CA2905181A1 - Pyrrolobenzodiazepines and conjugates thereof for providing targeted therapy - Google Patents
Pyrrolobenzodiazepines and conjugates thereof for providing targeted therapy Download PDFInfo
- Publication number
- CA2905181A1 CA2905181A1 CA2905181A CA2905181A CA2905181A1 CA 2905181 A1 CA2905181 A1 CA 2905181A1 CA 2905181 A CA2905181 A CA 2905181A CA 2905181 A CA2905181 A CA 2905181A CA 2905181 A1 CA2905181 A1 CA 2905181A1
- Authority
- CA
- Canada
- Prior art keywords
- group
- conjugate according
- antibody
- genbank
- conjugate
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- YUOCYTRGANSSRY-UHFFFAOYSA-N pyrrolo[2,3-i][1,2]benzodiazepine Chemical class C1=CN=NC2=C3C=CN=C3C=CC2=C1 YUOCYTRGANSSRY-UHFFFAOYSA-N 0.000 title abstract description 10
- 238000002626 targeted therapy Methods 0.000 title description 2
- 150000001875 compounds Chemical class 0.000 claims abstract description 148
- -1 PBD compound Chemical class 0.000 claims abstract description 124
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 70
- 239000011230 binding agent Substances 0.000 claims abstract description 63
- 201000011510 cancer Diseases 0.000 claims abstract description 46
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims abstract description 26
- 201000010099 disease Diseases 0.000 claims abstract description 20
- 230000002062 proliferating effect Effects 0.000 claims abstract description 16
- 238000003786 synthesis reaction Methods 0.000 claims abstract description 12
- 230000015572 biosynthetic process Effects 0.000 claims abstract description 10
- 210000004027 cell Anatomy 0.000 claims description 102
- 239000000562 conjugate Substances 0.000 claims description 99
- 125000003118 aryl group Chemical group 0.000 claims description 86
- 238000000034 method Methods 0.000 claims description 73
- 239000003814 drug Substances 0.000 claims description 62
- 229940049595 antibody-drug conjugate Drugs 0.000 claims description 58
- 239000000203 mixture Substances 0.000 claims description 58
- 239000000611 antibody drug conjugate Substances 0.000 claims description 56
- 125000001424 substituent group Chemical group 0.000 claims description 55
- 229940079593 drug Drugs 0.000 claims description 53
- 125000000623 heterocyclic group Chemical group 0.000 claims description 52
- 125000000217 alkyl group Chemical group 0.000 claims description 51
- 125000005647 linker group Chemical group 0.000 claims description 47
- 239000000427 antigen Substances 0.000 claims description 45
- 125000000956 methoxy group Chemical group [H]C([H])([H])O* 0.000 claims description 45
- 108091007433 antigens Proteins 0.000 claims description 44
- 102000036639 antigens Human genes 0.000 claims description 44
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 claims description 43
- 125000002947 alkylene group Chemical group 0.000 claims description 41
- 238000011282 treatment Methods 0.000 claims description 34
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 claims description 32
- 125000001997 phenyl group Chemical group [H]C1=C([H])C([H])=C(*)C([H])=C1[H] 0.000 claims description 28
- 125000005843 halogen group Chemical group 0.000 claims description 26
- UHOVQNZJYSORNB-UHFFFAOYSA-N Benzene Chemical compound C1=CC=CC=C1 UHOVQNZJYSORNB-UHFFFAOYSA-N 0.000 claims description 24
- 102100021435 Macrophage-stimulating protein receptor Human genes 0.000 claims description 22
- 102100034256 Mucin-1 Human genes 0.000 claims description 21
- 125000001495 ethyl group Chemical group [H]C([H])([H])C([H])([H])* 0.000 claims description 20
- 125000005842 heteroatom Chemical group 0.000 claims description 20
- 229910052757 nitrogen Inorganic materials 0.000 claims description 20
- 101001106413 Homo sapiens Macrophage-stimulating protein receptor Proteins 0.000 claims description 19
- 125000000539 amino acid group Chemical group 0.000 claims description 19
- 125000004432 carbon atom Chemical group C* 0.000 claims description 18
- 150000003839 salts Chemical class 0.000 claims description 18
- 102100034459 Hepatitis A virus cellular receptor 1 Human genes 0.000 claims description 17
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 claims description 17
- JUJWROOIHBZHMG-UHFFFAOYSA-N Pyridine Chemical compound C1=CC=NC=C1 JUJWROOIHBZHMG-UHFFFAOYSA-N 0.000 claims description 17
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 claims description 16
- 102100021969 Nucleotide pyrophosphatase Human genes 0.000 claims description 16
- 229910052739 hydrogen Inorganic materials 0.000 claims description 16
- 238000011068 loading method Methods 0.000 claims description 16
- 239000012634 fragment Substances 0.000 claims description 15
- 102100038080 B-cell receptor CD22 Human genes 0.000 claims description 14
- 102100029198 SLAM family member 7 Human genes 0.000 claims description 14
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 claims description 14
- 239000008194 pharmaceutical composition Substances 0.000 claims description 14
- 102100040842 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 Human genes 0.000 claims description 13
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 claims description 13
- 102100026878 Interleukin-2 receptor subunit alpha Human genes 0.000 claims description 13
- 108010008125 Tenascin Proteins 0.000 claims description 13
- 239000002253 acid Substances 0.000 claims description 13
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 claims description 12
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 claims description 12
- 102100022337 Integrin alpha-V Human genes 0.000 claims description 12
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 claims description 12
- 102100035721 Syndecan-1 Human genes 0.000 claims description 12
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 claims description 12
- 125000003342 alkenyl group Chemical group 0.000 claims description 12
- 239000012453 solvate Substances 0.000 claims description 12
- 102100024217 CAMPATH-1 antigen Human genes 0.000 claims description 11
- 102100022662 Guanylyl cyclase C Human genes 0.000 claims description 11
- 102100030595 HLA class II histocompatibility antigen gamma chain Human genes 0.000 claims description 11
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 claims description 11
- 102100023935 Transmembrane glycoprotein NMB Human genes 0.000 claims description 11
- 102100023144 Zinc transporter ZIP6 Human genes 0.000 claims description 11
- 125000001559 cyclopropyl group Chemical group [H]C1([H])C([H])([H])C1([H])* 0.000 claims description 11
- 229940127089 cytotoxic agent Drugs 0.000 claims description 11
- 150000002148 esters Chemical class 0.000 claims description 11
- 125000000449 nitro group Chemical group [O-][N+](*)=O 0.000 claims description 11
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 11
- 125000004178 (C1-C4) alkyl group Chemical group 0.000 claims description 10
- 102100040006 Annexin A1 Human genes 0.000 claims description 10
- 108090000663 Annexin A1 Proteins 0.000 claims description 10
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 claims description 10
- 102100025221 CD70 antigen Human genes 0.000 claims description 10
- 102100030074 Dickkopf-related protein 1 Human genes 0.000 claims description 10
- 102100037241 Endoglin Human genes 0.000 claims description 10
- 108010007712 Hepatitis A Virus Cellular Receptor 1 Proteins 0.000 claims description 10
- 101001082627 Homo sapiens HLA class II histocompatibility antigen gamma chain Proteins 0.000 claims description 10
- 101001046677 Homo sapiens Integrin alpha-V Proteins 0.000 claims description 10
- 102100039813 Inactive tyrosine-protein kinase 7 Human genes 0.000 claims description 10
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 claims description 10
- 102100037236 Tyrosine-protein kinase receptor UFO Human genes 0.000 claims description 10
- 239000002246 antineoplastic agent Substances 0.000 claims description 10
- 238000002560 therapeutic procedure Methods 0.000 claims description 10
- 102100021451 Endoplasmic reticulum chaperone BiP Human genes 0.000 claims description 9
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 claims description 9
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 claims description 9
- 101000904724 Homo sapiens Transmembrane glycoprotein NMB Proteins 0.000 claims description 9
- 108010021625 Immunoglobulin Fragments Proteins 0.000 claims description 9
- 102000008394 Immunoglobulin Fragments Human genes 0.000 claims description 9
- 102100026711 Metalloreductase STEAP2 Human genes 0.000 claims description 9
- 102100038126 Tenascin Human genes 0.000 claims description 9
- 102100033726 Tumor necrosis factor receptor superfamily member 17 Human genes 0.000 claims description 9
- 102100023543 Vascular cell adhesion protein 1 Human genes 0.000 claims description 9
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 9
- 125000006592 (C2-C3) alkenyl group Chemical group 0.000 claims description 8
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 claims description 8
- 102100032556 C-type lectin domain family 14 member A Human genes 0.000 claims description 8
- 108700041152 Endoplasmic Reticulum Chaperone BiP Proteins 0.000 claims description 8
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 claims description 8
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 claims description 8
- 101001055144 Homo sapiens Interleukin-2 receptor subunit alpha Proteins 0.000 claims description 8
- 101000628535 Homo sapiens Metalloreductase STEAP2 Proteins 0.000 claims description 8
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 claims description 8
- 101000874179 Homo sapiens Syndecan-1 Proteins 0.000 claims description 8
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 claims description 8
- 102000007000 Tenascin Human genes 0.000 claims description 8
- 150000001768 cations Chemical class 0.000 claims description 8
- UMJSCPRVCHMLSP-UHFFFAOYSA-N pyridine Natural products COC1=CC=CN=C1 UMJSCPRVCHMLSP-UHFFFAOYSA-N 0.000 claims description 8
- 108010065524 CD52 Antigen Proteins 0.000 claims description 7
- 101000942280 Homo sapiens C-type lectin domain family 14 member A Proteins 0.000 claims description 7
- 101000897042 Homo sapiens Nucleotide pyrophosphatase Proteins 0.000 claims description 7
- 101000610548 Homo sapiens Proline-rich protein 4 Proteins 0.000 claims description 7
- 101000955999 Homo sapiens V-set domain-containing T-cell activation inhibitor 1 Proteins 0.000 claims description 7
- 108010079206 V-Set Domain-Containing T-Cell Activation Inhibitor 1 Proteins 0.000 claims description 7
- 125000000753 cycloalkyl group Chemical group 0.000 claims description 7
- 125000004433 nitrogen atom Chemical group N* 0.000 claims description 7
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 claims description 7
- 101710099518 Dickkopf-related protein 1 Proteins 0.000 claims description 6
- 108010036395 Endoglin Proteins 0.000 claims description 6
- 101150112743 HSPA5 gene Proteins 0.000 claims description 6
- 101000893701 Homo sapiens 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 Proteins 0.000 claims description 6
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 claims description 6
- 101000899808 Homo sapiens Guanylyl cyclase C Proteins 0.000 claims description 6
- 101000606465 Homo sapiens Inactive tyrosine-protein kinase 7 Proteins 0.000 claims description 6
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 claims description 6
- 101000834948 Homo sapiens Tomoregulin-2 Proteins 0.000 claims description 6
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 claims description 6
- NQTADLQHYWFPDB-UHFFFAOYSA-N N-Hydroxysuccinimide Chemical compound ON1C(=O)CCC1=O NQTADLQHYWFPDB-UHFFFAOYSA-N 0.000 claims description 6
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 claims description 6
- 102100026160 Tomoregulin-2 Human genes 0.000 claims description 6
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 claims description 6
- 125000000732 arylene group Chemical group 0.000 claims description 6
- 239000003085 diluting agent Substances 0.000 claims description 6
- 150000002019 disulfides Chemical class 0.000 claims description 6
- 125000000524 functional group Chemical group 0.000 claims description 6
- 125000005439 maleimidyl group Chemical group C1(C=CC(N1*)=O)=O 0.000 claims description 6
- 125000001436 propyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])[H] 0.000 claims description 6
- 229910052717 sulfur Inorganic materials 0.000 claims description 6
- 125000001544 thienyl group Chemical group 0.000 claims description 6
- 125000000391 vinyl group Chemical group [H]C([*])=C([H])[H] 0.000 claims description 6
- 125000004400 (C1-C12) alkyl group Chemical group 0.000 claims description 5
- 125000000172 C5-C10 aryl group Chemical group 0.000 claims description 5
- 108090000369 Glutamate Carboxypeptidase II Proteins 0.000 claims description 5
- 101000959738 Homo sapiens Annexin A1 Proteins 0.000 claims description 5
- 101000835745 Homo sapiens Teratocarcinoma-derived growth factor 1 Proteins 0.000 claims description 5
- 101000622304 Homo sapiens Vascular cell adhesion protein 1 Proteins 0.000 claims description 5
- 102100033011 Integrin beta-6 Human genes 0.000 claims description 5
- 102100036735 Prostate stem cell antigen Human genes 0.000 claims description 5
- 102100026404 Teratocarcinoma-derived growth factor 1 Human genes 0.000 claims description 5
- 125000004093 cyano group Chemical group *C#N 0.000 claims description 5
- 125000001153 fluoro group Chemical group F* 0.000 claims description 5
- 238000004519 manufacturing process Methods 0.000 claims description 5
- 125000004076 pyridyl group Chemical group 0.000 claims description 5
- 102100025218 B-cell differentiation antigen CD72 Human genes 0.000 claims description 4
- 102100032312 Brevican core protein Human genes 0.000 claims description 4
- 102100024220 CD180 antigen Human genes 0.000 claims description 4
- 102100025475 Carcinoembryonic antigen-related cell adhesion molecule 5 Human genes 0.000 claims description 4
- 102000002029 Claudin Human genes 0.000 claims description 4
- 108050009302 Claudin Proteins 0.000 claims description 4
- 102100032768 Complement receptor type 2 Human genes 0.000 claims description 4
- 102100031511 Fc receptor-like protein 2 Human genes 0.000 claims description 4
- 101000980829 Homo sapiens CD180 antigen Proteins 0.000 claims description 4
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 claims description 4
- 101001015064 Homo sapiens Integrin beta-6 Proteins 0.000 claims description 4
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 claims description 4
- 102100036427 Spondin-2 Human genes 0.000 claims description 4
- 150000001299 aldehydes Chemical class 0.000 claims description 4
- 125000001931 aliphatic group Chemical group 0.000 claims description 4
- 150000002576 ketones Chemical class 0.000 claims description 4
- 108010074865 mindin Proteins 0.000 claims description 4
- JPSHPWJJSVEEAX-OWPBQMJCSA-N (2s)-2-amino-4-fluoranylpentanedioic acid Chemical compound OC(=O)[C@@H](N)CC([18F])C(O)=O JPSHPWJJSVEEAX-OWPBQMJCSA-N 0.000 claims description 3
- ASOKPJOREAFHNY-UHFFFAOYSA-N 1-Hydroxybenzotriazole Chemical class C1=CC=C2N(O)N=NC2=C1 ASOKPJOREAFHNY-UHFFFAOYSA-N 0.000 claims description 3
- 125000001963 4 membered heterocyclic group Chemical group 0.000 claims description 3
- 125000002373 5 membered heterocyclic group Chemical group 0.000 claims description 3
- 125000004070 6 membered heterocyclic group Chemical group 0.000 claims description 3
- 125000003341 7 membered heterocyclic group Chemical group 0.000 claims description 3
- 102100025473 Carcinoembryonic antigen-related cell adhesion molecule 6 Human genes 0.000 claims description 3
- 102100031517 Fc receptor-like protein 1 Human genes 0.000 claims description 3
- 101710120224 Fc receptor-like protein 1 Proteins 0.000 claims description 3
- 101000914326 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 6 Proteins 0.000 claims description 3
- 101000846911 Homo sapiens Fc receptor-like protein 2 Proteins 0.000 claims description 3
- 101001023705 Homo sapiens Nectin-4 Proteins 0.000 claims description 3
- 101000801255 Homo sapiens Tumor necrosis factor receptor superfamily member 17 Proteins 0.000 claims description 3
- 241000124008 Mammalia Species 0.000 claims description 3
- 102100037603 P2X purinoceptor 5 Human genes 0.000 claims description 3
- 101100111629 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) KAR2 gene Proteins 0.000 claims description 3
- 102100023802 Somatostatin receptor type 2 Human genes 0.000 claims description 3
- 102100023806 Somatostatin receptor type 5 Human genes 0.000 claims description 3
- 101710178300 Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 claims description 3
- HSFWRNGVRCDJHI-UHFFFAOYSA-N alpha-acetylene Natural products C#C HSFWRNGVRCDJHI-UHFFFAOYSA-N 0.000 claims description 3
- 125000001309 chloro group Chemical group Cl* 0.000 claims description 3
- 125000002534 ethynyl group Chemical group [H]C#C* 0.000 claims description 3
- 229910052731 fluorine Inorganic materials 0.000 claims description 3
- 101150028578 grp78 gene Proteins 0.000 claims description 3
- 150000004820 halides Chemical class 0.000 claims description 3
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 claims description 3
- 150000002825 nitriles Chemical group 0.000 claims description 3
- 229910052760 oxygen Inorganic materials 0.000 claims description 3
- 210000000130 stem cell Anatomy 0.000 claims description 3
- 102100027052 Bone morphogenetic protein receptor type-1B Human genes 0.000 claims description 2
- 108010085074 Brevican Proteins 0.000 claims description 2
- 102100031658 C-X-C chemokine receptor type 5 Human genes 0.000 claims description 2
- 102000000844 Cell Surface Receptors Human genes 0.000 claims description 2
- 108010001857 Cell Surface Receptors Proteins 0.000 claims description 2
- 102100031507 Fc receptor-like protein 5 Human genes 0.000 claims description 2
- 102100035139 Folate receptor alpha Human genes 0.000 claims description 2
- 102100031546 HLA class II histocompatibility antigen, DO beta chain Human genes 0.000 claims description 2
- 101000922405 Homo sapiens C-X-C chemokine receptor type 5 Proteins 0.000 claims description 2
- 101000941929 Homo sapiens Complement receptor type 2 Proteins 0.000 claims description 2
- 101000846908 Homo sapiens Fc receptor-like protein 5 Proteins 0.000 claims description 2
- 101001023230 Homo sapiens Folate receptor alpha Proteins 0.000 claims description 2
- 101000866281 Homo sapiens HLA class II histocompatibility antigen, DO beta chain Proteins 0.000 claims description 2
- 101000829138 Homo sapiens Somatostatin receptor type 3 Proteins 0.000 claims description 2
- 101100042271 Mus musculus Sema3b gene Proteins 0.000 claims description 2
- 101710189969 P2X purinoceptor 5 Proteins 0.000 claims description 2
- 108091006938 SLC39A6 Proteins 0.000 claims description 2
- 102100029329 Somatostatin receptor type 1 Human genes 0.000 claims description 2
- 102100023803 Somatostatin receptor type 3 Human genes 0.000 claims description 2
- 102100023801 Somatostatin receptor type 4 Human genes 0.000 claims description 2
- 230000001268 conjugating effect Effects 0.000 claims description 2
- IBAHLNWTOIHLKE-UHFFFAOYSA-N cyano cyanate Chemical compound N#COC#N IBAHLNWTOIHLKE-UHFFFAOYSA-N 0.000 claims description 2
- 208000023958 prostate neoplasm Diseases 0.000 claims description 2
- 108010064556 somatostatin receptor subtype-4 Proteins 0.000 claims description 2
- 108010082379 somatostatin receptor type 1 Proteins 0.000 claims description 2
- 125000006593 (C2-C3) alkynyl group Chemical group 0.000 claims 4
- 102220473068 Chemerin-like receptor 2_R17Q_mutation Human genes 0.000 claims 2
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 claims 2
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 claims 1
- 101150076616 EPHA2 gene Proteins 0.000 claims 1
- 101000934359 Homo sapiens B-cell differentiation antigen CD72 Proteins 0.000 claims 1
- 101000984546 Homo sapiens Bone morphogenetic protein receptor type-1B Proteins 0.000 claims 1
- 101000628547 Homo sapiens Metalloreductase STEAP1 Proteins 0.000 claims 1
- 101000829127 Homo sapiens Somatostatin receptor type 2 Proteins 0.000 claims 1
- 101000829153 Homo sapiens Somatostatin receptor type 5 Proteins 0.000 claims 1
- 102100026712 Metalloreductase STEAP1 Human genes 0.000 claims 1
- 102100035486 Nectin-4 Human genes 0.000 claims 1
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 claims 1
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 claims 1
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 claims 1
- 125000004573 morpholin-4-yl group Chemical group N1(CCOCC1)* 0.000 claims 1
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 claims 1
- 239000000543 intermediate Substances 0.000 abstract description 7
- 108090000765 processed proteins & peptides Proteins 0.000 description 103
- 102000004196 processed proteins & peptides Human genes 0.000 description 100
- 229920001184 polypeptide Polymers 0.000 description 94
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 93
- 241000282414 Homo sapiens Species 0.000 description 86
- 239000002773 nucleotide Substances 0.000 description 84
- 125000003729 nucleotide group Chemical group 0.000 description 84
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 75
- 239000005022 packaging material Substances 0.000 description 74
- 125000006701 (C1-C7) alkyl group Chemical group 0.000 description 62
- 125000003275 alpha amino acid group Chemical group 0.000 description 57
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 53
- 238000006243 chemical reaction Methods 0.000 description 50
- 238000004895 liquid chromatography mass spectrometry Methods 0.000 description 46
- 230000002829 reductive effect Effects 0.000 description 40
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 40
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 39
- 239000011541 reaction mixture Substances 0.000 description 39
- 108090000623 proteins and genes Proteins 0.000 description 37
- 239000002904 solvent Substances 0.000 description 35
- 229910001868 water Inorganic materials 0.000 description 35
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 33
- 238000002390 rotary evaporation Methods 0.000 description 33
- 230000027455 binding Effects 0.000 description 30
- 239000000243 solution Substances 0.000 description 29
- 239000003153 chemical reaction reagent Substances 0.000 description 28
- 210000004408 hybridoma Anatomy 0.000 description 27
- 238000005160 1H NMR spectroscopy Methods 0.000 description 25
- ZMXDDKWLCZADIW-UHFFFAOYSA-N N,N-Dimethylformamide Chemical compound CN(C)C=O ZMXDDKWLCZADIW-UHFFFAOYSA-N 0.000 description 24
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 24
- 239000012267 brine Substances 0.000 description 23
- 125000001147 pentyl group Chemical group C(CCCC)* 0.000 description 23
- 239000000047 product Substances 0.000 description 23
- HPALAKNZSZLMCH-UHFFFAOYSA-M sodium;chloride;hydrate Chemical compound O.[Na+].[Cl-] HPALAKNZSZLMCH-UHFFFAOYSA-M 0.000 description 23
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 22
- 125000003277 amino group Chemical group 0.000 description 22
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 21
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 21
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 20
- 235000019341 magnesium sulphate Nutrition 0.000 description 20
- BWHMMNNQKKPAPP-UHFFFAOYSA-L potassium carbonate Chemical compound [K+].[K+].[O-]C([O-])=O BWHMMNNQKKPAPP-UHFFFAOYSA-L 0.000 description 20
- 108060003951 Immunoglobulin Proteins 0.000 description 19
- WYURNTSHIVDZCO-UHFFFAOYSA-N Tetrahydrofuran Chemical compound C1CCOC1 WYURNTSHIVDZCO-UHFFFAOYSA-N 0.000 description 19
- 102000018358 immunoglobulin Human genes 0.000 description 19
- 229910052727 yttrium Inorganic materials 0.000 description 18
- 235000018417 cysteine Nutrition 0.000 description 17
- 235000018102 proteins Nutrition 0.000 description 17
- 102000004169 proteins and genes Human genes 0.000 description 17
- 125000006413 ring segment Chemical group 0.000 description 17
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 16
- 235000001014 amino acid Nutrition 0.000 description 16
- BDAGIHXWWSANSR-UHFFFAOYSA-N methanoic acid Natural products OC=O BDAGIHXWWSANSR-UHFFFAOYSA-N 0.000 description 16
- 125000003396 thiol group Chemical group [H]S* 0.000 description 16
- 210000004369 blood Anatomy 0.000 description 15
- 239000008280 blood Substances 0.000 description 15
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 15
- RAXXELZNTBOGNW-UHFFFAOYSA-N imidazole Natural products C1=CNC=N1 RAXXELZNTBOGNW-UHFFFAOYSA-N 0.000 description 15
- 125000006239 protecting group Chemical group 0.000 description 15
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 14
- 102100035360 Cerebellar degeneration-related antigen 1 Human genes 0.000 description 14
- 101000737793 Homo sapiens Cerebellar degeneration-related antigen 1 Proteins 0.000 description 14
- JCXJVPUVTGWSNB-UHFFFAOYSA-N Nitrogen dioxide Chemical compound O=[N]=O JCXJVPUVTGWSNB-UHFFFAOYSA-N 0.000 description 14
- 238000003818 flash chromatography Methods 0.000 description 14
- 230000000269 nucleophilic effect Effects 0.000 description 14
- WEVYAHXRMPXWCK-UHFFFAOYSA-N Acetonitrile Chemical compound CC#N WEVYAHXRMPXWCK-UHFFFAOYSA-N 0.000 description 13
- 239000003242 anti bacterial agent Substances 0.000 description 13
- 229940088710 antibiotic agent Drugs 0.000 description 13
- 238000009472 formulation Methods 0.000 description 13
- 239000001257 hydrogen Substances 0.000 description 13
- 239000007787 solid Substances 0.000 description 13
- XKRFYHLGVUSROY-UHFFFAOYSA-N Argon Chemical compound [Ar] XKRFYHLGVUSROY-UHFFFAOYSA-N 0.000 description 12
- 102100033579 Trophoblast glycoprotein Human genes 0.000 description 12
- 239000000741 silica gel Substances 0.000 description 12
- 229910002027 silica gel Inorganic materials 0.000 description 12
- 230000001225 therapeutic effect Effects 0.000 description 12
- 102100022623 Hepatocyte growth factor receptor Human genes 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 11
- 239000000725 suspension Substances 0.000 description 11
- 108010016626 Dipeptides Proteins 0.000 description 10
- 102000001301 EGF receptor Human genes 0.000 description 10
- 108700020796 Oncogene Proteins 0.000 description 10
- 210000001744 T-lymphocyte Anatomy 0.000 description 10
- 239000000539 dimer Substances 0.000 description 10
- 229910000027 potassium carbonate Inorganic materials 0.000 description 10
- YMXFJTUQQVLJEN-UHFFFAOYSA-N pyrimidine Chemical compound C1=CN=CN=C1.C1=CN=CN=C1 YMXFJTUQQVLJEN-UHFFFAOYSA-N 0.000 description 10
- 102000005962 receptors Human genes 0.000 description 10
- 108020003175 receptors Proteins 0.000 description 10
- 229920006395 saturated elastomer Polymers 0.000 description 10
- 238000003756 stirring Methods 0.000 description 10
- 238000004809 thin layer chromatography Methods 0.000 description 10
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 9
- 101150041968 CDC13 gene Proteins 0.000 description 9
- 102000010451 Folate receptor alpha Human genes 0.000 description 9
- 108050001931 Folate receptor alpha Proteins 0.000 description 9
- 101710183768 Glutamate carboxypeptidase 2 Proteins 0.000 description 9
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 9
- HEDRZPFGACZZDS-MICDWDOJSA-N Trichloro(2H)methane Chemical compound [2H]C(Cl)(Cl)Cl HEDRZPFGACZZDS-MICDWDOJSA-N 0.000 description 9
- QWHNJUXXYKPLQM-UHFFFAOYSA-N dimethyl cyclopentane Natural products CC1(C)CCCC1 QWHNJUXXYKPLQM-UHFFFAOYSA-N 0.000 description 9
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 9
- 239000003480 eluent Substances 0.000 description 9
- 150000002431 hydrogen Chemical class 0.000 description 9
- 239000000463 material Substances 0.000 description 9
- 125000001570 methylene group Chemical group [H]C([H])([*:1])[*:2] 0.000 description 9
- 238000002360 preparation method Methods 0.000 description 9
- 241000894007 species Species 0.000 description 9
- OSWFIVFLDKOXQC-UHFFFAOYSA-N 4-(3-methoxyphenyl)aniline Chemical compound COC1=CC=CC(C=2C=CC(N)=CC=2)=C1 OSWFIVFLDKOXQC-UHFFFAOYSA-N 0.000 description 8
- 101000801433 Homo sapiens Trophoblast glycoprotein Proteins 0.000 description 8
- 102000007399 Nuclear hormone receptor Human genes 0.000 description 8
- 108020005497 Nuclear hormone receptor Proteins 0.000 description 8
- 102100040122 Proline-rich protein 4 Human genes 0.000 description 8
- 101710100969 Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 8
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 8
- 125000000304 alkynyl group Chemical group 0.000 description 8
- 230000001363 autoimmune Effects 0.000 description 8
- 230000008901 benefit Effects 0.000 description 8
- 210000000349 chromosome Anatomy 0.000 description 8
- 230000021615 conjugation Effects 0.000 description 8
- 230000000694 effects Effects 0.000 description 8
- 235000019253 formic acid Nutrition 0.000 description 8
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 8
- 238000001727 in vivo Methods 0.000 description 8
- 239000007788 liquid Substances 0.000 description 8
- 108010067588 nucleotide pyrophosphatase Proteins 0.000 description 8
- 239000000126 substance Substances 0.000 description 8
- 238000006467 substitution reaction Methods 0.000 description 8
- 125000000999 tert-butyl group Chemical group [H]C([H])([H])C(*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 8
- KTZQTRPPVKQPFO-UHFFFAOYSA-N 1,2-benzoxazole Chemical compound C1=CC=C2C=NOC2=C1 KTZQTRPPVKQPFO-UHFFFAOYSA-N 0.000 description 7
- 108700012439 CA9 Proteins 0.000 description 7
- 108060006698 EGF receptor Proteins 0.000 description 7
- 101000807561 Homo sapiens Tyrosine-protein kinase receptor UFO Proteins 0.000 description 7
- 241001529936 Murinae Species 0.000 description 7
- 102100023832 Prolyl endopeptidase FAP Human genes 0.000 description 7
- 102100029986 Receptor tyrosine-protein kinase erbB-3 Human genes 0.000 description 7
- 125000004429 atom Chemical group 0.000 description 7
- 210000003719 b-lymphocyte Anatomy 0.000 description 7
- 125000003917 carbamoyl group Chemical group [H]N([H])C(*)=O 0.000 description 7
- 238000001514 detection method Methods 0.000 description 7
- 125000002147 dimethylamino group Chemical group [H]C([H])([H])N(*)C([H])([H])[H] 0.000 description 7
- 230000014509 gene expression Effects 0.000 description 7
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 7
- 235000018977 lysine Nutrition 0.000 description 7
- DPKBAXPHAYBPRL-UHFFFAOYSA-M tetrabutylazanium;iodide Chemical compound [I-].CCCC[N+](CCCC)(CCCC)CCCC DPKBAXPHAYBPRL-UHFFFAOYSA-M 0.000 description 7
- ITMCEJHCFYSIIV-UHFFFAOYSA-M triflate Chemical compound [O-]S(=O)(=O)C(F)(F)F ITMCEJHCFYSIIV-UHFFFAOYSA-M 0.000 description 7
- DJQYYYCQOZMCRC-UHFFFAOYSA-N 2-aminopropane-1,3-dithiol Chemical group SCC(N)CS DJQYYYCQOZMCRC-UHFFFAOYSA-N 0.000 description 6
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 6
- 101000910338 Homo sapiens Carbonic anhydrase 9 Proteins 0.000 description 6
- 108010008707 Mucin-1 Proteins 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- ABLZXFCXXLZCGV-UHFFFAOYSA-N Phosphorous acid Chemical compound OP(O)=O ABLZXFCXXLZCGV-UHFFFAOYSA-N 0.000 description 6
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 6
- 230000009471 action Effects 0.000 description 6
- 125000003545 alkoxy group Chemical group 0.000 description 6
- 150000001412 amines Chemical class 0.000 description 6
- 229910052786 argon Inorganic materials 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- HUMNYLRZRPPJDN-UHFFFAOYSA-N benzaldehyde Chemical compound O=CC1=CC=CC=C1 HUMNYLRZRPPJDN-UHFFFAOYSA-N 0.000 description 6
- 230000004071 biological effect Effects 0.000 description 6
- 239000003795 chemical substances by application Substances 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 125000004122 cyclic group Chemical group 0.000 description 6
- 231100000433 cytotoxic Toxicity 0.000 description 6
- 230000001472 cytotoxic effect Effects 0.000 description 6
- 229910052805 deuterium Inorganic materials 0.000 description 6
- 208000035475 disorder Diseases 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 239000004615 ingredient Substances 0.000 description 6
- 125000003588 lysine group Chemical class [H]N([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 6
- 239000002244 precipitate Substances 0.000 description 6
- 238000000746 purification Methods 0.000 description 6
- 125000003903 2-propenyl group Chemical group [H]C([*])([H])C([H])=C([H])[H] 0.000 description 5
- 108010083651 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase Proteins 0.000 description 5
- 102000004145 Annexin A1 Human genes 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 101000938346 Homo sapiens Ephrin type-A receptor 2 Proteins 0.000 description 5
- 101000684208 Homo sapiens Prolyl endopeptidase FAP Proteins 0.000 description 5
- 101000685848 Homo sapiens Zinc transporter ZIP6 Proteins 0.000 description 5
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 5
- KDLHZDBZIXYQEI-UHFFFAOYSA-N Palladium Chemical compound [Pd] KDLHZDBZIXYQEI-UHFFFAOYSA-N 0.000 description 5
- 239000004480 active ingredient Substances 0.000 description 5
- 230000004075 alteration Effects 0.000 description 5
- 150000001408 amides Chemical group 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 125000000484 butyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 5
- 229910052799 carbon Inorganic materials 0.000 description 5
- 239000000969 carrier Substances 0.000 description 5
- 238000009826 distribution Methods 0.000 description 5
