CA2957441A1 - Genome editing using campylobacter jejuni crispr/cas system-derived rgen - Google Patents

Abstract

The present invention relates to Campylobacter jejuni CRISPR/CAS system-derived RGEN and a use thereof.

Description

GENOME EDITING USING CAMPYLOBACTER JEJUNI CRISPRICAS
SYSTEM-DERIVED RGEN
TECHNICAL FIELD
[0001] The disclosure provided herewith relates to a Campylobacter jejuni CRISPR/CAS
system-derived, RNA-guided engineered nuclease (RGEN) and methods for using the same.
BACKGROUND ART

[0002] Engineered nucleases can be used to effectively manipulate genes in living cells or whole organisms by creating site-specific double-strand breaks at desired locations in the genome (Nat Rev Genet, 2014. 15(5): p. 321-34.). Engineered nucleases, which comprise a DNA-binding domain and a nuclease domain customized for type II restriction enzymes, have a broad spectrum of genome engineering applications in the biotechnology and medical fields as well as various other industries.
More recently, a more potent RGEN platform has been developed based on the bacterial adaptive immune system.

[0003] The sequence that RGEN targets is limited to a protospacer adjacent motif (PAM), which is a DNA sequence immediately following the DNA sequence targeted by the Cas9 nuclease.
The PAM sequence was not previously reprogammable in the CRISPR bacterial adaptive immune system. The canonical PAM comprises the sequence 5'-NGG-3' and is associated with the RGEN
derived from the CAS9 nuclease of Streptococcus pyogenes. Hence, the GG motif is a prerequisite for DNA recognition by the RGEN. To expand sequences for use as PAMs, attempts have been made to separate RGENs from different bacterial species with versatile PAMs. In fact, different PAMs have been found to be associated with the CAS9 protein of the bacteria Streptococcus thermophilus (PAM:
NNAGAAW) and Neisseria meningiti ells (PAM:
GAT1), widening the range of selection in determining RGEN target loci.

DETAILED DESCRIPTION OF THE INVENTION
TECHNICAL PROBLEM

[0004] As described herein, intensive and thorough research into the development of RGENs from bacteria other than Streptococcus pyogenes has resulted in the discovery that a Cas protein derived from Campylobacter jejuni (C. jejuni) specifically recognizes an NNNNRYAC
sequence, which can be used as a PAM in the targeting of a DNA of interest. Further, a guide RNA can be engineered for optimal of a DNA, thereby resulting in efficient genome editing, transcription regulation, and separation of a DNA of interest.
TECHNICAL SOLUTION

[0005] Accordingly, in one aspect, the present invention provides a method for targeting a DNA sequence comprising a PAM sequence of SEQ ID NO: 1, the method comprising introducing a Cas protein that recognizes the PAM sequence of SEQ ID NO: 1, or a nucleic acid encoding the Cas protein into a cell.

[0006] In another aspect, the present invention provides an isolated guide RNA
comprising a sequence capable of forming a duplex (forming a base pair or hybridizing) with a complementary strand of a target DNA sequence of interest adjacent to the PAM sequence of SEQ ID
NO: 1, or a composition comprising the same.

[0007] In still another aspect, the disclosure provided herewith provides a CRISPR-CAS
system, comprising: (i) a guide RNA comprising a sequence capable of duplexing with a target DNA
sequence adjacent to the PAM sequence of NNNNRYAC (SEQ ID NO: 1), or DNA
encoding the guide RNA, and (ii) a Cas protein recognizing the NNNNRYAC sequence (SEQ ID
NO: 1), or a nucleic acid encoding the Cas protein.

[0008] In still another aspect, the disclosure provided herewith provides a recombinant viral vector, comprising (i) an expression cassette for a guide RNA comprising a sequence capable of forming a duplex with a target DNA sequence adjacent to the PAM sequence NNNNRYAC (SEQ ID

NO: 1), and (ii) an expression cassette for a Cas protein recognizing the PAM
sequence NNNNRYAC
(SEQ ID NO: 1).

[0009] In still another aspect, the disclosure provides an isolated guide RNA
comprising a sequence, 21-23 bp in length, capable of forming a duplex with a complementary strand of a target DNA sequence, or a composition comprising the same.

[00010] In still another aspect, the disclosure provides an isolated guide RNA, comprising: a first region comprising a sequence capable of forming a duplex with a complementary strand of a target DNA sequence, and a second region comprising a stem-loop structure characterized by a stem 13-18 bp in length, or a composition comprising the isolated guide RNA.

[00011] In still another aspect, the disclosure provides an isolated guide RNA, comprising: a first region comprising a sequence capable of forming a duplex with a complementary strand of a target DNA sequence, and a second region comprising a stem-loop structure characterized by a loop 5-10 bp in length, or a composition comprising the isolated guide RNA.

[00012] In still another aspect, the disclosure provided herewith provides a method of genome editing in a cell, comprising introducing an isolated guide RNA or a DNA
encoding the isolated guide RNA, along with a Cas protein or a nucleic acid encoding the Cas protein, into the cell.

[00013] In still another aspect, the disclosure provides a method of cleaving a target DNA in a cell, comprising introducing an isolated guide RNA or a DNA encoding the isolated guide RNA, and a Cas protein or a nucleic acid encoding the Cas protein into the cell.

[00014] In still another aspect, the disclosure provides a method for preparing a target DNA-recognizing sequence of a guide RNA, comprising: (i) identifying the presence of a PAM sequence NNNNRYAC (SEQ ID NO: 1) in a given sequence; and (ii) determining a sequence located upstream of the PAM sequence NNNNRYAC (SEQ ID NO: 1) as being recognizable by a guide RNA, if the presence of the PAM sequence is identified in step (i).

[00015] In still another aspect, the disclosure provides a method for isolating a DNA of interest, comprising: (i) introducing a guide RNA or a DNA encoding the guide RNA, along with a deactivated Cos protein or a nucleic acid encoding the deactivated Cas protein, into a cell, to allow the guide RNA
and the deactivated Cas protein to foul' a complex together with the DNA of interest comprising a target DNA sequence; and (ii) separating the complex from a sample.

[00016] In still another aspect, the disclosure provides a method for Cas-mediated gene expression regulation in a DNA of interest comprising a target DNA sequence, comprising introducing an isolated guide RNA specifically recognizing the target DNA sequence or a DNA encoding the guide RNA, and an deactivated Cas protein fused to a transcription effector domain or a nucleic acid encoding the deactivated Cas protein into a cell.
ADVANTAGEOUS EFFECT

[00017] As described above, in some embodiments, the CRISPR/Cas system can be effectively used for targeting a target DNA, thereby achieving genome editing, transcription regulation, and isolation of a DNA of interest.
BRIEF DESCRIPTION OF DRAWINGS

[00018] FIG. 1 depicts a schematic diagram of a C. jejuni Cas9 expression vector. The vector is designed so that a humanized Cas9 protein is expressed under the regulation of a CMV promoter and is provided with a nuclear localization signal (NLS) and an HA tag at a C-terminal region.

[00019] FIG. 2A and FIG. 2B depict the experiments for C. jejuni RGEN-induced mutation in an endogenous human AAVS1 target locus. FIG. 2A shows that RGEN-driven chromosomal mutations were detected using a T7E1 assay. Asterisks (*) indicate DNA bands that are anticipated to be cleaved by T7E1. HEK293 wild-type (wt) gDNA was used as a negative control (-). A previously proven RGEN was used as a positive control (+). FIG. 2B shows DNA sequences of hAAVS1 mutant clones. Target sequence regions complementary to chimeric RNA are shown in bold. PAM sequences recognized by CAS9 are underlined. The WT sequence of FIG. 2B is represented by SEQ ID NO: 4, the (-2, xl) sequence by SEQ ID NO: 5, and the (-1, xl) sequence by SEQ ID NO:
6.

[00020] FIG. 3A and FIG. 3B show the experiments for C. jejuni RGEN-induced mutation in an endogenous mouse ROSA26 (mROSA) target locus. FIG. 3A shows that RGEN-driven chromosomal mutations were detected using a T7E1 assay. Asterisks (*) indicate DNA bands that are anticipated to be cleaved by T7E1. NIH3T3 wt gDNA was used as a negative control (-). A previously proven RGEN was used as a positive control (+). FIG. 3B shows DNA sequences of mROSA mutant clones. Target sequence regions complementary to chimeric RNA are shown in bold. PAM sequences recognized by C. jejuni CAS9 are underlined. The WT sequence of FIG. 3B is represented by SEQ ID
NO: 7, the(-1, xl) sequence by SEQ ID NO: 8, and the (+1, xl) sequence by SEQ
NO: 9.

[00021] FIG. 4 shows certain mutations induced in endogenous AAVS1 target loci by a mutant C. jejuni sgRNA structure. RGEN-driven chromosomal mutations were detected using a T7E1 assay.
Asterisks (*) indicate DNA bands that are anticipated to be cleaved by T7E1.
HEK293 wt gDNA was used as a negative control (-). A previously proven RGEN was used as a positive control (+).

