polypeptide comprising three non- naturally occurring pol ypepti de domains comprising 1-5 alpha helices connected by amino acid linkers, wherein each domain is the binding domain of al,hl and cl (a2, 112 and c2), and a fourth, fifth and sixth covalent dimerization domain;
wherein the first and second and third and fourth polypeptides are covalently bonded through the covalent dimerization domain.
(a) a first polypeptide comprising a polypeptide that binds a molecule expressed on T cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (a 1), and a first covalent dimerization domain;
(b) a second polypeptide comprising an antigen-binding fragment that binds a lineage-specific cell-surface antigen, a non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (bl), and a second covalent dimerization domain;
(c) a third polypeptide comprising a polypeptide that binds a molecule expressed on natural killer (NK) cells, a non- naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers (cl), and a third covalent dimerization domain; and (d) a fourth polypeptide comprising three non- naturally occurring pol ypepti de domains comprising 1-5 alpha helices connected by amino acid linkers, wherein each domain is the binding domain of al,hl and cl (a2, 112 and c2), and a fourth, fifth and sixth covalent dimerization domain;
wherein the first and second and third and fourth polypeptides are covalently bonded through the covalent dimerization domain.
17. The engineered heterotrimer protein of claim 16, wherein the molecule expressed on T
cells is CD3, and wherein the polypeptide that binds a molecule expressed on T
cells is a mono clonal antibody of CD3, wherein the lineage-specific cell-surface antigen is CD33, and wherein the molecule expressed on NK cells is NKG2D.
cells is CD3, and wherein the polypeptide that binds a molecule expressed on T
cells is a mono clonal antibody of CD3, wherein the lineage-specific cell-surface antigen is CD33, and wherein the molecule expressed on NK cells is NKG2D.
18. The engineered heterotrimer protein of claim 16, wherein the molecule expressed on T
cells is CD3, and wherein the polypeptide that binds a rnolecule expressed on T cells is a mono clonal antibody of CD3, wherein the lineage-specific cell-surface antigen is CD33, and wherein the molecule expressed on NK cells is CD16, and wherein the polypeptide that binds a molecule expressed on NK cells is a monoclonal antibody of CD16.
cells is CD3, and wherein the polypeptide that binds a rnolecule expressed on T cells is a mono clonal antibody of CD3, wherein the lineage-specific cell-surface antigen is CD33, and wherein the molecule expressed on NK cells is CD16, and wherein the polypeptide that binds a molecule expressed on NK cells is a monoclonal antibody of CD16.
19. The engineered heterotrimer protein of any of claims 16-18, wherein the first dimerization domain and/or the second dimerization domain and/or the third dimerization domain and/or the fourth dimerization domain and/or the fifth dimerization domain and/or the sixth dimerization domain comprise an IgG2 hinge domain.
20. The engineered heterotrimer protein of claim 19, wherein the first dimerization domain and/or the second dimerization domain and/or the third dimerization domain and/or the fourth dimerization domain and/or the fifth dimerization domain and/or the sixth dimerization domain further comprise an IgG2 Fc domain.
21. The engineered heterotrimer protein of any of claims 16-20, wherein the non-naturally occurring polypeptide domain comprising 1-5 alpha helices connected by amino acid linkers in the first polypeptide and the second polypeptide and the third polypeptide and the fourth polypeptide are chosen from the group consisting of 6DMPa and 6DMPb.
22. A composition comprising at least one vector encoding the engineered heterotrimer protein of cl aims 16-21.
23. A kit comprising the composition of claim 22.
24. A method of treating a hematopoietic malignancy in a subject, comprising administering to the subject an effective amount of the composition of claim 22.
Applications Claiming Priority (10)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US63/047,938 | 2020-07-03 | ||
US202063050346P | 2020-07-10 | 2020-07-10 | |
US63/050,346 | 2020-07-10 | ||
US202063075388P | 2020-09-08 | 2020-09-08 | |
US63/075,388 | 2020-09-08 | ||
US202163145083P | 2021-02-03 | 2021-02-03 | |
US63/145,083 | 2021-02-03 | ||
US202163189412P | 2021-05-17 | 2021-05-17 | |
US63/189,412 | 2021-05-17 | ||
PCT/US2021/040538 WO2022006564A1 (en) | 2020-07-03 | 2021-07-06 | Polyfunctional orthogonal protein chimeras |
Publications (1)
Publication Number | Publication Date |
---|---|
CA3184819A1 true CA3184819A1 (en) | 2022-01-06 |
Family
ID=85380732
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA3184819A Pending CA3184819A1 (en) | 2020-07-03 | 2021-07-06 | Polyfunctional orthogonal protein chimeras |
Country Status (1)
Country | Link |
---|---|
CA (1) | CA3184819A1 (en) |
-
2021
- 2021-07-06 CA CA3184819A patent/CA3184819A1/en active Pending
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US10912799B2 (en) | Compositions and methods for inhibition of lineage specific antigens | |
CN110300603B (en) | CD47-CAR-T cells | |
WO2014165818A2 (en) | Compositions and methods for preventing and treating prostate cancer | |
JP7182012B2 (en) | Mesothelin-specific chimeric antigen receptor and T cells expressing the same | |
US20220306739A1 (en) | Materials and methods for modulating an immune response | |
US20210284731A1 (en) | Methods and materials for modulating an immune response | |
US20230220107A1 (en) | Anti-Tumor Associated Antigen Antibodies and Uses Thereof | |
US20230391866A1 (en) | Polyfunctional orthogonal protein chimeras | |
CA3184819A1 (en) | Polyfunctional orthogonal protein chimeras | |
US20220305056A1 (en) | Chimeric antigen receptor system and uses thereof | |
US20210393685A1 (en) | Anti-cd33 and nkg2d ligand chimeras for treatment of myeloid malignancies | |
EP3366704A1 (en) | Antibodies specific for mmp1/hla-a2 complex | |
WO2024102604A1 (en) | Anti-5t4 antibodies and uses thereof | |
WO2024182475A2 (en) | Anti-ror2 antibodies and uses thereof | |
WO2023177974A2 (en) | Anti-mesothelin antibodies and uses thereof | |
WO2024076864A2 (en) | Anti-ror1 antibodies and uses thereof | |
WO2024091870A2 (en) | Anti-egfrviii antibodies and uses thereof |