- 229960002949 fluorouracil Drugs 0.000 description 5
- 125000004404 heteroalkyl group Chemical group 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 125000002183 isoquinolinyl group Chemical group C1(=NC=CC2=CC=CC=C12)* 0.000 description 5
- 230000000155 isotopic effect Effects 0.000 description 5
- 208000032839 leukemia Diseases 0.000 description 5
- 239000003921 oil Substances 0.000 description 5
- 235000019198 oils Nutrition 0.000 description 5
- 239000012044 organic layer Substances 0.000 description 5
- GHCAUEMXBSLMGU-UHFFFAOYSA-N oxadiazole;1,2,5-oxadiazole Chemical compound C=1C=NON=1.C1=CON=N1 GHCAUEMXBSLMGU-UHFFFAOYSA-N 0.000 description 5
- 229960002087 pertuzumab Drugs 0.000 description 5
- QQONPFPTGQHPMA-UHFFFAOYSA-N propylene Natural products CC=C QQONPFPTGQHPMA-UHFFFAOYSA-N 0.000 description 5
- 125000004805 propylene group Chemical group [H]C([H])([H])C([H])([*:1])C([H])([H])[*:2] 0.000 description 5
- 210000002307 prostate Anatomy 0.000 description 5
- 125000002943 quinolinyl group Chemical group N1=C(C=CC2=CC=CC=C12)* 0.000 description 5
- 239000011734 sodium Substances 0.000 description 5
- OISVCGZHLKNMSJ-UHFFFAOYSA-N 2,6-dimethyl-pyridine Natural products CC1=CC=CC(C)=N1 OISVCGZHLKNMSJ-UHFFFAOYSA-N 0.000 description 4
- KVVKFESATPCVEL-UHFFFAOYSA-N 4-(5-bromopentoxy)-3-methoxybenzaldehyde Chemical compound COC1=CC(C=O)=CC=C1OCCCCCBr KVVKFESATPCVEL-UHFFFAOYSA-N 0.000 description 4
- CWMRCRFALIQFHU-UHFFFAOYSA-N 4-hydroxy-3-phenylmethoxybenzaldehyde Chemical compound OC1=CC=C(C=O)C=C1OCC1=CC=CC=C1 CWMRCRFALIQFHU-UHFFFAOYSA-N 0.000 description 4
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 4
- 101710187595 B-cell receptor CD22 Proteins 0.000 description 4
- 102000007499 CD27 Ligand Human genes 0.000 description 4
- 108010046080 CD27 Ligand Proteins 0.000 description 4
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 4
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 4
- 108010023729 Complement 3d Receptors Proteins 0.000 description 4
- 102100031968 Ephrin type-B receptor 2 Human genes 0.000 description 4
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical group OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 4
- 101710184069 Hepatocyte growth factor receptor Proteins 0.000 description 4
- 101000980814 Homo sapiens CAMPATH-1 antigen Proteins 0.000 description 4
- 101000881679 Homo sapiens Endoglin Proteins 0.000 description 4
- 101000972946 Homo sapiens Hepatocyte growth factor receptor Proteins 0.000 description 4
- 101710190483 Interleukin-2 receptor subunit alpha Proteins 0.000 description 4
- 229930194542 Keto Natural products 0.000 description 4
- 108010044023 Ki-1 Antigen Proteins 0.000 description 4
- 206010025323 Lymphomas Diseases 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 4
- GLUUGHFHXGJENI-UHFFFAOYSA-N Piperazine Chemical compound C1CNCCN1 GLUUGHFHXGJENI-UHFFFAOYSA-N 0.000 description 4
- 108010076504 Protein Sorting Signals Proteins 0.000 description 4
- 102100032780 Semaphorin-5B Human genes 0.000 description 4
- 108010029157 Sialic Acid Binding Ig-like Lectin 2 Proteins 0.000 description 4
- 108090000058 Syndecan-1 Proteins 0.000 description 4
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 4
- DKGAVHZHDRPRBM-UHFFFAOYSA-N Tert-Butanol Chemical compound CC(C)(C)O DKGAVHZHDRPRBM-UHFFFAOYSA-N 0.000 description 4
- 101710190034 Trophoblast glycoprotein Proteins 0.000 description 4
- 108010000134 Vascular Cell Adhesion Molecule-1 Proteins 0.000 description 4
- 101710097851 Zinc transporter ZIP6 Proteins 0.000 description 4
- 125000002723 alicyclic group Chemical group 0.000 description 4
- 125000003368 amide group Chemical group 0.000 description 4
- 150000001409 amidines Chemical class 0.000 description 4
- 125000006242 amine protecting group Chemical group 0.000 description 4
- 125000000129 anionic group Chemical group 0.000 description 4
- 230000001093 anti-cancer Effects 0.000 description 4
- SQVRNKJHWKZAKO-UHFFFAOYSA-N beta-N-Acetyl-D-neuraminic acid Natural products CC(=O)NC1C(O)CC(O)(C(O)=O)OC1C(O)C(O)CO SQVRNKJHWKZAKO-UHFFFAOYSA-N 0.000 description 4
- 150000001721 carbon Chemical group 0.000 description 4
- 235000011089 carbon dioxide Nutrition 0.000 description 4
- 239000006143 cell culture medium Substances 0.000 description 4
- 230000004663 cell proliferation Effects 0.000 description 4
- 239000003638 chemical reducing agent Substances 0.000 description 4
- KQIADDMXRMTWHZ-UHFFFAOYSA-N chloro-tri(propan-2-yl)silane Chemical compound CC(C)[Si](Cl)(C(C)C)C(C)C KQIADDMXRMTWHZ-UHFFFAOYSA-N 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 239000002299 complementary DNA Substances 0.000 description 4
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 238000001914 filtration Methods 0.000 description 4
- 229940022353 herceptin Drugs 0.000 description 4
- 125000001072 heteroaryl group Chemical group 0.000 description 4
- 150000002466 imines Chemical class 0.000 description 4
- 125000001841 imino group Chemical group [H]N=* 0.000 description 4
- 230000002998 immunogenetic effect Effects 0.000 description 4
- 229940072221 immunoglobulins Drugs 0.000 description 4
- PQNFLJBBNBOBRQ-UHFFFAOYSA-N indane Chemical compound C1=CC=C2CCCC2=C1 PQNFLJBBNBOBRQ-UHFFFAOYSA-N 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 125000000468 ketone group Chemical group 0.000 description 4
- 239000002609 medium Substances 0.000 description 4
- GDOPTJXRTPNYNR-UHFFFAOYSA-N methylcyclopentane Chemical compound CC1CCCC1 GDOPTJXRTPNYNR-UHFFFAOYSA-N 0.000 description 4
- 239000012074 organic phase Substances 0.000 description 4
- CTSLXHKWHWQRSH-UHFFFAOYSA-N oxalyl chloride Chemical compound ClC(=O)C(Cl)=O CTSLXHKWHWQRSH-UHFFFAOYSA-N 0.000 description 4
- 239000012071 phase Substances 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- SQVRNKJHWKZAKO-OQPLDHBCSA-N sialic acid Chemical compound CC(=O)N[C@@H]1[C@@H](O)C[C@@](O)(C(O)=O)OC1[C@H](O)[C@H](O)CO SQVRNKJHWKZAKO-OQPLDHBCSA-N 0.000 description 4
- 229940115586 simulect Drugs 0.000 description 4
- 108090000586 somatostatin receptor 2 Proteins 0.000 description 4
- 108090000680 somatostatin receptor 5 Proteins 0.000 description 4
- 239000003381 stabilizer Substances 0.000 description 4
- 238000013456 study Methods 0.000 description 4
- 239000013589 supplement Substances 0.000 description 4
- 239000003826 tablet Substances 0.000 description 4
- CXWXQJXEFPUFDZ-UHFFFAOYSA-N tetralin Chemical compound C1=CC=C2CCCCC2=C1 CXWXQJXEFPUFDZ-UHFFFAOYSA-N 0.000 description 4
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 4
- WJKHJLXJJJATHN-UHFFFAOYSA-N triflic anhydride Chemical compound FC(F)(F)S(=O)(=O)OS(=O)(=O)C(F)(F)F WJKHJLXJJJATHN-UHFFFAOYSA-N 0.000 description 4
- RYHBNJHYFVUHQT-UHFFFAOYSA-N 1,4-Dioxane Chemical compound C1COCCO1 RYHBNJHYFVUHQT-UHFFFAOYSA-N 0.000 description 3
- SVUOLADPCWQTTE-UHFFFAOYSA-N 1h-1,2-benzodiazepine Chemical compound N1N=CC=CC2=CC=CC=C12 SVUOLADPCWQTTE-UHFFFAOYSA-N 0.000 description 3
- HBAQYPYDRFILMT-UHFFFAOYSA-N 8-[3-(1-cyclopropylpyrazol-4-yl)-1H-pyrazolo[4,3-d]pyrimidin-5-yl]-3-methyl-3,8-diazabicyclo[3.2.1]octan-2-one Chemical class C1(CC1)N1N=CC(=C1)C1=NNC2=C1N=C(N=C2)N1C2C(N(CC1CC2)C)=O HBAQYPYDRFILMT-UHFFFAOYSA-N 0.000 description 3
- 208000023275 Autoimmune disease Diseases 0.000 description 3
- 241000271566 Aves Species 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 108010001445 CD79 Antigens Proteins 0.000 description 3
- 102000000796 CD79 Antigens Human genes 0.000 description 3
- 241000282693 Cercopithecidae Species 0.000 description 3
- 206010009944 Colon cancer Diseases 0.000 description 3
- 102000011412 Complement 3d Receptors Human genes 0.000 description 3
- RGSFGYAAUTVSQA-UHFFFAOYSA-N Cyclopentane Chemical compound C1CCCC1 RGSFGYAAUTVSQA-UHFFFAOYSA-N 0.000 description 3
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 3
- 239000005977 Ethylene Substances 0.000 description 3
- YLQBMQCUIZJEEH-UHFFFAOYSA-N Furan Chemical compound C=1C=COC=1 YLQBMQCUIZJEEH-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101710198293 Guanylyl cyclase C Proteins 0.000 description 3
- 101000864646 Homo sapiens Dickkopf-related protein 1 Proteins 0.000 description 3
- 101001064462 Homo sapiens Ephrin type-B receptor 2 Proteins 0.000 description 3
- 101001068136 Homo sapiens Hepatitis A virus cellular receptor 1 Proteins 0.000 description 3
- 101000654679 Homo sapiens Semaphorin-5B Proteins 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- 101710099452 Inactive tyrosine-protein kinase 7 Proteins 0.000 description 3
- SIKJAQJRHWYJAI-UHFFFAOYSA-N Indole Chemical compound C1=CC=C2NC=CC2=C1 SIKJAQJRHWYJAI-UHFFFAOYSA-N 0.000 description 3
- 208000008839 Kidney Neoplasms Diseases 0.000 description 3
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 3
- 102000052922 Large Neutral Amino Acid-Transporter 1 Human genes 0.000 description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 101710196759 Macrophage-stimulating protein receptor Proteins 0.000 description 3
- 241001465754 Metazoa Species 0.000 description 3
- 102000007298 Mucin-1 Human genes 0.000 description 3
- MZRVEZGGRBJDDB-UHFFFAOYSA-N N-Butyllithium Chemical compound [Li]CCCC MZRVEZGGRBJDDB-UHFFFAOYSA-N 0.000 description 3
- 108010069196 Neural Cell Adhesion Molecules Proteins 0.000 description 3
- 241000283973 Oryctolagus cuniculus Species 0.000 description 3
- 239000012828 PI3K inhibitor Substances 0.000 description 3
- 206010061902 Pancreatic neoplasm Diseases 0.000 description 3
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 3
- 206010060862 Prostate cancer Diseases 0.000 description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 description 3
- 108010089836 Proto-Oncogene Proteins c-met Proteins 0.000 description 3
- 206010038389 Renal cancer Diseases 0.000 description 3
- 241000283984 Rodentia Species 0.000 description 3
- 108091006232 SLC7A5 Proteins 0.000 description 3
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 3
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 3
- BPEGJWRSRHCHSN-UHFFFAOYSA-N Temozolomide Chemical compound O=C1N(C)N=NC2=C(C(N)=O)N=CN21 BPEGJWRSRHCHSN-UHFFFAOYSA-N 0.000 description 3
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 3
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 description 3
- 150000001241 acetals Chemical class 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- 125000002252 acyl group Chemical group 0.000 description 3
- 229960000548 alemtuzumab Drugs 0.000 description 3
- 125000004419 alkynylene group Chemical group 0.000 description 3
- 125000004397 aminosulfonyl group Chemical group NS(=O)(=O)* 0.000 description 3
- SMWDFEZZVXVKRB-UHFFFAOYSA-N anhydrous quinoline Natural products N1=CC=CC2=CC=CC=C21 SMWDFEZZVXVKRB-UHFFFAOYSA-N 0.000 description 3
- 230000000259 anti-tumor effect Effects 0.000 description 3
- 239000003963 antioxidant agent Substances 0.000 description 3
- 235000006708 antioxidants Nutrition 0.000 description 3
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 3
- JFDZBHWFFUWGJE-UHFFFAOYSA-N benzonitrile Chemical compound N#CC1=CC=CC=C1 JFDZBHWFFUWGJE-UHFFFAOYSA-N 0.000 description 3
- 229960000397 bevacizumab Drugs 0.000 description 3
- HXCHCVDVKSCDHU-LULTVBGHSA-N calicheamicin Chemical compound C1[C@H](OC)[C@@H](NCC)CO[C@H]1O[C@H]1[C@H](O[C@@H]2C\3=C(NC(=O)OC)C(=O)C[C@](C/3=C/CSSSC)(O)C#C\C=C/C#C2)O[C@H](C)[C@@H](NO[C@@H]2O[C@H](C)[C@@H](SC(=O)C=3C(=C(OC)C(O[C@H]4[C@@H]([C@H](OC)[C@@H](O)[C@H](C)O4)O)=C(I)C=3C)OC)[C@@H](O)C2)[C@@H]1O HXCHCVDVKSCDHU-LULTVBGHSA-N 0.000 description 3
- 229930195731 calicheamicin Natural products 0.000 description 3
- 125000002091 cationic group Chemical group 0.000 description 3
- 238000001516 cell proliferation assay Methods 0.000 description 3
- 239000006285 cell suspension Substances 0.000 description 3
- 239000000460 chlorine Substances 0.000 description 3
- 239000002131 composite material Substances 0.000 description 3
- 230000008878 coupling Effects 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 238000005859 coupling reaction Methods 0.000 description 3
- 125000002993 cycloalkylene group Chemical group 0.000 description 3
- 239000002254 cytotoxic agent Substances 0.000 description 3
- 238000001962 electrophoresis Methods 0.000 description 3
- 238000010828 elution Methods 0.000 description 3
- 125000004185 ester group Chemical group 0.000 description 3
- 125000001301 ethoxy group Chemical group [H]C([H])([H])C([H])([H])O* 0.000 description 3
- 238000001704 evaporation Methods 0.000 description 3
- 230000008020 evaporation Effects 0.000 description 3
- 239000000706 filtrate Substances 0.000 description 3
- 230000002496 gastric effect Effects 0.000 description 3
- 210000004602 germ cell Anatomy 0.000 description 3
- 150000002373 hemiacetals Chemical class 0.000 description 3
- DMEGYFMYUHOHGS-UHFFFAOYSA-N heptamethylene Natural products C1CCCCCC1 DMEGYFMYUHOHGS-UHFFFAOYSA-N 0.000 description 3
- 238000004128 high performance liquid chromatography Methods 0.000 description 3
- 229940088597 hormone Drugs 0.000 description 3
- 239000005556 hormone Substances 0.000 description 3
- 150000002430 hydrocarbons Chemical class 0.000 description 3
- DOUHZFSGSXMPIE-UHFFFAOYSA-N hydroxidooxidosulfur(.) Chemical compound [O]SO DOUHZFSGSXMPIE-UHFFFAOYSA-N 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 102000006495 integrins Human genes 0.000 description 3
- 108010044426 integrins Proteins 0.000 description 3
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 3
- 125000001449 isopropyl group Chemical group [H]C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 3
- 201000010982 kidney cancer Diseases 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 208000014018 liver neoplasm Diseases 0.000 description 3
- 201000005202 lung cancer Diseases 0.000 description 3
- 208000020816 lung neoplasm Diseases 0.000 description 3
- 206010025135 lupus erythematosus Diseases 0.000 description 3
- 230000036210 malignancy Effects 0.000 description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 description 3
- 229950008001 matuzumab Drugs 0.000 description 3
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 3
- 230000002503 metabolic effect Effects 0.000 description 3
- XMYQHJDBLRZMLW-UHFFFAOYSA-N methanolamine Chemical compound NCO XMYQHJDBLRZMLW-UHFFFAOYSA-N 0.000 description 3
- 229960000485 methotrexate Drugs 0.000 description 3
- 239000002829 mitogen activated protein kinase inhibitor Substances 0.000 description 3
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 3
- 125000002950 monocyclic group Chemical group 0.000 description 3
- 125000004123 n-propyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])* 0.000 description 3
- 239000012299 nitrogen atmosphere Substances 0.000 description 3
- QJGQUHMNIGDVPM-UHFFFAOYSA-N nitrogen group Chemical group [N] QJGQUHMNIGDVPM-UHFFFAOYSA-N 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 150000007523 nucleic acids Chemical class 0.000 description 3
- 239000012038 nucleophile Substances 0.000 description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 description 3
- 229960001972 panitumumab Drugs 0.000 description 3
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 3
- 229940043441 phosphoinositide 3-kinase inhibitor Drugs 0.000 description 3
- 150000008300 phosphoramidites Chemical class 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000003755 preservative agent Substances 0.000 description 3
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- CPNGPNLZQNNVQM-UHFFFAOYSA-N pteridine Chemical compound N1=CN=CC2=NC=CN=C21 CPNGPNLZQNNVQM-UHFFFAOYSA-N 0.000 description 3
- XSCHRSMBECNVNS-UHFFFAOYSA-N quinoxaline Chemical compound N1=CC=NC2=CC=CC=C21 XSCHRSMBECNVNS-UHFFFAOYSA-N 0.000 description 3
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 3
- 229960002930 sirolimus Drugs 0.000 description 3
- 102000004052 somatostatin receptor 2 Human genes 0.000 description 3
- 102000004115 somatostatin receptor 5 Human genes 0.000 description 3
- 206010041823 squamous cell carcinoma Diseases 0.000 description 3
- 239000007858 starting material Substances 0.000 description 3
- CNHYKKNIIGEXAY-UHFFFAOYSA-N thiolan-2-imine Chemical compound N=C1CCCS1 CNHYKKNIIGEXAY-UHFFFAOYSA-N 0.000 description 3
- ATGUDZODTABURZ-UHFFFAOYSA-N thiolan-2-ylideneazanium;chloride Chemical compound Cl.N=C1CCCS1 ATGUDZODTABURZ-UHFFFAOYSA-N 0.000 description 3
- 210000001519 tissue Anatomy 0.000 description 3
- 230000001988 toxicity Effects 0.000 description 3
- 231100000419 toxicity Toxicity 0.000 description 3
- 229960000575 trastuzumab Drugs 0.000 description 3
- LWIHDJKSTIGBAC-UHFFFAOYSA-K tripotassium phosphate Chemical compound [K+].[K+].[K+].[O-]P([O-])([O-])=O LWIHDJKSTIGBAC-UHFFFAOYSA-K 0.000 description 3
- 210000004881 tumor cell Anatomy 0.000 description 3
- 208000035408 type 1 diabetes mellitus 1 Diseases 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 239000003643 water by type Substances 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- IFIJUZXXKFWQAU-NSHDSACASA-N (6as)-2-hydroxy-8-methylidene-5,6a,7,9-tetrahydropyrrolo[2,1-c][1,4]benzodiazepine-6,11-dione Chemical compound N1C(=O)[C@@H]2CC(=C)CN2C(=O)C2=CC(O)=CC=C21 IFIJUZXXKFWQAU-NSHDSACASA-N 0.000 description 2
- OMRPLUKQNWNZAV-CONSDPRKSA-N (6as)-3-[3-[[(6as)-2-methoxy-8-(4-methoxyphenyl)-11-oxo-6a,7-dihydropyrrolo[2,1-c][1,4]benzodiazepin-3-yl]oxy]propoxy]-8-(4-aminophenyl)-2-methoxy-6a,7-dihydropyrrolo[2,1-c][1,4]benzodiazepin-11-one Chemical compound C1=CC(OC)=CC=C1C1=CN2C(=O)C3=CC(OC)=C(OCCCOC=4C(=CC=5C(=O)N6C=C(C[C@H]6C=NC=5C=4)C=4C=CC(N)=CC=4)OC)C=C3N=C[C@@H]2C1 OMRPLUKQNWNZAV-CONSDPRKSA-N 0.000 description 2
- 125000006652 (C3-C12) cycloalkyl group Chemical group 0.000 description 2
- UQVNRKBFAXNOGA-OHLDGCSVSA-N (Z)-tomaymycin Chemical compound CO[C@H]1NC2=CC(O)=C(OC)C=C2C(=O)N2C\C(=C/C)C[C@@H]12 UQVNRKBFAXNOGA-OHLDGCSVSA-N 0.000 description 2
- YRIZYWQGELRKNT-UHFFFAOYSA-N 1,3,5-trichloro-1,3,5-triazinane-2,4,6-trione Chemical compound ClN1C(=O)N(Cl)C(=O)N(Cl)C1=O YRIZYWQGELRKNT-UHFFFAOYSA-N 0.000 description 2
- WNXJIVFYUVYPPR-UHFFFAOYSA-N 1,3-dioxolane Chemical compound C1COCO1 WNXJIVFYUVYPPR-UHFFFAOYSA-N 0.000 description 2
- KXMZDGSRSGHMMK-VWLOTQADSA-N 1-(6,7-dihydro-5h-benzo[2,3]cyclohepta[2,4-d]pyridazin-3-yl)-3-n-[(7s)-7-pyrrolidin-1-yl-6,7,8,9-tetrahydro-5h-benzo[7]annulen-3-yl]-1,2,4-triazole-3,5-diamine Chemical compound N1([C@H]2CCC3=CC=C(C=C3CC2)NC=2N=C(N(N=2)C=2N=NC=3C4=CC=CC=C4CCCC=3C=2)N)CCCC1 KXMZDGSRSGHMMK-VWLOTQADSA-N 0.000 description 2
- IANQTJSKSUMEQM-UHFFFAOYSA-N 1-benzofuran Chemical compound C1=CC=C2OC=CC2=C1 IANQTJSKSUMEQM-UHFFFAOYSA-N 0.000 description 2
- FCEHBMOGCRZNNI-UHFFFAOYSA-N 1-benzothiophene Chemical compound C1=CC=C2SC=CC2=C1 FCEHBMOGCRZNNI-UHFFFAOYSA-N 0.000 description 2
- CTMHWPIWNRWQEG-UHFFFAOYSA-N 1-methylcyclohexene Chemical compound CC1=CCCCC1 CTMHWPIWNRWQEG-UHFFFAOYSA-N 0.000 description 2
- YBYIRNPNPLQARY-UHFFFAOYSA-N 1H-indene Chemical compound C1=CC=C2CC=CC2=C1 YBYIRNPNPLQARY-UHFFFAOYSA-N 0.000 description 2
- VEPOHXYIFQMVHW-XOZOLZJESA-N 2,3-dihydroxybutanedioic acid (2S,3S)-3,4-dimethyl-2-phenylmorpholine Chemical compound OC(C(O)C(O)=O)C(O)=O.C[C@H]1[C@@H](OCCN1C)c1ccccc1 VEPOHXYIFQMVHW-XOZOLZJESA-N 0.000 description 2
- BPXKZEMBEZGUAH-UHFFFAOYSA-N 2-(chloromethoxy)ethyl-trimethylsilane Chemical compound C[Si](C)(C)CCOCCl BPXKZEMBEZGUAH-UHFFFAOYSA-N 0.000 description 2
- HZAXFHJVJLSVMW-UHFFFAOYSA-N 2-Aminoethan-1-ol Chemical compound NCCO HZAXFHJVJLSVMW-UHFFFAOYSA-N 0.000 description 2
- NGNBDVOYPDDBFK-UHFFFAOYSA-N 2-[2,4-di(pentan-2-yl)phenoxy]acetyl chloride Chemical compound CCCC(C)C1=CC=C(OCC(Cl)=O)C(C(C)CCC)=C1 NGNBDVOYPDDBFK-UHFFFAOYSA-N 0.000 description 2
- KZMAWJRXKGLWGS-UHFFFAOYSA-N 2-chloro-n-[4-(4-methoxyphenyl)-1,3-thiazol-2-yl]-n-(3-methoxypropyl)acetamide Chemical class S1C(N(C(=O)CCl)CCCOC)=NC(C=2C=CC(OC)=CC=2)=C1 KZMAWJRXKGLWGS-UHFFFAOYSA-N 0.000 description 2
- 125000001494 2-propynyl group Chemical group [H]C#CC([H])([H])* 0.000 description 2
- JZIBVTUXIVIFGC-UHFFFAOYSA-N 2H-pyrrole Chemical compound C1C=CC=N1 JZIBVTUXIVIFGC-UHFFFAOYSA-N 0.000 description 2
- IBGBGRVKPALMCQ-UHFFFAOYSA-N 3,4-dihydroxybenzaldehyde Chemical compound OC1=CC=C(C=O)C=C1O IBGBGRVKPALMCQ-UHFFFAOYSA-N 0.000 description 2
- JVQIKJMSUIMUDI-UHFFFAOYSA-N 3-pyrroline Chemical compound C1NCC=C1 JVQIKJMSUIMUDI-UHFFFAOYSA-N 0.000 description 2
- VVIAGPKUTFNRDU-UHFFFAOYSA-N 6S-folinic acid Natural products C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 VVIAGPKUTFNRDU-UHFFFAOYSA-N 0.000 description 2
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 2
- KDCGOANMDULRCW-UHFFFAOYSA-N 7H-purine Chemical compound N1=CNC2=NC=NC2=C1 KDCGOANMDULRCW-UHFFFAOYSA-N 0.000 description 2
- UJOBWOGCFQCDNV-UHFFFAOYSA-N 9H-carbazole Chemical compound C1=CC=C2C3=CC=CC=C3NC2=C1 UJOBWOGCFQCDNV-UHFFFAOYSA-N 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- NLXLAEXVIDQMFP-UHFFFAOYSA-N Ammonia chloride Chemical compound [NH4+].[Cl-] NLXLAEXVIDQMFP-UHFFFAOYSA-N 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 2
- PAYRUJLWNCNPSJ-UHFFFAOYSA-N Aniline Chemical compound NC1=CC=CC=C1 PAYRUJLWNCNPSJ-UHFFFAOYSA-N 0.000 description 2
- 102000000412 Annexin Human genes 0.000 description 2
- 108050008874 Annexin Proteins 0.000 description 2
- 208000002267 Anti-neutrophil cytoplasmic antibody-associated vasculitis Diseases 0.000 description 2
- 201000001320 Atherosclerosis Diseases 0.000 description 2
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical compound C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 2
- 108091008875 B cell receptors Proteins 0.000 description 2
- 108010046304 B-Cell Activation Factor Receptor Proteins 0.000 description 2
- 102100027203 B-cell antigen receptor complex-associated protein beta chain Human genes 0.000 description 2
- 101710129514 B-cell differentiation antigen CD72 Proteins 0.000 description 2
- 101710117995 B-lymphocyte antigen CD19 Proteins 0.000 description 2
- MLDQJTXFUGDVEO-UHFFFAOYSA-N BAY-43-9006 Chemical compound C1=NC(C(=O)NC)=CC(OC=2C=CC(NC(=O)NC=3C=C(C(Cl)=CC=3)C(F)(F)F)=CC=2)=C1 MLDQJTXFUGDVEO-UHFFFAOYSA-N 0.000 description 2
- 208000023328 Basedow disease Diseases 0.000 description 2
- LSNNMFCWUKXFEE-UHFFFAOYSA-M Bisulfite Chemical compound OS([O-])=O LSNNMFCWUKXFEE-UHFFFAOYSA-M 0.000 description 2
- 206010005003 Bladder cancer Diseases 0.000 description 2
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 2
- KXDHJXZQYSOELW-UHFFFAOYSA-M Carbamate Chemical compound NC([O-])=O KXDHJXZQYSOELW-UHFFFAOYSA-M 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 102000005600 Cathepsins Human genes 0.000 description 2
- 108010084457 Cathepsins Proteins 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 241000254173 Coleoptera Species 0.000 description 2
- 206010009900 Colitis ulcerative Diseases 0.000 description 2
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 2
- 108010092160 Dactinomycin Proteins 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- 102100020743 Dipeptidase 1 Human genes 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- 238000012286 ELISA Assay Methods 0.000 description 2
- 108010001687 Enterotoxin Receptors Proteins 0.000 description 2
- 101710116743 Ephrin type-A receptor 2 Proteins 0.000 description 2
- 241000283073 Equus caballus Species 0.000 description 2
- QUSNBJAOOMFDIB-UHFFFAOYSA-N Ethylamine Chemical compound CCN QUSNBJAOOMFDIB-UHFFFAOYSA-N 0.000 description 2
- 206010017993 Gastrointestinal neoplasms Diseases 0.000 description 2
- 206010018364 Glomerulonephritis Diseases 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 208000015023 Graves' disease Diseases 0.000 description 2
- 101710185991 Hepatitis A virus cellular receptor 1 homolog Proteins 0.000 description 2
- 101000690301 Homo sapiens Aldo-keto reductase family 1 member C4 Proteins 0.000 description 2
- 101000851181 Homo sapiens Epidermal growth factor receptor Proteins 0.000 description 2
- 101001057504 Homo sapiens Interferon-stimulated gene 20 kDa protein Proteins 0.000 description 2
- 101001063456 Homo sapiens Leucine-rich repeat-containing G-protein coupled receptor 5 Proteins 0.000 description 2
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 2
- 101001116548 Homo sapiens Protein CBFA2T1 Proteins 0.000 description 2
- 101000604039 Homo sapiens Sodium-dependent phosphate transport protein 2B Proteins 0.000 description 2
- 101000666340 Homo sapiens Tenascin Proteins 0.000 description 2
- 101000844504 Homo sapiens Transient receptor potential cation channel subfamily M member 4 Proteins 0.000 description 2
- OAKJQQAXSVQMHS-UHFFFAOYSA-N Hydrazine Chemical compound NN OAKJQQAXSVQMHS-UHFFFAOYSA-N 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 101710123022 Integrin alpha-V Proteins 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- 101710197070 Lectin-2 Proteins 0.000 description 2
- 108010006444 Leucine-Rich Repeat Proteins Proteins 0.000 description 2
- 102100031036 Leucine-rich repeat-containing G-protein coupled receptor 5 Human genes 0.000 description 2
- 108060001084 Luciferase Proteins 0.000 description 2
- 239000005089 Luciferase Substances 0.000 description 2
- 208000005777 Lupus Nephritis Diseases 0.000 description 2
- FSNCEEGOMTYXKY-JTQLQIEISA-N Lycoperodine 1 Natural products N1C2=CC=CC=C2C2=C1CN[C@H](C(=O)O)C2 FSNCEEGOMTYXKY-JTQLQIEISA-N 0.000 description 2
- 229940124647 MEK inhibitor Drugs 0.000 description 2
- 102000003735 Mesothelin Human genes 0.000 description 2
- 108090000015 Mesothelin Proteins 0.000 description 2
- YNAVUWVOSKDBBP-UHFFFAOYSA-N Morpholine Chemical compound C1COCCN1 YNAVUWVOSKDBBP-UHFFFAOYSA-N 0.000 description 2
- 102100023123 Mucin-16 Human genes 0.000 description 2
- 108010063954 Mucins Proteins 0.000 description 2
- 102000015728 Mucins Human genes 0.000 description 2
- 101100327295 Mus musculus Cd22 gene Proteins 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 2
- UFWIBTONFRDIAS-UHFFFAOYSA-N Naphthalene Chemical compound C1=CC=CC2=CC=CC=C21 UFWIBTONFRDIAS-UHFFFAOYSA-N 0.000 description 2
- 108050003738 Neural cell adhesion molecule 1 Proteins 0.000 description 2
- 206010033128 Ovarian cancer Diseases 0.000 description 2
- 206010061535 Ovarian neoplasm Diseases 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 208000031845 Pernicious anaemia Diseases 0.000 description 2
- PCNDJXKNXGMECE-UHFFFAOYSA-N Phenazine Natural products C1=CC=CC2=NC3=CC=CC=C3N=C21 PCNDJXKNXGMECE-UHFFFAOYSA-N 0.000 description 2
- XYFCBTPGUUZFHI-UHFFFAOYSA-N Phosphine Chemical compound P XYFCBTPGUUZFHI-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 101710124304 Proline-rich protein 4 Proteins 0.000 description 2
- 201000004681 Psoriasis Diseases 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- PLXBWHJQWKZRKG-UHFFFAOYSA-N Resazurin Chemical compound C1=CC(=O)C=C2OC3=CC(O)=CC=C3[N+]([O-])=C21 PLXBWHJQWKZRKG-UHFFFAOYSA-N 0.000 description 2
- 239000008156 Ringer's lactate solution Substances 0.000 description 2
- 206010039491 Sarcoma Diseases 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 208000021386 Sjogren Syndrome Diseases 0.000 description 2
- 206010041067 Small cell lung cancer Diseases 0.000 description 2
- UIIMBOGNXHQVGW-DEQYMQKBSA-M Sodium bicarbonate-14C Chemical class [Na+].O[14C]([O-])=O UIIMBOGNXHQVGW-DEQYMQKBSA-M 0.000 description 2
- 102100038437 Sodium-dependent phosphate transport protein 2B Human genes 0.000 description 2
- 108050001286 Somatostatin Receptor Proteins 0.000 description 2
- 102000011096 Somatostatin receptor Human genes 0.000 description 2
- 208000005718 Stomach Neoplasms Diseases 0.000 description 2
- 102100033447 T-lymphocyte surface antigen Ly-9 Human genes 0.000 description 2
- 101710114141 T-lymphocyte surface antigen Ly-9 Proteins 0.000 description 2
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 2
- YPWFISCTZQNZAU-UHFFFAOYSA-N Thiane Chemical compound C1CCSCC1 YPWFISCTZQNZAU-UHFFFAOYSA-N 0.000 description 2
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 2
- 101710187885 Tumor necrosis factor receptor superfamily member 17 Proteins 0.000 description 2
- 101710165436 Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 2
- 201000006704 Ulcerative Colitis Diseases 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- 208000007097 Urinary Bladder Neoplasms Diseases 0.000 description 2
- 208000024780 Urticaria Diseases 0.000 description 2
- CWRYPZZKDGJXCA-UHFFFAOYSA-N acenaphthene Chemical compound C1=CC(CC2)=C3C2=CC=CC3=C1 CWRYPZZKDGJXCA-UHFFFAOYSA-N 0.000 description 2
- 125000004036 acetal group Chemical group 0.000 description 2
- DZBUGLKDJFMEHC-UHFFFAOYSA-N acridine Chemical compound C1=CC=CC2=CC3=CC=CC=C3N=C21 DZBUGLKDJFMEHC-UHFFFAOYSA-N 0.000 description 2
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 208000021841 acute erythroid leukemia Diseases 0.000 description 2
- 125000004423 acyloxy group Chemical group 0.000 description 2
- 230000001464 adherent effect Effects 0.000 description 2
- 239000002671 adjuvant Substances 0.000 description 2
- 101150115889 al gene Proteins 0.000 description 2
- 125000004450 alkenylene group Chemical group 0.000 description 2
- 125000005907 alkyl ester group Chemical group 0.000 description 2
- 229960003437 aminoglutethimide Drugs 0.000 description 2
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000002491 angiogenic effect Effects 0.000 description 2
- MWPLVEDNUUSJAV-UHFFFAOYSA-N anthracene Chemical compound C1=CC=CC2=CC3=CC=CC=C3C=C21 MWPLVEDNUUSJAV-UHFFFAOYSA-N 0.000 description 2
- 230000000340 anti-metabolite Effects 0.000 description 2
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 2
- 229940100197 antimetabolite Drugs 0.000 description 2
- 239000002256 antimetabolite Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 239000012300 argon atmosphere Substances 0.000 description 2
- 150000001491 aromatic compounds Chemical class 0.000 description 2
- 125000004104 aryloxy group Chemical group 0.000 description 2
- CUFNKYGDVFVPHO-UHFFFAOYSA-N azulene Chemical compound C1=CC=CC2=CC=CC2=C1 CUFNKYGDVFVPHO-UHFFFAOYSA-N 0.000 description 2
- 229950009568 bemcentinib Drugs 0.000 description 2
- IOJUPLGTWVMSFF-UHFFFAOYSA-N benzothiazole Chemical compound C1=CC=C2SC=NC2=C1 IOJUPLGTWVMSFF-UHFFFAOYSA-N 0.000 description 2
- WGQKYBSKWIADBV-UHFFFAOYSA-N benzylamine Chemical compound NCC1=CC=CC=C1 WGQKYBSKWIADBV-UHFFFAOYSA-N 0.000 description 2
- 230000003115 biocidal effect Effects 0.000 description 2
- 210000000481 breast Anatomy 0.000 description 2
- HQABUPZFAYXKJW-UHFFFAOYSA-N butan-1-amine Chemical compound CCCCN HQABUPZFAYXKJW-UHFFFAOYSA-N 0.000 description 2
- KVUAALJSMIVURS-ZEDZUCNESA-L calcium folinate Chemical compound [Ca+2].C1NC=2NC(N)=NC(=O)C=2N(C=O)C1CNC1=CC=C(C(=O)N[C@@H](CCC([O-])=O)C([O-])=O)C=C1 KVUAALJSMIVURS-ZEDZUCNESA-L 0.000 description 2
- 229940112129 campath Drugs 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 125000001951 carbamoylamino group Chemical group C(N)(=O)N* 0.000 description 2
- 125000005488 carboaryl group Chemical group 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 239000011203 carbon fibre reinforced carbon Substances 0.000 description 2
- SKOLWUPSYHWYAM-UHFFFAOYSA-N carbonodithioic O,S-acid Chemical compound SC(S)=O SKOLWUPSYHWYAM-UHFFFAOYSA-N 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- 150000007942 carboxylates Chemical class 0.000 description 2
- 201000009909 cataract 6 multiple types Diseases 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 230000003833 cell viability Effects 0.000 description 2
- 238000012054 celltiter-glo Methods 0.000 description 2
- 229960005395 cetuximab Drugs 0.000 description 2
- 229910052801 chlorine Inorganic materials 0.000 description 2
- 238000004587 chromatography analysis Methods 0.000 description 2
- WCZVZNOTHYJIEI-UHFFFAOYSA-N cinnoline Chemical compound N1=NC=CC2=CC=CC=C21 WCZVZNOTHYJIEI-UHFFFAOYSA-N 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 208000029742 colonic neoplasm Diseases 0.000 description 2
- 229940125904 compound 1 Drugs 0.000 description 2
- 239000012043 crude product Substances 0.000 description 2
- HGCIXCUEYOPUTN-UHFFFAOYSA-N cyclohexene Chemical compound C1CCC=CC1 HGCIXCUEYOPUTN-UHFFFAOYSA-N 0.000 description 2
- LPIQUOYDBNQMRZ-UHFFFAOYSA-N cyclopentene Chemical compound C1CC=CC1 LPIQUOYDBNQMRZ-UHFFFAOYSA-N 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 150000001945 cysteines Chemical group 0.000 description 2
- 229940104302 cytosine Drugs 0.000 description 2
- 230000001085 cytostatic effect Effects 0.000 description 2
- 231100000599 cytotoxic agent Toxicity 0.000 description 2
- 229960002806 daclizumab Drugs 0.000 description 2
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 2
- 101150047356 dec-1 gene Proteins 0.000 description 2
- 230000007123 defense Effects 0.000 description 2
- 230000002939 deleterious effect Effects 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000010511 deprotection reaction Methods 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- TXCDCPKCNAJMEE-UHFFFAOYSA-N dibenzofuran Chemical compound C1=CC=C2C3=CC=CC=C3OC2=C1 TXCDCPKCNAJMEE-UHFFFAOYSA-N 0.000 description 2
- IYYZUPMFVPLQIF-UHFFFAOYSA-N dibenzothiophene Chemical compound C1=CC=C2C3=CC=CC=C3SC2=C1 IYYZUPMFVPLQIF-UHFFFAOYSA-N 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 125000002228 disulfide group Chemical group 0.000 description 2
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 2
- 239000003937 drug carrier Substances 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- VLCYCQAOQCDTCN-UHFFFAOYSA-N eflornithine Chemical compound NCCCC(N)(C(F)F)C(O)=O VLCYCQAOQCDTCN-UHFFFAOYSA-N 0.000 description 2
- 229960004137 elotuzumab Drugs 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 125000002587 enol group Chemical group 0.000 description 2
- 150000002085 enols Chemical class 0.000 description 2