[00022] FIG. 5A to FIG. 5C illustrate the optimization of the spacer length of sgRNAs. FIG.
5A shows various sgRNA structures. Additional nucleotides immediately upstream of the 5' end of the spacer of sgRNA are underlined, wherein small letters represent mismatched nucleotides with regard to the target sequence. The PAM sequence is boxed. In FIG. 5A, the target sequence is represented by SEQ ID NO: 10, GX19 by SEQ ID NO: 11, GX20 by SEQ ID NO: 12, GX21 by SEQ ID
NO: 13, GX22 by SEQ ID NO: 14, GX23 by SEQ ID NO: 15, GGX20 by SEQ ID NO: 16, and GGGX20 by SEQ ID NO: 17. FIG. 5B shows target sites of sgRNA wherein sequences for hAAVS-CJ1, hAAVS-NRG1, hAAVS-NRG3, and hAAVS-NRG5 are represented by SEQ ID NOs: 18, 19, 20, and 21, respectively. FIG. 5C shows the efficiency of the sgRNA constructs in inducing RGEN-mediated mutations. Briefly, sgRNAs were constructed to have various lengths of spacers (19-23bp) and various numbers of additional G (guanine) residues present immediately upstream of the spacer. Each of the sgRNAs shown in FIG. 5A was designed for 4 target sites of the human AAVS1 locus (FIG. 5B), and was delivered to human 293-cells. Subsequently, mutations induced by NHEJ were identified in the cells. In this embodiment, the target sites were amplified by PCR, and analyzed by deep sequencing using miSEQ (illumine) to detect the mutations. On the whole, genome editing (mutation) frequency was increased when the recognition sequence was 21-23 bp in length or was provided with 2 or 3 additional G residues at the 5' end thereof, compared to GX19 or GX20 used in C. jejuni or other species.

[00023] FIG. 6 is a graph showing the activity of C. jejuni CRISPR/Cas9 in which the AAVS 1 -CJ1 locus is inserted to a surrogate reporter. Relative to the activity (100) detected for the ACAC
sequence at the PAM site, activities were calculated when different nucleotides were substituted at each position. At the first position, G as well as A guaranteed high activity. T as well as C were effective at the second position. However, only A and C exhibited activity at the third and fourth positions, respectively. Therefore, NNNN-AJG-C/T-C-A (or NNNNRYAC, SEQ ID NO: 1, wherein A/G = R, C/T = Y) is inferred to be an optimal PAM sequence at least in some embodiments.

[00024] FIG. 7 shows a consensus logo for a potential off-target sequence of hAAVS1-CJ1 sgRNA, as excavated by the Digenome-Seq analysis.

[00025] FIG. 8 shows the test results for the PAM sequences of C. jejuni Cas9.
Seven target sites of NNNNRYAC (SEQ ID NO: 1) were analyzed for mutation efficiency. hAAVS1-RYN1 - 7:
ratio of mutation at each site in sgRNA/Cas9-treated cells, WT1 - 7: ratio of mutation at each site in genomic DNA of mock-treated cells.

[00026] FIG. 9 is a schematic diagram showing the structure of a C. jejuni CRISPR/Cas9 expression AAV vector.

[00027] FIG. 10 shows the genome editing, performed by C. jejuni CRISPR/Cas9 AAV
(adeno-associated virus), in the Rosa26 locus. Briefly, C2C12 cells were infected with a recombinant AAV vector carrying both Rosa26-sgRNA and C. jejuni Cas9 at different MOI
(multiplicity of infectivity). At 3, 5, 7, 10, and 14 days post-infection, genomic DNA was isolated, and analyzed for mutation ratio by deep sequencing.

EMBODIMENTS OF THE INVENTION

[00028] One embodiment of the present invention provides a method for targeting a DNA
sequence of interest, comprising introducing into a cell a Cas protein or a nucleic acid encoding the same.

[00029] In detail, in accordance with one aspect, the present disclosure provides a method for targeting a DNA sequence comprising a PAM (protospacer adjacent motif) sequence of SEQ ID NO: 1, comprising introducing a Cas protein that recognizes the PAM sequence NNNNRYAC
of SEQ ID NO:
1 or a nucleic acid encoding the Cas protein into a cell. In SEQ
NO: 1, according to the IUPAC
nomenclature, "N" refers to any nucleotide, for example, selected from A, C, G, and T; "R" refers to purine (A/G); and "Y" refers to pyrimidine (C/T).

[00030] In an aspect of the present disclosure, the method may further comprise introducing a guide RNA comprising a sequence capable of forming a duplex with a complementary strand of a DNA
of interest (target DNA) adjacent to the PAM sequence of SEQ ID NO: 1. The guide RNA can be introduced simultaneously or sequentially with the Cas protein that recognizes the PAM sequence of SEQ ID NO: 1 or the nucleic acid encoding the Cas protein.

[00031] As used herein, the term "targeting" is intended to encompass the binding of a Cas protein to a DNA sequence of interest, either with or without DNA cleavage.

[00032] The terminology that will be described later is applicable to all embodiments of the present disclosure, and can be used in combination.

[00033] The Cas protein can perform its activity after forming a complex with CRISPR RNA
(crRNA) and trans-activating crRNA (tracrRNA). The Cas protein may exhibit endonuclease or nickase activity.

[00034] Information related to Cas proteins or genes encoding Cas proteins can be found in well-known databases, such as GenBank of the NCBI (National Center for Biotechnology Information).
According to one embodiment, the Cos protein may be a Cas9 protein. In another embodiment, the Cas protein may be one originating (derived) from a Campylobacter spp. (i.e., the genus Campylobacter) and may particularly be of Campylobacter jejuni in origin. More particularly, the Cas9 protein can be derived from Campylobacter jejuni. In some embodiments of the present disclosure, the Cas protein may comprise the amino acid sequence represented by SEQ ID NO: 22, or may be homologous to the amino acid sequence of SEQ ID NO: 22, retaining the intrinsic activity thereof. For example, without limitation, the Cas protein and its homologous sequences encompassed by the present disclosure may have a sequence identity at least 50%, 60%, 70%, 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identical to the sequence of SEQ ED
NO: 22.

[00035] Moreover, the Cas protein, as used in certain embodiments of the present disclosure, is intended to encompass any variant that can serve as an activated endonuclease or nickase in cooperation with a guide RNA, as well as a native protein. The activated endonuclease or nickase may cleave a target DNA, or may be able to perfon-n genome editing with the cleavage function. As for deactivated variants, their functions may be used for regulating transcription or isolating a DNA of interest.

[00036] The Cas9 protein variant may be a derivative, variant, or mutant of Cas9 resulting from the substitution of a catalytic aspartate or histidine residue with a different amino acid. For example, the different amino acid may be alanine, but is not limited thereto.

[00037] Specifically, the Cas protein, for example, a Cas9 protein derived from C. jejuni may include a substitution of the catalytic aspartic acid (D) at position 8 or the histidine residue (H) at position 559 with an amino acid that differs from the wild type amino acid sequence. In some embodiments, the catalytic aspartic acid (D) at position 8 or the histidine residue (H) at position 559 of the sequence of SEQ ID NO. 22 is substituted with a different amino acid. For example, the different amino acid may be, without limitation, alanine. The Cas9 nuclease variant prepared by introducing a mutation to one active site of the native Cas9 nuclease can act as a nickase in association with a guide RNA. When bound to one guide RNA molecule, two nickase molecules can cleave both strands of a DNA duplex of interest, thereby creating double-strand breaks (DSB). Hence, such variants also belong to the scope of RGENs encompassed by the present disclosure.

[00038] As used herein, the term "deactivated Cas protein" refers to a Cas nuclease, the function of which is entirely or partially deactivated. The deactivated Cas protein may be abbreviated to dCas.
The Cas may be a Cas9 protein. Further, it may originate from Campylobacter spp., and particularly from C. jejuni. Any method may be used in the preparation of the deactivated Cas9 nuclease, so long as it eliminates nuclease activity. For example, a dCAS9 protein can be constructed by introducing mutations into the two above-mentioned active loci of the Cas9 nuclease. The dCAS9 can then act as a DNA-bound complex with a guide DNA, while lacking a DNA cleavage function.
Moreover, the dCAS9 protein may have substituents having other than the aspartic acid (D) at position 8 and the histidine (H) at position 559. For example, in some embodiments, the dCAS9 protein may have substituents other than the aspartic acid (D) at position 8 and the histidine (H) at position 559 of the sequence of SEQ ID NO. 22. The substituents maybe, without limitation, alanine.

[00039] As used herein, the term "cleavage" refers to the breakage of the covalent backbone of a nucleotide molecule.

[00040] In some embodiments of the present disclosure, the Cas protein can be a recombinant protein.

[00041] The term "recombinant", as used in conjunction with, for example, a cell, nucleic acid, protein, or vector, refers to the cell, nucleic acid, protein or vector that is modified by the introduction of a heterologous nucleic acid or protein or by the alteration of a native nucleic acid or protein, or which is derived from such a modified cell. Thus, for example, a recombinant Cas protein may be generated by reconstituting a Cas protein-encoding nucleic acid sequence (i.e., a sequence encoding a Cas protein), based on the human codon table.

[00042] In some embodiments of the present disclosure, the Cas protein or the nucleic acid encoding the same may be in a form that is allowed to be active within the nucleus.

[00043] In some embodiments of the present disclosure, the isolated Cas protein may be in a form that is easy to introduce into cells. For example, the Cas protein may be linked to a cell-penetrating peptide or a protein transduction domain. The protein transduction domain may be, without limitation, poly-arginine or an HIV-derived TAT protein. The present disclosure encompasses various examples of cell-penetrating peptides or protein transduction domains that are well known in the art.
[000'M] In some embodiments of the present disclosure, the Cas protein or the nucleic acid encoding the same may further comprise a nuclear localization signal (NSL) for transporting the protein or nucleic acid into a nucleus in a cell by nuclear transport. In addition, the nucleic acid encoding the Cas protein may further comprise a nuclear localization signal (NLS) sequence.
Thus, the Cas protein-encoding nucleic acid may be present as a component of an expression cassette that may contain, but is not limited to, an NLS sequence as well as a regulatory element, such as a promoter.
[00045] In some embodiments of the present disclosure, the Cas protein may be linked with a tag that facilitates separation and/or purification. As a non-limiting example, a small peptide tag, such as a His tag, a Flag tag, an S tag, etc., a glutathione S-transferase (GST) tag, or a maltose binding protein (MBP) tag may be used, depending on the purpose.
[00046] In some embodiments of the present disclosure, where the Cas protein is associated with target DNA-specific guide RNA, the Cas protein may be collectively termed an RGEN (RNA-Guided Engineered Nuclease). As used herein, the term "RGEN" refers to a nuclease having a target DNA-specific guide RNA and a Cas protein.
[00047] For application to cells, according to some embodiments of the present disclosure, the RGEN may have a target DNA-specific guide RNA or a DNA encoding the guide RNA;
as well as an isolated Cas protein or a nucleic acid encoding the Cos protein. hi this regard, the guide RNA or the DNA encoding the guide RNA may be applied to cells simultaneously or sequentially with the Cos protein or the nucleic acid encoding the Cas protein.
[00048] In an aspect of the present disclosure, the RGEN for delivery to cells include 1) a target DNA-specific guide RNA and an isolated Cas protein, or 2) a DNA encoding the guide RNA or a nucleic acid encoding the Cas protein. Delivery in the form of 1) is designated "RNP delivery."
[00049] Examples of the isolated guide RNA may comprise, but are not limited to, in vitro transcribed RNAs.

[00050] In some embodiments of the present disclosure, the guide RNA-coding DNA (DNA
encoding the guide RNA) and the Cas protein-coding nucleic acid may themselves be used as isolated nucleic acids. Alternatively, without limitation, they may be present in a vector having an expression cassette for expressing the guide RNA and/or the Cas protein.
[00051] Examples of suitable vectors include a viral vector, a plasmid vector, and an agrobacterium vector. The viral vector may be exemplified by, but is not limited to, an AAV (adeno-associated virus).
[00052] In some embodiments of the present disclosure, without limitation, the guide RNA-coding DNA and the Cas protein-coding nucleic acid may be present separately in respective vectors or together in a single vector.
[00053] The foregoing application embodiments of the subject matter can be applied to more exemplary embodiments as described in this specification. In addition, application embodiments that will be described later may be applied in combination with other constitutional elements.
[00054] As used herein, the term "guide RNA" may refer to a RNA having specificity to a target DNA (i.e., a target DNA-specific RNA), which can be coupled with a Cas protein to guide the Cas protein to the target DNA.
[00055] Moreover, at least in some embodiments, the guide RNA may be designed to be specific for a certain target to be cleaved.
[00056] In some embodiments of the present disclosure, the guide RNA may be a dual RNA
consisting of two RNAs, that is, a crRNA and a tracrRNA. In other embodiments, the guide RNA may be a sgRNA comprising or consisting of a first region containing a sequence complementary to the target DNA capable of forming a duplex with a complementary strand of the target DNA, and a second region containing a sequence responsible for interacting with the Cas protein.
More particularly, the guide RNA may be a sgRNA (single guide RNA or single-stranded guide RNA) synthesized by fusing respective essential portions of a crRNA and a tracrRNA.

[00057] In some embodiments of the present disclosure, the sequence capable of forming a duplex with a complementary strand of a target DNA sequence in the guide RNA
may range, without limitation, in length from 17 to 23 bp, from 18 to 23 bp, from 19 to 23 bp, particularly from 20 to 23 bp, and more particularly from 21 to 23 bp. The length may be applied to both the dual RNA and the sgRNA, and more particularly to the sgRNA.
[00058] In some embodiments of the present disclosure, the guide RNA may comprise one to three, more particularly two or three additional nucleotides just prior to the 5 'end of the sequence capable of forming a duplex with a complementary strand of a target DNA
sequence. The nucleotides are selected from among A, T, G, C, and combinations thereof The guide RNA may comprise, as additional nucleotides, one to three consecutive guanine (G) residues, more preferably, two or three consecutive G residues. This is applied, without limitation, to both dualRNAs and sgRNAs, and more preferably to sgRNAs.
[00059] In some embodiments of the present disclosure, the sgRNA may comprise a region complementary to a target DNA sequence (termed "Spacer region", "Target DNA
recognition sequence", "base pairing region", etc.), and a hairpin structure for binding to the Cos protein.
[00060] In some embodiments of the present disclosure, the sgRNA may comprise a region complementary to a target DNA sequence, a hairpin structure for binding to the Cas protein, and a terminator sequence. These elements may be, without limitation, sequentially arranged in the 5' to 3' direction.
[00061] In some embodiments of the present disclosure, any form of guide RNA
can be used, as long as it contains respective essential portions of a crRNA and a tracrRNA
and a region complementary to a target DNA.
[00062] In some embodiments of the present disclosure, the crRNA may hybridize with a target DNA.
[00063] In some embodiments of the present disclosure, the RGEN may consist of a Cas protein and a dualRNA, or a Cas protein and an sgRNA. Alternatively, the RGEN
may comprise respective nucleic acids encoding a Cas protein and an sgRNA as constitutional elements, but is not limited thereto.
[00064] In some embodiments of the present disclosure, the guide RNA, e.g., crRNA or sgRNA, may contain a sequence complementary to a target DNA sequence, and may comprise one or more additional nucleotides located upstream of the crRNA or sgRNA, particularly at the 5' end of the crRNA of sgRNA or dualRNA. The additional nucleotides may be, but are not limited to, guanine (G) residues.
[00065] In some embodiments of the present disclosure, the guide RNA may comprise a sequence capable of forming a duplex with (i.e., forming a base pair with or hybridizing to) a complementary strand of a target DNA sequence adjacent to the PAM (proto-spacer-adjacent motif) sequence NNNNRYAC (SEQ ID NO: 1).
[00066] In some embodiments of the present disclosure, the guide RNA may comprise a first region, capable of forming a duplex with a complementary stand of a target DNA
sequence, and a second region, comprising a stem-loop structure characterized by a stem 13-18 bp in length. In certain embodiments, the stem may comprise the nucleotide sequence of SEQ ID NO: 2 (5'-GUUUUAGUCCCUUGUG-3') and a complementary sequence thereof [00067] In some embodiments of the present disclosure, the guide RNA may comprise a first region, capable of forming a duplex with a complementary stand of a target DNA
sequence, and a second region comprising a stem-loop structure characterized by a loop 5-10 bp in length. The loop may comprise the nucleotide sequence of SEQ ID NO: 3 (5 '-AUAUUCAA-3').
[00068] In some embodiments of the present disclosure, the Cas proteins and the guide RNAs, especially sgRNAs, which are described above or later, may be those that are not naturally occurring or are engineered. In addition, the factors described for each matter may be combined together for application.
[00069] In some embodiments of the present disclosure, the intracellular introduction of RGEN
can be achieved by, but is not limited to, (1) delivering the Cas9 protein, purified after bacterial overexpression, and the sgRNA (single guided RNA), that recognizes a specific HLA target sequence, which is prepared after in vitro transcription in cells, or (2) delivering a plasmid carrying the Cas9 gene and the sgRNA into cells for expression or transcription.
[00070] In addition, proteins, RNAs or plasmid DNAs encompassed within the scope of the present disclosure can be introduced into cells through various methods known in the art, such as, without limitation, electroporation, or techniques using liposomes, viral vectors, nanoparticles, or PTD
(protein translocation domain) fusion proteins.
[00071] In some embodiments, a method of the present disclosure may be used to cleave a target DNA comprising the PAM sequence of SEQ ID NO: 1, and more particularly to edit a genome.
In this context, the Cas protein may be in an active form with a nuclease or nickase activity.
[00072] In certain embodiments, the Cas protein may be in a deactivated (inactivated) form. In this case, the method of the present disclosure is conducted in such a way that a target DNA sequence comprising the PAM sequence of SEQ ID NO: 1 is not cleaved, but is associated with the Cas protein.
[00073] Moreover, in some other embodiments, the Cas protein, more particularly, the deactivated Cas protein, may further comprise a transcription effector domain.
In detail, the deactivated Cas protein may be linked to, without limitation, an activator, a repressor, or so on.
[00074] Given the transcription effector domain, the method, at least in some embodiments, may be applied to Cas-mediated gene expression regulation comprising transcriptional regulation or epigenetic regulation.
[00075] In accordance with another aspect, the present disclosure provides an isolated guide RNA comprising a sequence capable of forming a duplex with a complementary strand of a target DNA
sequence adjacent to the PAM (proto-spacer-adjacent motif) NNNNRYAC (SEQ ID
NO: 1). The isolated guide RNA may be one that is not naturally occurring or is artificially engineered.
[00076] The individual elements are as described above.
[00077] In some embodiments of the present disclosure, the guide RNA may be single guide RNA in which the sequence capable of forming a duplex with a complementary strand of a target DNA