- 229940011871 estrogen Drugs 0.000 description 2
- 239000000262 estrogen Substances 0.000 description 2
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 2
- 125000000816 ethylene group Chemical group [H]C([H])([*:1])C([H])([H])[*:2] 0.000 description 2
- 230000029142 excretion Effects 0.000 description 2
- OVBPIULPVIDEAO-LBPRGKRZSA-N folic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-LBPRGKRZSA-N 0.000 description 2
- 235000008191 folinic acid Nutrition 0.000 description 2
- 239000011672 folinic acid Substances 0.000 description 2
- 108020001507 fusion proteins Proteins 0.000 description 2
- 102000037865 fusion proteins Human genes 0.000 description 2
- CHPZKNULDCNCBW-UHFFFAOYSA-N gallium nitrate Chemical compound [Ga+3].[O-][N+]([O-])=O.[O-][N+]([O-])=O.[O-][N+]([O-])=O CHPZKNULDCNCBW-UHFFFAOYSA-N 0.000 description 2
- 206010017758 gastric cancer Diseases 0.000 description 2
- 229960003297 gemtuzumab ozogamicin Drugs 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 125000001976 hemiacetal group Chemical group 0.000 description 2
- 230000002440 hepatic effect Effects 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- 238000013537 high throughput screening Methods 0.000 description 2
- 102000054751 human RUNX1T1 Human genes 0.000 description 2
- BHEPBYXIRTUNPN-UHFFFAOYSA-N hydridophosphorus(.) (triplet) Chemical compound [PH] BHEPBYXIRTUNPN-UHFFFAOYSA-N 0.000 description 2
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 2
- 230000003463 hyperproliferative effect Effects 0.000 description 2
- 229960001101 ifosfamide Drugs 0.000 description 2
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 2
- 230000001900 immune effect Effects 0.000 description 2
- 229940127121 immunoconjugate Drugs 0.000 description 2
- 230000002163 immunogen Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 239000003112 inhibitor Substances 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000001990 intravenous administration Methods 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 125000000959 isobutyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])* 0.000 description 2
- AWJUIBRHMBBTKR-UHFFFAOYSA-N isoquinoline Chemical compound C1=NC=CC2=CC=CC=C21 AWJUIBRHMBBTKR-UHFFFAOYSA-N 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 229940043355 kinase inhibitor Drugs 0.000 description 2
- 229960003881 letrozole Drugs 0.000 description 2
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 2
- 210000004901 leucine-rich repeat Anatomy 0.000 description 2
- 229960001691 leucovorin Drugs 0.000 description 2
- 229950002950 lintuzumab Drugs 0.000 description 2
- XIXADJRWDQXREU-UHFFFAOYSA-M lithium acetate Chemical compound [Li+].CC([O-])=O XIXADJRWDQXREU-UHFFFAOYSA-M 0.000 description 2
- 201000007270 liver cancer Diseases 0.000 description 2
- DHMTURDWPRKSOA-RUZDIDTESA-N lonafarnib Chemical compound C1CN(C(=O)N)CCC1CC(=O)N1CCC([C@@H]2C3=C(Br)C=C(Cl)C=C3CCC3=CC(Br)=CN=C32)CC1 DHMTURDWPRKSOA-RUZDIDTESA-N 0.000 description 2
- 210000004072 lung Anatomy 0.000 description 2
- 230000003211 malignant effect Effects 0.000 description 2
- MQXVYODZCMMZEM-ZYUZMQFOSA-N mannomustine Chemical compound ClCCNC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CNCCCl MQXVYODZCMMZEM-ZYUZMQFOSA-N 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 229960001428 mercaptopurine Drugs 0.000 description 2
- 150000004702 methyl esters Chemical class 0.000 description 2
- BDJAEZRIGNCQBZ-UHFFFAOYSA-N methylcyclobutane Chemical compound CC1CCC1 BDJAEZRIGNCQBZ-UHFFFAOYSA-N 0.000 description 2
- UAEPNZWRGJTJPN-UHFFFAOYSA-N methylcyclohexane Chemical compound CC1CCCCC1 UAEPNZWRGJTJPN-UHFFFAOYSA-N 0.000 description 2
- 125000004170 methylsulfonyl group Chemical group [H]C([H])([H])S(*)(=O)=O 0.000 description 2
- 230000005012 migration Effects 0.000 description 2
- 238000013508 migration Methods 0.000 description 2
- 229950003734 milatuzumab Drugs 0.000 description 2
- 229960001156 mitoxantrone Drugs 0.000 description 2
- 230000004048 modification Effects 0.000 description 2
- 238000012986 modification Methods 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 201000006417 multiple sclerosis Diseases 0.000 description 2
- 125000004108 n-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 2
- 229930014626 natural product Natural products 0.000 description 2
- QZGIWPZCWHMVQL-UIYAJPBUSA-N neocarzinostatin chromophore Chemical compound O1[C@H](C)[C@H](O)[C@H](O)[C@@H](NC)[C@H]1O[C@@H]1C/2=C/C#C[C@H]3O[C@@]3([C@@H]3OC(=O)OC3)C#CC\2=C[C@H]1OC(=O)C1=C(O)C=CC2=C(C)C=C(OC)C=C12 QZGIWPZCWHMVQL-UIYAJPBUSA-N 0.000 description 2
- 229950010203 nimotuzumab Drugs 0.000 description 2
- 125000000018 nitroso group Chemical group N(=O)* 0.000 description 2
- WPHGSKGZRAQSGP-UHFFFAOYSA-N norcarane Chemical compound C1CCCC2CC21 WPHGSKGZRAQSGP-UHFFFAOYSA-N 0.000 description 2
- 238000010899 nucleation Methods 0.000 description 2
- 230000003287 optical effect Effects 0.000 description 2
- 150000002891 organic anions Chemical class 0.000 description 2
- 150000002894 organic compounds Chemical class 0.000 description 2
- 150000002923 oximes Chemical class 0.000 description 2
- 125000000636 p-nitrophenyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1*)[N+]([O-])=O 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- 201000002528 pancreatic cancer Diseases 0.000 description 2
- QNGNSVIICDLXHT-UHFFFAOYSA-N para-ethylbenzaldehyde Natural products CCC1=CC=C(C=O)C=C1 QNGNSVIICDLXHT-UHFFFAOYSA-N 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- YNPNZTXNASCQKK-UHFFFAOYSA-N phenanthrene Chemical compound C1=CC=C2C3=CC=CC=C3C=CC2=C1 YNPNZTXNASCQKK-UHFFFAOYSA-N 0.000 description 2
- RDOWQLZANAYVLL-UHFFFAOYSA-N phenanthridine Chemical compound C1=CC=C2C3=CC=CC=C3C=NC2=C1 RDOWQLZANAYVLL-UHFFFAOYSA-N 0.000 description 2
- 125000000951 phenoxy group Chemical group [H]C1=C([H])C([H])=C(O*)C([H])=C1[H] 0.000 description 2
- 125000000843 phenylene group Chemical group C1(=C(C=CC=C1)*)* 0.000 description 2
- 125000005328 phosphinyl group Chemical group [PH2](=O)* 0.000 description 2
- PTMHPRAIXMAOOB-UHFFFAOYSA-N phosphoramidic acid Chemical group NP(O)(O)=O PTMHPRAIXMAOOB-UHFFFAOYSA-N 0.000 description 2
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 2
- 125000004193 piperazinyl group Chemical group 0.000 description 2
- 238000002600 positron emission tomography Methods 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 229940002612 prodrug Drugs 0.000 description 2
- 239000000651 prodrug Substances 0.000 description 2
- RXWNCPJZOCPEPQ-NVWDDTSBSA-N puromycin Chemical compound C1=CC(OC)=CC=C1C[C@H](N)C(=O)N[C@H]1[C@@H](O)[C@H](N2C3=NC=NC(=C3N=C2)N(C)C)O[C@@H]1CO RXWNCPJZOCPEPQ-NVWDDTSBSA-N 0.000 description 2
- BBEAQIROQSPTKN-UHFFFAOYSA-N pyrene Chemical compound C1=CC=C2C=CC3=CC=CC4=CC=C1C2=C43 BBEAQIROQSPTKN-UHFFFAOYSA-N 0.000 description 2
- 125000004550 quinolin-6-yl group Chemical group N1=CC=CC2=CC(=CC=C12)* 0.000 description 2
- 230000002285 radioactive effect Effects 0.000 description 2
- GZUITABIAKMVPG-UHFFFAOYSA-N raloxifene Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCCC3)=CC=2)C2=CC=C(O)C=C2S1 GZUITABIAKMVPG-UHFFFAOYSA-N 0.000 description 2
- 229960004622 raloxifene Drugs 0.000 description 2
- 238000004007 reversed phase HPLC Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 description 2
- 229960004641 rituximab Drugs 0.000 description 2
- 125000002914 sec-butyl group Chemical group [H]C([H])([H])C([H])([H])C([H])(*)C([H])([H])[H] 0.000 description 2
- 229940095743 selective estrogen receptor modulator Drugs 0.000 description 2
- 239000000333 selective estrogen receptor modulator Substances 0.000 description 2
- CYOHGALHFOKKQC-UHFFFAOYSA-N selumetinib Chemical compound OCCONC(=O)C=1C=C2N(C)C=NC2=C(F)C=1NC1=CC=C(Br)C=C1Cl CYOHGALHFOKKQC-UHFFFAOYSA-N 0.000 description 2
- 238000000926 separation method Methods 0.000 description 2
- 239000000377 silicon dioxide Substances 0.000 description 2
- NDVLTYZPCACLMA-UHFFFAOYSA-N silver oxide Chemical compound [O-2].[Ag+].[Ag+] NDVLTYZPCACLMA-UHFFFAOYSA-N 0.000 description 2
- 238000002603 single-photon emission computed tomography Methods 0.000 description 2
- 208000000587 small cell lung carcinoma Diseases 0.000 description 2
- 235000017557 sodium bicarbonate Nutrition 0.000 description 2
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 2
- 239000008354 sodium chloride injection Substances 0.000 description 2
- AKHNMLFCWUSKQB-UHFFFAOYSA-L sodium thiosulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=S AKHNMLFCWUSKQB-UHFFFAOYSA-L 0.000 description 2
- 235000019345 sodium thiosulphate Nutrition 0.000 description 2
- 229960003787 sorafenib Drugs 0.000 description 2
- 208000017572 squamous cell neoplasm Diseases 0.000 description 2
- 201000011549 stomach cancer Diseases 0.000 description 2
- PVYJZLYGTZKPJE-UHFFFAOYSA-N streptonigrin Chemical compound C=1C=C2C(=O)C(OC)=C(N)C(=O)C2=NC=1C(C=1N)=NC(C(O)=O)=C(C)C=1C1=CC=C(OC)C(OC)=C1O PVYJZLYGTZKPJE-UHFFFAOYSA-N 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- KZNICNPSHKQLFF-UHFFFAOYSA-N succinimide Chemical compound O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 2
- IWOKCMBOJXYDEE-UHFFFAOYSA-N sulfinylmethane Chemical group C=S=O IWOKCMBOJXYDEE-UHFFFAOYSA-N 0.000 description 2
- 125000005420 sulfonamido group Chemical group S(=O)(=O)(N*)* 0.000 description 2
- 125000001273 sulfonato group Chemical group [O-]S(*)(=O)=O 0.000 description 2
- 150000003457 sulfones Chemical class 0.000 description 2
- 208000024891 symptom Diseases 0.000 description 2
- 229960001603 tamoxifen Drugs 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- 150000003568 thioethers Chemical class 0.000 description 2
- 229960001196 thiotepa Drugs 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 206010043778 thyroiditis Diseases 0.000 description 2
- 229960003087 tioguanine Drugs 0.000 description 2
- 229960003989 tocilizumab Drugs 0.000 description 2
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 2
- 229960005267 tositumomab Drugs 0.000 description 2
- 238000011830 transgenic mouse model Methods 0.000 description 2
- 230000005945 translocation Effects 0.000 description 2
- 238000011269 treatment regimen Methods 0.000 description 2
- 229910000404 tripotassium phosphate Inorganic materials 0.000 description 2
- 235000019798 tripotassium phosphate Nutrition 0.000 description 2
- 201000005112 urinary bladder cancer Diseases 0.000 description 2
- 229960005486 vaccine Drugs 0.000 description 2
- 229960000241 vandetanib Drugs 0.000 description 2
- UHTHHESEBZOYNR-UHFFFAOYSA-N vandetanib Chemical compound COC1=CC(C(/N=CN2)=N/C=3C(=CC(Br)=CC=3)F)=C2C=C1OCC1CCN(C)CC1 UHTHHESEBZOYNR-UHFFFAOYSA-N 0.000 description 2
- 235000015112 vegetable and seed oil Nutrition 0.000 description 2
- 239000008158 vegetable oil Substances 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- NNJPGOLRFBJNIW-HNNXBMFYSA-N (-)-demecolcine Chemical compound C1=C(OC)C(=O)C=C2[C@@H](NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-HNNXBMFYSA-N 0.000 description 1
- WDQLRUYAYXDIFW-RWKIJVEZSA-N (2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-4-[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-6-[[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxymethyl]oxan-2-yl]oxy-6-(hydroxymethyl)oxane-2,3,5-triol Chemical compound O[C@@H]1[C@@H](CO)O[C@@H](O)[C@H](O)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO[C@H]2[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O2)O)O1 WDQLRUYAYXDIFW-RWKIJVEZSA-N 0.000 description 1
- NWZSZGALRFJKBT-KNIFDHDWSA-N (2s)-2,6-diaminohexanoic acid;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.NCCCC[C@H](N)C(O)=O NWZSZGALRFJKBT-KNIFDHDWSA-N 0.000 description 1
- SVNJBEMPMKWDCO-KCHLEUMXSA-N (2s)-2-[[(2s)-3-carboxy-2-[[2-[[(2s)-5-(diaminomethylideneamino)-2-[[4-oxo-4-[[4-(4-oxo-8-phenylchromen-2-yl)morpholin-4-ium-4-yl]methoxy]butanoyl]amino]pentanoyl]amino]acetyl]amino]propanoyl]amino]-3-hydroxypropanoate Chemical compound C=1C(=O)C2=CC=CC(C=3C=CC=CC=3)=C2OC=1[N+]1(COC(=O)CCC(=O)N[C@@H](CCCNC(=N)N)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CO)C([O-])=O)CCOCC1 SVNJBEMPMKWDCO-KCHLEUMXSA-N 0.000 description 1
- FLWWDYNPWOSLEO-HQVZTVAUSA-N (2s)-2-[[4-[1-(2-amino-4-oxo-1h-pteridin-6-yl)ethyl-methylamino]benzoyl]amino]pentanedioic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1C(C)N(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FLWWDYNPWOSLEO-HQVZTVAUSA-N 0.000 description 1
- CGMTUJFWROPELF-YPAAEMCBSA-N (3E,5S)-5-[(2S)-butan-2-yl]-3-(1-hydroxyethylidene)pyrrolidine-2,4-dione Chemical compound CC[C@H](C)[C@@H]1NC(=O)\C(=C(/C)O)C1=O CGMTUJFWROPELF-YPAAEMCBSA-N 0.000 description 1
- TVIRNGFXQVMMGB-OFWIHYRESA-N (3s,6r,10r,13e,16s)-16-[(2r,3r,4s)-4-chloro-3-hydroxy-4-phenylbutan-2-yl]-10-[(3-chloro-4-methoxyphenyl)methyl]-6-methyl-3-(2-methylpropyl)-1,4-dioxa-8,11-diazacyclohexadec-13-ene-2,5,9,12-tetrone Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H](O)[C@@H](Cl)C=2C=CC=CC=2)C/C=C/C(=O)N1 TVIRNGFXQVMMGB-OFWIHYRESA-N 0.000 description 1
- VIMMECPCYZXUCI-MIMFYIINSA-N (4s,6r)-6-[(1e)-4,4-bis(4-fluorophenyl)-3-(1-methyltetrazol-5-yl)buta-1,3-dienyl]-4-hydroxyoxan-2-one Chemical compound CN1N=NN=C1C(\C=C\[C@@H]1OC(=O)C[C@@H](O)C1)=C(C=1C=CC(F)=CC=1)C1=CC=C(F)C=C1 VIMMECPCYZXUCI-MIMFYIINSA-N 0.000 description 1
- XRBSKUSTLXISAB-XVVDYKMHSA-N (5r,6r,7r,8r)-8-hydroxy-7-(hydroxymethyl)-5-(3,4,5-trimethoxyphenyl)-5,6,7,8-tetrahydrobenzo[f][1,3]benzodioxole-6-carboxylic acid Chemical compound COC1=C(OC)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@H](O)[C@@H](CO)[C@@H]2C(O)=O)=C1 XRBSKUSTLXISAB-XVVDYKMHSA-N 0.000 description 1
- OMJKFYKNWZZKTK-POHAHGRESA-N (5z)-5-(dimethylaminohydrazinylidene)imidazole-4-carboxamide Chemical compound CN(C)N\N=C1/N=CN=C1C(N)=O OMJKFYKNWZZKTK-POHAHGRESA-N 0.000 description 1
- GZFAVYWCPSMLCM-UHFFFAOYSA-N (6-methoxynaphthalen-2-yl)boronic acid Chemical compound C1=C(B(O)O)C=CC2=CC(OC)=CC=C21 GZFAVYWCPSMLCM-UHFFFAOYSA-N 0.000 description 1
- RWZVMMQNDHPRQD-SFTDATJTSA-N (6as)-3-[3-[[(6as)-2-methoxy-8-methylidene-11-oxo-7,9-dihydro-6ah-pyrrolo[2,1-c][1,4]benzodiazepin-3-yl]oxy]propoxy]-2-methoxy-8-methylidene-7,9-dihydro-6ah-pyrrolo[2,1-c][1,4]benzodiazepin-11-one Chemical compound N1=C[C@@H]2CC(=C)CN2C(=O)C(C=C2OC)=C1C=C2OCCCOC1=CC(N=C[C@H]2N(CC(=C)C2)C2=O)=C2C=C1OC RWZVMMQNDHPRQD-SFTDATJTSA-N 0.000 description 1
- GYUDGZRJHSDPLH-KJQCOJPZSA-N (6as,8e)-8-ethylidene-7,9-dihydro-6ah-pyrrolo[2,1-c][1,4]benzodiazepin-11-one Chemical compound C1=NC2=CC=CC=C2C(=O)N2CC(=C/C)/C[C@H]21 GYUDGZRJHSDPLH-KJQCOJPZSA-N 0.000 description 1
- XRBSKUSTLXISAB-UHFFFAOYSA-N (7R,7'R,8R,8'R)-form-Podophyllic acid Natural products COC1=C(OC)C(OC)=CC(C2C3=CC=4OCOC=4C=C3C(O)C(CO)C2C(O)=O)=C1 XRBSKUSTLXISAB-UHFFFAOYSA-N 0.000 description 1
- AESVUZLWRXEGEX-DKCAWCKPSA-N (7S,9R)-7-[(2S,4R,5R,6R)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7H-tetracene-5,12-dione iron(3+) Chemical compound [Fe+3].COc1cccc2C(=O)c3c(O)c4C[C@@](O)(C[C@H](O[C@@H]5C[C@@H](N)[C@@H](O)[C@@H](C)O5)c4c(O)c3C(=O)c12)C(=O)CO AESVUZLWRXEGEX-DKCAWCKPSA-N 0.000 description 1
- JXVAMODRWBNUSF-KZQKBALLSA-N (7s,9r,10r)-7-[(2r,4s,5s,6s)-5-[[(2s,4as,5as,7s,9s,9ar,10ar)-2,9-dimethyl-3-oxo-4,4a,5a,6,7,9,9a,10a-octahydrodipyrano[4,2-a:4',3'-e][1,4]dioxin-7-yl]oxy]-4-(dimethylamino)-6-methyloxan-2-yl]oxy-10-[(2s,4s,5s,6s)-4-(dimethylamino)-5-hydroxy-6-methyloxan-2 Chemical compound O([C@@H]1C2=C(O)C=3C(=O)C4=CC=CC(O)=C4C(=O)C=3C(O)=C2[C@@H](O[C@@H]2O[C@@H](C)[C@@H](O[C@@H]3O[C@@H](C)[C@H]4O[C@@H]5O[C@@H](C)C(=O)C[C@@H]5O[C@H]4C3)[C@H](C2)N(C)C)C[C@]1(O)CC)[C@H]1C[C@H](N(C)C)[C@H](O)[C@H](C)O1 JXVAMODRWBNUSF-KZQKBALLSA-N 0.000 description 1
- INAUWOVKEZHHDM-PEDBPRJASA-N (7s,9s)-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-7-[(2r,4s,5s,6s)-5-hydroxy-6-methyl-4-morpholin-4-yloxan-2-yl]oxy-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1 INAUWOVKEZHHDM-PEDBPRJASA-N 0.000 description 1
- RCFNNLSZHVHCEK-IMHLAKCZSA-N (7s,9s)-7-(4-amino-6-methyloxan-2-yl)oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound [Cl-].O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)C1CC([NH3+])CC(C)O1 RCFNNLSZHVHCEK-IMHLAKCZSA-N 0.000 description 1
- NOPNWHSMQOXAEI-PUCKCBAPSA-N (7s,9s)-7-[(2r,4s,5s,6s)-4-(2,3-dihydropyrrol-1-yl)-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCC=C1 NOPNWHSMQOXAEI-PUCKCBAPSA-N 0.000 description 1
- DIPVWSTVQDONTF-NUAZBEIESA-N (8E)-2-[(2S,3R,4R,5R,6S)-3,4-dihydroxy-6-methyl-5-(methylamino)oxan-2-yl]oxy-6-methoxy-8-propylidene-6,6a,7,9-tetrahydro-5H-pyrrolo[2,1-c][1,4]benzodiazepin-11-one Chemical compound CC\C=C1/CC2C(Nc3ccc(O[C@@H]4O[C@@H](C)[C@H](NC)[C@@H](O)[C@H]4O)cc3C(=O)N2C1)OC DIPVWSTVQDONTF-NUAZBEIESA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- IEXUMDBQLIVNHZ-YOUGDJEHSA-N (8s,11r,13r,14s,17s)-11-[4-(dimethylamino)phenyl]-17-hydroxy-17-(3-hydroxypropyl)-13-methyl-1,2,6,7,8,11,12,14,15,16-decahydrocyclopenta[a]phenanthren-3-one Chemical compound C1=CC(N(C)C)=CC=C1[C@@H]1C2=C3CCC(=O)C=C3CC[C@H]2[C@H](CC[C@]2(O)CCCO)[C@@]2(C)C1 IEXUMDBQLIVNHZ-YOUGDJEHSA-N 0.000 description 1
- JEZZKSQFJNWDCY-NSIKDUERSA-N (8z)-2-[3,4-dihydroxy-4,6-dimethyl-5-(methylamino)oxan-2-yl]oxy-8-propylidene-7,9-dihydro-6ah-pyrrolo[2,1-c][1,4]benzodiazepin-11-one Chemical compound C1=C2C(=O)N3CC(=C/CC)\CC3C=NC2=CC=C1OC1OC(C)C(NC)C(C)(O)C1O JEZZKSQFJNWDCY-NSIKDUERSA-N 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- AGNGYMCLFWQVGX-AGFFZDDWSA-N (e)-1-[(2s)-2-amino-2-carboxyethoxy]-2-diazonioethenolate Chemical compound OC(=O)[C@@H](N)CO\C([O-])=C\[N+]#N AGNGYMCLFWQVGX-AGFFZDDWSA-N 0.000 description 1
- VMOHRPRQENZZPX-GQCTYLIASA-N (e)-3-(4,6-dihydroxy-3-methyl-11-oxo-5,6,6a,9-tetrahydropyrrolo[2,1-c][1,4]benzodiazepin-8-yl)-n-methylprop-2-enamide Chemical compound OC1NC2=C(O)C(C)=CC=C2C(=O)N2CC(/C=C/C(=O)NC)=CC21 VMOHRPRQENZZPX-GQCTYLIASA-N 0.000 description 1
- OQMYRVPMCIOFHL-GCOHUWJYSA-N (e)-3-[(6r)-6-hydroxy-4-methoxy-11-oxo-5,6,6a,7-tetrahydropyrrolo[2,1-c][1,4]benzodiazepin-8-yl]-n,n-dimethylprop-2-enamide Chemical compound N1[C@H](O)C2CC(\C=C\C(=O)N(C)C)=CN2C(=O)C2=C1C(OC)=CC=C2 OQMYRVPMCIOFHL-GCOHUWJYSA-N 0.000 description 1
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- OFZYBEBWCZBCPM-UHFFFAOYSA-N 1,1-dimethylcyclobutane Chemical compound CC1(C)CCC1 OFZYBEBWCZBCPM-UHFFFAOYSA-N 0.000 description 1
- PBIJFSCPEFQXBB-UHFFFAOYSA-N 1,1-dimethylcyclopropane Chemical compound CC1(C)CC1 PBIJFSCPEFQXBB-UHFFFAOYSA-N 0.000 description 1
- FNQJDLTXOVEEFB-UHFFFAOYSA-N 1,2,3-benzothiadiazole Chemical compound C1=CC=C2SN=NC2=C1 FNQJDLTXOVEEFB-UHFFFAOYSA-N 0.000 description 1
- JYEUMXHLPRZUAT-UHFFFAOYSA-N 1,2,3-triazine Chemical compound C1=CN=NN=C1 JYEUMXHLPRZUAT-UHFFFAOYSA-N 0.000 description 1
- PUAKTHBSHFXVAG-UHFFFAOYSA-N 1,2-dimethylcyclobutene Chemical compound CC1=C(C)CC1 PUAKTHBSHFXVAG-UHFFFAOYSA-N 0.000 description 1
- SZZWLAZADBEDQP-UHFFFAOYSA-N 1,2-dimethylcyclopentene Chemical compound CC1=C(C)CCC1 SZZWLAZADBEDQP-UHFFFAOYSA-N 0.000 description 1
- CIISBYKBBMFLEZ-UHFFFAOYSA-N 1,2-oxazolidine Chemical compound C1CNOC1 CIISBYKBBMFLEZ-UHFFFAOYSA-N 0.000 description 1
- BGJSXRVXTHVRSN-UHFFFAOYSA-N 1,3,5-trioxane Chemical compound C1OCOCO1 BGJSXRVXTHVRSN-UHFFFAOYSA-N 0.000 description 1
- FTNJQNQLEGKTGD-UHFFFAOYSA-N 1,3-benzodioxole Chemical compound C1=CC=C2OCOC2=C1 FTNJQNQLEGKTGD-UHFFFAOYSA-N 0.000 description 1
- BCMCBBGGLRIHSE-UHFFFAOYSA-N 1,3-benzoxazole Chemical compound C1=CC=C2OC=NC2=C1 BCMCBBGGLRIHSE-UHFFFAOYSA-N 0.000 description 1
- FONKWHRXTPJODV-DNQXCXABSA-N 1,3-bis[2-[(8s)-8-(chloromethyl)-4-hydroxy-1-methyl-7,8-dihydro-3h-pyrrolo[3,2-e]indole-6-carbonyl]-1h-indol-5-yl]urea Chemical compound C1([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C4=CC(O)=C5NC=C(C5=C4[C@H](CCl)C3)C)=C2C=C(O)C2=C1C(C)=CN2 FONKWHRXTPJODV-DNQXCXABSA-N 0.000 description 1
- OGYGFUAIIOPWQD-UHFFFAOYSA-N 1,3-thiazolidine Chemical compound C1CSCN1 OGYGFUAIIOPWQD-UHFFFAOYSA-N 0.000 description 1
- YNGDWRXWKFWCJY-UHFFFAOYSA-N 1,4-Dihydropyridine Chemical compound C1C=CNC=C1 YNGDWRXWKFWCJY-UHFFFAOYSA-N 0.000 description 1
- VMLKTERJLVWEJJ-UHFFFAOYSA-N 1,5-naphthyridine Chemical compound C1=CC=NC2=CC=CN=C21 VMLKTERJLVWEJJ-UHFFFAOYSA-N 0.000 description 1
- FLBAYUMRQUHISI-UHFFFAOYSA-N 1,8-naphthyridine Chemical compound N1=CC=CC2=CC=CN=C21 FLBAYUMRQUHISI-UHFFFAOYSA-N 0.000 description 1
- MYBLAOJMRYYKMS-RTRLPJTCSA-N 1-(2-chloroethyl)-1-nitroso-3-[(3r,4r,5s,6r)-2,4,5-trihydroxy-6-(hydroxymethyl)oxan-3-yl]urea Chemical compound OC[C@H]1OC(O)[C@H](NC(=O)N(CCCl)N=O)[C@@H](O)[C@@H]1O MYBLAOJMRYYKMS-RTRLPJTCSA-N 0.000 description 1
- ZGEGCLOFRBLKSE-UHFFFAOYSA-N 1-Heptene Chemical group CCCCCC=C ZGEGCLOFRBLKSE-UHFFFAOYSA-N 0.000 description 1
- TUSDEZXZIZRFGC-UHFFFAOYSA-N 1-O-galloyl-3,6-(R)-HHDP-beta-D-glucose Natural products OC1C(O2)COC(=O)C3=CC(O)=C(O)C(O)=C3C3=C(O)C(O)=C(O)C=C3C(=O)OC1C(O)C2OC(=O)C1=CC(O)=C(O)C(O)=C1 TUSDEZXZIZRFGC-UHFFFAOYSA-N 0.000 description 1
- MUPYMRJBEZFVMT-UHFFFAOYSA-N 1-chloro-4-dimethoxyphosphorylsulfanylbenzene Chemical compound COP(=O)(OC)SC1=CC=C(Cl)C=C1 MUPYMRJBEZFVMT-UHFFFAOYSA-N 0.000 description 1
- AVPHQXWAMGTQPF-UHFFFAOYSA-N 1-methylcyclobutene Chemical compound CC1=CCC1 AVPHQXWAMGTQPF-UHFFFAOYSA-N 0.000 description 1
- ATQUFXWBVZUTKO-UHFFFAOYSA-N 1-methylcyclopentene Chemical compound CC1=CCCC1 ATQUFXWBVZUTKO-UHFFFAOYSA-N 0.000 description 1
- SHDPRTQPPWIEJG-UHFFFAOYSA-N 1-methylcyclopropene Chemical compound CC1=CC1 SHDPRTQPPWIEJG-UHFFFAOYSA-N 0.000 description 1
- NFGXHKASABOEEW-UHFFFAOYSA-N 1-methylethyl 11-methoxy-3,7,11-trimethyl-2,4-dodecadienoate Chemical group COC(C)(C)CCCC(C)CC=CC(C)=CC(=O)OC(C)C NFGXHKASABOEEW-UHFFFAOYSA-N 0.000 description 1
- 125000006017 1-propenyl group Chemical group 0.000 description 1
- WJFKNYWRSNBZNX-UHFFFAOYSA-N 10H-phenothiazine Chemical compound C1=CC=C2NC3=CC=CC=C3SC2=C1 WJFKNYWRSNBZNX-UHFFFAOYSA-N 0.000 description 1
- TZMSYXZUNZXBOL-UHFFFAOYSA-N 10H-phenoxazine Chemical compound C1=CC=C2NC3=CC=CC=C3OC2=C1 TZMSYXZUNZXBOL-UHFFFAOYSA-N 0.000 description 1
- HYZJCKYKOHLVJF-UHFFFAOYSA-N 1H-benzimidazole Chemical compound C1=CC=C2NC=NC2=C1 HYZJCKYKOHLVJF-UHFFFAOYSA-N 0.000 description 1
- BAXOFTOLAUCFNW-UHFFFAOYSA-N 1H-indazole Chemical compound C1=CC=C2C=NNC2=C1 BAXOFTOLAUCFNW-UHFFFAOYSA-N 0.000 description 1
- MFJCPDOGFAYSTF-UHFFFAOYSA-N 1H-isochromene Chemical compound C1=CC=C2COC=CC2=C1 MFJCPDOGFAYSTF-UHFFFAOYSA-N 0.000 description 1
- AAQTWLBJPNLKHT-UHFFFAOYSA-N 1H-perimidine Chemical compound N1C=NC2=CC=CC3=CC=CC1=C32 AAQTWLBJPNLKHT-UHFFFAOYSA-N 0.000 description 1
- IEMAOEFPZAIMCN-UHFFFAOYSA-N 1H-pyrazole Chemical compound C=1C=NNC=1.C=1C=NNC=1 IEMAOEFPZAIMCN-UHFFFAOYSA-N 0.000 description 1
- MREIFUWKYMNYTK-UHFFFAOYSA-N 1H-pyrrole Chemical compound C=1C=CNC=1.C=1C=CNC=1 MREIFUWKYMNYTK-UHFFFAOYSA-N 0.000 description 1
- HUEXNHSMABCRTH-UHFFFAOYSA-N 1h-imidazole Chemical compound C1=CNC=N1.C1=CNC=N1 HUEXNHSMABCRTH-UHFFFAOYSA-N 0.000 description 1
- AWBOSXFRPFZLOP-UHFFFAOYSA-N 2,1,3-benzoxadiazole Chemical compound C1=CC=CC2=NON=C21 AWBOSXFRPFZLOP-UHFFFAOYSA-N 0.000 description 1
- BTOTXLJHDSNXMW-POYBYMJQSA-N 2,3-dideoxyuridine Chemical compound O1[C@H](CO)CC[C@@H]1N1C(=O)NC(=O)C=C1 BTOTXLJHDSNXMW-POYBYMJQSA-N 0.000 description 1
- FJRPOHLDJUJARI-UHFFFAOYSA-N 2,3-dihydro-1,2-oxazole Chemical compound C1NOC=C1 FJRPOHLDJUJARI-UHFFFAOYSA-N 0.000 description 1
- ZABMHLDQFJHDSC-UHFFFAOYSA-N 2,3-dihydro-1,3-oxazole Chemical compound C1NC=CO1 ZABMHLDQFJHDSC-UHFFFAOYSA-N 0.000 description 1
- FLNPFFMWAPTGOT-UHFFFAOYSA-N 2,3-dihydro-1h-pyrazole Chemical compound C1NNC=C1.C1NNC=C1 FLNPFFMWAPTGOT-UHFFFAOYSA-N 0.000 description 1
- JKTCBAGSMQIFNL-UHFFFAOYSA-N 2,3-dihydrofuran Chemical compound C1CC=CO1 JKTCBAGSMQIFNL-UHFFFAOYSA-N 0.000 description 1
- GPWNWKWQOLEVEQ-UHFFFAOYSA-N 2,4-diaminopyrimidine-5-carbaldehyde Chemical compound NC1=NC=C(C=O)C(N)=N1 GPWNWKWQOLEVEQ-UHFFFAOYSA-N 0.000 description 1
- BOMZMNZEXMAQQW-UHFFFAOYSA-N 2,5,11-trimethyl-6h-pyrido[4,3-b]carbazol-2-ium-9-ol;acetate Chemical compound CC([O-])=O.C[N+]1=CC=C2C(C)=C(NC=3C4=CC(O)=CC=3)C4=C(C)C2=C1 BOMZMNZEXMAQQW-UHFFFAOYSA-N 0.000 description 1
- QCXJFISCRQIYID-IAEPZHFASA-N 2-amino-1-n-[(3s,6s,7r,10s,16s)-3-[(2s)-butan-2-yl]-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-10-propan-2-yl-8-oxa-1,4,11,14-tetrazabicyclo[14.3.0]nonadecan-6-yl]-4,6-dimethyl-3-oxo-9-n-[(3s,6s,7r,10s,16s)-7,11,14-trimethyl-2,5,9,12,15-pentaoxo-3,10-di(propa Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N=C2C(C(=O)N[C@@H]3C(=O)N[C@H](C(N4CCC[C@H]4C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]3C)=O)[C@@H](C)CC)=C(N)C(=O)C(C)=C2O2)C2=C(C)C=C1 QCXJFISCRQIYID-IAEPZHFASA-N 0.000 description 1
- QINPEPAQOBZPOF-UHFFFAOYSA-N 2-amino-n-[3-[[3-(2-chloro-5-methoxyanilino)quinoxalin-2-yl]sulfamoyl]phenyl]-2-methylpropanamide Chemical compound COC1=CC=C(Cl)C(NC=2C(=NC3=CC=CC=C3N=2)NS(=O)(=O)C=2C=C(NC(=O)C(C)(C)N)C=CC=2)=C1 QINPEPAQOBZPOF-UHFFFAOYSA-N 0.000 description 1
- UXGVMFHEKMGWMA-UHFFFAOYSA-N 2-benzofuran Chemical compound C1=CC=CC2=COC=C21 UXGVMFHEKMGWMA-UHFFFAOYSA-N 0.000 description 1
- VNBAOSVONFJBKP-UHFFFAOYSA-N 2-chloro-n,n-bis(2-chloroethyl)propan-1-amine;hydrochloride Chemical compound Cl.CC(Cl)CN(CCCl)CCCl VNBAOSVONFJBKP-UHFFFAOYSA-N 0.000 description 1
- 125000004182 2-chlorophenyl group Chemical group [H]C1=C([H])C(Cl)=C(*)C([H])=C1[H] 0.000 description 1
- 125000002941 2-furyl group Chemical group O1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- NEAQRZUHTPSBBM-UHFFFAOYSA-N 2-hydroxy-3,3-dimethyl-7-nitro-4h-isoquinolin-1-one Chemical compound C1=C([N+]([O-])=O)C=C2C(=O)N(O)C(C)(C)CC2=C1 NEAQRZUHTPSBBM-UHFFFAOYSA-N 0.000 description 1
- UPHOPMSGKZNELG-UHFFFAOYSA-N 2-hydroxynaphthalene-1-carboxylic acid Chemical compound C1=CC=C2C(C(=O)O)=C(O)C=CC2=C1 UPHOPMSGKZNELG-UHFFFAOYSA-N 0.000 description 1
- XWKFPIODWVPXLX-UHFFFAOYSA-N 2-methyl-5-methylpyridine Natural products CC1=CC=C(C)N=C1 XWKFPIODWVPXLX-UHFFFAOYSA-N 0.000 description 1
- 229940080296 2-naphthalenesulfonate Drugs 0.000 description 1
- SLAMLWHELXOEJZ-UHFFFAOYSA-N 2-nitrobenzoic acid Chemical compound OC(=O)C1=CC=CC=C1[N+]([O-])=O SLAMLWHELXOEJZ-UHFFFAOYSA-N 0.000 description 1
- VSWICNJIUPRZIK-UHFFFAOYSA-N 2-piperideine Chemical compound C1CNC=CC1 VSWICNJIUPRZIK-UHFFFAOYSA-N 0.000 description 1
- RSEBUVRVKCANEP-UHFFFAOYSA-N 2-pyrroline Chemical compound C1CC=CN1 RSEBUVRVKCANEP-UHFFFAOYSA-N 0.000 description 1
- 125000000175 2-thienyl group Chemical group S1C([*])=C([H])C([H])=C1[H] 0.000 description 1
- BQTJMKIHKULPCZ-UHFFFAOYSA-N 2H-indene Chemical compound C1=CC=CC2=CCC=C21 BQTJMKIHKULPCZ-UHFFFAOYSA-N 0.000 description 1
- VHMICKWLTGFITH-UHFFFAOYSA-N 2H-isoindole Chemical compound C1=CC=CC2=CNC=C21 VHMICKWLTGFITH-UHFFFAOYSA-N 0.000 description 1
- MGADZUXDNSDTHW-UHFFFAOYSA-N 2H-pyran Chemical compound C1OC=CC=C1 MGADZUXDNSDTHW-UHFFFAOYSA-N 0.000 description 1
- CMLFRMDBDNHMRA-UHFFFAOYSA-N 2h-1,2-benzoxazine Chemical compound C1=CC=C2C=CNOC2=C1 CMLFRMDBDNHMRA-UHFFFAOYSA-N 0.000 description 1
- QMEQBOSUJUOXMX-UHFFFAOYSA-N 2h-oxadiazine Chemical compound N1OC=CC=N1 QMEQBOSUJUOXMX-UHFFFAOYSA-N 0.000 description 1
- BCHZICNRHXRCHY-UHFFFAOYSA-N 2h-oxazine Chemical compound N1OC=CC=C1 BCHZICNRHXRCHY-UHFFFAOYSA-N 0.000 description 1
- YIMDLWDNDGKDTJ-QLKYHASDSA-N 3'-deamino-3'-(3-cyanomorpholin-4-yl)doxorubicin Chemical compound N1([C@H]2C[C@@H](O[C@@H](C)[C@H]2O)O[C@H]2C[C@@](O)(CC=3C(O)=C4C(=O)C=5C=CC=C(C=5C(=O)C4=C(O)C=32)OC)C(=O)CO)CCOCC1C#N YIMDLWDNDGKDTJ-QLKYHASDSA-N 0.000 description 1
- NTIGNJOEVBTPJJ-UHFFFAOYSA-N 3,3-dibromopentane Chemical compound CCC(Br)(Br)CC NTIGNJOEVBTPJJ-UHFFFAOYSA-N 0.000 description 1
- PCYGLFXKCBFGPC-UHFFFAOYSA-N 3,4-Dihydroxy hydroxymethyl benzene Natural products OCC1=CC=C(O)C(O)=C1 PCYGLFXKCBFGPC-UHFFFAOYSA-N 0.000 description 1
- BOLMDIXLULGTBD-UHFFFAOYSA-N 3,4-dihydro-2h-oxazine Chemical compound C1CC=CON1 BOLMDIXLULGTBD-UHFFFAOYSA-N 0.000 description 1
- NDMPLJNOPCLANR-UHFFFAOYSA-N 3,4-dihydroxy-15-(4-hydroxy-18-methoxycarbonyl-5,18-seco-ibogamin-18-yl)-16-methoxy-1-methyl-6,7-didehydro-aspidospermidine-3-carboxylic acid methyl ester Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 NDMPLJNOPCLANR-UHFFFAOYSA-N 0.000 description 1
- FXMOIYLVKOALHC-UHFFFAOYSA-N 3,9-dihydroxy-2-methoxy-6a,7,8,9-tetrahydropyrrolo[2,1-c][1,4]benzodiazepin-11-one Chemical class N1=CC2CCC(O)N2C(=O)C2=C1C=C(O)C(OC)=C2 FXMOIYLVKOALHC-UHFFFAOYSA-N 0.000 description 1
- PWMYMKOUNYTVQN-UHFFFAOYSA-N 3-(8,8-diethyl-2-aza-8-germaspiro[4.5]decan-2-yl)-n,n-dimethylpropan-1-amine Chemical compound C1C[Ge](CC)(CC)CCC11CN(CCCN(C)C)CC1 PWMYMKOUNYTVQN-UHFFFAOYSA-N 0.000 description 1
- IWCQHVUQEFDRIW-UHFFFAOYSA-N 3-[1-[[4-(6-phenyl-8H-imidazo[4,5-g]quinoxalin-7-yl)phenyl]methyl]piperidin-4-yl]-1H-benzimidazol-2-one Chemical compound O=c1[nH]c2ccccc2n1C1CCN(Cc2ccc(cc2)-c2[nH]c3cc4ncnc4cc3nc2-c2ccccc2)CC1 IWCQHVUQEFDRIW-UHFFFAOYSA-N 0.000 description 1
- VNEOHNUYPRAJMX-UHFFFAOYSA-N 3-[[2-[[2-amino-3-(1h-indol-3-yl)propanoyl]amino]-4-methylpentanoyl]amino]-4-[[1-(butoxycarbonylamino)-1-oxo-3-phenylpropan-2-yl]amino]-4-oxobutanoic acid Chemical compound C=1NC2=CC=CC=C2C=1CC(N)C(=O)NC(CC(C)C)C(=O)NC(CC(O)=O)C(=O)NC(C(=O)NC(=O)OCCCC)CC1=CC=CC=C1 VNEOHNUYPRAJMX-UHFFFAOYSA-N 0.000 description 1
- PBVAJRFEEOIAGW-UHFFFAOYSA-N 3-[bis(2-carboxyethyl)phosphanyl]propanoic acid;hydrochloride Chemical compound Cl.OC(=O)CCP(CCC(O)=O)CCC(O)=O PBVAJRFEEOIAGW-UHFFFAOYSA-N 0.000 description 1
- 125000004179 3-chlorophenyl group Chemical group [H]C1=C([H])C(*)=C([H])C(Cl)=C1[H] 0.000 description 1
- 101710147124 3-galactosyl-N-acetylglucosaminide 4-alpha-L-fucosyltransferase FUT3 Proteins 0.000 description 1
- 125000004207 3-methoxyphenyl group Chemical group [H]C1=C([H])C(*)=C([H])C(OC([H])([H])[H])=C1[H] 0.000 description 1
- 125000001541 3-thienyl group Chemical group S1C([H])=C([*])C([H])=C1[H] 0.000 description 1
- VXIKDBJPBRMXBP-UHFFFAOYSA-N 3H-pyrrole Chemical compound C1C=CN=C1 VXIKDBJPBRMXBP-UHFFFAOYSA-N 0.000 description 1
- RELAJOWOFXGXHI-UHFFFAOYSA-N 3h-oxathiole Chemical compound C1SOC=C1 RELAJOWOFXGXHI-UHFFFAOYSA-N 0.000 description 1
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 1
- ZBWXZZIIMVVCNZ-UHFFFAOYSA-N 4,5-dihydroacephenanthrylene Chemical compound C1=CC(CC2)=C3C2=CC2=CC=CC=C2C3=C1 ZBWXZZIIMVVCNZ-UHFFFAOYSA-N 0.000 description 1
- GMOGICAFJFPMNS-UHFFFAOYSA-N 4-(1,4,8,11-tetrazacyclotetradec-1-ylmethyl)benzoic acid Chemical compound C1=CC(C(=O)O)=CC=C1CN1CCNCCCNCCNCCC1 GMOGICAFJFPMNS-UHFFFAOYSA-N 0.000 description 1
- CLPFFLWZZBQMAO-UHFFFAOYSA-N 4-(5,6,7,8-tetrahydroimidazo[1,5-a]pyridin-5-yl)benzonitrile Chemical compound C1=CC(C#N)=CC=C1C1N2C=NC=C2CCC1 CLPFFLWZZBQMAO-UHFFFAOYSA-N 0.000 description 1
- DODQJNMQWMSYGS-QPLCGJKRSA-N 4-[(z)-1-[4-[2-(dimethylamino)ethoxy]phenyl]-1-phenylbut-1-en-2-yl]phenol Chemical compound C=1C=C(O)C=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 DODQJNMQWMSYGS-QPLCGJKRSA-N 0.000 description 1
- GYBIIPYAGCDLOT-UHFFFAOYSA-N 4-[5-(4-carboxy-5-nitro-2-phenylmethoxyphenoxy)pentoxy]-5-methoxy-2-nitrobenzoic acid Chemical compound COC1=CC(C(O)=O)=C([N+]([O-])=O)C=C1OCCCCCOC1=CC([N+]([O-])=O)=C(C(O)=O)C=C1OCC1=CC=CC=C1 GYBIIPYAGCDLOT-UHFFFAOYSA-N 0.000 description 1
- QCQCHGYLTSGIGX-GHXANHINSA-N 4-[[(3ar,5ar,5br,7ar,9s,11ar,11br,13as)-5a,5b,8,8,11a-pentamethyl-3a-[(5-methylpyridine-3-carbonyl)amino]-2-oxo-1-propan-2-yl-4,5,6,7,7a,9,10,11,11b,12,13,13a-dodecahydro-3h-cyclopenta[a]chrysen-9-yl]oxy]-2,2-dimethyl-4-oxobutanoic acid Chemical compound N([C@@]12CC[C@@]3(C)[C@]4(C)CC[C@H]5C(C)(C)[C@@H](OC(=O)CC(C)(C)C(O)=O)CC[C@]5(C)[C@H]4CC[C@@H]3C1=C(C(C2)=O)C(C)C)C(=O)C1=CN=CC(C)=C1 QCQCHGYLTSGIGX-GHXANHINSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- 125000004801 4-cyanophenyl group Chemical group [H]C1=C([H])C(C#N)=C([H])C([H])=C1* 0.000 description 1
- MBVFRSJFKMJRHA-UHFFFAOYSA-N 4-fluoro-1-benzofuran-7-carbaldehyde Chemical compound FC1=CC=C(C=O)C2=C1C=CO2 MBVFRSJFKMJRHA-UHFFFAOYSA-N 0.000 description 1
- 125000001255 4-fluorophenyl group Chemical group [H]C1=C([H])C(*)=C([H])C([H])=C1F 0.000 description 1
- 125000004172 4-methoxyphenyl group Chemical group [H]C1=C([H])C(OC([H])([H])[H])=C([H])C([H])=C1* 0.000 description 1
- 125000006418 4-methylphenylsulfonyl group Chemical group 0.000 description 1
- GDRVFDDBLLKWRI-UHFFFAOYSA-N 4H-quinolizine Chemical compound C1=CC=CN2CC=CC=C21 GDRVFDDBLLKWRI-UHFFFAOYSA-N 0.000 description 1
- BBEQQKBWUHCIOU-UHFFFAOYSA-N 5-(dimethylamino)-1-naphthalenesulfonic acid(dansyl acid) Chemical compound C1=CC=C2C(N(C)C)=CC=CC2=C1S(O)(=O)=O BBEQQKBWUHCIOU-UHFFFAOYSA-N 0.000 description 1
- IDPUKCWIGUEADI-UHFFFAOYSA-N 5-[bis(2-chloroethyl)amino]uracil Chemical compound ClCCN(CCCl)C1=CNC(=O)NC1=O IDPUKCWIGUEADI-UHFFFAOYSA-N 0.000 description 1
- NMUSYJAQQFHJEW-KVTDHHQDSA-N 5-azacytidine Chemical compound O=C1N=C(N)N=CN1[C@H]1[C@H](O)[C@H](O)[C@@H](CO)O1 NMUSYJAQQFHJEW-KVTDHHQDSA-N 0.000 description 1
- MCNGFYXMIRHJEO-UHFFFAOYSA-N 5-methylpyrazolo[1,5-a]pyrimidin-7-amine Chemical compound N1=C(C)C=C(N)N2N=CC=C21 MCNGFYXMIRHJEO-UHFFFAOYSA-N 0.000 description 1
- WYXSYVWAUAUWLD-SHUUEZRQSA-N 6-azauridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=N1 WYXSYVWAUAUWLD-SHUUEZRQSA-N 0.000 description 1
- 229960005538 6-diazo-5-oxo-L-norleucine Drugs 0.000 description 1
- YCWQAMGASJSUIP-YFKPBYRVSA-N 6-diazo-5-oxo-L-norleucine Chemical compound OC(=O)[C@@H](N)CCC(=O)C=[N+]=[N-] YCWQAMGASJSUIP-YFKPBYRVSA-N 0.000 description 1
- NJBMMMJOXRZENQ-UHFFFAOYSA-N 6H-pyrrolo[2,3-f]quinoline Chemical compound c1cc2ccc3[nH]cccc3c2n1 NJBMMMJOXRZENQ-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- ZGXJTSGNIOSYLO-UHFFFAOYSA-N 88755TAZ87 Chemical compound NCC(=O)CCC(O)=O ZGXJTSGNIOSYLO-UHFFFAOYSA-N 0.000 description 1
- PQJUJGAVDBINPI-UHFFFAOYSA-N 9H-thioxanthene Chemical compound C1=CC=C2CC3=CC=CC=C3SC2=C1 PQJUJGAVDBINPI-UHFFFAOYSA-N 0.000 description 1
- GJCOSYZMQJWQCA-UHFFFAOYSA-N 9H-xanthene Chemical compound C1=CC=C2CC3=CC=CC=C3OC2=C1 GJCOSYZMQJWQCA-UHFFFAOYSA-N 0.000 description 1