may range in length from 17 to 23 bp, from 18 to 23 bp, from 19 to 23 bp, particularly from 20 to 23 bp, and more particularly from 21 to 23 bp, without being limited thereto.
[00078] Further, the guide RNA, at least in some embodiments, may comprise one to three consecutive guanine (G) residues just upstream of the 5 'end of the complementary strand of the target DNA, but is not limited thereto. Additionally, the foregoing description of the additional nucleotides can also be applicable to this embodiment.
[00079] Also, provided in accordance with a another aspect of the present disclosure is a composition comprising a guide RNA comprising a sequence capable of forming a duplex with a complementary strand of a target DNA sequence adjacent to the PAM (proto-spacer-adjacent motif) sequence NNNNRYAC (SEQ ID NO: 1), or a DNA encoding the guide RNA.
[00080] Each of the components, in at least some embodiments, is as described above.
[00081] In some embodiments of the present disclosure, the composition may further comprise a Cas protein recognizing the sequence NNNNRYAC (SEQ ID NO: 1) or a nucleic acid encoding the Cas protein.
[00082] In addition, in certain embodiments, the composition may be used for genome editing.
[00083] Further, in some embodiments, the composition may comprise: (i) a guide RNA
comprising a sequence capable of forming a duplex with a complementary strand of a target DNA
sequence adjacent to the PAM (proto-spacer-adjacent motif) NNNNRYAC (SEQ ID
NO: 1), or a DNA
encoding the guide RNA; and (ii) an deactivated Cas protein (dCas) or a nucleic acid encoding the dCas.
[00084] In an embodiment, the deactivated Cas protein may further comprise a transcription effector domain.
[00085] In some embodiments of the present disclosure, the composition may be used to isolate a DNA of interest comprising a target DNA sequence. In this regard, the deactivated Cas protein may be labeled with a tag useful for separation and purification, but is not limited thereto. The tag may be as described above.

[00086] In some embodiments of the present disclosure, the composition may be used for Cas-mediated gene expression regulation, comprising transcriptional regulation or epigenetic regulation.
[00087] In some embodiments of the present disclosure, the target DNA may be present in isolated cells, for example, eukaryotic cells. Examples of the eukaryotic cells include yeasts, fungi, protozoa, cells from plants, higher plants, insects or amphibians, and mammalian cells such as CHO, HeLa, HEI(293, and COS-1 cells. Without limitation, cultured cells (in vitro), graft cells, primary cell culture (in vitro and ex vivo), in vivo cells, and mammalian cells including human cells are commonly used in the art.
[00088] In accordance with a still further aspect, the present disclosure provides a CRISPR-CAS system, comprising (i) a guide RNA comprising a sequence capable of forming a duplex with a target DNA sequence adjacent to the PAM (proto-spacer-adjacent motif) NNNNRYAC
(SEQ ID NO:
1), or a DNA encoding the guide RNA; and (ii) a Cas protein recognizing the PAM sequence NNNNRYAC (SEQ ID NO: 1) or a nucleic acid encoding the Cas protein.
[00089] The individual factors are as described above. These factors may be non-naturally occurring or engineered.
[00090] Still another aspect of the present disclosure pertains to a recombinant viral vector, comprising (i) an expression cassette for a guide RNA comprising a sequence capable of forming a duplex with a target DNA sequence adjacent to the PAM (proto-spacer-adjacent Motif) sequence of NNNNRYAC (SEQ ID NO: 1), and (ii) an expression cassette for a Cos protein recognizing the PAM
sequence of NNNNRYAC (SEQ ID NO: 1).
[00091] The individual factors are as described above. These factors may be non-naturally occurring or engineered.
[00092] The viral vector, at least in some embodiments, may be of AAV (Adeno-associated virus) origin.

[00093] Yet another aspect of the present disclosure pertains to an isolated guide RNA
comprising a sequence of 21-23 bp in length, capable of forming a duplex with a complementary strand of a target DNA sequence.
[00094] The guide RNA is as defined above. The guide RNA may be non-naturally occurring or engineered.
[00095] Yet still another aspect of the present disclosure pertains to a composition comprising the guide RNA or a DNA encoding the guide RNA.
[00096] The individual factors are as described above. These factors may be non-naturally occurring or engineered.
[00097] The composition, at least in some embodiments, may comprise a Cas protein that recognizes the PAM sequence NNNNRYAC (SEQ ID NO: 1), or a nucleic acid that encodes the Cas protein.
[00098] In addition, the composition, in some embodiments, may comprise a deactivated Cos recognizing the NNNNRYAC sequence (SEQ ID NO: 1), or a nucleic acid encoding the deactivated Cas protein.
[00099] The deactivated Cas protein, in some embodiments, may further comprise a transcription effector domain.
[000100]
According to an additional aspect, the present disclosure provides an isolated guide RNA, comprising a first region comprising a sequence capable of forming a duplex with a complementary strand of a target DNA sequence, and a second region comprising a stem-loop structure characterized by a stem 13-18 bp in length.
[000101]
The individual factors are as defined above. These factors may be non-naturally occurring or engineered.
[000102]
In certain embodiments, the stem may comprise the nucleotide sequence of SEQ ID NO: 2 (5'-GUUUUAGUCCCUUGUG-3') and a complementary sequence thereof [000103]
According to a further additional aspect, the present disclosure provides an isolated guide RNA, comprising a first region comprising a sequence capable of forming a duplex with a complementary strand of a target DNA sequence, and a second region comprising a stem-loop structure characterized by a loop 5-10 bp in length.
[000104] The individual factors are as defined above. These factors may be non-naturally occurring or engineered.
[000105]
In certain embodiments, the loop may comprise the nucleotide sequence of SEQ ID NO: 3 (5'-AUAUUCAA-3').
[000106]
According to yet an additional aspect, the present disclosure provides a composition comprising a guide RNA, along with a Cos protein or a nucleic acid encoding the Cas protein.
[000107]
The individual factors are as defined above. These factors may be non-naturally occurring or engineered.
[000108]
Yet still another aspect of the present disclosure provides a method for genome editing in a cell, comprising introducing into the cell an isolated guide RNA
or a DNA encoding the isolated guide RNA, together with a Cas protein or a nucleic acid encoding the Cas protein.
[000109]
The individual factors are as defined above. These factors may be non-naturally occurring or engineered.
[000110]
Yet a further aspect of the present disclosure provides a method for cleaving a target DNA in a cell, comprising introducing into the cell an isolated guide RNA or a DNA encoding the isolated guide RNA, along with a Cas protein or a nucleic acid encoding the Cas protein.
[000111]
The individual factors are as defined above. These factors may be non-naturally occurring or engineered.
[000112]
In certain embodiments, the guide RNA or the DNA encoding the guide RNA
may be introduced into a cell simultaneously or sequentially with the Cas protein or the nucleic acid encoding the Cas protein.

[000113]
A still further aspect of the present disclosure provides a method for preparing a target DNA-recognizing sequence of a guide RNA (i.e., a sequence in a guide RNA that is responsible for recognizing a target DNA), comprising: (i) identifying the presence of a PAM sequence NNNNRYAC (SEQ ID NO: 1) in a given sequence; and (ii) determining a sequence located just upstream of the PAM sequence NNNNRYAC (SEQ ID NO: 1) as being recognizable by a guide RNA, if the presence of the PAM sequence is identified in step (i).
[000114]
The individual factors are as defined above. These factors may be non-naturally occurring or engineered.
[000115]
In some embodiments of the disclosure, the sequence located upstream of the PAM sequence may range, without limitation, in length from 17 to 23 bp, from 18 to 23 bp, from 19 to 23 bp, more particularly from 20 to 23 bp, and even more particularly from 21 to 23 bp.
[000116]
Yet another aspect of the present disclosure provides a method for isolating a DNA of interest, comprising: (i) introducing into a cell a guide RNA or a DNA
encoding the guide RNA, along with a deactivated Cos protein or a nucleic acid encoding the deactivated Cas protein, thereby permitting the guide RNA and the deactivated Cas protein to form a complex together with the DNA of interest comprising a target DNA sequence; and (ii) separating the complex from a sample.
[000117]
The individual factors are as defined above. These factors may be non-naturally occurring or engineered.
[000118]
The deactivated Cas protein, at least in some embodiments, may recognize the PAM (protospacer-adjacent Motif) sequence NNNNRYAC (SEQ ID NO: 1).
[000119]
In certain embodiments, the method for isolating a DNA of interest may be performed by allowing a guide RNA (gRNA), binding specifically to the DNA of interest, and a deactivated Cas protein (dCas) to form a dCas-gRNA-DNA of interest complex with the DNA of interest; and separating the complex from a sample.
95 [000120] The DNA of interest, in some embodiments, may be identified using a well-known detection method, such as PCR amplification, etc.