- HDZZVAMISRMYHH-UHFFFAOYSA-N 9beta-Ribofuranosyl-7-deazaadenin Natural products C1=CC=2C(N)=NC=NC=2N1C1OC(CO)C(O)C1O HDZZVAMISRMYHH-UHFFFAOYSA-N 0.000 description 1
- 108010005465 AC133 Antigen Proteins 0.000 description 1
- 102000005908 AC133 Antigen Human genes 0.000 description 1
- 230000035502 ADME Effects 0.000 description 1
- 208000030507 AIDS Diseases 0.000 description 1
- 239000005964 Acibenzolar-S-methyl Substances 0.000 description 1
- 208000026872 Addison Disease Diseases 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- CEIZFXOZIQNICU-UHFFFAOYSA-N Alternaria alternata Crofton-weed toxin Natural products CCC(C)C1NC(=O)C(C(C)=O)=C1O CEIZFXOZIQNICU-UHFFFAOYSA-N 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 206010061424 Anal cancer Diseases 0.000 description 1
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 101001005269 Arabidopsis thaliana Ceramide synthase 1 LOH3 Proteins 0.000 description 1
- 101001005312 Arabidopsis thaliana Ceramide synthase LOH1 Proteins 0.000 description 1
- 101100067974 Arabidopsis thaliana POP2 gene Proteins 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- BFYIZQONLCFLEV-DAELLWKTSA-N Aromasine Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(C(CC4)=O)[C@@H]4[C@@H]3CC(=C)C2=C1 BFYIZQONLCFLEV-DAELLWKTSA-N 0.000 description 1
- 102000014654 Aromatase Human genes 0.000 description 1
- 108010078554 Aromatase Proteins 0.000 description 1
- 241001133287 Artocarpus hirsutus Species 0.000 description 1
- 206010003827 Autoimmune hepatitis Diseases 0.000 description 1
- 230000024704 B cell apoptotic process Effects 0.000 description 1
- 108020003591 B-Form DNA Proteins 0.000 description 1
- 102100027205 B-cell antigen receptor complex-associated protein alpha chain Human genes 0.000 description 1
- 101710166261 B-cell antigen receptor complex-associated protein beta chain Proteins 0.000 description 1
- 230000003844 B-cell-activation Effects 0.000 description 1
- 108050001413 B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 208000009137 Behcet syndrome Diseases 0.000 description 1
- VGGGPCQERPFHOB-MCIONIFRSA-N Bestatin Chemical compound CC(C)C[C@H](C(O)=O)NC(=O)[C@@H](O)[C@H](N)CC1=CC=CC=C1 VGGGPCQERPFHOB-MCIONIFRSA-N 0.000 description 1
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 description 1
- 208000033222 Biliary cirrhosis primary Diseases 0.000 description 1
- 229940122361 Bisphosphonate Drugs 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 208000019838 Blood disease Diseases 0.000 description 1
- 102000007350 Bone Morphogenetic Proteins Human genes 0.000 description 1
- 108010007726 Bone Morphogenetic Proteins Proteins 0.000 description 1
- 208000020084 Bone disease Diseases 0.000 description 1
- 208000003174 Brain Neoplasms Diseases 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000026310 Breast neoplasm Diseases 0.000 description 1
- 101710140080 Brevican core protein Proteins 0.000 description 1
- MBABCNBNDNGODA-LTGLSHGVSA-N Bullatacin Natural products O=C1C(C[C@H](O)CCCCCCCCCC[C@@H](O)[C@@H]2O[C@@H]([C@@H]3O[C@H]([C@@H](O)CCCCCCCCCC)CC3)CC2)=C[C@H](C)O1 MBABCNBNDNGODA-LTGLSHGVSA-N 0.000 description 1
- KGGVWMAPBXIMEM-ZRTAFWODSA-N Bullatacinone Chemical compound O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@@H]1[C@@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@H]2OC(=O)[C@H](CC(C)=O)C2)CC1 KGGVWMAPBXIMEM-ZRTAFWODSA-N 0.000 description 1
- KGGVWMAPBXIMEM-JQFCFGFHSA-N Bullatacinone Natural products O=C(C[C@H]1C(=O)O[C@H](CCCCCCCCCC[C@H](O)[C@@H]2O[C@@H]([C@@H]3O[C@@H]([C@@H](O)CCCCCCCCCC)CC3)CC2)C1)C KGGVWMAPBXIMEM-JQFCFGFHSA-N 0.000 description 1
- 208000011691 Burkitt lymphomas Diseases 0.000 description 1
- 101710124023 C-type lectin domain family 14 member A Proteins 0.000 description 1
- 101710112758 CAMPATH-1 antigen Proteins 0.000 description 1
- 108091016585 CD44 antigen Proteins 0.000 description 1
- 102000013135 CD52 Antigen Human genes 0.000 description 1
- 101710130444 CD70 antigen Proteins 0.000 description 1
- 101150089397 CEG1 gene Proteins 0.000 description 1
- 101100180402 Caenorhabditis elegans jun-1 gene Proteins 0.000 description 1
- 101100294106 Caenorhabditis elegans nhr-3 gene Proteins 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 241000282836 Camelus dromedarius Species 0.000 description 1
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical group [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- SHHKQEUPHAENFK-UHFFFAOYSA-N Carboquone Chemical compound O=C1C(C)=C(N2CC2)C(=O)C(C(COC(N)=O)OC)=C1N1CC1 SHHKQEUPHAENFK-UHFFFAOYSA-N 0.000 description 1
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 1
- 241000399988 Carinoma Species 0.000 description 1
- AOCCBINRVIKJHY-UHFFFAOYSA-N Carmofur Chemical compound CCCCCCNC(=O)N1C=C(F)C(=O)NC1=O AOCCBINRVIKJHY-UHFFFAOYSA-N 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 102000011727 Caspases Human genes 0.000 description 1
- 108010076667 Caspases Proteins 0.000 description 1
- 102000053642 Catalytic RNA Human genes 0.000 description 1
- 108090000994 Catalytic RNA Proteins 0.000 description 1
- 102000004225 Cathepsin B Human genes 0.000 description 1
- 108090000712 Cathepsin B Proteins 0.000 description 1
- 241000700199 Cavia porcellus Species 0.000 description 1
- 102000016289 Cell Adhesion Molecules Human genes 0.000 description 1
- 108010067225 Cell Adhesion Molecules Proteins 0.000 description 1
- 238000003734 CellTiter-Glo Luminescent Cell Viability Assay Methods 0.000 description 1
- 102100025828 Centromere protein C Human genes 0.000 description 1
- 206010008342 Cervix carcinoma Diseases 0.000 description 1
- 108091006146 Channels Proteins 0.000 description 1
- 102000006574 Chemokine CXCL13 Human genes 0.000 description 1
- 108010008955 Chemokine CXCL13 Proteins 0.000 description 1
- 229930184471 Chicamycin Natural products 0.000 description 1
- 101100004180 Chironomus tentans BR3 gene Proteins 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- ZAMOUSCENKQFHK-UHFFFAOYSA-N Chlorine atom Chemical group [Cl] ZAMOUSCENKQFHK-UHFFFAOYSA-N 0.000 description 1
- XCDXSSFOJZZGQC-UHFFFAOYSA-N Chlornaphazine Chemical compound C1=CC=CC2=CC(N(CCCl)CCCl)=CC=C21 XCDXSSFOJZZGQC-UHFFFAOYSA-N 0.000 description 1
- 206010008609 Cholangitis sclerosing Diseases 0.000 description 1
- 208000006344 Churg-Strauss Syndrome Diseases 0.000 description 1
- 208000015943 Coeliac disease Diseases 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 102100030886 Complement receptor type 1 Human genes 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- 241000699800 Cricetinae Species 0.000 description 1
- 208000011231 Crohn disease Diseases 0.000 description 1
- 229930188224 Cryptophycin Natural products 0.000 description 1
- 108010069514 Cyclic Peptides Proteins 0.000 description 1
- 102000001189 Cyclic Peptides Human genes 0.000 description 1
- PMPVIKIVABFJJI-UHFFFAOYSA-N Cyclobutane Chemical compound C1CCC1 PMPVIKIVABFJJI-UHFFFAOYSA-N 0.000 description 1
- XDTMQSROBMDMFD-UHFFFAOYSA-N Cyclohexane Chemical compound C1CCCCC1 XDTMQSROBMDMFD-UHFFFAOYSA-N 0.000 description 1
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 1
- LVZWSLJZHVFIQJ-UHFFFAOYSA-N Cyclopropane Chemical compound C1CC1 LVZWSLJZHVFIQJ-UHFFFAOYSA-N 0.000 description 1
- WQZGKKKJIJFFOK-CBPJZXOFSA-N D-Gulose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@H](O)[C@H]1O WQZGKKKJIJFFOK-CBPJZXOFSA-N 0.000 description 1
- IGXWBGJHJZYPQS-SSDOTTSWSA-N D-Luciferin Chemical compound OC(=O)[C@H]1CSC(C=2SC3=CC=C(O)C=C3N=2)=N1 IGXWBGJHJZYPQS-SSDOTTSWSA-N 0.000 description 1
- WQZGKKKJIJFFOK-WHZQZERISA-N D-aldose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-WHZQZERISA-N 0.000 description 1
- WQZGKKKJIJFFOK-IVMDWMLBSA-N D-allopyranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@H](O)[C@@H]1O WQZGKKKJIJFFOK-IVMDWMLBSA-N 0.000 description 1
- HMFHBZSHGGEWLO-AGQMPKSLSA-N D-lyxofuranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@H]1O HMFHBZSHGGEWLO-AGQMPKSLSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- WEAHRLBPCANXCN-UHFFFAOYSA-N Daunomycin Natural products CCC1(O)CC(OC2CC(N)C(O)C(C)O2)c3cc4C(=O)c5c(OC)cccc5C(=O)c4c(O)c3C1 WEAHRLBPCANXCN-UHFFFAOYSA-N 0.000 description 1
- 206010011878 Deafness Diseases 0.000 description 1
- CYCGRDQQIOGCKX-UHFFFAOYSA-N Dehydro-luciferin Natural products OC(=O)C1=CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 CYCGRDQQIOGCKX-UHFFFAOYSA-N 0.000 description 1
- NNJPGOLRFBJNIW-UHFFFAOYSA-N Demecolcine Natural products C1=C(OC)C(=O)C=C2C(NC)CCC3=CC(OC)=C(OC)C(OC)=C3C2=C1 NNJPGOLRFBJNIW-UHFFFAOYSA-N 0.000 description 1
- 108010002156 Depsipeptides Proteins 0.000 description 1
- AUGQEEXBDZWUJY-ZLJUKNTDSA-N Diacetoxyscirpenol Chemical compound C([C@]12[C@]3(C)[C@H](OC(C)=O)[C@@H](O)[C@H]1O[C@@H]1C=C(C)CC[C@@]13COC(=O)C)O2 AUGQEEXBDZWUJY-ZLJUKNTDSA-N 0.000 description 1
- AUGQEEXBDZWUJY-UHFFFAOYSA-N Diacetoxyscirpenol Natural products CC(=O)OCC12CCC(C)=CC1OC1C(O)C(OC(C)=O)C2(C)C11CO1 AUGQEEXBDZWUJY-UHFFFAOYSA-N 0.000 description 1
- 102100037981 Dickkopf-like protein 1 Human genes 0.000 description 1
- 101710125833 Dickkopf-like protein 1 Proteins 0.000 description 1
- XBPCUCUWBYBCDP-UHFFFAOYSA-N Dicyclohexylamine Chemical compound C1CCCCC1NC1CCCCC1 XBPCUCUWBYBCDP-UHFFFAOYSA-N 0.000 description 1
- XTAHYROJKCXMOF-UHFFFAOYSA-N Dihydroaceanthrylene Chemical compound C1=CC=C2C(CCC3=CC=C4)=C3C4=CC2=C1 XTAHYROJKCXMOF-UHFFFAOYSA-N 0.000 description 1
- BUDQDWGNQVEFAC-UHFFFAOYSA-N Dihydropyran Chemical compound C1COC=CC1 BUDQDWGNQVEFAC-UHFFFAOYSA-N 0.000 description 1
- LCGLNKUTAGEVQW-UHFFFAOYSA-N Dimethyl ether Chemical compound COC LCGLNKUTAGEVQW-UHFFFAOYSA-N 0.000 description 1
- ZQZFYGIXNQKOAV-OCEACIFDSA-N Droloxifene Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=C(O)C=CC=1)\C1=CC=C(OCCN(C)C)C=C1 ZQZFYGIXNQKOAV-OCEACIFDSA-N 0.000 description 1
- 229930193152 Dynemicin Natural products 0.000 description 1
- 102100026245 E3 ubiquitin-protein ligase RNF43 Human genes 0.000 description 1
- 102000012545 EGF-like domains Human genes 0.000 description 1
- 108050002150 EGF-like domains Proteins 0.000 description 1
- 239000004150 EU approved colour Substances 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 208000017701 Endocrine disease Diseases 0.000 description 1
- 102000012085 Endoglin Human genes 0.000 description 1
- 206010014733 Endometrial cancer Diseases 0.000 description 1
- 206010014759 Endometrial neoplasm Diseases 0.000 description 1
- 102000002045 Endothelin Human genes 0.000 description 1
- 108050009340 Endothelin Proteins 0.000 description 1
- AFMYMMXSQGUCBK-UHFFFAOYSA-N Endynamicin A Natural products C1#CC=CC#CC2NC(C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C3)=C3C34OC32C(C)C(C(O)=O)=C(OC)C41 AFMYMMXSQGUCBK-UHFFFAOYSA-N 0.000 description 1
- 241000854350 Enicospilus group Species 0.000 description 1
- SAMRUMKYXPVKPA-VFKOLLTISA-N Enocitabine Chemical compound O=C1N=C(NC(=O)CCCCCCCCCCCCCCCCCCCCC)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 SAMRUMKYXPVKPA-VFKOLLTISA-N 0.000 description 1
- 208000018428 Eosinophilic granulomatosis with polyangiitis Diseases 0.000 description 1
- 206010014982 Epidermal and dermal conditions Diseases 0.000 description 1
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 1
- OBMLHUPNRURLOK-XGRAFVIBSA-N Epitiostanol Chemical compound C1[C@@H]2S[C@@H]2C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@H]21 OBMLHUPNRURLOK-XGRAFVIBSA-N 0.000 description 1
- 102000056372 ErbB-3 Receptor Human genes 0.000 description 1
- 229930189413 Esperamicin Natural products 0.000 description 1
- JOYRKODLDBILNP-UHFFFAOYSA-N Ethyl urethane Chemical compound CCOC(N)=O JOYRKODLDBILNP-UHFFFAOYSA-N 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- PIICEJLVQHRZGT-UHFFFAOYSA-N Ethylenediamine Chemical compound NCCN PIICEJLVQHRZGT-UHFFFAOYSA-N 0.000 description 1
- 244000166102 Eucalyptus leucoxylon Species 0.000 description 1
- 235000004694 Eucalyptus leucoxylon Nutrition 0.000 description 1
- 241000289695 Eutheria Species 0.000 description 1
- 108010007457 Extracellular Signal-Regulated MAP Kinases Proteins 0.000 description 1
- 239000001263 FEMA 3042 Substances 0.000 description 1
- 108091008794 FGF receptors Proteins 0.000 description 1
- 108010087819 Fc receptors Proteins 0.000 description 1
- 102000009109 Fc receptors Human genes 0.000 description 1
- 241000282324 Felis Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 description 1
- 108090000331 Firefly luciferases Proteins 0.000 description 1
- BJGNCJDXODQBOB-UHFFFAOYSA-N Fivefly Luciferin Natural products OC(=O)C1CSC(C=2SC3=CC(O)=CC=C3N=2)=N1 BJGNCJDXODQBOB-UHFFFAOYSA-N 0.000 description 1
- PXGOKWXKJXAPGV-UHFFFAOYSA-N Fluorine Chemical group FF PXGOKWXKJXAPGV-UHFFFAOYSA-N 0.000 description 1
- MPJKWIXIYCLVCU-UHFFFAOYSA-N Folinic acid Natural products NC1=NC2=C(N(C=O)C(CNc3ccc(cc3)C(=O)NC(CCC(=O)O)CC(=O)O)CN2)C(=O)N1 MPJKWIXIYCLVCU-UHFFFAOYSA-N 0.000 description 1
- 244000182067 Fraxinus ornus Species 0.000 description 1
- 101710186842 Fucosyltransferase 3 Proteins 0.000 description 1
- VWUXBMIQPBEWFH-WCCTWKNTSA-N Fulvestrant Chemical compound OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3[C@H](CCCCCCCCCS(=O)CCCC(F)(F)C(F)(F)F)CC2=C1 VWUXBMIQPBEWFH-WCCTWKNTSA-N 0.000 description 1
- 102000003688 G-Protein-Coupled Receptors Human genes 0.000 description 1
- 108090000045 G-Protein-Coupled Receptors Proteins 0.000 description 1
- 201000003741 Gastrointestinal carcinoma Diseases 0.000 description 1
- 208000018522 Gastrointestinal disease Diseases 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- 102000003958 Glutamate Carboxypeptidase II Human genes 0.000 description 1
- 208000024869 Goodpasture syndrome Diseases 0.000 description 1
- 241000282575 Gorilla Species 0.000 description 1
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 description 1
- 108091008603 HGF receptors Proteins 0.000 description 1
- 208000031886 HIV Infections Diseases 0.000 description 1
- 101710119866 HLA class II histocompatibility antigen gamma chain Proteins 0.000 description 1
- 102100029966 HLA class II histocompatibility antigen, DP alpha 1 chain Human genes 0.000 description 1
- 208000016621 Hearing disease Diseases 0.000 description 1
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 description 1
- 102000008055 Heparan Sulfate Proteoglycans Human genes 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- 102100038009 High affinity immunoglobulin epsilon receptor subunit beta Human genes 0.000 description 1
- 102100028999 High mobility group protein HMGI-C Human genes 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000914489 Homo sapiens B-cell antigen receptor complex-associated protein alpha chain Proteins 0.000 description 1
- 101000914491 Homo sapiens B-cell antigen receptor complex-associated protein beta chain Proteins 0.000 description 1
- 101000731086 Homo sapiens Brevican core protein Proteins 0.000 description 1
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 1
- 101000914241 Homo sapiens Centromere protein C Proteins 0.000 description 1
- 101000727061 Homo sapiens Complement receptor type 1 Proteins 0.000 description 1
- 101000927579 Homo sapiens D-dopachrome decarboxylase Proteins 0.000 description 1
- 101100223941 Homo sapiens DKK1 gene Proteins 0.000 description 1
- 101000932213 Homo sapiens Dipeptidase 1 Proteins 0.000 description 1
- 101000692702 Homo sapiens E3 ubiquitin-protein ligase RNF43 Proteins 0.000 description 1
- 101100118549 Homo sapiens EGFR gene Proteins 0.000 description 1
- 101001010541 Homo sapiens Electron transfer flavoprotein subunit alpha, mitochondrial Proteins 0.000 description 1
- 101000899240 Homo sapiens Endoplasmic reticulum chaperone BiP Proteins 0.000 description 1
- 101100119857 Homo sapiens FCRL2 gene Proteins 0.000 description 1
- 101100227587 Homo sapiens FOLH1 gene Proteins 0.000 description 1
- 101100391538 Homo sapiens FUT3 gene Proteins 0.000 description 1
- 101000935587 Homo sapiens Flavin reductase (NADPH) Proteins 0.000 description 1
- 101001058904 Homo sapiens Gamma-tubulin complex component 2 Proteins 0.000 description 1
- 101001014636 Homo sapiens Golgin subfamily A member 4 Proteins 0.000 description 1
- 101000864089 Homo sapiens HLA class II histocompatibility antigen, DP alpha 1 chain Proteins 0.000 description 1
- 101000930802 Homo sapiens HLA class II histocompatibility antigen, DQ alpha 1 chain Proteins 0.000 description 1
- 101000968032 Homo sapiens HLA class II histocompatibility antigen, DR beta 3 chain Proteins 0.000 description 1
- 101000878594 Homo sapiens High affinity immunoglobulin epsilon receptor subunit beta Proteins 0.000 description 1
- 101000986379 Homo sapiens High mobility group protein HMGI-C Proteins 0.000 description 1
- 101001044893 Homo sapiens Interleukin-20 receptor subunit alpha Proteins 0.000 description 1
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 description 1
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 description 1
- 101000576802 Homo sapiens Mesothelin Proteins 0.000 description 1
- 101000604168 Homo sapiens Neuromedin-B Proteins 0.000 description 1
- 101001024605 Homo sapiens Next to BRCA1 gene 1 protein Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 101000883798 Homo sapiens Probable ATP-dependent RNA helicase DDX53 Proteins 0.000 description 1
- 101000831286 Homo sapiens Protein timeless homolog Proteins 0.000 description 1
- 101001010819 Homo sapiens Receptor tyrosine-protein kinase erbB-3 Proteins 0.000 description 1
- 101000752245 Homo sapiens Rho guanine nucleotide exchange factor 5 Proteins 0.000 description 1
- 101100425948 Homo sapiens TNFRSF13C gene Proteins 0.000 description 1
- 101000610640 Homo sapiens U4/U6 small nuclear ribonucleoprotein Prp3 Proteins 0.000 description 1
- LELOWRISYMNNSU-UHFFFAOYSA-N Hydrocyanic acid Natural products N#C LELOWRISYMNNSU-UHFFFAOYSA-N 0.000 description 1
- VSNHCAURESNICA-UHFFFAOYSA-N Hydroxyurea Chemical compound NC(=O)NO VSNHCAURESNICA-UHFFFAOYSA-N 0.000 description 1
- 241000282620 Hylobates sp. Species 0.000 description 1
- 206010020853 Hypertonic bladder Diseases 0.000 description 1
- WQZGKKKJIJFFOK-YIDFTEPTSA-N IDOSE Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@H](O)[C@H]1O WQZGKKKJIJFFOK-YIDFTEPTSA-N 0.000 description 1
- MPBVHIBUJCELCL-UHFFFAOYSA-N Ibandronate Chemical compound CCCCCN(C)CCC(O)(P(O)(O)=O)P(O)(O)=O MPBVHIBUJCELCL-UHFFFAOYSA-N 0.000 description 1
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 1
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 1
- 208000010159 IgA glomerulonephritis Diseases 0.000 description 1
- 206010021263 IgA nephropathy Diseases 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- WRYCSMQKUKOKBP-UHFFFAOYSA-N Imidazolidine Chemical compound C1CNCN1 WRYCSMQKUKOKBP-UHFFFAOYSA-N 0.000 description 1
- 102000009786 Immunoglobulin Constant Regions Human genes 0.000 description 1
- 108010009817 Immunoglobulin Constant Regions Proteins 0.000 description 1
- 208000022559 Inflammatory bowel disease Diseases 0.000 description 1
- 208000027601 Inner ear disease Diseases 0.000 description 1
- 108010047852 Integrin alphaVbeta3 Proteins 0.000 description 1
- 102100022706 Interleukin-20 receptor subunit alpha Human genes 0.000 description 1
- 102000004310 Ion Channels Human genes 0.000 description 1
- 108090000862 Ion Channels Proteins 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- WQZGKKKJIJFFOK-VSOAQEOCSA-N L-altropyranose Chemical compound OC[C@@H]1OC(O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-VSOAQEOCSA-N 0.000 description 1
- HMFHBZSHGGEWLO-HWQSCIPKSA-N L-arabinofuranose Chemical compound OC[C@@H]1OC(O)[C@H](O)[C@H]1O HMFHBZSHGGEWLO-HWQSCIPKSA-N 0.000 description 1
- RHGKLRLOHDJJDR-BYPYZUCNSA-N L-citrulline Chemical group NC(=O)NCCC[C@H]([NH3+])C([O-])=O RHGKLRLOHDJJDR-BYPYZUCNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 239000005411 L01XE02 - Gefitinib Substances 0.000 description 1
- 239000005551 L01XE03 - Erlotinib Substances 0.000 description 1
- 239000002147 L01XE04 - Sunitinib Substances 0.000 description 1
- 239000005511 L01XE05 - Sorafenib Substances 0.000 description 1
- 239000002136 L01XE07 - Lapatinib Substances 0.000 description 1
- 239000003798 L01XE11 - Pazopanib Substances 0.000 description 1
- 239000002118 L01XE12 - Vandetanib Substances 0.000 description 1
- JLERVPBPJHKRBJ-UHFFFAOYSA-N LY 117018 Chemical compound C1=CC(O)=CC=C1C1=C(C(=O)C=2C=CC(OCCN3CCCC3)=CC=2)C2=CC=C(O)C=C2S1 JLERVPBPJHKRBJ-UHFFFAOYSA-N 0.000 description 1
- 208000017119 Labyrinth disease Diseases 0.000 description 1
- 241000283953 Lagomorpha Species 0.000 description 1
- XNRVGTHNYCNCFF-UHFFFAOYSA-N Lapatinib ditosylate monohydrate Chemical compound O.CC1=CC=C(S(O)(=O)=O)C=C1.CC1=CC=C(S(O)(=O)=O)C=C1.O1C(CNCCS(=O)(=O)C)=CC=C1C1=CC=C(N=CN=C2NC=3C=C(Cl)C(OCC=4C=C(F)C=CC=4)=CC=3)C2=C1 XNRVGTHNYCNCFF-UHFFFAOYSA-N 0.000 description 1
- 101710197063 Lectin-3 Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 229920001491 Lentinan Polymers 0.000 description 1
- 208000035036 Lethal congenital contracture syndrome type 2 Diseases 0.000 description 1
- 101710146560 Leukocyte antigen CD37 Proteins 0.000 description 1
- 108010000817 Leuprolide Proteins 0.000 description 1
- 102000004086 Ligand-Gated Ion Channels Human genes 0.000 description 1
- 108090000543 Ligand-Gated Ion Channels Proteins 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- GQYIWUVLTXOXAJ-UHFFFAOYSA-N Lomustine Chemical compound ClCCN(N=O)C(=O)NC1CCCCC1 GQYIWUVLTXOXAJ-UHFFFAOYSA-N 0.000 description 1
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 description 1
- DDWFXDSYGUXRAY-UHFFFAOYSA-N Luciferin Natural products CCc1c(C)c(CC2NC(=O)C(=C2C=C)C)[nH]c1Cc3[nH]c4C(=C5/NC(CC(=O)O)C(C)C5CC(=O)O)CC(=O)c4c3C DDWFXDSYGUXRAY-UHFFFAOYSA-N 0.000 description 1
- 108010074338 Lymphokines Proteins 0.000 description 1
- 102000008072 Lymphokines Human genes 0.000 description 1
- 101000929342 Lytechinus pictus Actin, cytoskeletal 1 Proteins 0.000 description 1
- 241000289581 Macropus sp. Species 0.000 description 1
- 101710141347 Major envelope glycoprotein Proteins 0.000 description 1
- VJRAUFKOOPNFIQ-UHFFFAOYSA-N Marcellomycin Natural products C12=C(O)C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C=C2C(C(=O)OC)C(CC)(O)CC1OC(OC1C)CC(N(C)C)C1OC(OC1C)CC(O)C1OC1CC(O)C(O)C(C)O1 VJRAUFKOOPNFIQ-UHFFFAOYSA-N 0.000 description 1
- 229930126263 Maytansine Natural products 0.000 description 1
- 229930184247 Mazethramycin Natural products 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- IVDYZAAPOLNZKG-KWHRADDSSA-N Mepitiostane Chemical compound O([C@@H]1[C@]2(CC[C@@H]3[C@@]4(C)C[C@H]5S[C@H]5C[C@@H]4CC[C@H]3[C@@H]2CC1)C)C1(OC)CCCC1 IVDYZAAPOLNZKG-KWHRADDSSA-N 0.000 description 1
- 102100025096 Mesothelin Human genes 0.000 description 1
- 101710147242 Metalloreductase STEAP2 Proteins 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-M Methanesulfonate Chemical compound CS([O-])(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-M 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 108090000192 Methionyl aminopeptidases Proteins 0.000 description 1
- VFKZTMPDYBFSTM-KVTDHHQDSA-N Mitobronitol Chemical compound BrC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-KVTDHHQDSA-N 0.000 description 1
- 229930192392 Mitomycin Natural products 0.000 description 1
- HRHKSTOGXBBQCB-UHFFFAOYSA-N Mitomycin E Natural products O=C1C(N)=C(C)C(=O)C2=C1C(COC(N)=O)C1(OC)C3N(C)C3CN12 HRHKSTOGXBBQCB-UHFFFAOYSA-N 0.000 description 1
- 241000289390 Monotremata Species 0.000 description 1
- 241000699660 Mus musculus Species 0.000 description 1
- 101000623899 Mus musculus Mucin-13 Proteins 0.000 description 1
- 101000866339 Mus musculus Transcription factor E2F6 Proteins 0.000 description 1
- 101000904718 Mus musculus Transmembrane glycoprotein NMB Proteins 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 101710147545 Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- OVBPIULPVIDEAO-UHFFFAOYSA-N N-Pteroyl-L-glutaminsaeure Natural products C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(O)=O)C(O)=O)C=C1 OVBPIULPVIDEAO-UHFFFAOYSA-N 0.000 description 1
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 1
- MBBZMMPHUWSWHV-BDVNFPICSA-N N-methylglucamine Chemical compound CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO MBBZMMPHUWSWHV-BDVNFPICSA-N 0.000 description 1
- RHGKLRLOHDJJDR-UHFFFAOYSA-N Ndelta-carbamoyl-DL-ornithine Natural products OC(=O)C(N)CCCNC(N)=O RHGKLRLOHDJJDR-UHFFFAOYSA-N 0.000 description 1
- 208000012902 Nervous system disease Diseases 0.000 description 1
- 102100023616 Neural cell adhesion molecule L1-like protein Human genes 0.000 description 1
- 102400000058 Neuregulin-1 Human genes 0.000 description 1
- 108090000556 Neuregulin-1 Proteins 0.000 description 1
- 208000025966 Neurological disease Diseases 0.000 description 1
- GRYLNZFGIOXLOG-UHFFFAOYSA-N Nitric acid Chemical compound O[N+]([O-])=O GRYLNZFGIOXLOG-UHFFFAOYSA-N 0.000 description 1
- SYNHCENRCUAUNM-UHFFFAOYSA-N Nitrogen mustard N-oxide hydrochloride Chemical compound Cl.ClCC[N+]([O-])(C)CCCl SYNHCENRCUAUNM-UHFFFAOYSA-N 0.000 description 1
- KGTDRFCXGRULNK-UHFFFAOYSA-N Nogalamycin Natural products COC1C(OC)(C)C(OC)C(C)OC1OC1C2=C(O)C(C(=O)C3=C(O)C=C4C5(C)OC(C(C(C5O)N(C)C)O)OC4=C3C3=O)=C3C=C2C(C(=O)OC)C(C)(O)C1 KGTDRFCXGRULNK-UHFFFAOYSA-N 0.000 description 1
- 229930187135 Olivomycin Natural products 0.000 description 1
- 208000005225 Opsoclonus-Myoclonus Syndrome Diseases 0.000 description 1
- 241000289371 Ornithorhynchus anatinus Species 0.000 description 1
- 101710160107 Outer membrane protein A Proteins 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- ZCQWOFVYLHDMMC-UHFFFAOYSA-N Oxazole Chemical compound C1=COC=N1 ZCQWOFVYLHDMMC-UHFFFAOYSA-N 0.000 description 1
- WYNCHZVNFNFDNH-UHFFFAOYSA-N Oxazolidine Chemical compound C1COCN1 WYNCHZVNFNFDNH-UHFFFAOYSA-N 0.000 description 1
- SUDAHWBOROXANE-SECBINFHSA-N PD 0325901 Chemical compound OC[C@@H](O)CONC(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1F SUDAHWBOROXANE-SECBINFHSA-N 0.000 description 1
- SUDAHWBOROXANE-VIFPVBQESA-N PD 0325901-Cl Chemical compound OC[C@H](O)CONC(=O)C1=CC=C(F)C(F)=C1NC1=CC=C(I)C=C1F SUDAHWBOROXANE-VIFPVBQESA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 102100035593 POU domain, class 2, transcription factor 1 Human genes 0.000 description 1
- 101710084414 POU domain, class 2, transcription factor 1 Proteins 0.000 description 1
- 102100026459 POU domain, class 3, transcription factor 2 Human genes 0.000 description 1
- 101710133394 POU domain, class 3, transcription factor 2 Proteins 0.000 description 1
- 241000282577 Pan troglodytes Species 0.000 description 1
- VREZDOWOLGNDPW-ALTGWBOUSA-N Pancratistatin Chemical compound C1=C2[C@H]3[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)[C@@H]3NC(=O)C2=C(O)C2=C1OCO2 VREZDOWOLGNDPW-ALTGWBOUSA-N 0.000 description 1
- VREZDOWOLGNDPW-MYVCAWNPSA-N Pancratistatin Natural products O=C1N[C@H]2[C@H](O)[C@H](O)[C@H](O)[C@H](O)[C@@H]2c2c1c(O)c1OCOc1c2 VREZDOWOLGNDPW-MYVCAWNPSA-N 0.000 description 1
- 241001504519 Papio ursinus Species 0.000 description 1
- 208000018737 Parkinson disease Diseases 0.000 description 1
- NFHFRUOZVGFOOS-UHFFFAOYSA-N Pd(PPh3)4 Substances [Pd].C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1.C1=CC=CC=C1P(C=1C=CC=CC=1)C1=CC=CC=C1 NFHFRUOZVGFOOS-UHFFFAOYSA-N 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 206010034277 Pemphigoid Diseases 0.000 description 1
- 201000011152 Pemphigus Diseases 0.000 description 1
- LRBQNJMCXXYXIU-PPKXGCFTSA-N Penta-digallate-beta-D-glucose Natural products OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-PPKXGCFTSA-N 0.000 description 1
- 108010057150 Peplomycin Proteins 0.000 description 1
- 241000577979 Peromyscus spicilegus Species 0.000 description 1
- 206010057249 Phagocytosis Diseases 0.000 description 1
- 108010092528 Phosphate Transport Proteins Proteins 0.000 description 1
- 102000016462 Phosphate Transport Proteins Human genes 0.000 description 1
- 108010030678 Phosphatidylethanolamine N-Methyltransferase Proteins 0.000 description 1
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 1
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 1
- KMSKQZKKOZQFFG-HSUXVGOQSA-N Pirarubicin Chemical compound O([C@H]1[C@@H](N)C[C@@H](O[C@H]1C)O[C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1CCCCO1 KMSKQZKKOZQFFG-HSUXVGOQSA-N 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 206010036105 Polyneuropathy Diseases 0.000 description 1
- 229930187104 Porothramycin Natural products 0.000 description 1
- HFVNWDWLWUCIHC-GUPDPFMOSA-N Prednimustine Chemical compound O=C([C@@]1(O)CC[C@H]2[C@H]3[C@@H]([C@]4(C=CC(=O)C=C4CC3)C)[C@@H](O)C[C@@]21C)COC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 HFVNWDWLWUCIHC-GUPDPFMOSA-N 0.000 description 1
- 208000012654 Primary biliary cholangitis Diseases 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 102100033237 Pro-epidermal growth factor Human genes 0.000 description 1
- 102100038236 Probable ATP-dependent RNA helicase DDX53 Human genes 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 1
- 101710129873 Prolyl endopeptidase FAP Proteins 0.000 description 1
- 101710120463 Prostate stem cell antigen Proteins 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 102100024924 Protein kinase C alpha type Human genes 0.000 description 1
- 101710109947 Protein kinase C alpha type Proteins 0.000 description 1
- 102000016611 Proteoglycans Human genes 0.000 description 1
- 108010067787 Proteoglycans Proteins 0.000 description 1
- GYUDGZRJHSDPLH-UHFFFAOYSA-N Prothracarcin Natural products C1=NC2=CC=CC=C2C(=O)N2CC(=CC)CC21 GYUDGZRJHSDPLH-UHFFFAOYSA-N 0.000 description 1
- 201000001263 Psoriatic Arthritis Diseases 0.000 description 1
- 208000036824 Psoriatic arthropathy Diseases 0.000 description 1
- 241000567363 Puccinellia maritima Species 0.000 description 1
- 108010080192 Purinergic Receptors Proteins 0.000 description 1
- 101710126089 Putative inactive carbonic anhydrase 5B-like protein Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 101001039269 Rattus norvegicus Glycine N-methyltransferase Proteins 0.000 description 1
- 208000003782 Raynaud disease Diseases 0.000 description 1
- 208000012322 Raynaud phenomenon Diseases 0.000 description 1
- 102000004278 Receptor Protein-Tyrosine Kinases Human genes 0.000 description 1
- 108090000873 Receptor Protein-Tyrosine Kinases Proteins 0.000 description 1
- 208000015634 Rectal Neoplasms Diseases 0.000 description 1
- 208000025747 Rheumatic disease Diseases 0.000 description 1
- OWPCHSCAPHNHAV-UHFFFAOYSA-N Rhizoxin Natural products C1C(O)C2(C)OC2C=CC(C)C(OC(=O)C2)CC2CC2OC2C(=O)OC1C(C)C(OC)C(C)=CC=CC(C)=CC1=COC(C)=N1 OWPCHSCAPHNHAV-UHFFFAOYSA-N 0.000 description 1
- NSFWWJIQIKBZMJ-YKNYLIOZSA-N Roridin A Chemical compound C([C@]12[C@]3(C)[C@H]4C[C@H]1O[C@@H]1C=C(C)CC[C@@]13COC(=O)[C@@H](O)[C@H](C)CCO[C@H](\C=C\C=C/C(=O)O4)[C@H](O)C)O2 NSFWWJIQIKBZMJ-YKNYLIOZSA-N 0.000 description 1
- GNSXDDLDAGAXTL-UHFFFAOYSA-N S1OCCCC1.O1SCCCC1 Chemical compound S1OCCCC1.O1SCCCC1 GNSXDDLDAGAXTL-UHFFFAOYSA-N 0.000 description 1
- 102000014400 SH2 domains Human genes 0.000 description 1
- 108050003452 SH2 domains Proteins 0.000 description 1
- 108050003189 SH2B adapter protein 1 Proteins 0.000 description 1
- 101710083287 SLAM family member 7 Proteins 0.000 description 1
- 101001110823 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 60S ribosomal protein L6-A Proteins 0.000 description 1
- 101000712176 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) 60S ribosomal protein L6-B Proteins 0.000 description 1
- 101100123851 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) HER1 gene Proteins 0.000 description 1
- 206010061934 Salivary gland cancer Diseases 0.000 description 1
- 206010039710 Scleroderma Diseases 0.000 description 1
- 102000009203 Sema domains Human genes 0.000 description 1
- 108050000099 Sema domains Proteins 0.000 description 1
- 102000014105 Semaphorin Human genes 0.000 description 1
- 108050003978 Semaphorin Proteins 0.000 description 1
- 101710199399 Semaphorin-5B Proteins 0.000 description 1
- 108010029180 Sialic Acid Binding Ig-like Lectin 3 Proteins 0.000 description 1
- JEZZKSQFJNWDCY-UHFFFAOYSA-N Sibanomicin Natural products C1=C2C(=O)N3CC(=CCC)CC3C=NC2=CC=C1OC1OC(C)C(NC)C(C)(O)C1O JEZZKSQFJNWDCY-UHFFFAOYSA-N 0.000 description 1
- 229920000519 Sizofiran Polymers 0.000 description 1
- KEAYESYHFKHZAL-UHFFFAOYSA-N Sodium Chemical compound [Na] KEAYESYHFKHZAL-UHFFFAOYSA-N 0.000 description 1
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 1
- 239000004133 Sodium thiosulphate Substances 0.000 description 1
- 229940124269 Somatostatin receptor 2 agonist Drugs 0.000 description 1
- 101710192613 Somatostatin receptor type 2 Proteins 0.000 description 1
- 101710192646 Somatostatin receptor type 5 Proteins 0.000 description 1
- 101000668858 Spinacia oleracea 30S ribosomal protein S1, chloroplastic Proteins 0.000 description 1
- 231100000632 Spindle poison Toxicity 0.000 description 1
- 101100523267 Staphylococcus aureus qacC gene Proteins 0.000 description 1
- 101000898746 Streptomyces clavuligerus Clavaminate synthase 1 Proteins 0.000 description 1
- UCKMPCXJQFINFW-UHFFFAOYSA-N Sulphide Chemical compound [S-2] UCKMPCXJQFINFW-UHFFFAOYSA-N 0.000 description 1
- 108050006774 Syndecan Proteins 0.000 description 1
- 102000003705 Syndecan-1 Human genes 0.000 description 1
- 108090000054 Syndecan-2 Proteins 0.000 description 1
- BXFOFFBJRFZBQZ-QYWOHJEZSA-N T-2 toxin Chemical compound C([C@@]12[C@]3(C)[C@H](OC(C)=O)[C@@H](O)[C@H]1O[C@H]1[C@]3(COC(C)=O)C[C@@H](C(=C1)C)OC(=O)CC(C)C)O2 BXFOFFBJRFZBQZ-QYWOHJEZSA-N 0.000 description 1
- 102000003618 TRPM4 Human genes 0.000 description 1
- 229940126624 Tacatuzumab tetraxetan Drugs 0.000 description 1