[000121]
The isolation method, in some embodiments, may be adapted for cell-free DNA in vitro without forming crosslinks via covalent bonds between the DNA, the gRNA, and the dCas.
[000122]
In addition, the isolation method may further comprise isolating the DNA of interest from the complex in some embodiments.
[000123]
The deactivated Cas protein, in some embodiments, may be linked with an affinity tag for use in isolating the DNA of interest. The affinity tag may be selected from the group consisting of a His tag, a Flag tag, an S tag, a GST (Glutathione S-transferase) tag, an MBP (Maltose binding protein) tag, a CBP (chitin binding protein) tag, an Avi tag, a calmodulin tag, a polyglutamate tag, an E tag, an HA tag, a myc tag, an SBP tag, softag 1, softag 3, a strep tag, a TC tag, an Xpress tag, a BCCP (biotin carboxyl carrier protein) tag, and a GFP (green fluorescent protein) tag, but are not limited thereto.
[000124]
The deactivated Cas protein, in some embodiments, may be a Cos protein that lacks DNA cleavage activity.
[000125] Isolation of a DNA of interest, in some embodiments, may be achieved using an affinity column or magnetic beads capable of binding the tag used. For example, when a His tag is used to isolate the DNA of interest, a metal affinity column or magnetic beads capable of binding the His tag may be employed. The magnetic beads may comprise, but are not limited to, Ni-NTA magnetic beads.
[000126] In some embodiments, isolation of a DNA of interest from the complex may be conducted using RNase and protease.
[000127]
In some embodiments in the method for isolating a DNA of interest, a certain genotype DNA, or two or more different DNAs of interest can be isolated from an isolated sample containing a mixture of two or more different genotype DNAs. When the method involves isolating two or more different DNAs of interest, guide RNAs respectively specific for the two or more different DNAs of interest may be employed to isolate two or more DNAs of interest.

[000128]
In certain embodiments, the guide RNA may be single guide RNA (sgRNA), or dualRNA comprising crRNA and tracrRNA. The guide RNA may be an isolated RNA, or may be encoded in a plasmid.
[000129]
The isolation method, in certain embodiments, may be performed by binding a guide RNA (gRNA) specifically to 1) a DNA of interest and 2) a deactivated Cas protein (dCas) to form a dCas-gRNA-DNA complex with the DNA of interest; and separating the complex from the sample.
[000130]
Yet an additional aspect of the present disclosure provides a method for Cas-mediated gene expression regulation in a DNA of interest comprising a target DNA sequence, the method comprising introducing an isolated guide RNA, specifically recognizing the target DNA or a DNA encoding the guide RNA, along with a deactivated Cos protein fused to a transcription effector domain or a nucleic acid encoding the deactivated Cas protein, into a cell.
[000131]
The individual factors are as defined above. These factors may be non-naturally occurring or engineered.
EXAMPLES
[000132] The following examples are provided for the purpose of illustrating some aspects of the disclosure provided herewith and they should not be construed as limiting the scope of the present disclosure in any manner.
C. jejuni CRISPR/Cas9 System EXAMPLE I: Genome Editing using C. jejuni CRISPR/Cas9 [000133] The present inventors succeeded in isolating RGEN from C. jejuni. To identify the characteristics of the C. jejuni CRISPR/CAS9-derived RGEN with regard to genome editing, a C.
jejuni CAS9 gene optimized for human codons was synthesized (TABLE 1) and then inserted into a mammalian expression vector to construct a C. jejuni CAS9 expression cassette in which the HA-tagged, NLS-linked Cas gene was under the regulation of a CMV promoter (FIG.
1).

Amino Acid Sequence of C jejuni Cas9 Protein Amino acid sequence size SEQ ID NO
MARILAFDIGISSIGWAFSENDELKDCGVRIETKVENPKTGESLALPRRLA
RSARKRLARRKARENHLICHLIANEFICLNYEDYQSFDESLAKAYKGSLIS
PYELRFRALNELLSKQDFARVILITIAKRRGYDDIKNSDDKEKGAILKAIK.
QNEEKLANYQSVGEYLYKEYFQKFICENSKE ' SYERCIAQSF
LKDELKLIFICKQREFGESFSICKFEEEVLSVAFYICRALKDFSHLVGNCSFF
TDEKRAPKNSPLAFMFVALTRIINLLNNIKNTEGILYTKDDLNALLNEVL
KNGTETYKQTICKLEGLSDDYEFKGEKGTYFIEEKKYKEFIKALGEHNLS
QDDLNEIAKDITLIKDEIKEKKALAKYDLNQNQIDSLSICLEFICDHLNISEK
ALKLVTPLMLEGICKYDEACNELNEKVAINEDKICDFLPAFNETYYKDEV
TNPVVERAIKEYRKVLNALLKICYGKVITIGNIELAREVGKNHSQRAKIEK
EQNENYKAKKDAELECEKLGLKINSKNILKLRLFKEQKEFCAYSGEKIKI 1003a.a 22 SDLQDEKMLEIDHIYPYSRSEDDSYMNKVINFTKQNQEKLNQTPFEAFG
NDSAKWQICIEVLAKNITTKKQKRILDKNYKDICEQKNEKDRNENDTRYI
ARLVENYTKDYLDFLPLSDDENTKENDTQKGSKVHVEAKSGMLTSALR
HTWGFSAKDRNNHLHHAIDAVITAYANNSIVICAFSDEKKEQESNSAELY
AKKISELDYKNKRKFFEPFSGFRQKVLDKIDEIFVSKPERKKPSGALHEET
FRKEEEFYQSYGGICEGVLKALELGKIRKVNGKIVI(NGDMFRVDIFKHK
KTNKFYAVPIYTMDFALKVLPNKAVARSKKGEIKDWILMDENYEFCFSL
YKDSLILIQTKDMQEPEFVYYNAFTSSTVSLIVSKHDNKFETLSKNQIULF
KNANEKEVIAKSIGIQNLKVFEKYIVSALGEVTICAEFRQREDFICKSGPPK
KKRKVYPYDVPDYA-[000134] The native guide RNA of the C. jejuni CRISPR/CAS9 system consists of tracrRNA and target-specific crRNA. In view of the notion that the guide RNA
is used as the two RNA
molecules in themselves or as a single guide RNA (sgRNA) in which crRNA and tracrRNA are fused to each other, the present inventors designed and constructed an expression plasmid for C. jejuni sgRNA
(TABLE 2).

sgRNAs sgRNA sequence SEQ ID NO
NNNNNNNNNNNNNNNNNNNNGTTITAGTCCCTGAAAAG
C.jetimi_sgRNA GGACTAAAATAAAGAG 1 1 1 GCGGGACTCTGCGGGGTTACA 23 [000135] Then, potential target loci for human AAVS1 and mouse Rosa-26 were selected based on the PAM sequence (NNNACA) of the C. jejuni CRISPR/CAS9 system (TABLE 3).

sgRNAs Target Sequence SEQ ID NO
Human AAVS 1_C Jejuni ATATAAGGTGGTCCCAGCTCGGGGACA 24 Mouse Rosa26_C.Jejuni ATTCCCCTGCAGGACAACGCCCACACA 25 [000136]
To examine whether the C. jejuni RGEN can be used for the targeted disruption of endogenous genes in mammalian cells, genomic DNA, isolated from transfected cells using T7 endonuclease I (T7E1), a mismatch-sensitive endonuclease that specifically recognizes and cleaves heteroduplexes formed by the hybridization of wild-type and mutant DNA
sequences, was analyzed. The primer sequences used are as follows (TABLE 4).