- CBPNZQVSJQDFBE-FUXHJELOSA-N Temsirolimus Chemical compound C1C[C@@H](OC(=O)C(C)(CO)CO)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 CBPNZQVSJQDFBE-FUXHJELOSA-N 0.000 description 1
- CGMTUJFWROPELF-UHFFFAOYSA-N Tenuazonic acid Natural products CCC(C)C1NC(=O)C(=C(C)/O)C1=O CGMTUJFWROPELF-UHFFFAOYSA-N 0.000 description 1
- 101710098080 Teratocarcinoma-derived growth factor Proteins 0.000 description 1
- 208000024313 Testicular Neoplasms Diseases 0.000 description 1
- 206010057644 Testis cancer Diseases 0.000 description 1
- 108010012944 Tetragastrin Proteins 0.000 description 1
- FZWLAAWBMGSTSO-UHFFFAOYSA-N Thiazole Chemical compound C1=CSC=N1 FZWLAAWBMGSTSO-UHFFFAOYSA-N 0.000 description 1
- 241001061127 Thione Species 0.000 description 1
- 206010043561 Thrombocytopenic purpura Diseases 0.000 description 1
- 108060008245 Thrombospondin Proteins 0.000 description 1
- 102000002938 Thrombospondin Human genes 0.000 description 1
- 201000007023 Thrombotic Thrombocytopenic Purpura Diseases 0.000 description 1
- 208000024770 Thyroid neoplasm Diseases 0.000 description 1
- 101710183280 Topoisomerase Proteins 0.000 description 1
- 239000000365 Topoisomerase I Inhibitor Substances 0.000 description 1
- 201000003379 Townes-Brocks syndrome Diseases 0.000 description 1
- 208000003441 Transfusion reaction Diseases 0.000 description 1
- 102100031228 Transient receptor potential cation channel subfamily M member 4 Human genes 0.000 description 1
- 101710170091 Transmembrane glycoprotein NMB Proteins 0.000 description 1
- UMILHIMHKXVDGH-UHFFFAOYSA-N Triethylene glycol diglycidyl ether Chemical compound C1OC1COCCOCCOCCOCC1CO1 UMILHIMHKXVDGH-UHFFFAOYSA-N 0.000 description 1
- 101710149792 Triosephosphate isomerase, chloroplastic Proteins 0.000 description 1
- 101710195516 Triosephosphate isomerase, glycosomal Proteins 0.000 description 1
- FYAMXEPQQLNQDM-UHFFFAOYSA-N Tris(1-aziridinyl)phosphine oxide Chemical compound C1CN1P(N1CC1)(=O)N1CC1 FYAMXEPQQLNQDM-UHFFFAOYSA-N 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000704 Tubulin Proteins 0.000 description 1
- 102000004243 Tubulin Human genes 0.000 description 1
- 108010051765 Type I Bone Morphogenetic Protein Receptors Proteins 0.000 description 1
- 101710192735 Tyrosine-protein kinase receptor UFO Proteins 0.000 description 1
- 102100040374 U4/U6 small nuclear ribonucleoprotein Prp3 Human genes 0.000 description 1
- VGQOVCHZGQWAOI-UHFFFAOYSA-N UNPD55612 Natural products N1C(O)C2CC(C=CC(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-UHFFFAOYSA-N 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 206010046851 Uveitis Diseases 0.000 description 1
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 1
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 1
- 101710160666 Vascular cell adhesion protein 1 Proteins 0.000 description 1
- 206010047115 Vasculitis Diseases 0.000 description 1
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 1
- 241000289674 Vombatidae Species 0.000 description 1
- 206010047741 Vulval cancer Diseases 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- SPJCRMJCFSJKDE-ZWBUGVOYSA-N [(3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthren-3-yl] 2-[4-[bis(2-chloroethyl)amino]phenyl]acetate Chemical compound O([C@@H]1CC2=CC[C@H]3[C@@H]4CC[C@@H]([C@]4(CC[C@@H]3[C@@]2(C)CC1)C)[C@H](C)CCCC(C)C)C(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 SPJCRMJCFSJKDE-ZWBUGVOYSA-N 0.000 description 1
- IFJUINDAXYAPTO-UUBSBJJBSA-N [(8r,9s,13s,14s,17s)-17-[2-[4-[4-[bis(2-chloroethyl)amino]phenyl]butanoyloxy]acetyl]oxy-13-methyl-6,7,8,9,11,12,14,15,16,17-decahydrocyclopenta[a]phenanthren-3-yl] benzoate Chemical compound C([C@@H]1[C@@H](C2=CC=3)CC[C@]4([C@H]1CC[C@@H]4OC(=O)COC(=O)CCCC=1C=CC(=CC=1)N(CCCl)CCCl)C)CC2=CC=3OC(=O)C1=CC=CC=C1 IFJUINDAXYAPTO-UUBSBJJBSA-N 0.000 description 1
- DGEZNRSVGBDHLK-UHFFFAOYSA-N [1,10]phenanthroline Chemical compound C1=CN=C2C3=NC=CC=C3C=CC2=C1 DGEZNRSVGBDHLK-UHFFFAOYSA-N 0.000 description 1
- IHGLINDYFMDHJG-UHFFFAOYSA-N [2-(4-methoxyphenyl)-3,4-dihydronaphthalen-1-yl]-[4-(2-pyrrolidin-1-ylethoxy)phenyl]methanone Chemical compound C1=CC(OC)=CC=C1C(CCC1=CC=CC=C11)=C1C(=O)C(C=C1)=CC=C1OCCN1CCCC1 IHGLINDYFMDHJG-UHFFFAOYSA-N 0.000 description 1
- XZSRRNFBEIOBDA-CFNBKWCHSA-N [2-[(2s,4s)-4-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-2,5,12-trihydroxy-7-methoxy-6,11-dioxo-3,4-dihydro-1h-tetracen-2-yl]-2-oxoethyl] 2,2-diethoxyacetate Chemical compound O([C@H]1C[C@](CC2=C(O)C=3C(=O)C4=CC=CC(OC)=C4C(=O)C=3C(O)=C21)(O)C(=O)COC(=O)C(OCC)OCC)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 XZSRRNFBEIOBDA-CFNBKWCHSA-N 0.000 description 1
- IBXPAFBDJCXCDW-MHFPCNPESA-A [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].Cc1cn([C@H]2C[C@H](O)[C@@H](COP([S-])(=O)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3CO)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3cnc4c3nc(N)[nH]c4=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O Chemical compound [Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].[Na+].Cc1cn([C@H]2C[C@H](O)[C@@H](COP([S-])(=O)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3COP([O-])(=S)O[C@H]3C[C@@H](O[C@@H]3CO)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3cnc4c3nc(N)[nH]c4=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3cnc4c3nc(N)[nH]c4=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O IBXPAFBDJCXCDW-MHFPCNPESA-A 0.000 description 1
- CHKFLBOLYREYDO-SHYZEUOFSA-N [[(2s,4r,5r)-5-(4-amino-2-oxopyrimidin-1-yl)-4-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl] phosphono hydrogen phosphate Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)C[C@@H](COP(O)(=O)OP(O)(=O)OP(O)(O)=O)O1 CHKFLBOLYREYDO-SHYZEUOFSA-N 0.000 description 1
- GXVKHKJETWAWRR-UHFFFAOYSA-N a805143 Chemical compound C1CCNC1.C1CCNC1 GXVKHKJETWAWRR-UHFFFAOYSA-N 0.000 description 1
- SSMFXCDUJJPFBJ-UWJYBYFXSA-N abbeymycin Chemical compound CO[C@@H]1NC2=CC=CC=C2C(=O)N2C[C@@H](O)C[C@@H]12 SSMFXCDUJJPFBJ-UWJYBYFXSA-N 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- ZOZKYEHVNDEUCO-XUTVFYLZSA-N aceglatone Chemical compound O1C(=O)[C@H](OC(C)=O)[C@@H]2OC(=O)[C@@H](OC(=O)C)[C@@H]21 ZOZKYEHVNDEUCO-XUTVFYLZSA-N 0.000 description 1
- 229950002684 aceglatone Drugs 0.000 description 1
- DHKHKXVYLBGOIT-UHFFFAOYSA-N acetaldehyde Diethyl Acetal Natural products CCOC(C)OCC DHKHKXVYLBGOIT-UHFFFAOYSA-N 0.000 description 1
- HXGDTGSAIMULJN-UHFFFAOYSA-N acetnaphthylene Natural products C1=CC(C=C2)=C3C2=CC=CC3=C1 HXGDTGSAIMULJN-UHFFFAOYSA-N 0.000 description 1
- 125000002777 acetyl group Chemical group [H]C([H])([H])C(*)=O 0.000 description 1
- 125000003668 acetyloxy group Chemical group [H]C([H])([H])C(=O)O[*] 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 125000004442 acylamino group Chemical group 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 229950004955 adozelesin Drugs 0.000 description 1
- BYRVKDUQDLJUBX-JJCDCTGGSA-N adozelesin Chemical compound C1=CC=C2OC(C(=O)NC=3C=C4C=C(NC4=CC=3)C(=O)N3C[C@H]4C[C@]44C5=C(C(C=C43)=O)NC=C5C)=CC2=C1 BYRVKDUQDLJUBX-JJCDCTGGSA-N 0.000 description 1
- 210000004100 adrenal gland Anatomy 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 238000003349 alamar blue assay Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 150000001298 alcohols Chemical class 0.000 description 1
- 229910001413 alkali metal ion Inorganic materials 0.000 description 1
- 229930013930 alkaloid Natural products 0.000 description 1
- 125000005257 alkyl acyl group Chemical group 0.000 description 1
- 125000003282 alkyl amino group Chemical group 0.000 description 1
- 229940045714 alkyl sulfonate alkylating agent Drugs 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- 125000004414 alkyl thio group Chemical group 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- 230000002152 alkylating effect Effects 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 208000026935 allergic disease Diseases 0.000 description 1
- WQZGKKKJIJFFOK-PHYPRBDBSA-N alpha-D-galactose Chemical compound OC[C@H]1O[C@H](O)[C@H](O)[C@@H](O)[C@H]1O WQZGKKKJIJFFOK-PHYPRBDBSA-N 0.000 description 1
- 229960000473 altretamine Drugs 0.000 description 1
- 239000004411 aluminium Substances 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 125000000320 amidine group Chemical group 0.000 description 1
- 230000006229 amino acid addition Effects 0.000 description 1
- 229960002749 aminolevulinic acid Drugs 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 235000019270 ammonium chloride Nutrition 0.000 description 1
- VZTDIZULWFCMLS-UHFFFAOYSA-N ammonium formate Chemical compound [NH4+].[O-]C=O VZTDIZULWFCMLS-UHFFFAOYSA-N 0.000 description 1
- 229960001220 amsacrine Drugs 0.000 description 1
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 1
- 201000007538 anal carcinoma Diseases 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 1
- BBDAGFIXKZCXAH-CCXZUQQUSA-N ancitabine Chemical compound N=C1C=CN2[C@@H]3O[C@H](CO)[C@@H](O)[C@@H]3OC2=N1 BBDAGFIXKZCXAH-CCXZUQQUSA-N 0.000 description 1
- 229950000242 ancitabine Drugs 0.000 description 1
- 239000003098 androgen Substances 0.000 description 1
- 229940030486 androgens Drugs 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 125000002490 anilino group Chemical group [H]N(*)C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 239000010775 animal oil Substances 0.000 description 1
- 150000001449 anionic compounds Chemical class 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- VGQOVCHZGQWAOI-HYUHUPJXSA-N anthramycin Chemical compound N1[C@@H](O)[C@@H]2CC(\C=C\C(N)=O)=CN2C(=O)C2=CC=C(C)C(O)=C12 VGQOVCHZGQWAOI-HYUHUPJXSA-N 0.000 description 1
- 230000002280 anti-androgenic effect Effects 0.000 description 1
- 230000002494 anti-cea effect Effects 0.000 description 1
- 229940046836 anti-estrogen Drugs 0.000 description 1
- 230000001833 anti-estrogenic effect Effects 0.000 description 1
- 239000000051 antiandrogen Substances 0.000 description 1
- 229940030495 antiandrogen sex hormone and modulator of the genital system Drugs 0.000 description 1
- 238000009175 antibody therapy Methods 0.000 description 1
- 230000000890 antigenic effect Effects 0.000 description 1
- 239000013059 antihormonal agent Substances 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 229940041181 antineoplastic drug Drugs 0.000 description 1
- 229940045988 antineoplastic drug protein kinase inhibitors Drugs 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 229950003145 apolizumab Drugs 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 150000008209 arabinosides Chemical class 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 125000005251 aryl acyl group Chemical group 0.000 description 1
- 229950002882 aselizumab Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 238000011914 asymmetric synthesis Methods 0.000 description 1
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical group [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 1
- 201000005000 autoimmune gastritis Diseases 0.000 description 1
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 description 1
- 208000010928 autoimmune thyroid disease Diseases 0.000 description 1
- 108010023337 axl receptor tyrosine kinase Proteins 0.000 description 1
- 229960002756 azacitidine Drugs 0.000 description 1
- 229950011321 azaserine Drugs 0.000 description 1
- XYOVOXDWRFGKEX-UHFFFAOYSA-N azepine Chemical compound N1C=CC=CC=C1 XYOVOXDWRFGKEX-UHFFFAOYSA-N 0.000 description 1
- HONIICLYMWZJFZ-UHFFFAOYSA-N azetidine Chemical compound C1CNC1 HONIICLYMWZJFZ-UHFFFAOYSA-N 0.000 description 1
- 150000001540 azides Chemical class 0.000 description 1
- 125000000852 azido group Chemical group *N=[N+]=[N-] 0.000 description 1
- 150000001541 aziridines Chemical class 0.000 description 1
- 229950001863 bapineuzumab Drugs 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 229960004669 basiliximab Drugs 0.000 description 1
- 229940049706 benzodiazepine Drugs 0.000 description 1
- BNBQRQQYDMDJAH-UHFFFAOYSA-N benzodioxan Chemical compound C1=CC=C2OCCOC2=C1 BNBQRQQYDMDJAH-UHFFFAOYSA-N 0.000 description 1
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 1
- QRUDEWIWKLJBPS-UHFFFAOYSA-N benzotriazole Chemical compound C1=CC=C2N[N][N]C2=C1 QRUDEWIWKLJBPS-UHFFFAOYSA-N 0.000 description 1
- 239000012964 benzotriazole Substances 0.000 description 1
- 125000003236 benzoyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C(*)=O 0.000 description 1
- AGEZXYOZHKGVCM-UHFFFAOYSA-N benzyl bromide Chemical compound BrCC1=CC=CC=C1 AGEZXYOZHKGVCM-UHFFFAOYSA-N 0.000 description 1
- 125000001797 benzyl group Chemical group [H]C1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])* 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- SHOMMGQAMRXRRK-UHFFFAOYSA-N bicyclo[3.1.1]heptane Chemical compound C1C2CC1CCC2 SHOMMGQAMRXRRK-UHFFFAOYSA-N 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 239000012620 biological material Substances 0.000 description 1
- 229940126587 biotherapeutics Drugs 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 229950008548 bisantrene Drugs 0.000 description 1
- 150000004663 bisphosphonates Chemical class 0.000 description 1
- 229960005522 bivatuzumab mertansine Drugs 0.000 description 1
- 229950006844 bizelesin Drugs 0.000 description 1
- 201000000053 blastoma Diseases 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical class N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000009835 boiling Methods 0.000 description 1
- 229940112869 bone morphogenetic protein Drugs 0.000 description 1
- GXJABQQUPOEUTA-RDJZCZTQSA-N bortezomib Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)B(O)O)NC(=O)C=1N=CC=NC=1)C1=CC=CC=C1 GXJABQQUPOEUTA-RDJZCZTQSA-N 0.000 description 1
- 229960001467 bortezomib Drugs 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 229910052794 bromium Inorganic materials 0.000 description 1
- 125000003865 brosyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1Br)S(*)(=O)=O 0.000 description 1
- 229960005520 bryostatin Drugs 0.000 description 1
- MJQUEDHRCUIRLF-TVIXENOKSA-N bryostatin 1 Chemical compound C([C@@H]1CC(/[C@@H]([C@@](C(C)(C)/C=C/2)(O)O1)OC(=O)/C=C/C=C/CCC)=C\C(=O)OC)[C@H]([C@@H](C)O)OC(=O)C[C@H](O)C[C@@H](O1)C[C@H](OC(C)=O)C(C)(C)[C@]1(O)C[C@@H]1C\C(=C\C(=O)OC)C[C@H]\2O1 MJQUEDHRCUIRLF-TVIXENOKSA-N 0.000 description 1
- MUIWQCKLQMOUAT-AKUNNTHJSA-N bryostatin 20 Natural products COC(=O)C=C1C[C@@]2(C)C[C@]3(O)O[C@](C)(C[C@@H](O)CC(=O)O[C@](C)(C[C@@]4(C)O[C@](O)(CC5=CC(=O)O[C@]45C)C(C)(C)C=C[C@@](C)(C1)O2)[C@@H](C)O)C[C@H](OC(=O)C(C)(C)C)C3(C)C MUIWQCKLQMOUAT-AKUNNTHJSA-N 0.000 description 1
- MBABCNBNDNGODA-LUVUIASKSA-N bullatacin Chemical compound O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@@H]1[C@@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@@H](O)CC=2C(O[C@@H](C)C=2)=O)CC1 MBABCNBNDNGODA-LUVUIASKSA-N 0.000 description 1
- 208000000594 bullous pemphigoid Diseases 0.000 description 1
- 229960002092 busulfan Drugs 0.000 description 1
- KTUQUZJOVNIKNZ-UHFFFAOYSA-N butan-1-ol;hydrate Chemical compound O.CCCCO KTUQUZJOVNIKNZ-UHFFFAOYSA-N 0.000 description 1
- 125000004369 butenyl group Chemical group C(=CCC)* 0.000 description 1
- 108700002839 cactinomycin Proteins 0.000 description 1
- 229950009908 cactinomycin Drugs 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- BPKIGYQJPYCAOW-FFJTTWKXSA-I calcium;potassium;disodium;(2s)-2-hydroxypropanoate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].C[C@H](O)C([O-])=O BPKIGYQJPYCAOW-FFJTTWKXSA-I 0.000 description 1
- BMLSTPRTEKLIPM-UHFFFAOYSA-I calcium;potassium;disodium;hydrogen carbonate;dichloride;dihydroxide;hydrate Chemical compound O.[OH-].[OH-].[Na+].[Na+].[Cl-].[Cl-].[K+].[Ca+2].OC([O-])=O BMLSTPRTEKLIPM-UHFFFAOYSA-I 0.000 description 1
- ZEWYCNBZMPELPF-UHFFFAOYSA-J calcium;potassium;sodium;2-hydroxypropanoic acid;sodium;tetrachloride Chemical compound [Na].[Na+].[Cl-].[Cl-].[Cl-].[Cl-].[K+].[Ca+2].CC(O)C(O)=O ZEWYCNBZMPELPF-UHFFFAOYSA-J 0.000 description 1
- 229950009823 calusterone Drugs 0.000 description 1
- IVFYLRMMHVYGJH-PVPPCFLZSA-N calusterone Chemical compound C1C[C@]2(C)[C@](O)(C)CC[C@H]2[C@@H]2[C@@H](C)CC3=CC(=O)CC[C@]3(C)[C@H]21 IVFYLRMMHVYGJH-PVPPCFLZSA-N 0.000 description 1
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 1
- 229940127093 camptothecin Drugs 0.000 description 1
- OJLHWPALWODJPQ-QNWVGRARSA-N canfosfamide Chemical compound ClCCN(CCCl)P(=O)(N(CCCl)CCCl)OCCS(=O)(=O)C[C@H](NC(=O)CC[C@H](N)C(O)=O)C(=O)N[C@@H](C(O)=O)C1=CC=CC=C1 OJLHWPALWODJPQ-QNWVGRARSA-N 0.000 description 1
- 229950000772 canfosfamide Drugs 0.000 description 1
- 229950007296 cantuzumab mertansine Drugs 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 125000003739 carbamimidoyl group Chemical group C(N)(=N)* 0.000 description 1
- 125000002837 carbocyclic group Chemical group 0.000 description 1
- 238000001460 carbon-13 nuclear magnetic resonance spectrum Methods 0.000 description 1
- 229960002115 carboquone Drugs 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 1
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 1
- 150000001733 carboxylic acid esters Chemical class 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- XREUEWVEMYWFFA-CSKJXFQVSA-N carminomycin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=C(O)C=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XREUEWVEMYWFFA-CSKJXFQVSA-N 0.000 description 1
- 229930188550 carminomycin Natural products 0.000 description 1
- XREUEWVEMYWFFA-UHFFFAOYSA-N carminomycin I Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=C(O)C=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XREUEWVEMYWFFA-UHFFFAOYSA-N 0.000 description 1
- 229960003261 carmofur Drugs 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 229950001725 carubicin Drugs 0.000 description 1
- BBZDXMBRAFTCAA-AREMUKBSSA-N carzelesin Chemical compound C1=2NC=C(C)C=2C([C@H](CCl)CN2C(=O)C=3NC4=CC=C(C=C4C=3)NC(=O)C3=CC4=CC=C(C=C4O3)N(CC)CC)=C2C=C1OC(=O)NC1=CC=CC=C1 BBZDXMBRAFTCAA-AREMUKBSSA-N 0.000 description 1
- 229950007509 carzelesin Drugs 0.000 description 1
- 108010047060 carzinophilin Proteins 0.000 description 1
- 150000001767 cationic compounds Chemical class 0.000 description 1
- 229950006754 cedelizumab Drugs 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000006037 cell lysis Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 229960003115 certolizumab pegol Drugs 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000001311 chemical methods and process Methods 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 229960004630 chlorambucil Drugs 0.000 description 1
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 1
- 229950008249 chlornaphazine Drugs 0.000 description 1
- 229960001480 chlorozotocin Drugs 0.000 description 1
- OEYIOHPDSNJKLS-UHFFFAOYSA-N choline Chemical compound C[N+](C)(C)CCO OEYIOHPDSNJKLS-UHFFFAOYSA-N 0.000 description 1
- 229960001231 choline Drugs 0.000 description 1
- VZWXIQHBIQLMPN-UHFFFAOYSA-N chromane Chemical compound C1=CC=C2CCCOC2=C1 VZWXIQHBIQLMPN-UHFFFAOYSA-N 0.000 description 1
- QZHPTGXQGDFGEN-UHFFFAOYSA-N chromene Chemical compound C1=CC=C2C=C[CH]OC2=C1 QZHPTGXQGDFGEN-UHFFFAOYSA-N 0.000 description 1
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 description 1
- 229960002173 citrulline Drugs 0.000 description 1
- 235000013477 citrulline Nutrition 0.000 description 1
- 229960002286 clodronic acid Drugs 0.000 description 1
- ACSIXWWBWUQEHA-UHFFFAOYSA-L clondronate(2-) Chemical compound OP([O-])(=O)C(Cl)(Cl)P(O)([O-])=O ACSIXWWBWUQEHA-UHFFFAOYSA-L 0.000 description 1
- 229960002271 cobimetinib Drugs 0.000 description 1
- 210000001072 colon Anatomy 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 230000004540 complement-dependent cytotoxicity Effects 0.000 description 1
- 229940125782 compound 2 Drugs 0.000 description 1
- 210000002808 connective tissue Anatomy 0.000 description 1
- 238000011254 conventional chemotherapy Methods 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- ARUVKPQLZAKDPS-UHFFFAOYSA-L copper(II) sulfate Chemical compound [Cu+2].[O-][S+2]([O-])([O-])[O-] ARUVKPQLZAKDPS-UHFFFAOYSA-L 0.000 description 1
- 238000004132 cross linking Methods 0.000 description 1
- 201000003278 cryoglobulinemia Diseases 0.000 description 1
- PSNOPSMXOBPNNV-VVCTWANISA-N cryptophycin 1 Chemical compound C1=C(Cl)C(OC)=CC=C1C[C@@H]1C(=O)NC[C@@H](C)C(=O)O[C@@H](CC(C)C)C(=O)O[C@H]([C@H](C)[C@@H]2[C@H](O2)C=2C=CC=CC=2)C/C=C/C(=O)N1 PSNOPSMXOBPNNV-VVCTWANISA-N 0.000 description 1
- 108010089438 cryptophycin 1 Proteins 0.000 description 1
- 108010090203 cryptophycin 8 Proteins 0.000 description 1
- PSNOPSMXOBPNNV-UHFFFAOYSA-N cryptophycin-327 Natural products C1=C(Cl)C(OC)=CC=C1CC1C(=O)NCC(C)C(=O)OC(CC(C)C)C(=O)OC(C(C)C2C(O2)C=2C=CC=CC=2)CC=CC(=O)N1 PSNOPSMXOBPNNV-UHFFFAOYSA-N 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 208000004921 cutaneous lupus erythematosus Diseases 0.000 description 1
- 125000001651 cyanato group Chemical class [*]OC#N 0.000 description 1
- CFBGXYDUODCMNS-UHFFFAOYSA-N cyclobutene Chemical compound C1CC=C1 CFBGXYDUODCMNS-UHFFFAOYSA-N 0.000 description 1
- 125000001995 cyclobutyl group Chemical group [H]C1([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000005725 cyclohexenylene group Chemical group 0.000 description 1
- 125000000113 cyclohexyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C([H])([H])C1([H])[H] 0.000 description 1
- 125000004956 cyclohexylene group Chemical group 0.000 description 1
- 125000001511 cyclopentyl group Chemical group [H]C1([H])C([H])([H])C([H])([H])C([H])(*)C1([H])[H] 0.000 description 1
- 125000004979 cyclopentylene group Chemical group 0.000 description 1
- 229960004397 cyclophosphamide Drugs 0.000 description 1
- OOXWYYGXTJLWHA-UHFFFAOYSA-N cyclopropene Chemical compound C1C=C1 OOXWYYGXTJLWHA-UHFFFAOYSA-N 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 102000003675 cytokine receptors Human genes 0.000 description 1
- 108010057085 cytokine receptors Proteins 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 230000003013 cytotoxicity Effects 0.000 description 1
- 231100000135 cytotoxicity Toxicity 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 229960003901 dacarbazine Drugs 0.000 description 1
- 229960000640 dactinomycin Drugs 0.000 description 1
- 229950006418 dactolisib Drugs 0.000 description 1
- JOGKUKXHTYWRGZ-UHFFFAOYSA-N dactolisib Chemical compound O=C1N(C)C2=CN=C3C=CC(C=4C=C5C=CC=CC5=NC=4)=CC3=C2N1C1=CC=C(C(C)(C)C#N)C=C1 JOGKUKXHTYWRGZ-UHFFFAOYSA-N 0.000 description 1
- 125000001295 dansyl group Chemical group [H]C1=C([H])C(N(C([H])([H])[H])C([H])([H])[H])=C2C([H])=C([H])C([H])=C(C2=C1[H])S(*)(=O)=O 0.000 description 1
- 229960000975 daunorubicin Drugs 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000003111 delayed effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 229960005052 demecolcine Drugs 0.000 description 1
- 230000003831 deregulation Effects 0.000 description 1
- 201000001981 dermatomyositis Diseases 0.000 description 1
- 229950003913 detorubicin Drugs 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- WVYXNIXAMZOZFK-UHFFFAOYSA-N diaziquone Chemical compound O=C1C(NC(=O)OCC)=C(N2CC2)C(=O)C(NC(=O)OCC)=C1N1CC1 WVYXNIXAMZOZFK-UHFFFAOYSA-N 0.000 description 1
- 229950002389 diaziquone Drugs 0.000 description 1
- MHDVGSVTJDSBDK-UHFFFAOYSA-N dibenzyl ether Chemical compound C=1C=CC=CC=1COCC1=CC=CC=C1 MHDVGSVTJDSBDK-UHFFFAOYSA-N 0.000 description 1
- ZBCBWPMODOFKDW-UHFFFAOYSA-N diethanolamine Chemical compound OCCNCCO ZBCBWPMODOFKDW-UHFFFAOYSA-N 0.000 description 1
- HPNMFZURTQLUMO-UHFFFAOYSA-N diethylamine Chemical compound CCNCC HPNMFZURTQLUMO-UHFFFAOYSA-N 0.000 description 1
- HGGNZMUHOHGHBJ-UHFFFAOYSA-N dioxepane Chemical compound C1CCOOCC1 HGGNZMUHOHGHBJ-UHFFFAOYSA-N 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 230000009266 disease activity Effects 0.000 description 1
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 1
- 229960003668 docetaxel Drugs 0.000 description 1
- AMRJKAQTDDKMCE-UHFFFAOYSA-N dolastatin Chemical compound CC(C)C(N(C)C)C(=O)NC(C(C)C)C(=O)N(C)C(C(C)C)C(OC)CC(=O)N1CCCC1C(OC)C(C)C(=O)NC(C=1SC=CN=1)CC1=CC=CC=C1 AMRJKAQTDDKMCE-UHFFFAOYSA-N 0.000 description 1
- 229930188854 dolastatin Natural products 0.000 description 1
- 239000002552 dosage form Substances 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- ZWAOHEXOSAUJHY-ZIYNGMLESA-N doxifluridine Chemical compound O[C@@H]1[C@H](O)[C@@H](C)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ZWAOHEXOSAUJHY-ZIYNGMLESA-N 0.000 description 1
- 229950005454 doxifluridine Drugs 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 229950004203 droloxifene Drugs 0.000 description 1
- NOTIQUSPUUHHEH-UXOVVSIBSA-N dromostanolone propionate Chemical compound C([C@@H]1CC2)C(=O)[C@H](C)C[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H](OC(=O)CC)[C@@]2(C)CC1 NOTIQUSPUUHHEH-UXOVVSIBSA-N 0.000 description 1
- 229950004683 drostanolone propionate Drugs 0.000 description 1
- 230000036267 drug metabolism Effects 0.000 description 1
- 239000003596 drug target Substances 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 229960005501 duocarmycin Drugs 0.000 description 1
- VQNATVDKACXKTF-XELLLNAOSA-N duocarmycin Chemical compound COC1=C(OC)C(OC)=C2NC(C(=O)N3C4=CC(=O)C5=C([C@@]64C[C@@H]6C3)C=C(N5)C(=O)OC)=CC2=C1 VQNATVDKACXKTF-XELLLNAOSA-N 0.000 description 1
- 229930184221 duocarmycin Natural products 0.000 description 1
- AFMYMMXSQGUCBK-AKMKHHNQSA-N dynemicin a Chemical compound C1#C\C=C/C#C[C@@H]2NC(C=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C3)=C3[C@@]34O[C@]32[C@@H](C)C(C(O)=O)=C(OC)[C@H]41 AFMYMMXSQGUCBK-AKMKHHNQSA-N 0.000 description 1
- 229960002224 eculizumab Drugs 0.000 description 1
- FSIRXIHZBIXHKT-MHTVFEQDSA-N edatrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CC(CC)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FSIRXIHZBIXHKT-MHTVFEQDSA-N 0.000 description 1
- 229950006700 edatrexate Drugs 0.000 description 1
- 229960000284 efalizumab Drugs 0.000 description 1
- 229960002759 eflornithine Drugs 0.000 description 1
- XOPYFXBZMVTEJF-PDACKIITSA-N eleutherobin Chemical compound C(/[C@H]1[C@H](C(=CC[C@@H]1C(C)C)C)C[C@@H]([C@@]1(C)O[C@@]2(C=C1)OC)OC(=O)\C=C\C=1N=CN(C)C=1)=C2\CO[C@@H]1OC[C@@H](O)[C@@H](O)[C@@H]1OC(C)=O XOPYFXBZMVTEJF-PDACKIITSA-N 0.000 description 1
- XOPYFXBZMVTEJF-UHFFFAOYSA-N eleutherobin Natural products C1=CC2(OC)OC1(C)C(OC(=O)C=CC=1N=CN(C)C=1)CC(C(=CCC1C(C)C)C)C1C=C2COC1OCC(O)C(O)C1OC(C)=O XOPYFXBZMVTEJF-UHFFFAOYSA-N 0.000 description 1
- 229950000549 elliptinium acetate Drugs 0.000 description 1
- 201000008184 embryoma Diseases 0.000 description 1
- 150000002081 enamines Chemical class 0.000 description 1
- 201000003914 endometrial carcinoma Diseases 0.000 description 1
- 230000002357 endometrial effect Effects 0.000 description 1
- 210000002472 endoplasmic reticulum Anatomy 0.000 description 1
- ZUBDGKVDJUIMQQ-UBFCDGJISA-N endothelin-1 Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(O)=O)NC(=O)[C@H]1NC(=O)[C@H](CC=2C=CC=CC=2)NC(=O)[C@@H](CC=2C=CC(O)=CC=2)NC(=O)[C@H](C(C)C)NC(=O)[C@H]2CSSC[C@@H](C(N[C@H](CO)C(=O)N[C@@H](CO)C(=O)N[C@H](CC(C)C)C(=O)N[C@@H](CCSC)C(=O)N[C@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCC(O)=O)C(=O)N2)=O)NC(=O)[C@@H](CO)NC(=O)[C@H](N)CSSC1)C1=CNC=N1 ZUBDGKVDJUIMQQ-UBFCDGJISA-N 0.000 description 1
- JOZGNYDSEBIJDH-UHFFFAOYSA-N eniluracil Chemical compound O=C1NC=C(C#C)C(=O)N1 JOZGNYDSEBIJDH-UHFFFAOYSA-N 0.000 description 1
- 229950010213 eniluracil Drugs 0.000 description 1
- 229950011487 enocitabine Drugs 0.000 description 1
- 229960001904 epirubicin Drugs 0.000 description 1
- 210000002919 epithelial cell Anatomy 0.000 description 1
- 229950002973 epitiostanol Drugs 0.000 description 1
- 229930013356 epothilone Natural products 0.000 description 1
- 150000003883 epothilone derivatives Chemical class 0.000 description 1
- 229950009760 epratuzumab Drugs 0.000 description 1
- 229940082789 erbitux Drugs 0.000 description 1
- 229950004292 erlizumab Drugs 0.000 description 1
- 229960001433 erlotinib Drugs 0.000 description 1
- AAKJLRGGTJKAMG-UHFFFAOYSA-N erlotinib Chemical compound C=12C=C(OCCOC)C(OCCOC)=CC2=NC=NC=1NC1=CC=CC(C#C)=C1 AAKJLRGGTJKAMG-UHFFFAOYSA-N 0.000 description 1
- ITSGNOIFAJAQHJ-BMFNZSJVSA-N esorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)C[C@H](C)O1 ITSGNOIFAJAQHJ-BMFNZSJVSA-N 0.000 description 1
- 229950002017 esorubicin Drugs 0.000 description 1
- LJQQFQHBKUKHIS-WJHRIEJJSA-N esperamicin Chemical compound O1CC(NC(C)C)C(OC)CC1OC1C(O)C(NOC2OC(C)C(SC)C(O)C2)C(C)OC1OC1C(\C2=C/CSSSC)=C(NC(=O)OC)C(=O)C(OC3OC(C)C(O)C(OC(=O)C=4C(=CC(OC)=C(OC)C=4)NC(=O)C(=C)OC)C3)C2(O)C#C\C=C/C#C1 LJQQFQHBKUKHIS-WJHRIEJJSA-N 0.000 description 1
- 229960001842 estramustine Drugs 0.000 description 1
- FRPJXPJMRWBBIH-RBRWEJTLSA-N estramustine Chemical compound ClCCN(CCCl)C(=O)OC1=CC=C2[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 FRPJXPJMRWBBIH-RBRWEJTLSA-N 0.000 description 1
- 239000000328 estrogen antagonist Substances 0.000 description 1
- RQIFXTOWUNAUJC-UHFFFAOYSA-N ethanesulfinic acid Chemical compound CCS(O)=O RQIFXTOWUNAUJC-UHFFFAOYSA-N 0.000 description 1
- 125000001033 ether group Chemical group 0.000 description 1
- 150000002170 ethers Chemical class 0.000 description 1
- QSRLNKCNOLVZIR-KRWDZBQOSA-N ethyl (2s)-2-[[2-[4-[bis(2-chloroethyl)amino]phenyl]acetyl]amino]-4-methylsulfanylbutanoate Chemical compound CCOC(=O)[C@H](CCSC)NC(=O)CC1=CC=C(N(CCCl)CCCl)C=C1 QSRLNKCNOLVZIR-KRWDZBQOSA-N 0.000 description 1
- 125000004494 ethyl ester group Chemical group 0.000 description 1
- 125000004705 ethylthio group Chemical group C(C)S* 0.000 description 1
- 229960005237 etoglucid Drugs 0.000 description 1
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 229960000255 exemestane Drugs 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 229950011548 fadrozole Drugs 0.000 description 1
- 229950001563 felvizumab Drugs 0.000 description 1
- 108010072257 fibroblast activation protein alpha Proteins 0.000 description 1
- 230000000893 fibroproliferative effect Effects 0.000 description 1
- 239000000945 filler Substances 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- GVEPBJHOBDJJJI-UHFFFAOYSA-N fluoranthrene Natural products C1=CC(C2=CC=CC=C22)=C3C2=CC=CC3=C1 GVEPBJHOBDJJJI-UHFFFAOYSA-N 0.000 description 1
- RMBPEFMHABBEKP-UHFFFAOYSA-N fluorene Chemical compound C1=CC=C2C3=C[CH]C=CC3=CC2=C1 RMBPEFMHABBEKP-UHFFFAOYSA-N 0.000 description 1
- 239000003269 fluorescent indicator Substances 0.000 description 1
- 239000011737 fluorine Chemical group 0.000 description 1
- MKXKFYHWDHIYRV-UHFFFAOYSA-N flutamide Chemical compound CC(C)C(=O)NC1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 MKXKFYHWDHIYRV-UHFFFAOYSA-N 0.000 description 1
- 229960002074 flutamide Drugs 0.000 description 1
- 235000019152 folic acid Nutrition 0.000 description 1
- 239000011724 folic acid Substances 0.000 description 1
- 229960000304 folic acid Drugs 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 229950004923 fontolizumab Drugs 0.000 description 1
- 235000013355 food flavoring agent Nutrition 0.000 description 1
- 235000003599 food sweetener Nutrition 0.000 description 1
- 125000002485 formyl group Chemical group [H]C(*)=O 0.000 description 1
- 229960004783 fotemustine Drugs 0.000 description 1
- YAKWPXVTIGTRJH-UHFFFAOYSA-N fotemustine Chemical compound CCOP(=O)(OCC)C(C)NC(=O)N(CCCl)N=O YAKWPXVTIGTRJH-UHFFFAOYSA-N 0.000 description 1
- 238000001640 fractional crystallisation Methods 0.000 description 1
- 238000004108 freeze drying Methods 0.000 description 1
- 239000012737 fresh medium Substances 0.000 description 1
- 125000002446 fucosyl group Chemical group C1([C@@H](O)[C@H](O)[C@H](O)[C@@H](O1)C)* 0.000 description 1
- 229960002258 fulvestrant Drugs 0.000 description 1
- WCVXAYSKMJJPLO-UHFFFAOYSA-N furan Chemical compound C=1C=COC=1.C=1C=COC=1 WCVXAYSKMJJPLO-UHFFFAOYSA-N 0.000 description 1
- 150000002243 furanoses Chemical class 0.000 description 1
- 125000002541 furyl group Chemical group 0.000 description 1
- 229960003082 galactose Drugs 0.000 description 1
- 229940044658 gallium nitrate Drugs 0.000 description 1
- 229960002584 gefitinib Drugs 0.000 description 1
- XGALLCVXEZPNRQ-UHFFFAOYSA-N gefitinib Chemical compound C=12C=C(OCCCN3CCOCC3)C(OC)=CC2=NC=NC=1NC1=CC=C(F)C(Cl)=C1 XGALLCVXEZPNRQ-UHFFFAOYSA-N 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 230000000762 glandular Effects 0.000 description 1
- 230000002518 glial effect Effects 0.000 description 1
- 208000005017 glioblastoma Diseases 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-L glutamate group Chemical group N[C@@H](CCC(=O)[O-])C(=O)[O-] WHUUTDBJXJRKMK-VKHMYHEASA-L 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 150000002334 glycols Chemical class 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 229960002913 goserelin Drugs 0.000 description 1
- 239000008187 granular material Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 125000002795 guanidino group Chemical group C(N)(=N)N* 0.000 description 1
- 201000010536 head and neck cancer Diseases 0.000 description 1
- 208000014829 head and neck neoplasm Diseases 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000010370 hearing loss Effects 0.000 description 1
- 231100000888 hearing loss Toxicity 0.000 description 1
- 208000016354 hearing loss disease Diseases 0.000 description 1
- 208000014951 hematologic disease Diseases 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 125000003187 heptyl group Chemical group [H]C([*])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[H] 0.000 description 1
- 150000002391 heterocyclic compounds Chemical class 0.000 description 1
- 125000005844 heterocyclyloxy group Chemical group 0.000 description 1
- 239000008241 heterogeneous mixture Substances 0.000 description 1
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 1
- 125000006038 hexenyl group Chemical group 0.000 description 1