Primer Sequence SEQ ID NO
Human AAVSI-F TGC I 1 CTCCTCTTGGGAAGT 26 Human AAVS1-R CCCCGTTCTCCTGTGGATTC 27 Mouse Rosa76-F ACG 1'1 I CCGACTTGAGTTGC 28 Mouse Rosa26-R CCCAGCTACAGCCTCGAT 11 29 [000137]
As a result, mutations (interchangeably substitution or variation) were detected only in the cells into which the CAS9 protein and the guide RNA were introduced together. The mutation frequency was found to be RNA-dose dependent, as measured based on relative DNA band intensities (FIG. 2A). In addition, DNA sequencing analysis of the PCR
amplicons corroborated the induction of RGEN-mediated mutations at the endogenous sites. Indels and microhomoloes, which are characteristic of error-prone nonhomologous end joining (NHEJ) repair, were observed at the target sites (FIG. 2B). The mutation frequency was 16.7 % as measured by direct sequencing (= 2 mutant clones / 12 clones).
[000138]
Likewise, when mouse Rosa26 C. jejuni RGEN was delivered into mouse NHI3T3 cells, mutations were effectively induced at the mouse Rosa26 site, as measured by a T7E1 assay (FIG. 3A). In addition, DNA sequencing analysis of the PCR amplicons revealed the induction of C. jejuni RGEN-mediated mutation at the endogenous gene sites (FIG. 3B). The mutation frequency was found to be 22.2 % as measured by direct sequencing (2 mutant clones /9 clones).
EXANIPLE 2: Structural Modification of sgRNA
[000139] With the anticipation that the C. jejuni crRNA : tracrRNA
complex would comprise a shorter loop structure than those from other bacterial species, a modified stem or loop structure was designed to structurally stabilize the C. jejuni RGEN sgRNA
constructed in Example 1 (TABLE 5).

sgRNAs sgRNA Sequecne SEQ ID NO
NNNNNNNNNNNNNNNNNNNNGTTTTAGTCCC

Cjejuni_sgRNA 23 ACTCTGCGGGGTTACAATCCCCTAAAACCGCTT

NNNNNNNNNNNNNNNNNNNNGTTTTAGTCCC
Cjejuni_sgRNA_stem TTGTGGAAATATAAGGGACTAAAATAAAGAG
modified Fl 1GCGGGACTCTGCGGGGTTACAATCCCCTAA

NNNNNNNNNNNNNNNNNNNNGTTTFAGTCCC
C.jejuni_sgRNAJoop TATATTCAAAGGGACTAAAATAAAGAG1'11GC

modified GGGACTCTGCGGGGITACAATCCCCTAAAACC

[000140] In TABLE 5, norm stem parts are shown in bold and underlined.
10 [000141] When the modified sgRNA was introduced to target the target site of the human AAVS1 C. jejuni RGEN into which mutations were successfully induced through the normal sgRNA structure, similar mutation frequencies were observed (FIG. 4). In this regard, the primer sequences used are as shown in TABLE 4.
EXAMPLE 3: Optimization of Length of sgRNA Spacer 15 [000142] The spacer sequence of C. jejuni crRNA, recognizing a target sequence, was reported to be 20 bp in length in the literature. To determine which spacer length is optimal, a genome editing test was performed for 4 target sites of Cj Cas9 on human AAVS1 loci, as shown in TABLE 6, using spacers with various lengths, and sgRNA mutant structures with additional nucleotides at 5' terminus (FIGS. 5A to 5C). For the method used in this experiment, reference was made to Genome Res. 2014 Jan; 24(1):132-41.

Target Site sgRNA Sequence (20bp-SPACERnnnnACA) SEQ ID
NO
Human AAVS1-CJ1 ATATAAGGTGGTCCCAGCTCggggACA 32 Human AAVS1-NRGI GTAGAGGCGGCCACGACCTGgtgaACA 33 Human AAVS1-NRG3 TCACAAAGGGAG 1 1 1 1 CCACacggACA 34 Human AAVSI-NRG5 TAGGCAGATTCCTTATCTGGtgacACA 35 [000143] Three days after an sgRNA expression vector was delivered into 293-cells, genomic DNA was isolated and analyzed for mutation efficiency by deep sequencing. The results are depicted in FIG. 5C. As can be seen, high efficiency was detected when the spacers ranged in length from 21 to 23 bp. In addition, even when 2-3 additional G residues were added to the 5' end of sgRNA
of a 20 bp-long spacer, an improvement in genome editing was observed.

NGS- NGS-Sequences Sequences Target sgRNA
primer-F* primer-R**
GTGACTGGAGT

TCAGACGTGTG
ACGACGCTCTTCCGA

TGTCATGGCATC
AAGGATGG TTCCAGGG
(SEQ ID NO: 36) (SEQ ID NO: 39) GTGACTGGAGT

TCAGACGTGTG
ACGACGCTCTTCCGA
Human CTC1 1 CCGATCT
AS-AV-F2 TCTGCTCTGGGCGGA AS-AV-R2 NRG I ,NRG3 AAVS I TCCGTGCGTCAG
GGAATATG

(SEQ ID NO: 37) (SEQ ID NO: 40) GTGACTGGAGT

TCAGACGTGTG
ACGACGCTCTTCCGA
CTCTTCCGATCT

CCGGTTAATGTG
TCCATCGT
GCTCTGGT
(SEQ ID NO: 38) (SEQ ID NO: 41) [000144] Here, F* indicates a forward primer and R** indicates a reverse primer.

EXAMPLE 4: Cjejuni Cas9 PAM Sequence Analysis [000145]
In the present disclosure, the PAM sequence of C. jejuni Cas9 was inferred to comprise "NNNNACA", based on data in the existing literature, and experiments were conducted. Of 34 C. jejuni CRISPR/Cas9 systems constructed for five genome sites, only three exhibited activity.
Particularly, additional analysis of the sequences covering the sites in the three active systems showed that the nucleotide "C" was identified immediately after the PAM sequence ACA) in all three sites (TABLE 8).

Activity sgRNA Sequence SEQ ID NO
(T7E1 assay) Human hAAVS1-CJ1 0 GACAC

AAVS1 hAAVS1-CJ2 X
CAG

hAAVS1-CJ3 X
CAG

AA

AT

CAT

CAT

AT

ACAT

ACAG

CAA
Mouse AA

ROSA26-CJ2* 0 ACAC

CAA
Rosa26 CAA

AA

CAG

Activity sgRNA Sequence SEQ ID NO
(T7E1 assay) AGCCTTATCAAAAGGTA n I I AGAA 59 CAC

CAG

CAA

CAT

CAG

CAT

CAC

CAG

GACAC

CAG

mP 1 EN-CJ1 X
AC

mPTEN-CJ2 X
CAA

mPTEN-CJ3 X
CAA

PTEN mPTEN-CJ4 X
CAA

mPTEN-CJ5 X
CAC

mPTEN-CJ6 X
CAT
Al I 1 AACTGCAGAGGTATGTATAAA 75 mP I EN-CJ7 X
CAT
[000146]
Based on this result, the PAM sequence was inferred to contain "NNNNACAC". While the nucleotide at each site of "ACAC" were substituted by A/T/G/C, the activity of C. jejuni Cas9 was analyzed to identify the PAM sequence of C.
jejuni RGEN. For this, a surrogate reporter assay was utilized. As a result, C. jejuni was identified to comprise the PAM
sequence of "NNNNRYAC (SEQ ID NO: 1)" (FIG. 6, wherein R is a purine residue (A or G) and Y is a pyrimidine residue (C/T)). This experiment was carried out using the surrogate reporter assay described in Nat Methods. 2011 Oct 9;8(11):941-3.

EXAMPLE 5: Assay of Specificity and PAM Sequence of C jejuni CRISPR/Cas9 [000147] The cleavage sites of C. jejuni CR1SPR/CAS9 in the AAVS1-CJ1 loci were analyzed at the genomic level using Digenome-seq, a CRISPR/Cas9 off-target assay developed and submitted for patent protection by the present inventors. The experiment was carried out using a method described in Nat Methods. 2015 Mar; 12(3):237-43.
[000148] Through Digenome-Seq, 41 loci at which AAVS1-CJ1 CRISPR/Cas9 seemed to be cleaved were determined (Genomic locations in TABLE 9). Consensus sequences were obtained from alignments of cleavage site sequences of the 41 loci, and PAM consistent with that identified in Example 4 was verified.
[000149] Further, to examine whether an off-target mutation is actually introduced into the potential off-targets acquired by Digenome-Seq, genomic DNA from 293-cells to which AAVS1-CJ1 CRISPR engineered nuclease was delivered was subjected to deep sequencing for 40 potential off-target sites. As shown in TABLE 9, no significant mutations were observed.