- 125000004051 hexyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 108010077157 histocompatibility antigen 37 Proteins 0.000 description 1
- IKDUDTNKRLTJSI-UHFFFAOYSA-N hydrazine monohydrate Substances O.NN IKDUDTNKRLTJSI-UHFFFAOYSA-N 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- KLGSHNXEUZOKHH-JBUOLDKXSA-N hydron;methyl (2s,4r)-4-hydroxypyrrolidine-2-carboxylate;chloride Chemical compound Cl.COC(=O)[C@@H]1C[C@@H](O)CN1 KLGSHNXEUZOKHH-JBUOLDKXSA-N 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 229960001330 hydroxycarbamide Drugs 0.000 description 1
- UWYVPFMHMJIBHE-OWOJBTEDSA-N hydroxymaleic acid group Chemical group O/C(/C(=O)O)=C/C(=O)O UWYVPFMHMJIBHE-OWOJBTEDSA-N 0.000 description 1
- 125000004029 hydroxymethyl group Chemical group [H]OC([H])([H])* 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- 230000002390 hyperplastic effect Effects 0.000 description 1
- 230000002267 hypothalamic effect Effects 0.000 description 1
- 229940015872 ibandronate Drugs 0.000 description 1
- 229960000908 idarubicin Drugs 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 229960003685 imatinib mesylate Drugs 0.000 description 1
- YLMAHDNUQAMNNX-UHFFFAOYSA-N imatinib methanesulfonate Chemical compound CS(O)(=O)=O.C1CN(C)CCN1CC1=CC=C(C(=O)NC=2C=C(NC=3N=C(C=CN=3)C=3C=NC=CC=3)C(C)=CC=2)C=C1 YLMAHDNUQAMNNX-UHFFFAOYSA-N 0.000 description 1
- MTNDZQHUAFNZQY-UHFFFAOYSA-N imidazoline Chemical compound C1CN=CN1 MTNDZQHUAFNZQY-UHFFFAOYSA-N 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- DBIGHPPNXATHOF-UHFFFAOYSA-N improsulfan Chemical compound CS(=O)(=O)OCCCNCCCOS(C)(=O)=O DBIGHPPNXATHOF-UHFFFAOYSA-N 0.000 description 1
- 229950008097 improsulfan Drugs 0.000 description 1
- 230000001976 improved effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- PZOUSPYUWWUPPK-UHFFFAOYSA-N indole Natural products CC1=CC=CC2=C1C=CN2 PZOUSPYUWWUPPK-UHFFFAOYSA-N 0.000 description 1
- RKJUIXBNRJVNHR-UHFFFAOYSA-N indolenine Natural products C1=CC=C2CC=NC2=C1 RKJUIXBNRJVNHR-UHFFFAOYSA-N 0.000 description 1
- HOBCFUWDNJPFHB-UHFFFAOYSA-N indolizine Chemical compound C1=CC=CN2C=CC=C21 HOBCFUWDNJPFHB-UHFFFAOYSA-N 0.000 description 1
- 230000006882 induction of apoptosis Effects 0.000 description 1
- 230000001939 inductive effect Effects 0.000 description 1
- 229940050282 inebilizumab-cdon Drugs 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 229910001412 inorganic anion Inorganic materials 0.000 description 1
- 229910001411 inorganic cation Inorganic materials 0.000 description 1
- 229950004101 inotuzumab ozogamicin Drugs 0.000 description 1
- 108010021309 integrin beta6 Proteins 0.000 description 1
- 230000003993 interaction Effects 0.000 description 1
- 201000002313 intestinal cancer Diseases 0.000 description 1
- 230000007154 intracellular accumulation Effects 0.000 description 1
- 108010028930 invariant chain Proteins 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 229960005386 ipilimumab Drugs 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- VYFOAVADNIHPTR-UHFFFAOYSA-N isatoic anhydride Chemical compound NC1=CC=CC=C1CO VYFOAVADNIHPTR-UHFFFAOYSA-N 0.000 description 1
- 125000002510 isobutoxy group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])O* 0.000 description 1
- HEBMCVBCEDMUOF-UHFFFAOYSA-N isochromane Chemical compound C1=CC=C2COCCC2=C1 HEBMCVBCEDMUOF-UHFFFAOYSA-N 0.000 description 1
- GWVMLCQWXVFZCN-UHFFFAOYSA-N isoindoline Chemical compound C1=CC=C2CNCC2=C1 GWVMLCQWXVFZCN-UHFFFAOYSA-N 0.000 description 1
- 238000006317 isomerization reaction Methods 0.000 description 1
- 125000001972 isopentyl group Chemical group [H]C([H])([H])C([H])(C([H])([H])[H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000000555 isopropenyl group Chemical group [H]\C([H])=C(\*)C([H])([H])[H] 0.000 description 1
- 125000003253 isopropoxy group Chemical group [H]C([H])([H])C([H])(O*)C([H])([H])[H] 0.000 description 1
- 125000004254 isoquinolin-1-yl group Chemical group [H]C1=C([H])C2=C([H])C([H])=C([H])C([H])=C2C(*)=N1 0.000 description 1
- 125000004551 isoquinolin-3-yl group Chemical group C1=NC(=CC2=CC=CC=C12)* 0.000 description 1
- ZLTPDFXIESTBQG-UHFFFAOYSA-N isothiazole Chemical compound C=1C=NSC=1 ZLTPDFXIESTBQG-UHFFFAOYSA-N 0.000 description 1
- 125000001810 isothiocyanato group Chemical group *N=C=S 0.000 description 1
- CTAPFRYPJLPFDF-UHFFFAOYSA-N isoxazole Chemical compound C=1C=NOC=1 CTAPFRYPJLPFDF-UHFFFAOYSA-N 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 229950000518 labetuzumab Drugs 0.000 description 1
- 229960004891 lapatinib Drugs 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 229940115286 lentinan Drugs 0.000 description 1
- 201000004803 lethal congenital contracture syndrome 2 Diseases 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- GFIJNRVAKGFPGQ-LIJARHBVSA-N leuprolide Chemical compound CCNC(=O)[C@@H]1CCCN1C(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1N=CNC=1)NC(=O)[C@H]1NC(=O)CC1)CC1=CC=C(O)C=C1 GFIJNRVAKGFPGQ-LIJARHBVSA-N 0.000 description 1
- 229960004338 leuprorelin Drugs 0.000 description 1
- QDLAGTHXVHQKRE-UHFFFAOYSA-N lichenxanthone Natural products COC1=CC(O)=C2C(=O)C3=C(C)C=C(OC)C=C3OC2=C1 QDLAGTHXVHQKRE-UHFFFAOYSA-N 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 238000004811 liquid chromatography Methods 0.000 description 1
- DLEDOFVPSDKWEF-UHFFFAOYSA-N lithium butane Chemical compound [Li+].CCC[CH2-] DLEDOFVPSDKWEF-UHFFFAOYSA-N 0.000 description 1
- 210000004185 liver Anatomy 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 229960002247 lomustine Drugs 0.000 description 1
- 229950001750 lonafarnib Drugs 0.000 description 1
- YROQEQPFUCPDCP-UHFFFAOYSA-N losoxantrone Chemical compound OCCNCCN1N=C2C3=CC=CC(O)=C3C(=O)C3=C2C1=CC=C3NCCNCCO YROQEQPFUCPDCP-UHFFFAOYSA-N 0.000 description 1
- 229950008745 losoxantrone Drugs 0.000 description 1
- 239000000314 lubricant Substances 0.000 description 1
- 238000004020 luminiscence type Methods 0.000 description 1
- 201000005249 lung adenocarcinoma Diseases 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 229950008612 mannomustine Drugs 0.000 description 1
- 241001515942 marmosets Species 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- WKPWGQKGSOKKOO-RSFHAFMBSA-N maytansine Chemical compound CO[C@@H]([C@@]1(O)C[C@](OC(=O)N1)([C@H]([C@@H]1O[C@@]1(C)[C@@H](OC(=O)[C@H](C)N(C)C(C)=O)CC(=O)N1C)C)[H])\C=C\C=C(C)\CC2=CC(OC)=C(Cl)C1=C2 WKPWGQKGSOKKOO-RSFHAFMBSA-N 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- RQZAXGRLVPAYTJ-GQFGMJRRSA-N megestrol acetate Chemical compound C1=C(C)C2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@@](C(C)=O)(OC(=O)C)[C@@]1(C)CC2 RQZAXGRLVPAYTJ-GQFGMJRRSA-N 0.000 description 1
- 229960004296 megestrol acetate Drugs 0.000 description 1
- 229960003194 meglumine Drugs 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- 229960001924 melphalan Drugs 0.000 description 1
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 229950009246 mepitiostane Drugs 0.000 description 1
- 229960005108 mepolizumab Drugs 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- MYWUZJCMWCOHBA-VIFPVBQESA-N methamphetamine Chemical compound CN[C@@H](C)CC1=CC=CC=C1 MYWUZJCMWCOHBA-VIFPVBQESA-N 0.000 description 1
- XNEFVTBPCXGIRX-UHFFFAOYSA-N methanesulfinic acid Chemical compound CS(O)=O XNEFVTBPCXGIRX-UHFFFAOYSA-N 0.000 description 1
- 125000001160 methoxycarbonyl group Chemical group [H]C([H])([H])OC(*)=O 0.000 description 1
- VJRAUFKOOPNFIQ-TVEKBUMESA-N methyl (1r,2r,4s)-4-[(2r,4s,5s,6s)-5-[(2s,4s,5s,6s)-5-[(2s,4s,5s,6s)-4,5-dihydroxy-6-methyloxan-2-yl]oxy-4-hydroxy-6-methyloxan-2-yl]oxy-4-(dimethylamino)-6-methyloxan-2-yl]oxy-2-ethyl-2,5,7,10-tetrahydroxy-6,11-dioxo-3,4-dihydro-1h-tetracene-1-carboxylat Chemical compound O([C@H]1[C@@H](O)C[C@@H](O[C@H]1C)O[C@H]1[C@H](C[C@@H](O[C@H]1C)O[C@H]1C[C@]([C@@H](C2=CC=3C(=O)C4=C(O)C=CC(O)=C4C(=O)C=3C(O)=C21)C(=O)OC)(O)CC)N(C)C)[C@H]1C[C@H](O)[C@H](O)[C@H](C)O1 VJRAUFKOOPNFIQ-TVEKBUMESA-N 0.000 description 1
- QRMNENFZDDYDEF-GOSISDBHSA-N methyl (8s)-8-(bromomethyl)-2-methyl-4-(4-methylpiperazine-1-carbonyl)oxy-6-(5,6,7-trimethoxy-1h-indole-2-carbonyl)-7,8-dihydro-3h-pyrrolo[3,2-e]indole-1-carboxylate Chemical compound C1([C@H](CBr)CN(C1=C1)C(=O)C=2NC3=C(OC)C(OC)=C(OC)C=C3C=2)=C2C(C(=O)OC)=C(C)NC2=C1OC(=O)N1CCN(C)CC1 QRMNENFZDDYDEF-GOSISDBHSA-N 0.000 description 1
- GYNNXHKOJHMOHS-UHFFFAOYSA-N methyl-cycloheptane Natural products CC1CCCCCC1 GYNNXHKOJHMOHS-UHFFFAOYSA-N 0.000 description 1
- KTMKRRPZPWUYKK-UHFFFAOYSA-N methylboronic acid Chemical compound CB(O)O KTMKRRPZPWUYKK-UHFFFAOYSA-N 0.000 description 1
- VNXBKJFUJUWOCW-UHFFFAOYSA-N methylcyclopropane Chemical compound CC1CC1 VNXBKJFUJUWOCW-UHFFFAOYSA-N 0.000 description 1
- HRHKSTOGXBBQCB-VFWICMBZSA-N methylmitomycin Chemical compound O=C1C(N)=C(C)C(=O)C2=C1[C@@H](COC(N)=O)[C@@]1(OC)[C@H]3N(C)[C@H]3CN12 HRHKSTOGXBBQCB-VFWICMBZSA-N 0.000 description 1
- 125000002816 methylsulfanyl group Chemical group [H]C([H])([H])S[*] 0.000 description 1
- HPNSFSBZBAHARI-UHFFFAOYSA-N micophenolic acid Natural products OC1=C(CC=C(C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-UHFFFAOYSA-N 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- 150000007522 mineralic acids Chemical class 0.000 description 1
- 231100000324 minimal toxicity Toxicity 0.000 description 1
- 229960005485 mitobronitol Drugs 0.000 description 1
- MXWHMTNPTTVWDM-NXOFHUPFSA-N mitoguazone Chemical compound NC(N)=N\N=C(/C)\C=N\N=C(N)N MXWHMTNPTTVWDM-NXOFHUPFSA-N 0.000 description 1
- 229960003539 mitoguazone Drugs 0.000 description 1
- VFKZTMPDYBFSTM-GUCUJZIJSA-N mitolactol Chemical compound BrC[C@H](O)[C@@H](O)[C@@H](O)[C@H](O)CBr VFKZTMPDYBFSTM-GUCUJZIJSA-N 0.000 description 1
- 229950010913 mitolactol Drugs 0.000 description 1
- 229960004857 mitomycin Drugs 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 150000004682 monohydrates Chemical class 0.000 description 1
- 125000006518 morpholino carbonyl group Chemical group [H]C1([H])OC([H])([H])C([H])([H])N(C(*)=O)C1([H])[H] 0.000 description 1
- 229960001521 motavizumab Drugs 0.000 description 1
- 238000010172 mouse model Methods 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 206010028417 myasthenia gravis Diseases 0.000 description 1
- 229960000951 mycophenolic acid Drugs 0.000 description 1
- HPNSFSBZBAHARI-RUDMXATFSA-N mycophenolic acid Chemical compound OC1=C(C\C=C(/C)CCC(O)=O)C(OC)=C(C)C2=C1C(=O)OC2 HPNSFSBZBAHARI-RUDMXATFSA-N 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- NJSMWLQOCQIOPE-OCHFTUDZSA-N n-[(e)-[10-[(e)-(4,5-dihydro-1h-imidazol-2-ylhydrazinylidene)methyl]anthracen-9-yl]methylideneamino]-4,5-dihydro-1h-imidazol-2-amine Chemical compound N1CCN=C1N\N=C\C(C1=CC=CC=C11)=C(C=CC=C2)C2=C1\C=N\NC1=NCCN1 NJSMWLQOCQIOPE-OCHFTUDZSA-N 0.000 description 1
- LBWFXVZLPYTWQI-IPOVEDGCSA-N n-[2-(diethylamino)ethyl]-5-[(z)-(5-fluoro-2-oxo-1h-indol-3-ylidene)methyl]-2,4-dimethyl-1h-pyrrole-3-carboxamide;(2s)-2-hydroxybutanedioic acid Chemical compound OC(=O)[C@@H](O)CC(O)=O.CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C LBWFXVZLPYTWQI-IPOVEDGCSA-N 0.000 description 1
- OWIUPIRUAQMTTK-UHFFFAOYSA-M n-aminocarbamate Chemical compound NNC([O-])=O OWIUPIRUAQMTTK-UHFFFAOYSA-M 0.000 description 1
- GTWJETSWSUWSEJ-UHFFFAOYSA-N n-benzylaniline Chemical compound C=1C=CC=CC=1CNC1=CC=CC=C1 GTWJETSWSUWSEJ-UHFFFAOYSA-N 0.000 description 1
- 125000006606 n-butoxy group Chemical group 0.000 description 1
- DIOQZVSQGTUSAI-UHFFFAOYSA-N n-butylhexane Natural products CCCCCCCCCC DIOQZVSQGTUSAI-UHFFFAOYSA-N 0.000 description 1
- 125000003136 n-heptyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000001280 n-hexyl group Chemical group C(CCCCC)* 0.000 description 1
- 125000000740 n-pentyl group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])C([H])([H])C([H])([H])* 0.000 description 1
- 125000003506 n-propoxy group Chemical group [H]C([H])([H])C([H])([H])C([H])([H])O* 0.000 description 1
- 239000002105 nanoparticle Substances 0.000 description 1
- KVBGVZZKJNLNJU-UHFFFAOYSA-M naphthalene-2-sulfonate Chemical compound C1=CC=CC2=CC(S(=O)(=O)[O-])=CC=C21 KVBGVZZKJNLNJU-UHFFFAOYSA-M 0.000 description 1
- 125000001624 naphthyl group Chemical group 0.000 description 1
- 229960005027 natalizumab Drugs 0.000 description 1
- CTMCWCONSULRHO-UHQPFXKFSA-N nemorubicin Chemical compound C1CO[C@H](OC)CN1[C@@H]1[C@H](O)[C@H](C)O[C@@H](O[C@@H]2C3=C(O)C=4C(=O)C5=C(OC)C=CC=C5C(=O)C=4C(O)=C3C[C@](O)(C2)C(=O)CO)C1 CTMCWCONSULRHO-UHQPFXKFSA-N 0.000 description 1
- 229950010159 nemorubicin Drugs 0.000 description 1
- 125000001971 neopentyl group Chemical group [H]C([*])([H])C(C([H])([H])[H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 229930188317 neothramycin Natural products 0.000 description 1
- 230000001537 neural effect Effects 0.000 description 1
- 230000004766 neurogenesis Effects 0.000 description 1
- 208000008795 neuromyelitis optica Diseases 0.000 description 1
- 108010049585 neuronectin Proteins 0.000 description 1
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- 229960001420 nimustine Drugs 0.000 description 1
- VFEDRRNHLBGPNN-UHFFFAOYSA-N nimustine Chemical compound CC1=NC=C(CNC(=O)N(CCCl)N=O)C(N)=N1 VFEDRRNHLBGPNN-UHFFFAOYSA-N 0.000 description 1
- 229910017604 nitric acid Inorganic materials 0.000 description 1
- GQPLMRYTRLFLPF-UHFFFAOYSA-N nitrous oxide Inorganic materials [O-][N+]#N GQPLMRYTRLFLPF-UHFFFAOYSA-N 0.000 description 1
- KGTDRFCXGRULNK-JYOBTZKQSA-N nogalamycin Chemical compound CO[C@@H]1[C@@](OC)(C)[C@@H](OC)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=C(O)C=C4[C@@]5(C)O[C@H]([C@H]([C@@H]([C@H]5O)N(C)C)O)OC4=C3C3=O)=C3C=C2[C@@H](C(=O)OC)[C@@](C)(O)C1 KGTDRFCXGRULNK-JYOBTZKQSA-N 0.000 description 1
- 229950009266 nogalamycin Drugs 0.000 description 1
- 208000002154 non-small cell lung carcinoma Diseases 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- UMRZSTCPUPJPOJ-KNVOCYPGSA-N norbornane Chemical compound C1C[C@H]2CC[C@@H]1C2 UMRZSTCPUPJPOJ-KNVOCYPGSA-N 0.000 description 1
- 125000001736 nosyl group Chemical group S(=O)(=O)(C1=CC=C([N+](=O)[O-])C=C1)* 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- NIHNNTQXNPWCJQ-UHFFFAOYSA-N o-biphenylenemethane Natural products C1=CC=C2CC3=CC=CC=C3C2=C1 NIHNNTQXNPWCJQ-UHFFFAOYSA-N 0.000 description 1
- 229960000435 oblimersen Drugs 0.000 description 1
- 229950005751 ocrelizumab Drugs 0.000 description 1
- 229960002450 ofatumumab Drugs 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid group Chemical group C(CCCCCCC\C=C/CCCCCCCC)(=O)O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- CZDBNBLGZNWKMC-MWQNXGTOSA-N olivomycin Chemical class O([C@@H]1C[C@@H](O[C@H](C)[C@@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1)O[C@H]1O[C@@H](C)[C@H](O)[C@@H](OC2O[C@@H](C)[C@H](O)[C@@H](O)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@H](O)[C@H](OC)[C@H](C)O1 CZDBNBLGZNWKMC-MWQNXGTOSA-N 0.000 description 1
- 229960000470 omalizumab Drugs 0.000 description 1
- 229950011093 onapristone Drugs 0.000 description 1
- 229940006093 opthalmologic coloring agent diagnostic Drugs 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 150000002892 organic cations Chemical class 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 208000008798 osteoma Diseases 0.000 description 1
- 201000008968 osteosarcoma Diseases 0.000 description 1
- 230000002611 ovarian Effects 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- GUVKYQNSMXSMMU-UHFFFAOYSA-N oxane Chemical compound C1CCOCC1.C1CCOCC1 GUVKYQNSMXSMMU-UHFFFAOYSA-N 0.000 description 1
- NFBOHOGPQUYFRF-UHFFFAOYSA-N oxanthrene Chemical compound C1=CC=C2OC3=CC=CC=C3OC2=C1 NFBOHOGPQUYFRF-UHFFFAOYSA-N 0.000 description 1
- AZHVQJLDOFKHPZ-UHFFFAOYSA-N oxathiazine Chemical compound O1SN=CC=C1 AZHVQJLDOFKHPZ-UHFFFAOYSA-N 0.000 description 1
- CQDAMYNQINDRQC-UHFFFAOYSA-N oxatriazole Chemical compound C1=NN=NO1 CQDAMYNQINDRQC-UHFFFAOYSA-N 0.000 description 1
- ATYBXHSAIOKLMG-UHFFFAOYSA-N oxepin Chemical compound O1C=CC=CC=C1 ATYBXHSAIOKLMG-UHFFFAOYSA-N 0.000 description 1
- AHHWIHXENZJRFG-UHFFFAOYSA-N oxetane Chemical compound C1COC1 AHHWIHXENZJRFG-UHFFFAOYSA-N 0.000 description 1
- AUONHKJOIZSQGR-UHFFFAOYSA-N oxophosphane Chemical compound P=O AUONHKJOIZSQGR-UHFFFAOYSA-N 0.000 description 1
- 125000005740 oxycarbonyl group Chemical group [*:1]OC([*:2])=O 0.000 description 1
- 239000001301 oxygen Chemical group 0.000 description 1
- 125000004430 oxygen atom Chemical group O* 0.000 description 1
- 125000003854 p-chlorophenyl group Chemical group [H]C1=C([H])C(*)=C([H])C([H])=C1Cl 0.000 description 1
- 229960000402 palivizumab Drugs 0.000 description 1
- 229910052763 palladium Inorganic materials 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-N palmitic acid group Chemical group C(CCCCCCCCCCCCCCC)(=O)O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 description 1
- VREZDOWOLGNDPW-UHFFFAOYSA-N pancratistatine Natural products C1=C2C3C(O)C(O)C(O)C(O)C3NC(=O)C2=C(O)C2=C1OCO2 VREZDOWOLGNDPW-UHFFFAOYSA-N 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 229950011485 pascolizumab Drugs 0.000 description 1
- 230000007310 pathophysiology Effects 0.000 description 1
- 229960000639 pazopanib Drugs 0.000 description 1
- CUIHSIWYWATEQL-UHFFFAOYSA-N pazopanib Chemical compound C1=CC2=C(C)N(C)N=C2C=C1N(C)C(N=1)=CC=NC=1NC1=CC=C(C)C(S(N)(=O)=O)=C1 CUIHSIWYWATEQL-UHFFFAOYSA-N 0.000 description 1
- 201000001976 pemphigus vulgaris Diseases 0.000 description 1
- 208000030940 penile carcinoma Diseases 0.000 description 1
- 201000008174 penis carcinoma Diseases 0.000 description 1
- 125000004817 pentamethylene group Chemical group [H]C([H])([*:2])C([H])([H])C([H])([H])C([H])([H])C([H])([H])[*:1] 0.000 description 1
- 125000002255 pentenyl group Chemical group C(=CCCC)* 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- QIMGFXOHTOXMQP-GFAGFCTOSA-N peplomycin Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCCN[C@@H](C)C=1C=CC=CC=1)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1NC=NC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C QIMGFXOHTOXMQP-GFAGFCTOSA-N 0.000 description 1
- 229950003180 peplomycin Drugs 0.000 description 1
- 201000002628 peritoneum cancer Diseases 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 239000003208 petroleum Substances 0.000 description 1
- 229950003203 pexelizumab Drugs 0.000 description 1
- 230000008782 phagocytosis Effects 0.000 description 1
- 229940124531 pharmaceutical excipient Drugs 0.000 description 1
- XDJOIMJURHQYDW-UHFFFAOYSA-N phenalene Chemical compound C1=CC(CC=C2)=C3C2=CC=CC3=C1 XDJOIMJURHQYDW-UHFFFAOYSA-N 0.000 description 1
- 229950000688 phenothiazine Drugs 0.000 description 1
- GJSGGHOYGKMUPT-UHFFFAOYSA-N phenoxathiine Chemical compound C1=CC=C2OC3=CC=CC=C3SC2=C1 GJSGGHOYGKMUPT-UHFFFAOYSA-N 0.000 description 1
- WLJVXDMOQOGPHL-UHFFFAOYSA-N phenylacetic acid Chemical compound OC(=O)CC1=CC=CC=C1 WLJVXDMOQOGPHL-UHFFFAOYSA-N 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 125000003170 phenylsulfonyl group Chemical group C1(=CC=CC=C1)S(=O)(=O)* 0.000 description 1
- FVZVCSNXTFCBQU-UHFFFAOYSA-N phosphanyl Chemical group [PH2] FVZVCSNXTFCBQU-UHFFFAOYSA-N 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 239000002953 phosphate buffered saline Substances 0.000 description 1
- UEZVMMHDMIWARA-UHFFFAOYSA-M phosphonate Chemical compound [O-]P(=O)=O UEZVMMHDMIWARA-UHFFFAOYSA-M 0.000 description 1
- 125000001476 phosphono group Chemical group [H]OP(*)(=O)O[H] 0.000 description 1
- PTMHPRAIXMAOOB-UHFFFAOYSA-L phosphoramidate Chemical compound NP([O-])([O-])=O PTMHPRAIXMAOOB-UHFFFAOYSA-L 0.000 description 1
- 229910000073 phosphorus hydride Inorganic materials 0.000 description 1
- 239000003504 photosensitizing agent Substances 0.000 description 1
- LFSXCDWNBUNEEM-UHFFFAOYSA-N phthalazine Chemical compound C1=NN=CC2=CC=CC=C21 LFSXCDWNBUNEEM-UHFFFAOYSA-N 0.000 description 1
- 125000005545 phthalimidyl group Chemical group 0.000 description 1
- 230000000704 physical effect Effects 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 229960000952 pipobroman Drugs 0.000 description 1
- NJBFOOCLYDNZJN-UHFFFAOYSA-N pipobroman Chemical compound BrCCC(=O)N1CCN(C(=O)CCBr)CC1 NJBFOOCLYDNZJN-UHFFFAOYSA-N 0.000 description 1
- NUKCGLDCWQXYOQ-UHFFFAOYSA-N piposulfan Chemical compound CS(=O)(=O)OCCC(=O)N1CCN(C(=O)CCOS(C)(=O)=O)CC1 NUKCGLDCWQXYOQ-UHFFFAOYSA-N 0.000 description 1
- 229950001100 piposulfan Drugs 0.000 description 1
- 229960001221 pirarubicin Drugs 0.000 description 1
- 239000000902 placebo Substances 0.000 description 1
- 229940068196 placebo Drugs 0.000 description 1
- 150000003057 platinum Chemical class 0.000 description 1
- CLSUSRZJUQMOHH-UHFFFAOYSA-L platinum dichloride Chemical compound Cl[Pt]Cl CLSUSRZJUQMOHH-UHFFFAOYSA-L 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 208000005987 polymyositis Diseases 0.000 description 1
- 230000007824 polyneuropathy Effects 0.000 description 1
- 229920005862 polyol Polymers 0.000 description 1
- 150000003077 polyols Chemical class 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229950004406 porfiromycin Drugs 0.000 description 1
- 239000002243 precursor Substances 0.000 description 1
- 229960004694 prednimustine Drugs 0.000 description 1
- 230000003449 preventive effect Effects 0.000 description 1
- 201000000742 primary sclerosing cholangitis Diseases 0.000 description 1
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 1
- 229960000624 procarbazine Drugs 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- ONIBWKKTOPOVIA-UHFFFAOYSA-M prolinate Chemical compound [O-]C(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-M 0.000 description 1
- 125000006238 prop-1-en-1-yl group Chemical group [H]\C(*)=C(/[H])C([H])([H])[H] 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- YORCIIVHUBAYBQ-UHFFFAOYSA-N propargyl bromide Chemical compound BrCC#C YORCIIVHUBAYBQ-UHFFFAOYSA-N 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 125000001501 propionyl group Chemical group O=C([*])C([H])([H])C([H])([H])[H] 0.000 description 1
- 239000003909 protein kinase inhibitor Substances 0.000 description 1
- 238000000425 proton nuclear magnetic resonance spectrum Methods 0.000 description 1
- WOLQREOUPKZMEX-UHFFFAOYSA-N pteroyltriglutamic acid Chemical compound C=1N=C2NC(N)=NC(=O)C2=NC=1CNC1=CC=C(C(=O)NC(CCC(=O)NC(CCC(=O)NC(CCC(O)=O)C(O)=O)C(O)=O)C(O)=O)C=C1 WOLQREOUPKZMEX-UHFFFAOYSA-N 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 229950010131 puromycin Drugs 0.000 description 1
- 150000003215 pyranoses Chemical class 0.000 description 1
- CRTBNOWPBHJICM-UHFFFAOYSA-N pyrazine Chemical compound C1=CN=CC=N1.C1=CN=CC=N1 CRTBNOWPBHJICM-UHFFFAOYSA-N 0.000 description 1
- UBRJWPDONDYLLX-UHFFFAOYSA-N pyrazolidine Chemical compound C1CNNC1.C1CNNC1 UBRJWPDONDYLLX-UHFFFAOYSA-N 0.000 description 1
- IOXGEAHHEGTLMQ-UHFFFAOYSA-N pyridazine Chemical compound C1=CC=NN=C1.C1=CC=NN=C1 IOXGEAHHEGTLMQ-UHFFFAOYSA-N 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- ZVJHJDDKYZXRJI-UHFFFAOYSA-N pyrroline Natural products C1CC=NC1 ZVJHJDDKYZXRJI-UHFFFAOYSA-N 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- JWVCLYRUEFBMGU-UHFFFAOYSA-N quinazoline Chemical compound N1=CN=CC2=CC=CC=C21 JWVCLYRUEFBMGU-UHFFFAOYSA-N 0.000 description 1
- 125000004159 quinolin-2-yl group Chemical group [H]C1=C([H])C([H])=C2C([H])=C([H])C(*)=NC2=C1[H] 0.000 description 1
- 125000004548 quinolin-3-yl group Chemical group N1=CC(=CC2=CC=CC=C12)* 0.000 description 1
- UOWVMDUEMSNCAV-WYENRQIDSA-N rachelmycin Chemical compound C1([C@]23C[C@@H]2CN1C(=O)C=1NC=2C(OC)=C(O)C4=C(C=2C=1)CCN4C(=O)C1=CC=2C=4CCN(C=4C(O)=C(C=2N1)OC)C(N)=O)=CC(=O)C1=C3C(C)=CN1 UOWVMDUEMSNCAV-WYENRQIDSA-N 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 229960003876 ranibizumab Drugs 0.000 description 1
- BMKDZUISNHGIBY-UHFFFAOYSA-N razoxane Chemical compound C1C(=O)NC(=O)CN1C(C)CN1CC(=O)NC(=O)C1 BMKDZUISNHGIBY-UHFFFAOYSA-N 0.000 description 1
- 229960000460 razoxane Drugs 0.000 description 1
- 230000035484 reaction time Effects 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000003259 recombinant expression Methods 0.000 description 1
- 206010038038 rectal cancer Diseases 0.000 description 1
- 201000001275 rectum cancer Diseases 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 230000003578 releasing effect Effects 0.000 description 1
- 230000008521 reorganization Effects 0.000 description 1
- 229960003254 reslizumab Drugs 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- OWPCHSCAPHNHAV-LMONGJCWSA-N rhizoxin Chemical compound C/C([C@H](OC)[C@@H](C)[C@@H]1C[C@H](O)[C@]2(C)O[C@@H]2/C=C/[C@@H](C)[C@]2([H])OC(=O)C[C@@](C2)(C[C@@H]2O[C@H]2C(=O)O1)[H])=C\C=C\C(\C)=C\C1=COC(C)=N1 OWPCHSCAPHNHAV-LMONGJCWSA-N 0.000 description 1
- 108091092562 ribozyme Proteins 0.000 description 1
- 229950004892 rodorubicin Drugs 0.000 description 1
- MBABCNBNDNGODA-WPZDJQSSSA-N rolliniastatin 1 Natural products O1[C@@H]([C@@H](O)CCCCCCCCCC)CC[C@H]1[C@H]1O[C@@H]([C@H](O)CCCCCCCCCC[C@@H](O)CC=2C(O[C@@H](C)C=2)=O)CC1 MBABCNBNDNGODA-WPZDJQSSSA-N 0.000 description 1
- IMUQLZLGWJSVMV-UOBFQKKOSA-N roridin A Natural products CC(O)C1OCCC(C)C(O)C(=O)OCC2CC(=CC3OC4CC(OC(=O)C=C/C=C/1)C(C)(C23)C45CO5)C IMUQLZLGWJSVMV-UOBFQKKOSA-N 0.000 description 1
- 229950009092 rovelizumab Drugs 0.000 description 1
- VHXNKPBCCMUMSW-FQEVSTJZSA-N rubitecan Chemical compound C1=CC([N+]([O-])=O)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VHXNKPBCCMUMSW-FQEVSTJZSA-N 0.000 description 1
- 229950005374 ruplizumab Drugs 0.000 description 1
- 201000003804 salivary gland carcinoma Diseases 0.000 description 1
- 229930182947 sarcodictyin Natural products 0.000 description 1
- 208000010157 sclerosing cholangitis Diseases 0.000 description 1
- 125000005920 sec-butoxy group Chemical group 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 229950008834 seribantumab Drugs 0.000 description 1
- 150000003354 serine derivatives Chemical class 0.000 description 1
- 125000003607 serino group Chemical group [H]N([H])[C@]([H])(C(=O)[*])C(O[H])([H])[H] 0.000 description 1
- 238000007493 shaping process Methods 0.000 description 1
- RAGFPHFDFVNLCG-INYQBOQCSA-N sibiromycin Chemical compound O[C@@H]1[C@@](O)(C)[C@@H](NC)[C@H](C)O[C@H]1OC(C(=C1O)C)=CC(C2=O)=C1N[C@H](O)[C@H]1N2C=C(\C=C\C)C1 RAGFPHFDFVNLCG-INYQBOQCSA-N 0.000 description 1
- RAGFPHFDFVNLCG-UHFFFAOYSA-N sibiromycin Natural products OC1C(O)(C)C(NC)C(C)OC1OC(C(=C1O)C)=CC(C2=O)=C1NC(O)C1N2C=C(C=CC)C1 RAGFPHFDFVNLCG-UHFFFAOYSA-N 0.000 description 1
- 229950008684 sibrotuzumab Drugs 0.000 description 1
- 230000019491 signal transduction Effects 0.000 description 1
- 229910001923 silver oxide Inorganic materials 0.000 description 1
- 229950003804 siplizumab Drugs 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 229950001403 sizofiran Drugs 0.000 description 1
- 210000003491 skin Anatomy 0.000 description 1
- 239000002002 slurry Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000001632 sodium acetate Substances 0.000 description 1
- 235000017281 sodium acetate Nutrition 0.000 description 1
- PPASLZSBLFJQEF-RKJRWTFHSA-M sodium ascorbate Substances [Na+].OC[C@@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RKJRWTFHSA-M 0.000 description 1
- 235000010378 sodium ascorbate Nutrition 0.000 description 1
- 229960005055 sodium ascorbate Drugs 0.000 description 1
- UKLNMMHNWFDKNT-UHFFFAOYSA-M sodium chlorite Chemical compound [Na+].[O-]Cl=O UKLNMMHNWFDKNT-UHFFFAOYSA-M 0.000 description 1
- 229960002218 sodium chlorite Drugs 0.000 description 1
- 239000012312 sodium hydride Substances 0.000 description 1
- 229910000104 sodium hydride Inorganic materials 0.000 description 1
- 239000001488 sodium phosphate Substances 0.000 description 1
- 229910000162 sodium phosphate Inorganic materials 0.000 description 1
- PPASLZSBLFJQEF-RXSVEWSESA-M sodium-L-ascorbate Chemical compound [Na+].OC[C@H](O)[C@H]1OC(=O)C(O)=C1[O-] PPASLZSBLFJQEF-RXSVEWSESA-M 0.000 description 1
- 239000011973 solid acid Substances 0.000 description 1
- 229950006551 sontuzumab Drugs 0.000 description 1
- 230000003595 spectral effect Effects 0.000 description 1
- 229950006315 spirogermanium Drugs 0.000 description 1
- ICXJVZHDZFXYQC-UHFFFAOYSA-N spongistatin 1 Natural products OC1C(O2)(O)CC(O)C(C)C2CCCC=CC(O2)CC(O)CC2(O2)CC(OC)CC2CC(=O)C(C)C(OC(C)=O)C(C)C(=C)CC(O2)CC(C)(O)CC2(O2)CC(OC(C)=O)CC2CC(=O)OC2C(O)C(CC(=C)CC(O)C=CC(Cl)=C)OC1C2C ICXJVZHDZFXYQC-UHFFFAOYSA-N 0.000 description 1
- 239000012258 stirred mixture Substances 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 229960002317 succinimide Drugs 0.000 description 1
- BUUPQKDIAURBJP-UHFFFAOYSA-N sulfinic acid Chemical compound OS=O BUUPQKDIAURBJP-UHFFFAOYSA-N 0.000 description 1
- 125000001010 sulfinic acid amide group Chemical group 0.000 description 1
- 150000003451 sulfinic acid amides Chemical class 0.000 description 1
- 150000003453 sulfinic acid esters Chemical class 0.000 description 1
- 125000000213 sulfino group Chemical group [H]OS(*)=O 0.000 description 1
- 125000000475 sulfinyl group Chemical group [*:2]S([*:1])=O 0.000 description 1
- 125000000020 sulfo group Chemical group O=S(=O)([*])O[H] 0.000 description 1
- 229940124530 sulfonamide Drugs 0.000 description 1
- 150000003456 sulfonamides Chemical class 0.000 description 1
- BDHFUVZGWQCTTF-UHFFFAOYSA-M sulfonate Chemical compound [O-]S(=O)=O BDHFUVZGWQCTTF-UHFFFAOYSA-M 0.000 description 1
- 125000001174 sulfone group Chemical group 0.000 description 1
- 150000003459 sulfonic acid esters Chemical class 0.000 description 1
- 125000000472 sulfonyl group Chemical group *S(*)(=O)=O 0.000 description 1
- 150000003462 sulfoxides Chemical class 0.000 description 1
- WINHZLLDWRZWRT-ATVHPVEESA-N sunitinib Chemical compound CCN(CC)CCNC(=O)C1=C(C)NC(\C=C/2C3=CC(F)=CC=C3NC\2=O)=C1C WINHZLLDWRZWRT-ATVHPVEESA-N 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 208000032649 susceptibility to 9 autism Diseases 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 238000004114 suspension culture Methods 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 238000013268 sustained release Methods 0.000 description 1
- 239000012730 sustained-release form Substances 0.000 description 1
- 229940034785 sutent Drugs 0.000 description 1
- 239000003765 sweetening agent Substances 0.000 description 1
- 210000000225 synapse Anatomy 0.000 description 1
- 230000005062 synaptic transmission Effects 0.000 description 1
- 238000001308 synthesis method Methods 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 230000009885 systemic effect Effects 0.000 description 1
- 229950001072 tadocizumab Drugs 0.000 description 1
- 229940121503 tafasitamab Drugs 0.000 description 1
- 229950004218 talizumab Drugs 0.000 description 1
- FQZYTYWMLGAPFJ-OQKDUQJOSA-N tamoxifen citrate Chemical compound [H+].[H+].[H+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O.C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 FQZYTYWMLGAPFJ-OQKDUQJOSA-N 0.000 description 1
- 229960003454 tamoxifen citrate Drugs 0.000 description 1
- LRBQNJMCXXYXIU-NRMVVENXSA-N tannic acid Chemical compound OC1=C(O)C(O)=CC(C(=O)OC=2C(=C(O)C=C(C=2)C(=O)OC[C@@H]2[C@H]([C@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)[C@@H](OC(=O)C=3C=C(OC(=O)C=4C=C(O)C(O)=C(O)C=4)C(O)=C(O)C=3)O2)OC(=O)C=2C=C(OC(=O)C=3C=C(O)C(O)=C(O)C=3)C(O)=C(O)C=2)O)=C1 LRBQNJMCXXYXIU-NRMVVENXSA-N 0.000 description 1
- 235000015523 tannic acid Nutrition 0.000 description 1
- 229920002258 tannic acid Polymers 0.000 description 1
- 229940033123 tannic acid Drugs 0.000 description 1
- 125000003666 tauryl group Chemical group [H]N([H])C([H])([H])C([H])([H])S(*)(=O)=O 0.000 description 1
- 229950001788 tefibazumab Drugs 0.000 description 1
- 229960004964 temozolomide Drugs 0.000 description 1
- 229960000235 temsirolimus Drugs 0.000 description 1
- QFJCIRLUMZQUOT-UHFFFAOYSA-N temsirolimus Natural products C1CC(O)C(OC)CC1CC(C)C1OC(=O)C2CCCCN2C(=O)C(=O)C(O)(O2)C(C)CCC2CC(OC)C(C)=CC=CC=CC(C)CC(C)C(=O)C(OC)C(O)C(C)=CC(C)C(=O)C1 QFJCIRLUMZQUOT-UHFFFAOYSA-N 0.000 description 1
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 1
- 229960001278 teniposide Drugs 0.000 description 1
- 125000004213 tert-butoxy group Chemical group [H]C([H])([H])C(O*)(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- ISIJQEHRDSCQIU-UHFFFAOYSA-N tert-butyl 2,7-diazaspiro[4.5]decane-7-carboxylate Chemical compound C1N(C(=O)OC(C)(C)C)CCCC11CNCC1 ISIJQEHRDSCQIU-UHFFFAOYSA-N 0.000 description 1
- BCNZYOJHNLTNEZ-UHFFFAOYSA-N tert-butyldimethylsilyl chloride Chemical compound CC(C)(C)[Si](C)(C)Cl BCNZYOJHNLTNEZ-UHFFFAOYSA-N 0.000 description 1
- 125000001981 tert-butyldimethylsilyl group Chemical group [H]C([H])([H])[Si]([H])(C([H])([H])[H])[*]C(C([H])([H])[H])(C([H])([H])[H])C([H])([H])[H] 0.000 description 1
- 125000000037 tert-butyldiphenylsilyl group Chemical group [H]C1=C([H])C([H])=C([H])C([H])=C1[Si]([H])([*]C(C([H])([H])[H])(C([H])([H])[H])C([H])([H])[H])C1=C([H])C([H])=C([H])C([H])=C1[H] 0.000 description 1
- 201000003120 testicular cancer Diseases 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- BPEWUONYVDABNZ-DZBHQSCQSA-N testolactone Chemical compound O=C1C=C[C@]2(C)[C@H]3CC[C@](C)(OC(=O)CC4)[C@@H]4[C@@H]3CCC2=C1 BPEWUONYVDABNZ-DZBHQSCQSA-N 0.000 description 1
- 229960005353 testolactone Drugs 0.000 description 1
- IFLREYGFSNHWGE-UHFFFAOYSA-N tetracene Chemical compound C1=CC=CC2=CC3=CC4=CC=CC=C4C=C3C=C21 IFLREYGFSNHWGE-UHFFFAOYSA-N 0.000 description 1
- RGYLYUZOGHTBRF-BIHRQFPBSA-N tetragastrin Chemical compound C([C@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@@H](NC(=O)[C@@H](N)CC=1C2=CC=CC=C2NC=1)CCSC)C(N)=O)C1=CC=CC=C1 RGYLYUZOGHTBRF-BIHRQFPBSA-N 0.000 description 1
- KHVCOYGKHDJPBZ-WDCZJNDASA-N tetrahydrooxazine Chemical compound OC[C@H]1ONC[C@@H](O)[C@@H]1O KHVCOYGKHDJPBZ-WDCZJNDASA-N 0.000 description 1
- 125000000383 tetramethylene group Chemical group [H]C([H])([*:1])C([H])([H])C([H])([H])C([H])([H])[*:2] 0.000 description 1