hide! Frequency Genomic Location Mock C.Jejuni CRISPR
On-target chr19 55627221 0.02 5.123 CJ AAVS1_1 chrl 24521012 0.019 0.034 CJ_AAVS1 2 chrl 29848565 0.157 0.136 CJ_AAVS1_3 chrl 30381084 0.041 0.035 CJ_AAVS1_4 chrl 37283269 0.016 0.016 CJ_AAVS1_5 chr2 55333369 0.079 0.091 CJ_AAVS1_6 chr4 153532801 0.003 0.003 CJ_AAVS1_7 chr4 153926891 0 0 CJ AAVS1_8 chr4 183304101 0.033 0.046 CJ_AAVS1_9 chr6 51746466 0.41 0.43 CJ_AAVS1_10 chr7 11346020 0.02 0.038 CJ_AAVS1_11 chr7 128481430 0.024 0.036 CJ_AAVS1_12 chr7 142878579 0.024 0.028 CJ_AAVS 1_13 chr8 25979587 0.138 0.155 CJ_AAVS1_14 chr8 80240626 0.043 0.049 CJ AAVS1_15 chr8 141347249 0.028 0.024 hide! Frequency Genomic Location Mock C.Jejuni CRISPR
CJ_AAVS 1_16 chr8 141688584 0.088 0.092 CLAAVS1_17 chr8 143120119 0.016 0.013 CJ_AAVS1_18 chr9 83960768 0.032 0.037 CLAAVS1_19 chr9 102650644 0.029 0.034 CJ_AAVS1 20 chr9 129141695 0.014 0.009 CLAAVS1_21 chr10 103862556 0.053 0.073 CLAAVS1_22 chr12 9085293 0.21 0.277 CJ_AAVS1_23 chr14 70581187 0.013 0.025 CJ AAVS1_24 chr14 95327446 0.046 0.041 CLAAVS1_25 chr14 102331176 0.015 0.028 CLAAVS 1_26 chr14 104753692 0.035 0.041 CLAAVS1_27 chr15 67686972 0.061 0.096 CLAAVS1_28 chr16 85565862 0.028 0.028 CJ_AAVS1_29 chr17 17270109 0.003 0 CLAAVS1_30 chr17 79782954 0.03 0.043 CJ_AAVS1_31 chrl 8 42305670 0.035 0.043 CLAAVS1_32 chr19 12826405 0.024 0.039 CLAAVS1_33 chr19 32268337 0.043 0.042 CLAAVS1_35 chr20 40758976 0 0 CLAAVS1_36 chr21 41295936 0.011 0.007 CJ_AAVS1_37 chr22 20990738 0.004 0.004 CLAAVS1_38 chr22 46402289 0.006 0.011 CLAAVS1_39 chr22 46426607 0.003 0 CLAAVS1_40 chrX 27472673 0.279 0.318 [000150] Further, consensus sequences were obtained from the entire alignment of the sequences of 41 loci that showed cleavages in vitro. Consistent with previous results, PAM was actually observed as NNNNRYAC (SEQ ID NO: 1).
EXAMPLE 6: Degeneracy at First Two Nucleotides of PAM
[000151] The PAM sequence of C. jejuni was found to be NNNNRYAC" as well as "NNNNACAC" in Example 5, showing degeneracy at the first two positions. In order to corroborate the degeneracy, sgRNAs were constructed respectively for the 7 PAM target sequences of C. jejuni of human AAVS1 loci, which carried G or T residues at the first two positions (TABLE 10), and analyzed for mutation efficiency in HEI(293 cells.

SEQ ID NO
sgRNA Direction PAM Target Sequence hAAVS1-RYN1 gCCACGACCTGGTGAACACCTAGGACGCAC 76 hAAVS I -RYN2 gGCCTTATCTCACAGGTAAAACTGACGCAC
hAAVS1-RYN3 cTC11 hAAVS1-RYN4 NNNNRYAC
aGCTGCAGCACCAGGATCAGTGAAACGCAC
hAAVS1-RYN5 cTGTGGGGTGGAGGGGACAGATAAAAGTAC
hAAVS1-RYN6 gCCGGTTAATGTGGCTCTGGITCTGGGTAC 81 hAAVS1-RYN7 gCCATGACAGGGGGCTGGAAGAGCTAGCAC 82 [000152]
Of the seven constructed sgRNAs, six were found to induce mutations, demonstrating degeneracy at the first two positions of the PAM sequences (FIG.
8). Accordingly, this degeneracy increases the frequency of the PAM sequences, allowing improved accuracy of the genome 5 editing of C. jejuni.
EXAMPLE 7: Genome Editing through C. jejuni CRISPR/CAS9 Delivery Using AAV
[000153]
Representative among promising fields in which genome editing finds application are genome editing technologies for gene and cell therapy. The practical application of genome editing to therapy needs a clinically applicable vector for effectively delivering an engineered nuclease and a donor DNA to target cells in vitro or in vivo. The two most widely used engineered nuclease platforms, TALENs and RGEN, are limited to application to established gene therapy vectors due to their large sizes. In contrast, the C. jejuni RGEN of the present disclosure consists of the smallest CAS9 protein and sgRNA among the RGENs developed so far. Thanks to its small size, the C. jejuni RGEN can allow large-sized gene therapy vectors to be used in genome manipulation. For example, (adeno-associated virus), serving as one of the most important vectors for gene therapy, imposes strict limitations on the size of the DNA to be carried thereby, and thus is difficult to apply to the RGEN
derived from S. pyogenes, S. thennophilus, or N. meningitidis, or to the currently used engineered nuclease platform TALEN. In contrast, the C jejuni RGEN can be applied to an AAV vector.
[000154]
In the present disclosure, examination was made of the operation of the C.

jejuni Cas9 through practical AAV delivery. To this end, an AAV vector carrying both a C. jejuni Cas9 expression cassette and an sgRNA expression cassette was constructed (FIG. 9) and used to produce AAV. Alter infection with the AAV, mouse C2C12 cells were quantitatively analyzed for mutations (FIG. 10). As can be seen, mutations were induced in target sites in an AAV
dose- and time-dependent manner. Particularly, 4 weeks after infection at high MOI (100), mutations were induced at an efficiency of 90 % or higher in the target sites.
[000155]
Consequently, the C. jejuni RGEN was proven to effectively perform genome editing in cultured cells. In addition, the PAM sequence of the C. jejuni CRISPR/Cas9 system was actually determined, as the sequence proposed in previous studies was found not to be perfect. Further, the C. jejuni RGEN can be loaded into a single virus thanks to the small sizes of its elements, and thus can be used for effective genome editing.
Enrichment of target DNA using dCAS9:2RNA complex [000156]
Moreover, a target DNA was isolated and enriched using the RGEN
(dCas9:gRNA complex) composed of a Streptococcus pyogenes-derived, deactivated Cas9 protein and a guide RNA.
[000157] In this regard, the dCas9 protein was tagged with six consecutive His residues, so that it could be purified using Ni-NTA magnetic beads for selectively binding to the His tag. In addition, the dCas protein-sgRNA complex can be used for the selective purification of a target DNA
because the complex can bind specifically to a certain DNA sequence, but lacks nuclease activity.
[000158]
The RGEN (dCas9: gRNA complex) composed of a guide RNA and a deactivated Cas nuclease was tested for ability to isolate a target DNA. For this, first, the plasmid pUC19 was digested with restriction enzymes (SpeI, XmaI, XhoI) to yield plasmid DNA fragments 4134 bp, 2570 bp, and 1263 bp in length, respectively.
[000159]
For each of the plasmid DNA fragments digested with the restriction enzymes, two different sgRNAs were synthesized (4134bp sg#1, 4134bp_sg#2, 2570bp_sg#1, 2570bp_sg#2, 1263bp sg#1, and 1263bp sg#2). A purification procedure was carried out using the sgRNAs corresponding to target DNAs, singularly or in combination (4134bp sg#1+2, 2570bp sg#1+2, and 1263bp_sg#1+2). The nucleotide sequences of the sgRNAs are listed in TABLE 11 below.

sgRNA Target sequence PAM Sequecne GAGAACCAGACCACCCAGAA
4134bp_sg#1 GGG
(SEQ ID NO: 83) GGCAGCCCCGCCATCAAGAA
4134bp_sg#2 GGG
(SEQ ID NO: 84) 2570bp_sg#1 TGG
(SEQ ID NO: 85) 2570bp_sg#2 GGG
(SEQ ID NO: 86) GCCTCCAAAAAAGAAGAGAA
1270bp_sg#1 AGG
(SEQ ID NO: 87) TGACATCAATTATTATACAT
1270bp_sg#2 CGG
(SEQ ID NO: 88) * nucleotide sequences of the sgRNAs are identical to those of the target DNA, except for U in place of T.
[000160]
A total of 200 [A of a mixture solution containing DNA : dCas9 protein :
sgRNA at a molar ratio of 1 : 20 : 100 was incubated at 37 C for 1.5 hrs.
Then, the solution was mixed with 50 pl of Ni-NTA magnetic beads binding specifically to His-tag, and washed twice with 200 pl of a wash buffer, followed by purifying a dCas9-sgRNA-target DNA complex with 200 ;A of an eluting buffer (Bioneer, K-7200).
[000161]
Thereafter, the eluate was incubated at 37 C for 2 hrs with 0.2 mg/m1RNase A
(Amresco, E866) and then at 55 C for 45 min with 0.2 mg/ml Proteinase K to remove both the sgRNA
and the dCas9 protein. The target DNA alone was precipitated in ethanol.
[000162]
As a result, using the sgRNAs, whether singularly or in combinations of two thereof, for individual target DNAs, desired target DNAs could be isolated from the three DNA
fragments digested by size. In addition, when multiple target DNAs were purified with combinations of sgRNA, such as a total of 4 different sgRNAs for two different target DNAs (2 sgRNAs for each target DNA), the target DNAs were associated with corresponding sgRNAs and thus purified. The results indicate that each target DNA could be isolated at a purity of 95 % or higher.

[000163]
Also, the purification technique is true of the Cos protein recognizing the PAM
(proto-spacer-adjacent motif) sequence NNNNRYAC (SEQ ID NO: 1) of the present disclosure.
[000164]
Based on the above description, it should be understood by those skilled in the art that various alternatives to the embodiments of the invention described herein may be employed in practicing the invention without departing from the technical idea or essential features of the invention as defined in the following claims. In this regard, the above-described examples are for illustrative purposes only, and the invention is not intended to be limited by these examples. The scope of the present invention should be understood to comprise all of the modifications or modified forms derived from the meaning and scope of the following claims or equivalent concepts.

Claims

WHAT IS CLAIMED IS:
1. A method of altering a genome via targeting a DNA sequence comprising a protospacer adjacent motif (PAM) sequence of NNNNRYAC (SEQ ID NO: 1), the method comprising:
introducing a Cas protein that recognizes the PAM sequence of SEQ ID NO: 1, or a nucleic acid encoding the Cas protein into a cell comprising the genome, thereby altering the genome.
2. The method of claim 1, wherein the Cas protein originates from a microorganism belonging to Campylobacter.
3. The method of claim 2, wherein the microorganism is Campylobacter jejuni.
4. The method of claim 1, wherein the Cas protein is a Cas9 protein.
5. The method of claim 1, further comprising introducing a guide RNA
comprising a sequence capable of forming a duplex with a complementary strand of a target DNA sequence, simultaneously or sequentially with the Cas protein that recognizes the PAM
sequence of SEQ ID NO:
1.
6. The method of claim 5, wherein the guide RNA is a dual RNA comprising CRISPR
RNA (crRNA) and trans-activating crRNA (tracrRNA).
7. The method of claim 6, wherein the guide RNA is a single guide RNA
(sgRNA).
8. The method of claim 7, wherein the sgRNA comprises a first region containing a sequence capable of forming a duplex with a complementary strand of the target DNA sequence, and a second region containing a sequence that interacts with the Cas protein.
9. The method of claim 7, wherein the sgRNA comprises a portion of a crRNA
which contains a sequence capable of forming a duplex with a complementary strand of the target DNA
sequence, and a portion of a tracrRNA which containins a sequence interacting with the Cas protein.

10. The method of claim 1, wherein the Cas protein has a nuclease or a nickase activity.
11. The method of claim 10, wherein the Cas protein having the nickase activity has a catalytic aspartic acid (D) at position 8 and histidine (H) at position 559 substituted with another amino acid.
12. The method of claim 1, wherein the Cas protein is in a deactivated form.
13. The method of claim 11, wherein the substituted amino acid is alanine.
14. The method of claim 1, wherein the Cas protein binds to the target DNA
sequence comprising the PAM sequence of SEQ ID NO: 1, without cleaving the target DNA.
15. An isolated guide RNA, comprising a sequence capable of forming a duplex with a complementary strand of a target DNA sequence adjacent to a proto-spacer-adjacent motif (PAM) sequence of NNNNRYAC (SEQ ID NO: 1).
16. The isolated guide RNA of claim 15, wherein the isolated guide RNA is a single-stranded guide RNA.
17. The isolated guide RNA of claim 15, wherein the length of the sequence capable of forming a duplex with a complementary strand of a target DNA sequence is 17 to 23bp.
18. The isolated guide RNA of claim 15, wherein the guide RNA further comprises one to three additional nucleotides prior to a 5' end of the sequence capable of forming a duplex with a complementary strand of the target DNA.
19. The isolated guide RNA of claim 18, wherein the additional nucleotides comprise guanine (G).
20. A composition comprising:
the isolated guide RNA of claim 15 or a DNA encoding the isolated guide RNA of claim 15, and a Cas protein that recognizes the sequence of NNNNRYAC (SEQ ID NO: 1) or a nucleic acid encoding the Cas protein.
21. The composition of claim 20, wherein the Cas protein is a deactivated Cas protein (dCas) or a nucleic acid that encodes the dCas.
22. The composition of claim 20, wherein the isolated guide RNA is a dual RNA
comprising a crRNA (CRISPR RNA) and a tracrRNA (trans-activating crRNA).
23. The composition of claim 20, wherein the isolated guide RNA is a single-stranded guide RNA (sgRNA).
24. The composition of claim 23, wherein the sgRNA comprises a first region containing a sequence capable of forming a duplex with a complementary strand of the target DNA sequence, and a second region containing a sequence interacting with the Cas protein.
25. The composition of claim 23, wherein the sgRNA comprises a portion of a crRNA
containing a sequence capable of forming a duplex with a complementary strand of the target DNA
sequence, and a portion of a tracrRNA containing a sequence that interacts with the Cas protein.
26. The composition of claim 24, wherein the sequence capable of forming a duplex with a complementary strand of the target DNA sequence has a length of 17 to 23bp.
27. The composition of claim 20, wherein the isolated guide RNA further comprises one to three additional nucleotides prior to a 5' end of the sequence capable of forming a duplex with a complementary strand of the target DNA sequence.
28. The composition of claim 27, wherein the additional nucleotides comprise guanine (G).
29. The composition of claim 20, wherein the Cas protein originates from a microorganism belonging to Campylobacter.
30. The composition of claim 20, wherein the Cas protein is Cas 9.

31. A recombinant viral vector comprising:
(i) an expression cassette for a guide RNA comprising a sequence capable of forming a duplex with a target DNA sequence adjacent to a PAM (proto-spacer-adjacent Motif) sequence of NNNNRYAC (SEQ ID NO: 1), and (ii) an expression cassette for a Cas protein recognizing the sequence of NNNNRYAC (SEQ
ID NO: 1).
32. The recombinant viral vector of claim 31, wherein the viral vector is an Adeno-associated virus (AAV).
33. An isolated guide RNA comprising:
a first region comprising a sequence capable of forming a duplex with a complementary strand of a target DNA sequence, and a second region comprising a stem-loop structure, which comprises a stem of 13-18 bp in length.
34. The isolated guide RNA of claim 33, wherein the stem comprises the sequence of SEQ
ID NO: 2 (5'-GUUUUAGUCCCUUGUG-3') and a complementary sequence thereof.
35. An isolated guide RNA comprising:
a first region comprising a sequence capable of forming a duplex with a complementary strand of a target DNA sequence, and a second region comprising a stem-loop structure, which comprises a loop 5-10 bp in length.
36. The isolated guide RNA of claim 35, wherein the loop comprises the nucleotide sequence of SEQ ID NO: 3 (5'-AUAUUCAA-3').
37. A composition comprising the guide RNA of claim 33 and a Cas protein or a nucleic acid encoding the Cas protein.
38. A composition comprising the guide RNA of claim 35 and a Cas protein or a nucleic acid encoding the Cas protein.

39. A method of genome editing in a cell comprising:
introducing, into the cell, the isolated guide RNA of any one of claims 15, 33, and 35 or a DNA encoding the guide RNA of any one of claims 15, 33, and 35, and a Cas protein or a nucleic acid encoding the Cas protein.
40. A method of cleaving a target DNA in a cell comprising:
introducing, into the cell, the isolated guide RNA of any one of claims 15, 33, and 35 or a DNA encoding the guide RNA of any one of claims 15, 33, and 35, and a Cas protein or a nucleic acid encoding the Cas protein.
41. A method of preparing a target DNA-recognizing sequence of a guide RNA, comprising:
(i) identifying the presence of a PAM sequence of NNNNRYAC (SEQ ID NO: 1) in a given DNA sequence; (ii) determining if a sequence located upstream of the PAM
sequence is recognizable by a guide RNA, and (iii) producing a target DNA recognizing sequence of a guide RNA corresponding to the sequence located upstream of the PAM sequence.
42. The method of claim 41, wherein the sequence located upstream of the PAM sequence is 17 to 23bp in length.
43. A method for isolating a DNA of interest, comprising (i) introducing (a) the isolated guide RNA of any one of claims 15, 33, and 35 or a DNA encoding the isolated guide RNA of any one of claims 15, 33, and 35, and (b) a deactivated Cas protein (dCas) or a nucleic acid encoding the dCas into a cell, wherein the guide RNA and the dCas form a complex together with the DNA of interest and wherein the DNA of interest comprises a target DNA sequence, and (ii) separating the complex, thereby isolating the DNA of interest.
44. The method of claim 43, wherein the dCas recognizes a PAM sequence of NNNNRYAC (SEQ ID MO: 1).
45. A method of Cas-mediated gene expression regulation on a target DNA
sequence, comprising:

introducing (i) the isolated guide RNA of any one of claims 15, 33, and 35 or a DNA
encoding the isolated guide RNA of any one of claims 15, 33, and 35, wherein the isolated guide RNA recognizes the target DNA sequence, and (ii) a deactivated Cas protein (dCas) fused to a transcription effector domain or a nucleic acid encoding the dCas fused to a transcription domain.
46. The isolated guide RNA of any one of claims 15, 33, and 35, wherein the target DNA
sequence is derived from a genome of a eukaryotic cell.
47. The method of claim 1, wherein the genome is a eukaryotic genome.
50. The method of any one of claims 39, 40, and 43, wherein the cell is a eukaryotic cell.
51. The method of claim 45, wherein the target DNA sequence is derived from a genome of a eukaryotic cell.