- CZDYPVPMEAXLPK-UHFFFAOYSA-N tetramethylsilane Chemical compound C[Si](C)(C)C CZDYPVPMEAXLPK-UHFFFAOYSA-N 0.000 description 1
- 150000003536 tetrazoles Chemical class 0.000 description 1
- 125000003831 tetrazolyl group Chemical group 0.000 description 1
- 231100001274 therapeutic index Toxicity 0.000 description 1
- GVIJJXMXTUZIOD-UHFFFAOYSA-N thianthrene Chemical compound C1=CC=C2SC3=CC=CC=C3SC2=C1 GVIJJXMXTUZIOD-UHFFFAOYSA-N 0.000 description 1
- CBDKQYKMCICBOF-UHFFFAOYSA-N thiazoline Chemical compound C1CN=CS1 CBDKQYKMCICBOF-UHFFFAOYSA-N 0.000 description 1
- 239000002562 thickening agent Substances 0.000 description 1
- JWCVYQRPINPYQJ-UHFFFAOYSA-N thiepane Chemical compound C1CCCSCC1 JWCVYQRPINPYQJ-UHFFFAOYSA-N 0.000 description 1
- XSROQCDVUIHRSI-UHFFFAOYSA-N thietane Chemical compound C1CSC1 XSROQCDVUIHRSI-UHFFFAOYSA-N 0.000 description 1
- VOVUARRWDCVURC-UHFFFAOYSA-N thiirane Chemical compound C1CS1 VOVUARRWDCVURC-UHFFFAOYSA-N 0.000 description 1
- SRVJKTDHMYAMHA-WUXMJOGZSA-N thioacetazone Chemical compound CC(=O)NC1=CC=C(\C=N\NC(N)=S)C=C1 SRVJKTDHMYAMHA-WUXMJOGZSA-N 0.000 description 1
- 125000005300 thiocarboxy group Chemical group C(=S)(O)* 0.000 description 1
- 150000003566 thiocarboxylic acids Chemical class 0.000 description 1
- 125000000858 thiocyanato group Chemical group *SC#N 0.000 description 1
- 125000005031 thiocyano group Chemical group S(C#N)* 0.000 description 1
- BQAJJINKFRRSFO-UHFFFAOYSA-N thiolane Chemical compound C1CCSC1.C1CCSC1 BQAJJINKFRRSFO-UHFFFAOYSA-N 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- BRNULMACUQOKMR-UHFFFAOYSA-N thiomorpholine Chemical compound C1CSCCN1 BRNULMACUQOKMR-UHFFFAOYSA-N 0.000 description 1
- 125000005505 thiomorpholino group Chemical group 0.000 description 1
- WEMNATFLVGEPEW-UHFFFAOYSA-N thiophene Chemical compound C=1C=CSC=1.C=1C=CSC=1 WEMNATFLVGEPEW-UHFFFAOYSA-N 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- 201000002510 thyroid cancer Diseases 0.000 description 1
- YFTWHEBLORWGNI-UHFFFAOYSA-N tiamiprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC(N)=NC2=C1NC=N2 YFTWHEBLORWGNI-UHFFFAOYSA-N 0.000 description 1
- 229950011457 tiamiprine Drugs 0.000 description 1
- PLHJCIYEEKOWNM-HHHXNRCGSA-N tipifarnib Chemical compound CN1C=NC=C1[C@](N)(C=1C=C2C(C=3C=C(Cl)C=CC=3)=CC(=O)N(C)C2=CC=1)C1=CC=C(Cl)C=C1 PLHJCIYEEKOWNM-HHHXNRCGSA-N 0.000 description 1
- 229950009158 tipifarnib Drugs 0.000 description 1
- 238000003354 tissue distribution assay Methods 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- 229950001802 toralizumab Drugs 0.000 description 1
- 125000002088 tosyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1C([H])([H])[H])S(*)(=O)=O 0.000 description 1
- 230000001131 transforming effect Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- IUCJMVBFZDHPDX-UHFFFAOYSA-N tretamine Chemical compound C1CN1C1=NC(N2CC2)=NC(N2CC2)=N1 IUCJMVBFZDHPDX-UHFFFAOYSA-N 0.000 description 1
- 229950001353 tretamine Drugs 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- PXSOHRWMIRDKMP-UHFFFAOYSA-N triaziquone Chemical compound O=C1C(N2CC2)=C(N2CC2)C(=O)C=C1N1CC1 PXSOHRWMIRDKMP-UHFFFAOYSA-N 0.000 description 1
- 229960004560 triaziquone Drugs 0.000 description 1
- 150000003852 triazoles Chemical class 0.000 description 1
- 229930013292 trichothecene Natural products 0.000 description 1
- 150000003327 trichothecene derivatives Chemical class 0.000 description 1
- 125000001889 triflyl group Chemical group FC(F)(F)S(*)(=O)=O 0.000 description 1
- 150000004684 trihydrates Chemical class 0.000 description 1
- KVJXBPDAXMEYOA-CXANFOAXSA-N trilostane Chemical compound OC1=C(C#N)C[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CC[C@@]32O[C@@H]31 KVJXBPDAXMEYOA-CXANFOAXSA-N 0.000 description 1
- 229960001670 trilostane Drugs 0.000 description 1
- 125000003258 trimethylene group Chemical group [H]C([H])([*:2])C([H])([H])C([H])([H])[*:1] 0.000 description 1
- NOYPYLRCIDNJJB-UHFFFAOYSA-O trimetrexate Chemical compound COC1=C(OC)C(OC)=CC(NCC=2C(=C3C(N)=[NH+]C(N)=NC3=CC=2)C)=C1 NOYPYLRCIDNJJB-UHFFFAOYSA-O 0.000 description 1
- 229960001099 trimetrexate Drugs 0.000 description 1
- 229950000212 trioxifene Drugs 0.000 description 1
- BPLUKJNHPBNVQL-UHFFFAOYSA-N triphenylarsine Chemical compound C1=CC=CC=C1[As](C=1C=CC=CC=1)C1=CC=CC=C1 BPLUKJNHPBNVQL-UHFFFAOYSA-N 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- 229960000875 trofosfamide Drugs 0.000 description 1
- UMKFEPPTGMDVMI-UHFFFAOYSA-N trofosfamide Chemical compound ClCCN(CCCl)P1(=O)OCCCN1CCCl UMKFEPPTGMDVMI-UHFFFAOYSA-N 0.000 description 1
- 229960000281 trometamol Drugs 0.000 description 1
- 229950010147 troxacitabine Drugs 0.000 description 1
- RXRGZNYSEHTMHC-BQBZGAKWSA-N troxacitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1O[C@@H](CO)OC1 RXRGZNYSEHTMHC-BQBZGAKWSA-N 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- HDZZVAMISRMYHH-LITAXDCLSA-N tubercidin Chemical compound C1=CC=2C(N)=NC=NC=2N1[C@@H]1O[C@@H](CO)[C@H](O)[C@H]1O HDZZVAMISRMYHH-LITAXDCLSA-N 0.000 description 1
- 229950003364 tucotuzumab celmoleukin Drugs 0.000 description 1
- 108700008509 tucotuzumab celmoleukin Proteins 0.000 description 1
- 208000029729 tumor suppressor gene on chromosome 11 Diseases 0.000 description 1
- 201000007912 type 1 diabetes mellitus 10 Diseases 0.000 description 1
- 229950009811 ubenimex Drugs 0.000 description 1
- 238000004704 ultra performance liquid chromatography Methods 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- 229960001055 uracil mustard Drugs 0.000 description 1
- 210000003932 urinary bladder Anatomy 0.000 description 1
- 229950004362 urtoxazumab Drugs 0.000 description 1
- 206010046766 uterine cancer Diseases 0.000 description 1
- 208000012991 uterine carcinoma Diseases 0.000 description 1
- 238000003828 vacuum filtration Methods 0.000 description 1
- 235000012141 vanillin Nutrition 0.000 description 1
- FGQOOHJZONJGDT-UHFFFAOYSA-N vanillin Natural products COC1=CC(O)=CC(C=O)=C1 FGQOOHJZONJGDT-UHFFFAOYSA-N 0.000 description 1
- MWOOGOJBHIARFG-UHFFFAOYSA-N vanillin Chemical compound COC1=CC(C=O)=CC=C1O MWOOGOJBHIARFG-UHFFFAOYSA-N 0.000 description 1
- LLDWLPRYLVPDTG-UHFFFAOYSA-N vatalanib succinate Chemical compound OC(=O)CCC(O)=O.C1=CC(Cl)=CC=C1NC(C1=CC=CC=C11)=NN=C1CC1=CC=NC=C1 LLDWLPRYLVPDTG-UHFFFAOYSA-N 0.000 description 1
- 229950000815 veltuzumab Drugs 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- 229960003048 vinblastine Drugs 0.000 description 1
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 1
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 1
- 229960004528 vincristine Drugs 0.000 description 1
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 1
- UGGWPQSBPIFKDZ-KOTLKJBCSA-N vindesine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(N)=O)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1N=C1[C]2C=CC=C1 UGGWPQSBPIFKDZ-KOTLKJBCSA-N 0.000 description 1
- 229960004355 vindesine Drugs 0.000 description 1
- GBABOYUKABKIAF-GHYRFKGUSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-GHYRFKGUSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 229950004393 visilizumab Drugs 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 229960001771 vorozole Drugs 0.000 description 1
- XLMPPFTZALNBFS-INIZCTEOSA-N vorozole Chemical compound C1([C@@H](C2=CC=C3N=NN(C3=C2)C)N2N=CN=C2)=CC=C(Cl)C=C1 XLMPPFTZALNBFS-INIZCTEOSA-N 0.000 description 1
- 201000005102 vulva cancer Diseases 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000008215 water for injection Substances 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 238000010626 work up procedure Methods 0.000 description 1
- 229950008250 zalutumumab Drugs 0.000 description 1
- 229950009268 zinostatin Drugs 0.000 description 1
- 229960000641 zorubicin Drugs 0.000 description 1
- FBTUMDXHSRTGRV-ALTNURHMSA-N zorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(\C)=N\NC(=O)C=1C=CC=CC=1)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 FBTUMDXHSRTGRV-ALTNURHMSA-N 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D487/00—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00
- C07D487/02—Heterocyclic compounds containing nitrogen atoms as the only ring hetero atoms in the condensed system, not provided for by groups C07D451/00 - C07D477/00 in which the condensed system contains two hetero rings
- C07D487/04—Ortho-condensed systems
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K31/00—Medicinal preparations containing organic active ingredients
- A61K31/33—Heterocyclic compounds
- A61K31/395—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins
- A61K31/55—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole
- A61K31/551—Heterocyclic compounds having nitrogen as a ring hetero atom, e.g. guanethidine or rifamycins having seven-membered rings, e.g. azelastine, pentylenetetrazole having two nitrogen atoms, e.g. dilazep
- A61K31/5513—1,4-Benzodiazepines, e.g. diazepam or clozapine
- A61K31/5517—1,4-Benzodiazepines, e.g. diazepam or clozapine condensed with five-membered rings having nitrogen as a ring hetero atom, e.g. imidazobenzodiazepines, triazolam
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/62—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being a protein, peptide or polyamino acid
- A61K47/64—Drug-peptide, drug-protein or drug-polyamino acid conjugates, i.e. the modifying agent being a peptide, protein or polyamino acid which is covalently bonded or complexed to a therapeutically active agent
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/68035—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug being a pyrrolobenzodiazepine
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6801—Drug-antibody or immunoglobulin conjugates defined by the pharmacologically or therapeutically active agent
- A61K47/6803—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates
- A61K47/6807—Drugs conjugated to an antibody or immunoglobulin, e.g. cisplatin-antibody conjugates the drug or compound being a sugar, nucleoside, nucleotide, nucleic acid, e.g. RNA antisense
- A61K47/6809—Antibiotics, e.g. antitumor antibiotics anthracyclins, adriamycin, doxorubicin or daunomycin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K47/00—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient
- A61K47/50—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates
- A61K47/51—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent
- A61K47/68—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment
- A61K47/6835—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site
- A61K47/6851—Medicinal preparations characterised by the non-active ingredients used, e.g. carriers or inert additives; Targeting or modifying agents chemically bound to the active ingredient the non-active ingredient being chemically bound to the active ingredient, e.g. polymer-drug conjugates the non-active ingredient being a modifying agent the modifying agent being an antibody, an immunoglobulin or a fragment thereof, e.g. an Fc-fragment the modifying agent being an antibody or an immunoglobulin bearing at least one antigen-binding site the antibody targeting a determinant of a tumour cell
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/32—Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against translation products of oncogenes
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Epidemiology (AREA)
- Organic Chemistry (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Biochemistry (AREA)
- Cell Biology (AREA)
- Oncology (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
- Medicinal Preparation (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
- Reproductive Health (AREA)
- Hematology (AREA)
Abstract
Disclosed herein are selected conjugates of formula (A):
(See Formula A) The conjugates comprise a pyrrolobenzodiazepine (PBD) compound with a linker for connecting to a cell binding agent, wherein the linker is attached in a cleavable manner to the C7 posiiton of the PBD. The cell binding agent is preferably an antibody.
Also disclosed is the PBD compound with the linking unit attached and intermediates for their synthesis.
The conjugates may be useful for treating a proliferative disease in a subject, preferably cancer.
(See Formula A) The conjugates comprise a pyrrolobenzodiazepine (PBD) compound with a linker for connecting to a cell binding agent, wherein the linker is attached in a cleavable manner to the C7 posiiton of the PBD. The cell binding agent is preferably an antibody.
Also disclosed is the PBD compound with the linking unit attached and intermediates for their synthesis.
The conjugates may be useful for treating a proliferative disease in a subject, preferably cancer.
Description
PYRROLOBENZODIAZEPINES AND CONJUGATES THEREOF
The present invention relates to pyrrolobenzodiazepines (PBDs), in particular pyrrolobenzodiazepines having a linker group connected to a cell binding agent.
Background to the invention Pyrrolobenzodiazepines Some pyrrolobenzodiazepines (PBDs) have the ability to recognise and bond to specific sequences of DNA; the preferred sequence is PuGPu. The first PBD antitumour antibiotic, anthramycin, was discovered in 1965 (Leimgruber, et al., J. Am. Chem. Soc., 87, 5793-5795 (1965); Leimgruber, et al., J. Am. Chem. Soc., 87, 5791-5793 (1965)). Since then, a number of naturally occurring PBDs have been reported, and over 10 synthetic routes have been developed to a variety of analogues (Thurston, et al., Chem. Rev. 1994, 433-465 (1994);
Antonow, D. and Thurston, D.E., Chem. Rev. 2011 111 (4), 2815-2864). Family members include abbeymycin (Hochlowski, et al., J. Antibiotics, 40, 145-148 (1987)), chicamycin (Konishi, et al., J. Antibiotics, 37, 200-206 (1984)), DC-81 (Japanese Patent 58-180 487;
Thurston, et al., Chem. Brit., 26, 767-772 (1990); Bose, et al., Tetrahedron, 48, 751-758 (1992)), mazethramycin (Kuminoto, et al., J. Antibiotics, 33, 665-667 (1980)), neothramycins A and B (Takeuchi, et al., J. Antibiotics, 29, 93-96 (1976)), porothramycin (Tsunakawa, et al., J. Antibiotics, 41, 1366-1373 (1988)), prothracarcin (Shimizu, et al, J.
Antibiotics, 29, 2492-2503 (1982); Langley and Thurston, J. Org. Chem., 52, 91-97 (1987)), sibanomicin (DC-102)(Hara, et al., J. Antibiotics, 41, 702-704 (1988); ltoh, et al., J.
Antibiotics, 41, 1281-1284 (1988)), sibiromycin (Leber, et al., J. Am. Chem. Soc., 110, 2992-2993 (1988)) and tomamycin (Arima, et al., J. Antibiotics, 25, 437-444 (1972)). PBDs are of the general structure:
8 \
1 A g . - 2 They differ in the number, type and position of substituents, in both their aromatic A rings and pyrrolo C rings, and in the degree of saturation of the C ring. In the B-ring there is either 30 an imine (N=C), a carbinolamine(NH-CH(OH)), or a carbinolamine methyl ether (NH-CH(OMe)) at the N10-C11 position which is the electrophilic centre responsible for alkylating
The present invention relates to pyrrolobenzodiazepines (PBDs), in particular pyrrolobenzodiazepines having a linker group connected to a cell binding agent.
Background to the invention Pyrrolobenzodiazepines Some pyrrolobenzodiazepines (PBDs) have the ability to recognise and bond to specific sequences of DNA; the preferred sequence is PuGPu. The first PBD antitumour antibiotic, anthramycin, was discovered in 1965 (Leimgruber, et al., J. Am. Chem. Soc., 87, 5793-5795 (1965); Leimgruber, et al., J. Am. Chem. Soc., 87, 5791-5793 (1965)). Since then, a number of naturally occurring PBDs have been reported, and over 10 synthetic routes have been developed to a variety of analogues (Thurston, et al., Chem. Rev. 1994, 433-465 (1994);
Antonow, D. and Thurston, D.E., Chem. Rev. 2011 111 (4), 2815-2864). Family members include abbeymycin (Hochlowski, et al., J. Antibiotics, 40, 145-148 (1987)), chicamycin (Konishi, et al., J. Antibiotics, 37, 200-206 (1984)), DC-81 (Japanese Patent 58-180 487;
Thurston, et al., Chem. Brit., 26, 767-772 (1990); Bose, et al., Tetrahedron, 48, 751-758 (1992)), mazethramycin (Kuminoto, et al., J. Antibiotics, 33, 665-667 (1980)), neothramycins A and B (Takeuchi, et al., J. Antibiotics, 29, 93-96 (1976)), porothramycin (Tsunakawa, et al., J. Antibiotics, 41, 1366-1373 (1988)), prothracarcin (Shimizu, et al, J.
Antibiotics, 29, 2492-2503 (1982); Langley and Thurston, J. Org. Chem., 52, 91-97 (1987)), sibanomicin (DC-102)(Hara, et al., J. Antibiotics, 41, 702-704 (1988); ltoh, et al., J.
Antibiotics, 41, 1281-1284 (1988)), sibiromycin (Leber, et al., J. Am. Chem. Soc., 110, 2992-2993 (1988)) and tomamycin (Arima, et al., J. Antibiotics, 25, 437-444 (1972)). PBDs are of the general structure:
8 \
1 A g . - 2 They differ in the number, type and position of substituents, in both their aromatic A rings and pyrrolo C rings, and in the degree of saturation of the C ring. In the B-ring there is either 30 an imine (N=C), a carbinolamine(NH-CH(OH)), or a carbinolamine methyl ether (NH-CH(OMe)) at the N10-C11 position which is the electrophilic centre responsible for alkylating
2 DNA. All of the known natural products have an (S)-configuration at the chiral C11 a position which provides them with a right-handed twist when viewed from the C ring towards the A
ring. This gives them the appropriate three-dimensional shape for isohelicity with the minor groove of B-form DNA, leading to a snug fit at the binding site (Kohn, In Antibiotics III.
Springer-Verlag, New York, pp. 3-11 (1975); Hurley and Needham-VanDevanter, Acc.
Chem. Res., 19, 230-237 (1986)). Their ability to form an adduct in the minor groove, enables them to interfere with DNA processing, hence their use as antitumour agents.
A particularly advantageous pyrrolobenzodiazepine compound is described by Gregson et al. (Chem. Commun. 1999, 797-798) as compound 1, and by Gregson et al. (J.
Med. Chem.
2001, 44, 1161-1174) as compound 4a. This compound, also known as SJG-136, is shown below:
N
OMe Me0 Other dimeric PBD compounds, such as those bearing C2 aryl substituents in WO
2005/085251, have been disclosed, an example being:
00 N, H
N OMe Me0 N
Me0 OMe These compounds have been shown to be highly useful cytotoxic agents.
Antibody-drug conjugates Antibody therapy has been established for the targeted treatment of patients with cancer, immunological and angiogenic disorders (Carter, P. (2006) Nature Reviews Immunology 6:343-357). The use of antibody-drug conjugates (ADC), i.e. immunoconjugates, for the local delivery of cytotoxic or cytostatic agents, i.e. drugs to kill or inhibit tumor cells in the treatment of cancer, targets delivery of the drug moiety to tumors, and intracellular accumulation therein, whereas systemic administration of these unconjugated drug agents may result in unacceptable levels of toxicity to normal cells as well as the tumor cells sought to be eliminated (Xie et al (2006) Expert. Opin. Biol. Ther. 6(3):281-291;
Kovtun et al (2006)
ring. This gives them the appropriate three-dimensional shape for isohelicity with the minor groove of B-form DNA, leading to a snug fit at the binding site (Kohn, In Antibiotics III.
Springer-Verlag, New York, pp. 3-11 (1975); Hurley and Needham-VanDevanter, Acc.
Chem. Res., 19, 230-237 (1986)). Their ability to form an adduct in the minor groove, enables them to interfere with DNA processing, hence their use as antitumour agents.
A particularly advantageous pyrrolobenzodiazepine compound is described by Gregson et al. (Chem. Commun. 1999, 797-798) as compound 1, and by Gregson et al. (J.
Med. Chem.
2001, 44, 1161-1174) as compound 4a. This compound, also known as SJG-136, is shown below:
N
OMe Me0 Other dimeric PBD compounds, such as those bearing C2 aryl substituents in WO
2005/085251, have been disclosed, an example being:
00 N, H
N OMe Me0 N
Me0 OMe These compounds have been shown to be highly useful cytotoxic agents.
Antibody-drug conjugates Antibody therapy has been established for the targeted treatment of patients with cancer, immunological and angiogenic disorders (Carter, P. (2006) Nature Reviews Immunology 6:343-357). The use of antibody-drug conjugates (ADC), i.e. immunoconjugates, for the local delivery of cytotoxic or cytostatic agents, i.e. drugs to kill or inhibit tumor cells in the treatment of cancer, targets delivery of the drug moiety to tumors, and intracellular accumulation therein, whereas systemic administration of these unconjugated drug agents may result in unacceptable levels of toxicity to normal cells as well as the tumor cells sought to be eliminated (Xie et al (2006) Expert. Opin. Biol. Ther. 6(3):281-291;
Kovtun et al (2006)
3 Cancer Res. 66(6):3214-3121; Law et al (2006) Cancer Res. 66(4):2328-2337; Wu et al (2005) Nature Biotech. 23(9):1137-1145; Lambert J. (2005) Current Opin. in Pharmacol.
5:543-549; Hamann P. (2005) Expert Opin. Ther. Patents 15(9):1087-1103; Payne, G.
(2003) Cancer Cell 3:207-212; Trail et al (2003) Cancer Immunol. Immunother.
52:328-337;
Syrigos and Epenetos (1999) Anticancer Research 19:605-614).
Maximal efficacy with minimal toxicity is sought thereby. Efforts to design and refine ADC
have focused on the selectivity of monoclonal antibodies (mAbs) as well as drug mechanism of action, drug-linking, drug/antibody ratio (loading), and drug-releasing properties (Junutula, et al., 2008b Nature Biotech., 26(8):925-932; Dornan et al (2009) Blood 114(13):2721-2729;
US 7521541; US 7723485; W02009/052249; McDonagh (2006) Protein Eng. Design &
Sel.
19(7): 299-307; Doronina et al (2006) Bioconj. Chem. 17:114-124; Erickson et al (2006) Cancer Res. 66(8):1-8; Sanderson et al (2005) Clin. Cancer Res. 11:843-852;
Jeffrey et al (2005) J. Med. Chem. 48:1344-1358; Hamblett et al (2004) Clin. Cancer Res.
10:7063-7070). Drug moieties may impart their cytotoxic and cytostatic effects by mechanisms including tubulin binding, DNA binding, or topoisomerase inhibition. Some cytotoxic drugs tend to be inactive or less active when conjugated to large antibodies or protein receptor ligands.
PBDs in ADCs Dimeric PBDs have been disclosed as the drugs in drug conjugates. For example, in WO
2011/130598, dimer PBD compounds having linker groups for connection to a cell binding agent, such as an antibody, are disclosed where the linker group is attached to one of the available N10 positions, and are generally cleaved by action of an enzyme on the linker group.
By contrast, in WO 2011/130613 and WO 2011/130616, dimer PBD compounds having linker groups for connection to a cell binding agent, such as an antibody, are disclosed where the linker group is attached via an aromatic group at one of the C2 postions, and are generally cleaved by action of an enzyme on the linker group. Such antibody drug conjugates are also described in Flyagre, J., et al, Chem. Biol. Drug Des. 81:
(2013), which also describes other types of antibody drug conjugates.
A further approach is described in WO 2007/085930, wherein tomamycin-like dimers have a linker group for connection to a cell binding agent, such as an antibody, where the linker
5:543-549; Hamann P. (2005) Expert Opin. Ther. Patents 15(9):1087-1103; Payne, G.
(2003) Cancer Cell 3:207-212; Trail et al (2003) Cancer Immunol. Immunother.
52:328-337;
Syrigos and Epenetos (1999) Anticancer Research 19:605-614).
Maximal efficacy with minimal toxicity is sought thereby. Efforts to design and refine ADC
have focused on the selectivity of monoclonal antibodies (mAbs) as well as drug mechanism of action, drug-linking, drug/antibody ratio (loading), and drug-releasing properties (Junutula, et al., 2008b Nature Biotech., 26(8):925-932; Dornan et al (2009) Blood 114(13):2721-2729;
US 7521541; US 7723485; W02009/052249; McDonagh (2006) Protein Eng. Design &
Sel.
19(7): 299-307; Doronina et al (2006) Bioconj. Chem. 17:114-124; Erickson et al (2006) Cancer Res. 66(8):1-8; Sanderson et al (2005) Clin. Cancer Res. 11:843-852;
Jeffrey et al (2005) J. Med. Chem. 48:1344-1358; Hamblett et al (2004) Clin. Cancer Res.
10:7063-7070). Drug moieties may impart their cytotoxic and cytostatic effects by mechanisms including tubulin binding, DNA binding, or topoisomerase inhibition. Some cytotoxic drugs tend to be inactive or less active when conjugated to large antibodies or protein receptor ligands.
PBDs in ADCs Dimeric PBDs have been disclosed as the drugs in drug conjugates. For example, in WO
2011/130598, dimer PBD compounds having linker groups for connection to a cell binding agent, such as an antibody, are disclosed where the linker group is attached to one of the available N10 positions, and are generally cleaved by action of an enzyme on the linker group.
By contrast, in WO 2011/130613 and WO 2011/130616, dimer PBD compounds having linker groups for connection to a cell binding agent, such as an antibody, are disclosed where the linker group is attached via an aromatic group at one of the C2 postions, and are generally cleaved by action of an enzyme on the linker group. Such antibody drug conjugates are also described in Flyagre, J., et al, Chem. Biol. Drug Des. 81:
(2013), which also describes other types of antibody drug conjugates.
A further approach is described in WO 2007/085930, wherein tomamycin-like dimers have a linker group for connection to a cell binding agent, such as an antibody, where the linker
4 group is attached to the tether between the tomamycin units, and are generally cleaved by action of an enzyme on the linker group.
The present inventors have developed a novel approach to forming PBD
conjugates with cell binding agents, and in particular PBD antibody conjugates.
Summary of the Invention In a general aspect the present invention provides a conjugate comprising a PBD compound with a linker for connecting to a cell binding agent, wherein the linker is attached in a non-cleavable manner to the C7 position of the one PBD units. The cell binding agent is preferably an antibody. The invention also provides the PBD compound with the linking unit attached, and intermediates for their synthesis.
In a first aspect, the present invention provides a conjugate of formula A:
R R \ R11 A
and salts and solvates thereof, wherein:
D represents either group D1 or D2:
ate.s.5.f. C3 0 R
=
, the dotted line indicates the optional presence of a double bond between C2 and C3;
when there is a double bond present between C2 and C3, R2 is selected from the group consisting of:
(ia) C5_10 aryl group, optionally substituted by one or more substituents selected from the group comprising: halo, nitro, cyano, ether, carboxy, ester, C1_7 alkyl, C3_7 heterocyclyl and bis-oxy-C1_3 alkylene;
(ib) C1_5 saturated aliphatic alkyl;
(ic) C3-6 saturated cycloalkyl;
(id) R , wherein each of R31, R32 and R33 are independently selected from H, C1_3 saturated alkyl, C2_3 alkenyl, C2_3 alkynyl and cyclopropyl, where the total number of carbon atoms in the R2 group is no more than 5;
R35b ;R35a (ie) , wherein one of R35a and R35b is H and the other is selected from:
The present inventors have developed a novel approach to forming PBD
conjugates with cell binding agents, and in particular PBD antibody conjugates.
Summary of the Invention In a general aspect the present invention provides a conjugate comprising a PBD compound with a linker for connecting to a cell binding agent, wherein the linker is attached in a non-cleavable manner to the C7 position of the one PBD units. The cell binding agent is preferably an antibody. The invention also provides the PBD compound with the linking unit attached, and intermediates for their synthesis.
In a first aspect, the present invention provides a conjugate of formula A:
R R \ R11 A
and salts and solvates thereof, wherein:
D represents either group D1 or D2:
ate.s.5.f. C3 0 R
=
, the dotted line indicates the optional presence of a double bond between C2 and C3;
when there is a double bond present between C2 and C3, R2 is selected from the group consisting of:
(ia) C5_10 aryl group, optionally substituted by one or more substituents selected from the group comprising: halo, nitro, cyano, ether, carboxy, ester, C1_7 alkyl, C3_7 heterocyclyl and bis-oxy-C1_3 alkylene;
(ib) C1_5 saturated aliphatic alkyl;
(ic) C3-6 saturated cycloalkyl;
(id) R , wherein each of R31, R32 and R33 are independently selected from H, C1_3 saturated alkyl, C2_3 alkenyl, C2_3 alkynyl and cyclopropyl, where the total number of carbon atoms in the R2 group is no more than 5;
R35b ;R35a (ie) , wherein one of R35a and R35b is H and the other is selected from:
5 phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl; and =st (if) R34 , where R34 is selected from: H; C1_3 saturated alkyl;
C2_3 alkenyl; C2_3 alkynyl; cyclopropyl; phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl;
(ig) halo;
when there is a single bond present between C2 and C3, R36a 6b R2 is R , where R36a and R36b are independently selected from H, F, C1_4 saturated alkyl, C2-3 alkenyl, which alkyl and alkenyl groups are optionally substituted by a group selected from C1_4 alkyl amido and C1_4 alkyl ester; or, when one of R16a and R16b is H, the other is selected from nitrile and a C1_4 alkyl ester;
R6 and R9 are independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo;
either (a) R19 is H, and R11 is OH or ORA, where RA is C1_4 alkyl; or (b) R19 and R11 form a nitrogen-carbon double bond between the nitrogen and carbon atoms to which they are bound; or (c) R19 is H and R11 is OSOzM, where z is 2 or 3 and M is a monovalent pharmaceutically acceptable cation; or (d) R11 is OH or ORA, where RA is C1_4 alkyl and R19 is selected from:
C2_3 alkenyl; C2_3 alkynyl; cyclopropyl; phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl;
(ig) halo;
when there is a single bond present between C2 and C3, R36a 6b R2 is R , where R36a and R36b are independently selected from H, F, C1_4 saturated alkyl, C2-3 alkenyl, which alkyl and alkenyl groups are optionally substituted by a group selected from C1_4 alkyl amido and C1_4 alkyl ester; or, when one of R16a and R16b is H, the other is selected from nitrile and a C1_4 alkyl ester;
R6 and R9 are independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo;
either (a) R19 is H, and R11 is OH or ORA, where RA is C1_4 alkyl; or (b) R19 and R11 form a nitrogen-carbon double bond between the nitrogen and carbon atoms to which they are bound; or (c) R19 is H and R11 is OSOzM, where z is 2 or 3 and M is a monovalent pharmaceutically acceptable cation; or (d) R11 is OH or ORA, where RA is C1_4 alkyl and R19 is selected from:
6 Ph I
0=S=0 /
(d-i) * ;
I
(d-ii) * ;
0 Rz (d-iii) * , where Rz is selected from:
*--0.._ -.0 N
/ \
\ N/
1 .
(z-i) (z-ii) OC(=0)CH3;
(z-iii) NO2;
(z-iv) OMe;
(z-v) glucoronide;
(z-vi) -C(=0)-X1-NHC(=0)X2-NH-R, where -C(=0)-X1-NH- and -C(=0)-X2-NH- represent natural amino acid residues and Rzc is selected from Me, OMe, OCH2CH20Me;
0=S=0 /
(d-i) * ;
I
(d-ii) * ;
0 Rz (d-iii) * , where Rz is selected from:
*--0.._ -.0 N
/ \
\ N/
1 .
(z-i) (z-ii) OC(=0)CH3;
(z-iii) NO2;
(z-iv) OMe;
(z-v) glucoronide;
(z-vi) -C(=0)-X1-NHC(=0)X2-NH-R, where -C(=0)-X1-NH- and -C(=0)-X2-NH- represent natural amino acid residues and Rzc is selected from Me, OMe, OCH2CH20Me;
7 Y is selected from formulae A1, A2 and A3:
CBA
\ n H
N¨N HN,Z2 ....
µrN I
0 .T.
z1 7 o I.,.
(A1) (A2) o )¨"I
\
0*\ 0 n _______________________ f */0.,/
(A3) Z1 is a C1_3 alkylene group;
Z2 is a C1_3 alkylene group;
Z3 is a C1_3 alkylene group;
L is a linker connected to a cell binding agent;
CBA is the cell binding agent;
n is an integer between 0 and 48;
R and R' are each independently selected from optionally substituted C1-12 alkyl, C3-20 heterocyclyl and C5-20 aryl groups, and optionally in relation to the group NRR', R and R' together with the nitrogen atom to which they are attached form an optionally substituted 4-, 5-, 6- or 7-membered heterocyclic ring;
R8 is either:
(a) independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo; or (b) of formula A*:
CBA
\ n H
N¨N HN,Z2 ....
µrN I
0 .T.
z1 7 o I.,.
(A1) (A2) o )¨"I
\
0*\ 0 n _______________________ f */0.,/
(A3) Z1 is a C1_3 alkylene group;
Z2 is a C1_3 alkylene group;
Z3 is a C1_3 alkylene group;
L is a linker connected to a cell binding agent;
CBA is the cell binding agent;
n is an integer between 0 and 48;
R and R' are each independently selected from optionally substituted C1-12 alkyl, C3-20 heterocyclyl and C5-20 aryl groups, and optionally in relation to the group NRR', R and R' together with the nitrogen atom to which they are attached form an optionally substituted 4-, 5-, 6- or 7-membered heterocyclic ring;
R8 is either:
(a) independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo; or (b) of formula A*:
8 N X ,X, , 0" y H,, R,.
D' 0 R16 A*
wherein:
D' represents either group D'1 or D2:
C2' jrc...õ. C3' 0 c3 R
D'1 D'2 wherein the dotted line indicates the optional presence of a double bond between C2' and C3';
R17 is independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo;
R" is a C3_12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. 0, S, N(H), NMe and/or aromatic rings, e.g. benzene or pyridine, which rings are optionally substituted; and X and X' are independently selected from 0, S and N(H); and R22, R16, R19, R20 and rc .-.21 are as defined for R2, Rs, R9, R10 and R11 respectively.
Thus formula A is selected from the following formulae A-I, A-II and A-Ill, depending on Y:
D' 0 R16 A*
wherein:
D' represents either group D'1 or D2:
C2' jrc...õ. C3' 0 c3 R
D'1 D'2 wherein the dotted line indicates the optional presence of a double bond between C2' and C3';
R17 is independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo;
R" is a C3_12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. 0, S, N(H), NMe and/or aromatic rings, e.g. benzene or pyridine, which rings are optionally substituted; and X and X' are independently selected from 0, S and N(H); and R22, R16, R19, R20 and rc .-.21 are as defined for R2, Rs, R9, R10 and R11 respectively.
Thus formula A is selected from the following formulae A-I, A-II and A-Ill, depending on Y:
9 Y A
(A1) 9 r,10 R rc \ R11 A-I
N) N¨N
\
---\--, 0 \
L 13./8) /
(A2) 9 r,10 R rµ \N R11 0 le N H
A-II
I
HN
on n N
L¨
(A3) R R \ R11 A-III
CI
H N>
kj¨ X n H
N
L¨( CBA o When R8 is A*, the compound is of the formula A*A:
R
' ,X
el X R17 D' 0 R16 ?ON
A"A
A second aspect of the present invention provides novel drug-linker compounds of formula 5 (B):
9 r_,10 yL 1.1 and salts and solvates thereof, wherein:
YL is selected from formulae B1, B2 and B3:
n H
N-N\I\ 2 (21 (B1) (B2) c n ___________________ [\il /0,1st (B3) G is a linker for connecting to a cell binding agent; and the remaining groups are as defined in the first aspect.
A third aspect of the present invention also provides compounds of formula (C), which may be used in the preparation of the drug-linkers and conjugates of the invention:
R9 R1 o \
H
yc 0 N
R6 o D
c and salts and solvates thereof, Yc is selected from from formulae C1, C2 and C3:
III Hn'N 2 Z
Zo 0 s J. 7 (C1) (C2) (C3) Z3 (C3) and the remaining groups are as defined in the first aspect.
A fourth aspect of the present invention provides the use of a compound of the first aspect of the invention in a method of medical treatment. The fourth aspect also provides a pharmaceutical composition comprising a compound of the first aspect, and a pharmaceutically acceptable excipient.
A fifth aspect of the present invention provides a compound of the first aspect of the invention or a pharmaceutical composition of the fourth aspect of the invention for use in a method of treatment of a proliferative disease. The fifth aspect also provides the use of a compound of the first aspect in a method of manufacture of a medicament for the treatment of a proliferative disease, and a method of treating a mammal having a proliferative disease, comprising administering an effective amount of a compound of the first aspect or a pharmaceutical composition of the fourth aspect.
A sixth aspect of the present invention provides a method of synthesis of a compound of the first aspect of the present invention, comprising the step of conjugating a drug-linker of the second aspect with a cell-binding agent.
A seventh aspect of the present invention provides a method of synthesis of a drug-linke of the second aspect, comprising the step of reacting a compound of the third aspect with one or more suitable reagents.
Detailed Description of the Invention Preferences The following preferences may apply to all aspects of the invention as described above, or may relate to a single aspect. The preferences may be combined together in any combination.
D
In some embodiments, D is D1.
In some embodiments, D is D2.
In some embodiments, R8 may be independently selected from H, OH, OR, SH, SR, NH2, NHR, NRR', and halo.
In some embodiments, R8 may be independently selected from H, OH and OR, where R
may be selected from optionally substituted C1_7 alkyl, C3_10 heterocyclyl and C5_10 aryl groups. R in R8 may in some of these embodiments be a C1_4 alkyl group, which may or may not be substituted. A substituent of interest is a C5_6 aryl group (e.g.
phenyl).
In some embodiments, R8 is selected from OMe and OCH2Ph.
In some embodiments, R8 is of formula A*, such that the compound is a PBD
dimer.
Dimer link X and X' are preferably O.
R" is a C3_12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. 0, S, N(H), NMe and/or aromatic rings, e.g. benzene or pyridine, which rings are optionally substituted.
In some embodiments, R" may be C3_12 alkylene group, which chain may be interrupted by one or more heteroatoms and/or aromatic rings, e.g. benzene or pyridine.
In some embodiments, R" may be C3_12 alkylene group which is optionally interrupted by one or more heteroatoms selected from 0, S, and NMe and/or aromatic rings, which rings are optionally substituted.
In some embodiments, the aromatic ring is a C5_20 arylene group, where arylene pertains to a divalent moiety obtained by removing two hydrogen atoms from two aromatic ring atoms of an aromatic compound, which moiety has from 5 to 20 ring atoms.
In some embodiments, R" may be a C3_12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. 0, S, N(H), NMe and/or aromatic rings, e.g.
benzene or pyridine, which rings are optionally substituted by NH2.
In some embodiments, R" may be C3-12 alkylene group.
In some embodiments, R" may be selected from a C3, C5, C7, C9 and a C11 alkylene group.
In some embodiments, R" may be selected from a C3, C5 and a C7 alkylene group.
In some embodiments, R" may be selected from a C3 and a C5 alkylene group.
In some embodiments, R" is a C3 alkylene group.
In some embodiments, R" is a C5 alkylene group.
The alkylene groups listed above may be optionally interrupted by one or more heteroatoms and/or aromatic rings, e.g. benzene or pyridine, which rings are optionally substituted.
The alkylene groups listed above may be optionally interrupted by one or more heteroatoms and/or aromatic rings, e.g. benzene or pyridine.
The alkylene groups listed above may be unsubstituted linear aliphatic alkylene groups.
R" is preferably a C3_7 alkylene group with no substituents. More preferably R" is a C3, C5 or C7 alkylene. Most preferably, R" is a C3 or C5 alkylene.
In some embodiments, R6 may be independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo.
In some embodiments, R6 may be independently selected from H, OH, OR, SH, NH2, and halo.
In some embodiments, R6 is independently selected from H and halo.
In some embodiments, R6 is independently H.
These embodiments also apply to R16.
In some embodiments, R9 may be independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo.
In some embodiments, R9 is independently H.
These embodiments also apply to R19.
In some embodiments, R17 may be independently selected from H, OH, OR, SH, SR, NH2, NHR, NRR', and halo.
In some embodiments, R17 may be independently selected from H, OH and OR, where R
may be selected from optionally substituted C1-7 alkyl, C3_10 heterocycly1 and C5_10 aryl groups. R in R17 may in some of these embodiments be a C1-4 alkyl group, which may or may not be substituted. A substituent of interest is a C5-6 aryl group (e.g.
phenyl).
In some embodiments, R17 is selected from OMe and OCH2Ph.
When R2 is a C5_10 aryl group, in some embodiments it may be a C5_7 aryl group. A C5_7 aryl group may be a phenyl group or a C5_7 heteroaryl group, for example furanyl, thiophenyl and pyridyl. In some embodiments, R2 may be phenyl. In other embodiments, R2 may be thiophenyl, for example, thiophen-2-y1 and thiophen-3-yl.
When R2 is a C5_10 aryl group, it some embodiments it may be a C8_10 aryl, for example a quinolinyl or isoquinolinyl group. The quinolinyl or isoquinolinyl group may be bound to the PBD core through any available ring position. For example, the quinolinyl may be quinolin-2-yl, quinolin-3-yl, quinolin-4y1, quinolin-5-yl, quinolin-6-yl, quinolin-7-y1 and quinolin-8-yl. Of 5 these quinolin-3-y1 and quinolin-6-ylmay be preferred. The isoquinolinyl may be isoquinolin-1-yl, isoquinolin-3-yl, isoquinolin-4y1, isoquinolin-5-yl, isoquinolin-6-yl, isoquinolin-7-y1 and isoquinolin-8-yl. Of these isoquinolin-3-y1 and isoquinolin-6-y1 may be preferred.
When R2 is a C5-10 aryl group, it may bear any number of substituent groups.
In some
(A1) 9 r,10 R rc \ R11 A-I
N) N¨N
\
---\--, 0 \
L 13./8) /
(A2) 9 r,10 R rµ \N R11 0 le N H
A-II
I
HN
on n N
L¨
(A3) R R \ R11 A-III
CI
H N>
kj¨ X n H
N
L¨( CBA o When R8 is A*, the compound is of the formula A*A:
R
' ,X
el X R17 D' 0 R16 ?ON
A"A
A second aspect of the present invention provides novel drug-linker compounds of formula 5 (B):
9 r_,10 yL 1.1 and salts and solvates thereof, wherein:
YL is selected from formulae B1, B2 and B3:
n H
N-N\I\ 2 (21 (B1) (B2) c n ___________________ [\il /0,1st (B3) G is a linker for connecting to a cell binding agent; and the remaining groups are as defined in the first aspect.
A third aspect of the present invention also provides compounds of formula (C), which may be used in the preparation of the drug-linkers and conjugates of the invention:
R9 R1 o \
H
yc 0 N
R6 o D
c and salts and solvates thereof, Yc is selected from from formulae C1, C2 and C3:
III Hn'N 2 Z
Zo 0 s J. 7 (C1) (C2) (C3) Z3 (C3) and the remaining groups are as defined in the first aspect.
A fourth aspect of the present invention provides the use of a compound of the first aspect of the invention in a method of medical treatment. The fourth aspect also provides a pharmaceutical composition comprising a compound of the first aspect, and a pharmaceutically acceptable excipient.
A fifth aspect of the present invention provides a compound of the first aspect of the invention or a pharmaceutical composition of the fourth aspect of the invention for use in a method of treatment of a proliferative disease. The fifth aspect also provides the use of a compound of the first aspect in a method of manufacture of a medicament for the treatment of a proliferative disease, and a method of treating a mammal having a proliferative disease, comprising administering an effective amount of a compound of the first aspect or a pharmaceutical composition of the fourth aspect.
A sixth aspect of the present invention provides a method of synthesis of a compound of the first aspect of the present invention, comprising the step of conjugating a drug-linker of the second aspect with a cell-binding agent.
A seventh aspect of the present invention provides a method of synthesis of a drug-linke of the second aspect, comprising the step of reacting a compound of the third aspect with one or more suitable reagents.
Detailed Description of the Invention Preferences The following preferences may apply to all aspects of the invention as described above, or may relate to a single aspect. The preferences may be combined together in any combination.
D
In some embodiments, D is D1.
In some embodiments, D is D2.
In some embodiments, R8 may be independently selected from H, OH, OR, SH, SR, NH2, NHR, NRR', and halo.
In some embodiments, R8 may be independently selected from H, OH and OR, where R
may be selected from optionally substituted C1_7 alkyl, C3_10 heterocyclyl and C5_10 aryl groups. R in R8 may in some of these embodiments be a C1_4 alkyl group, which may or may not be substituted. A substituent of interest is a C5_6 aryl group (e.g.
phenyl).
In some embodiments, R8 is selected from OMe and OCH2Ph.
In some embodiments, R8 is of formula A*, such that the compound is a PBD
dimer.
Dimer link X and X' are preferably O.
R" is a C3_12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. 0, S, N(H), NMe and/or aromatic rings, e.g. benzene or pyridine, which rings are optionally substituted.
In some embodiments, R" may be C3_12 alkylene group, which chain may be interrupted by one or more heteroatoms and/or aromatic rings, e.g. benzene or pyridine.
In some embodiments, R" may be C3_12 alkylene group which is optionally interrupted by one or more heteroatoms selected from 0, S, and NMe and/or aromatic rings, which rings are optionally substituted.
In some embodiments, the aromatic ring is a C5_20 arylene group, where arylene pertains to a divalent moiety obtained by removing two hydrogen atoms from two aromatic ring atoms of an aromatic compound, which moiety has from 5 to 20 ring atoms.
In some embodiments, R" may be a C3_12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. 0, S, N(H), NMe and/or aromatic rings, e.g.
benzene or pyridine, which rings are optionally substituted by NH2.
In some embodiments, R" may be C3-12 alkylene group.
In some embodiments, R" may be selected from a C3, C5, C7, C9 and a C11 alkylene group.
In some embodiments, R" may be selected from a C3, C5 and a C7 alkylene group.
In some embodiments, R" may be selected from a C3 and a C5 alkylene group.
In some embodiments, R" is a C3 alkylene group.
In some embodiments, R" is a C5 alkylene group.
The alkylene groups listed above may be optionally interrupted by one or more heteroatoms and/or aromatic rings, e.g. benzene or pyridine, which rings are optionally substituted.
The alkylene groups listed above may be optionally interrupted by one or more heteroatoms and/or aromatic rings, e.g. benzene or pyridine.
The alkylene groups listed above may be unsubstituted linear aliphatic alkylene groups.
R" is preferably a C3_7 alkylene group with no substituents. More preferably R" is a C3, C5 or C7 alkylene. Most preferably, R" is a C3 or C5 alkylene.
In some embodiments, R6 may be independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo.
In some embodiments, R6 may be independently selected from H, OH, OR, SH, NH2, and halo.
In some embodiments, R6 is independently selected from H and halo.
In some embodiments, R6 is independently H.
These embodiments also apply to R16.
In some embodiments, R9 may be independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo.
In some embodiments, R9 is independently H.
These embodiments also apply to R19.
In some embodiments, R17 may be independently selected from H, OH, OR, SH, SR, NH2, NHR, NRR', and halo.
In some embodiments, R17 may be independently selected from H, OH and OR, where R
may be selected from optionally substituted C1-7 alkyl, C3_10 heterocycly1 and C5_10 aryl groups. R in R17 may in some of these embodiments be a C1-4 alkyl group, which may or may not be substituted. A substituent of interest is a C5-6 aryl group (e.g.
phenyl).
In some embodiments, R17 is selected from OMe and OCH2Ph.
When R2 is a C5_10 aryl group, in some embodiments it may be a C5_7 aryl group. A C5_7 aryl group may be a phenyl group or a C5_7 heteroaryl group, for example furanyl, thiophenyl and pyridyl. In some embodiments, R2 may be phenyl. In other embodiments, R2 may be thiophenyl, for example, thiophen-2-y1 and thiophen-3-yl.
When R2 is a C5_10 aryl group, it some embodiments it may be a C8_10 aryl, for example a quinolinyl or isoquinolinyl group. The quinolinyl or isoquinolinyl group may be bound to the PBD core through any available ring position. For example, the quinolinyl may be quinolin-2-yl, quinolin-3-yl, quinolin-4y1, quinolin-5-yl, quinolin-6-yl, quinolin-7-y1 and quinolin-8-yl. Of 5 these quinolin-3-y1 and quinolin-6-ylmay be preferred. The isoquinolinyl may be isoquinolin-1-yl, isoquinolin-3-yl, isoquinolin-4y1, isoquinolin-5-yl, isoquinolin-6-yl, isoquinolin-7-y1 and isoquinolin-8-yl. Of these isoquinolin-3-y1 and isoquinolin-6-y1 may be preferred.
When R2 is a C5-10 aryl group, it may bear any number of substituent groups.
In some
10 embodiments, it may bear from 1 to 3 substituent groups. In some embodiments, it may bear 1 or 2 substituent groups. In some embodiments, it may bear a single substituent group. The substituents may be any position.
Where R2 is C5_7 aryl group, in some embodiments a single substituent may be on a ring 15 atom that is not adjacent the bond to the remainder of the compound, i.e. it may be [3 or y to the bond to the remainder of the compound. Therefore, in embodiments where the C5_7 aryl group is phenyl, the substituent may be in the meta- or para- positions, or may be in the para- position.
Where R2 is a C8_10 aryl group, for example quinolinyl or isoquinolinyl, in some embodiments there may be any number of substituents at any position of the quinoline or isoquinoline rings. In some embodiments, it bears one, two or three substituents, and these may be on either the proximal and distal rings or both (if more than one substituent).
R2 substituents, when R2 is a C5_10 aryl group In embodiments where a substituent on R2 when R2 is a C8_10 aryl group is halo, it may be F
or CI, and in some of these embodiments Cl.
In embodiments where a substituent on R2 when R2 is a C8_10 aryl group is ether, it may in some embodiments be an alkoxy group, for example, a C1_7 alkoxy group (e.g.
methoxy, ethoxy) or it may in some embodiments be a C5_7 aryloxy group (e.g phenoxy, pyridyloxy, furanyloxy). The alkoxy group may itself be further substituted, for example by an amino group (e.g. dimethylamino).
In embodiments where a substituent on R2 when R2 is is a C5-10 aryl group is C1-7 alkyl, it may be a C1-4 alkyl group (e.g. methyl, ethyl, propryl, butyl).
In embodiments where a substituent on R2 when R2 is a C5-10 aryl group is C3-7 heterocyclyl, it may be C6 nitrogen containing heterocyclyl group, e.g. morpholino, thiomorpholino, piperidinyl, piperazinyl. These groups may be bound to the rest of the PBD
moiety via the nitrogen atom. These groups may be further substituted, for example, by C1-4 alkyl groups.
If the C6 nitrogen containing heterocyclyl group is piperazinyl, the said further substituent may be on the second nitrogen ring atom.
In embodiments where a substituent on R2 when R2 is a C5-10 aryl group is bis-oxy-C1-3 alkylene, this may be bis-oxy-methylene or bis-oxy-ethylene.
In embodiments where a substituent on R2 when R2 is a C5_10 aryl group is ester, this is preferably methyl ester or ethyl ester.
In some embodiments, substituents when R2 is a C5_10 aryl group may include methoxy, ethoxy, fluoro, chloro, cyano, bis-oxy-methylene, methyl-piperazinyl, morpholino, methyl-thiophenyl, dimethylaminopropyloxy and carboxy.
In some embodiments, R2 may be selected from 4-methoxy-phenyl, 3-methoxyphenyl, 4-ethoxy-phenyl, 3-ethoxy-phenyl, 4-fluoro-phenyl, 4-chloro-phenyl, 3,4-bisoxymethylene-phenyl, 4-methylthiophenyl, 4-cyanophenyl, 4-phenoxyphenyl, quinolin-3-y1 and quinolin-6-yl, isoquinolin-3-y1 and isoquinolin-6-yl, 2-thienyl, 2-furanyl, methoxynaphthyl, naphthyl, 4-nitrophenyl, 4-(4-methylpiperazin-1-yl)phenyl and 3,4-bisoxymethylene-phenyl.
When R2 is C1_5 saturated aliphatic alkyl, it may be methyl, ethyl, propyl, butyl or pentyl. In some embodiments, it may be methyl, ethyl or propyl (n-pentyl or isopropyl).
In some of these embodiments, it may be methyl. In other embodiments, it may be butyl or pentyl, which may be linear or branched.
When R2 is C3-6 saturated cycloalkyl, it may be cyclopropyl, cyclobutyl, cyclopentyl or cyclohexyl. In some embodiments, it may be cyclopropyl.
,sfyR33 When R2 is R31 , in some embodiments, the total number of carbon atoms in the R2 group is no more than 4 or no more than 3.
In some embodiments, one of R31, R32 and R33 is H, with the other two groups being selected from H, C1_3 saturated alkyl, C2_3 alkenyl, C2_3 alkynyl and cyclopropyl.
In other embodiments, two of R31, R32 and R33 are H, with the other group being selected from H, C1_3 saturated alkyl, C2-3 alkenyl, C2_3 alkynyl and cyclopropyl.
In some embodiments, the groups that are not H are selected from methyl and ethyl. In some of these embodiments, the groups that are not H are methyl.
In some embodiments, R31 is H.
In some embodiments, R32 is H.
In some embodiments, R33 is H.
In some embodiments, R31 and R32 are H.
In some embodiments, R31 and R33 are H.
In some embodiments, R32 and R33 are H.
A R2 group of particular interest is: .
R35b .sR35a When R2 is , in some embodiments, the group (R35a or R35b) which is not H is optionally substituted phenyl. If the phenyl optional substituent is halo, it may be fluoro.
In some embodiment, the phenyl group is unsubstituted.
When R2 is .st R34 , in some embodiments where R34 is phenyl, it is unsubstituted. In other embodiments, the phenyl group bears a single fluoro substituent. In other emboidments, R14 is selected from H, methyl, ethyl, ethenyl and ethynyl. In some of these embodiments, R14 is selected from H and methyl.
When R2 is halo, in some embodiments, it is fluoro.
R36a 1.6b When there is a single bond present between C2 and C3, R2 is R .
In some embodiments, R36a and R36b are both H.
In other embodiments, R36a and R36b are both methyl.
In further embodiments, one of R36a and R36b is H, and the other is selected from C1_4 saturated alkyl, C2_3 alkenyl, which alkyl and alkenyl groups are optionally substituted. In some of these further embodiment, the group which is not H may be selected from methyl and ethyl.
The above preferences for R2 when there is a double bond present between C2 and C3 apply equally to R22, when there is a double bond present between C2' and C3'.
The above preferences for R2 when there is a single bond present between C2 and C3 apply equally to R22, when there is a single bond present between C2' and C3'.
In some embodiment, R1 is H, and R" is OH, ORA, where RA is C1_4 alkyl. In some of these embodiments, R" is OH. In others of these embodiments, R11 is ORA, where RA is alkyl. In some of these embodiments, RA is methyl.
In some embodiments, R1 and R" form a nitrogen-carbon double bond between the nitrogen and carbon atoms to which they are bound.
In some embodiments, R1 is H and R11 is OSO,M, where z is 2 or 3 and M is a monovalent pharmaceutically acceptable cation. In some of these embodiments, M is a monovalent pharmaceutically acceptable cation, and may be Na. Furthermore, in some embodiments z is 3.
In some embodiments where R1 is (d-iii), there may be an additional ntiro group on the benzene ring, e.g. ortho to Rz.
In some embodiments, R11 is OH or ORA, where RA is C1_4 alkyl and R1 is selected from:
R10a Ph I
0=S= 0 H
--.
Riob I
¨
Rloc r N
0 N, el v R1Od 0 Me )( _ R10e 0, 0 ........,.
R1of 0 OMe 0, 0 ¨
Riog OH
H 0õ,,).,s 0 H
.070 SI OH
¨
Rion H zc 0 xlNyX2sl\lR
H
¨
-C(=0)-X1-NHC(=0)X2-NH- represent a dipeptide. The amino acids in the dipeptide may be any combination of natural amino acids. The dipeptide may be the site of action for cathepsin-mediated cleavage.
In one embodiment, the dipeptide, -C(=0)-X1-NHC(=0)X2-NH-, is selected from:
-Phe-Lys-, -Val-Ala-, -Val-Lys-, 10 -Ala-Lys-, -Val-Cit-, -Phe-Cit-, -Leu-Cit-, -1Ie-Cit-, 15 -Phe-Arg-, -Trp-Cit-where Cit is citrulline.
Preferably, the dipeptide, -C(=0)-X1-NHC(=0)X2-NH-, is selected from:
-Phe-Lys-, -Val-Ala-, -Val-Lys-, -Ala-Lys-, -Val-Cit-.
Most preferably, the dipeptide, -C(=0)-X1-NHC(=0)X2-NH-, is -Phe-Lys- or -Val-Ala-.
Other dipeptide combinations may be used, including those described by Dubowchik et al., Bioconjugate Chemistry, 2002, 13,855-869, which is incorporated herein by reference.
In one embodiment, the amino acid side chain is derivatised, where appropriate. For example, an amino group or carboxy group of an amino acid side chain may be derivatised.
In one embodiment, an amino group NH2 of a side chain amino acid, such as lysine, is a derivatised form selected from the group consisting of NHR and NRR'.
In one embodiment, a carboxy group COOH of a side chain amino acid, such as aspartic acid, is a derivatised form selected from the group consisting of COOR, CONH2, CONHR
and CONRR'.
In one embodiment, the amino acid side chain is chemically protected, where appropriate.
The side chain protecting group may be a group as discussed above. The present inventors have established that protected amino acid sequences are cleavable by enzymes.
For example, it has been established that a dipeptide sequence comprising a Boc side chain-protected Lys residue is cleavable by cathepsin.
Protecting groups for the side chains of amino acids are well known in the art and are described in the Novabiochem Catalog. Additional protecting group strategies are set out in Protective Groups in Organic Synthesis, Greene and Wuts.
Possible side chain protecting groups are shown below for those amino acids having reactive side chain functionality:
Arg: Z, Mtr, Tos;
Asn: Trt, Xan;
Asp: BzI, t-Bu;
Cys: Acm, BzI, Bz1-0Me, Bzl-Me, Trt;
Glu: BzI, t-Bu;
Gln: Trt, Xan;
His: Boc, Dnp, Tos, Trt;
Lys: Boc, Z-CI, Fmoc, Z, Alloc;
Ser: BzI, TBDMS, TBDPS;
Thr: Bz;
Trp: Boc;
Tyr: BzI, Z, Z-Br.
In one embodiment, the side chain protection is selected to be orthogonal to a group provided as, or as part of, a capping group, where present. Thus, the removal of the side chain protecting group does not remove the capping group, or any protecting group functionality that is part of the capping group.
In other embodiments of the invention, the amino acids selected are those having no reactive side chain functionality. For example, the amino acids may be selected from: Ala, Gly, Ile, Leu, Met, Phe, Pro, and Val.
It is particularly preferred in the present invention, that if L1 comprises a dipeptide, then -C(=0)-X1-NHC(=0)X2-NH- is the same dipeptide.
Other preferred R1 groups include:
OH
and ¨
The above preferences apply equally to R2 and R21.
R and R' In some embodiments, R is independently selected from optionally substituted C1_12 alkyl, C3_20 heterocyclyl and C5_20 aryl groups. These groups are each defined in the substituents section below.
In some embodiments, R is independently optionally substituted C1-12 alkyl. In other embodiments, R is independently optionally substituted C3-20 heterocyclyl. In further embodiments, R is independently optionally substituted C5-20 aryl. In further embodiments, R
is independently optionally substituted C1-12 alkyl.
Described above in relation to R2 are various embodiments relating to preferred alkyl and aryl groups and the identity and number of optional substituents. The preferences set out for R2 as it applies to R are applicable, where appropriate, to all other groups R.
The preferences for R apply also to R'.
In some embodiments of the invention there is provided a compound having a substituent group -NRR'. In one embodiment, R and R' together with the nitrogen atom to which they are attached form an optionally substituted 4-, 5-, 6- or 7-membered heterocyclic ring. The ring may contain a further heteroatom, for example N, 0 or S. In some of these embodiments, the heterocyclic ring is itself substituted with a group R. Where a further N
heteroatom is present, the substituent may be on the N heteroatom.
Dimers In some embodiments, the groups X', D, R16, R19, R29 and R21 are the same as the groups X, D', R6, R9, R19 and R11 respectively. In these embodiments, the PBD monomer units have the same substituents except for at the 7 position.
Particularly preferred compounds of the first aspect of the present invention may be of formula la:
la R2a, OR1a Y R2a where R10, R11, R20, .-.21 1-< and Y are as defined above;
m is 1 or 3;
Rla is methyl or phenyl; and R2a is selected from:
*
(a) Me0 (b) ;
(c) ;
(d) =
(e) (f) < 0 VI
(0) ;and =
(h) Particularly preferred compounds of the first aspect of the present invention may be of formula lb:
R
lb ORia where R10, R11, R20, .-.21 1-< and Y are as defined above;
m is 1 or 3; and Rla is methyl or phenyl.
Particularly preferred compounds of the second aspect of the present invention may be of formula Ila:
R \ Rii H N 0 õ..4.....--.),..,.0 0 N H
-,, m Ila L
R2 a8---: 1401 ORla Y ¨ 1\1Ij-..,R2a where 5 R10, R11, R20, R21 and s r 4_ are as defined above;
m is 1 or 3;
R1 a is methyl or phenyl; and R2a is selected from:
O*
(a) Me0 .
, 10 (b) =
(c) ;
*
I.
(d) =
, .V.* .
(e) (f) =
, <O
15 (g) ;and rN SI
,Nj (h) Particularly preferred compounds of the second aspect of the present invention may be of formula Ilb:
R
R
Ilb ORia where R10, R11, R20, R21 an r s-L
are as defined above;
m is 1 or 3; and IRla is methyl or phenyl.
Particularly preferred compounds of the third aspect of the present invention may be of formula Illa:
R
¨N 00 Illa =
la N OR
R2a R2a where R10, R11, R20, R21 an r s-c are as defined above;
m is 1 or 3;
IRla is methyl or phenyl; and R2a is selected from:
*
(a) Me0 (b) (c) ;
(d) =
(e) (f) \z oo is (0) ;and Nj (h) .
Particularly preferred compounds of the third aspect of the present invention may be of formula Illb:
R
rc / R Illb11 -'-.
N 0 C)i a m c *I \ N
OR Y N
where R10, R11, R20, R21 and Y s-c are as defined above;
m is 1 or 3; and Rla is methyl or phenyl.
Z1, Z2, Z3 In some embodiments, Z1 is methylene. In some embodiments, Z1 is ethylene. In some embodiments, Z1 is propylene.
In some embodiments, Z2 is methylene. In some embodiments, Z2 is ethylene. In some embodiments, Z2 is propylene.
In some embodiments, Z3 is methylene. In some embodiments, Z3 is ethylene. In some embodiments, Z3 is propylene.
n (Y, YL) In some embodiments, n (in Y or YL) is an integer between 0 and 24.
In some embodiments, n (in Y or YL) is an integer between 0 and 12.
In some embodiments, n (in Y or YL) is an integer between 0 and 8.
In some embodiments, n (in Y or YL) is an integer between 0 and 6.
In some embodiments, n (in Y or Y) is 0.
In some embodiments, n (in Y or Y) is 1.
In some embodiments, n (in Y or Y) is 2.
In some embodiments, n (in Y or Y) is 3.
In some embodiments, n (in Y or Y) is 4.
In some embodiments, n (in Y or Y) is 5.
In some embodiments, n (in Y or Y) is 6.
In some embodiments, n (in Y or Y) is 7.
In some embodiments, n (in Y or Y) is 8.
In some embodiments, Z1 is methylene and n is 3.
In some embodiments, Z2 is propylene and n is 8.
L and G
L is a linker connected to the cell binding agent in the conjugate conmpound.
G is a linker for connecting the PBD dimer to the cell binding agent to form the conjugate compound.
Preferably, the linker contains an electrophilic functional group for reaction with a nucleophilic functional group on the cell binding agent. Nucleophilic groups on antibodies include, but are not limited to: (i) N-terminal amine groups, (ii) side chain amine groups, e.g.
lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated. Amine, thiol, and hydroxyl groups are nucleophilic and capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents including: (i) maleimide groups (ii) activated disulfides, (iii) active esters such as NHS (N-hydroxysuccinimide) esters, HOBt (N-hydroxybenzotriazole) esters, haloformates, and acid halides; (iv) alkyl and benzyl halides such as haloacetamides; and (v) aldehydes, ketones, carboxyl, and, some of which are exemplified as follows:
\ 1 H
,,O...................
/ Br,...................,--......õwõ...........v Br\
._...N( H
\ 0 Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges. Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol). Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol. Reactive thiol groups may be introduced into the antibody (or fragment thereof) by introducing one, two, three, four, or more cysteine residues (e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues). US
7521541 teaches engineering antibodies by introduction of reactive cysteine amino acids.
In some embodiments, a Linker has a reactive nucleophilic group which is reactive with an electrophilic group present on an antibody. Useful electrophilic groups on an antibody include, but are not limited to, aldehyde and ketone carbonyl groups. The heteroatom of a nucleophilic group of a Linker can react with an electrophilic group on an antibody and form a covalent bond to an antibody unit. Useful nucleophilic groups on a Linker include, but are not limited to, hydrazide, oxime, amino, hydroxyl, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide. The electrophilic group on an antibody provides a convenient site for attachment to a Linker.
In one embodiment, the group L is:
o o where the asterisk indicates the point of attachment to the rest of group Y, the wavy line indicates the point of attachment to the cell binding agent, and m is 0 to 6. In one 5 embodiment, m is 5.
In one embodiment, the connection between the cell binding agent and L is through a thiol residue of the cell binding agent and a maleimide group of L.
10 In one embodiment, the connection between the cell binding agent and L
is:
0 *
_ti,L\I
S
¨\--\--\¨\/ 0 where the asterisk indicates the point of attachment to the remaining portion of the L
group or the remaining portion of the Y group and the wavy line indicates the point of attachment to the remaining portion of the cell binding agent. In this embodiment, the S
15 atom is typically derived from the cell binding agent.
In each of the embodiments above, an alternative functionality may be used in place of the maleimide-derived group shown below:
/ N *
20 where the wavy line indicates the point of attachment to the cell binding agent as before, and the asterisk indicates the bond to the remaining portion of the L
group or the remaining portion of the Y group.
In one embodiment, the maleimide-derived group is replaced with the group:
Hi 0 where the wavy line indicates point of attachment to the cell binding agent, and the asterisk indicates the bond to the remaining portion of the L group or the remaining portion of the Y group.
In one embodiment, the maleimide-derived group is replaced with a group, which optionally together with the cell binding agent, is selected from:
-C(=O)N H-, -C(=0)0-, -NHC(=0)-, -0C(=0)-, -0C(=0)0-, -NHC(=0)0-, -0C(=0)NH-, -NHC(=0)NH-, -NHC(=0)NH, -C(=0)NHC(=0)-, -S-, -S-S-, -CH2C(=0)--C(=0)CH2-, =N-NH-, and -NH-N=.
In one embodiment, the maleimide-derived group is replaced with a group, which optionally together with the cell binding agent, is selected from:
/-'-rs'- /--/-/-/--\ \
N,* N
1\tµ j N\\
N N
*
where the wavy line indicates either the point of attachment to the cell binding agent or the bond to the remaining portion of the L group or the remaining portion of the Y group, and the asterisk indicates the other of the point of attachment to the cell binding agent or the bond to the remaining portion of the L group or the remaining portion of the Y
group.
Other groups that can be used as L for connecting the remaining portion of the Y group to the cell binding agent are described in WO 2005/082023.
Thus, in embodiments of the present invention, L is of formula:
-LA-(CH2)m-Where m is from 0 to 6; and LA is selected from:
(01-1) _______________________________________________________________________ 0 (06) CBA
CBA NA
\
(01_2) 0 (LA7) CBA1 CBA N' y (LA2) ________________________________________________________________________ 0 (08_1) CBA
A 1\1 N N
(03-1) (08-2) N __ L. CBA
CBA >I1 S I\ µI\1 (L A3-2) _________________________________ (L A9-1 ) N \ N
CBI_ s)---I \
CBA
(LA4 ) al (LA9-2) N
IN
CBA
(LA5) 0 CBA1 ,/
O¨
where Ar represents a C5_6 arylene group, e.g. phenylene.
Thus, in embodiments of the present invention, G is of formula:
GA-(CH2)m-Where m is from 0 to 6; and GA is selected from:
(GA1-1) 0 (GA4) ..... ei, / ./
\ Hal N-1 H
Where Hal = I, Br, Cl (GA1-2) 0 \
(GA2) 0 (GA5) 0 Hal _1\(C))-(GA3-1) >1, (GA6) 0 S-S
/ ( 0 24 \ N
+/ ti\/1 (No2) where the NO2 group is optional (GA3-2) >1, (GA7) Br¨,.õ
s¨s it (No2) where the NO2 group is optional (GA3-3) (G A8) \\ j.
S-S)---1 ( \ N
02N ¨/
where the NO2 group is optional (GA3-4) (GA9) N3 S-S)--I
where the NO2 group is optional where Ar represents a C5_6 arylene group, e.g. phenylene.
In some embodiments, m may be 2 or 5.
Cell Binding Agent A cell binding agent may be of any kind, and include peptides and non-peptides. These can include antibodies or a fragment of an antibody that contains at least one binding site, lymphokines, hormones, hormone mimetics, vitamins, growth factors, nutrient-transport molecules, or any other cell binding molecule or substance.
Peptides In one embodiment, the cell binding agent is a linear or cyclic peptide comprising 4-30, preferably 6-20, contiguous amino acid residues. In this embodiment, it is preferred that one cell binding agent is linked to one monomer or dimer pyrrolobenzodiazepine compound.
In one embodiment the cell binding agent comprises a peptide that binds integrin av[36. The peptide may be selective for av[36 over XYS.
In one embodiment the cell binding agent comprises the A2OFMDV-Cys polypeptide. The A2OFMDV-Cys has the sequence: NAVPNLRGDLQVLAQKVARTC. Alternatively, a variant of the A2OFMDV-Cys sequence may be used wherein one, two, three, four, five, six, seven, eight, nine or ten amino acid residues are substituted with another amino acid residue.
Furthermore, the polypeptide may have the sequence NAVXXXXXXXXXXXXXXXRTC.
Antibodies The term "antibody" herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity (Miller et al (2003) Jour. of Immunology 170:4854-4861). Antibodies may be murine, human, humanized, chimeric, or derived from other species. An antibody is a protein generated by the immune system that is capable of recognizing and binding to a specific antigen.
(Janeway, C., Travers, P., Wa!port, M., Shlomchik (2001) Immuno Biology, 5th Ed., Garland Publishing, New York). A target antigen generally has numerous binding sites, also called 5 epitopes, recognized by CDRs on multiple antibodies. Each antibody that specifically binds to a different epitope has a different structure. Thus, one antigen may have more than one corresponding antibody. An antibody includes a full-length immunoglobulin molecule or an immunologically active portion of a full-length immunoglobulin molecule, i.e., a molecule that contains an antigen binding site that immunospecifically binds an antigen of a target of 10 interest or part thereof, such targets including but not limited to, cancer cell or cells that produce autoimmune antibodies associated with an autoimmune disease. The immunoglobulin can be of any type (e.g. IgG, IgE, IgM, IgD, and IgA), class (e.g. IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass of immunoglobulin molecule. The immunoglobulins can be derived from any species, including human, murine, or rabbit origin.
"Antibody fragments" comprise a portion of a full length antibody, generally the antigen binding or variable region thereof. Examples of antibody fragments include Fab, Fab', F(ab1)2, and scFv fragments; diabodies; linear antibodies; fragments produced by a Fab expression library, anti-idiotypic (anti-ld) antibodies, CDR (complementary determining region), and epitope-binding fragments of any of the above which immunospecifically bind to cancer cell antigens, viral antigens or microbial antigens, single-chain antibody molecules;
and multispecific antibodies formed from antibody fragments.
The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations which include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The modifier "monoclonal"
indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al (1975) Nature 256:495, or may be made by recombinant DNA methods (see, US
4816567).
The monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al (1991) Nature, 352:624-628; Marks et al (1991) J.
Mol. Biol., 222:581-597 or from transgenic mice carrying a fully human immunoglobulin system (Lonberg (2008) Curr. Opinion 20(4):450-459).
The monoclonal antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (US 4816567; and Morrison et al (1984) Proc. Natl. Acad. Sci. USA, 81:6851-6855). Chimeric antibodies include "primatized"
antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g. Old World Monkey or Ape) and human constant region sequences.
An "intact antibody" herein is one comprising a VL and VH domains, as well as a light chain constant domain (CL) and heavy chain constant domains, CH1, CH2 and CH3. The constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variant thereof. The intact antibody may have one or more "effector functions" which refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody. Examples of antibody effector functions include C1q binding;
complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; and down regulation of cell surface receptors such as B
cell receptor and BCR.
Depending on the amino acid sequence of the constant domain of their heavy chains, intact antibodies can be assigned to different "classes." There are five major classes of intact antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into "subclasses" (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy-chain constant domains that correspond to the different classes of antibodies are called a, 6, E, y, and p, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
Humanisation Techniques to reduce the in vivo immunogenicity of a non-human antibody or antibody fragment include those termed "humanisation".
A "humanized antibody" refers to a polypeptide comprising at least a portion of a modified variable region of a human antibody wherein a portion of the variable region, preferably a portion substantially less than the intact human variable domain, has been substituted by the corresponding sequence from a non-human species and wherein the modified variable region is linked to at least another part of another protein, preferably the constant region of a human antibody. The expression "humanized antibodies" includes human antibodies in which one or more complementarity determining region ("CDR") amino acid residues and/or one or more framework region ("FW" or "FR") amino acid residues are substituted by amino acid residues from analogous sites in rodent or other non-human antibodies.
The expression "humanized antibody" also includes an immunoglobulin amino acid sequence variant or fragment thereof that comprises an FR having substantially the amino acid sequence of a human immunoglobulin and a CDR having substantially the amino acid sequence of a non-human immunoglobulin.
"Humanized" forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. Or, looked at another way, a humanized antibody is a human antibody that also contains selected sequences from non-human (e.g. murine) antibodies in place of the human sequences. A
humanized antibody can include conservative amino acid substitutions or non-natural residues from the same or different species that do not significantly alter its binding and/or biologic activity.
Such antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulins.
There are a range of humanisation techniques, including 'CDR grafting', 'guided selection', `deimmunization', 'resurfacing' (also known as Veneering'), 'composite antibodies', 'Human String Content Optimisation' and framework shuffling.
CDR grafting In this technique, the humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient antibody are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, camel, bovine, goat, or rabbit having the desired properties (in effect, the non-human CDRs are 'grafted' onto the human framework). In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues (this may happen when, for example, a particular FR residue has significant effect on antigen binding).
Furthermore, humanized antibodies can comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further refine and maximize antibody performance. Thus, in general, a humanized antibody will comprise all of at least one, and in one aspect two, variable domains, in which all or all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), or that of a human immunoglobulin.
Guided selection The method consists of combining the VH or VI_ domain of a given non-human antibody specific for a particular epitope with a human VH or VI_ library and specific human V domains are selected against the antigen of interest. This selected human VH is then combined with a VL library to generate a completely human VHxVL combination. The method is described in Nature Biotechnology (N.Y.) 12, (1994) 899-903.
Composite antibodies In this method, two or more segments of amino acid sequence from a human antibody are combined within the final antibody molecule. They are constructed by combining multiple human VH and VL sequence segments in combinations which limit or avoid human T
cell epitopes in the final composite antibody V regions. Where required, T cell epitopes are limited or avoided by, exchanging V region segments contributing to or encoding a T cell epitope with alternative segments which avoid T cell epitopes. This method is described in US 2008/0206239 Al.
Deimmunization This method involves the removal of human (or other second species) T-cell epitopes from the V regions of the therapeutic antibody (or other molecule). The therapeutic antibodies V-region sequence is analysed for the presence of MHC class II- binding motifs by, for example, comparison with databases of MHC-binding motifs (such as the "motifs"
database hosted at vvww.wehi.edu.au). Alternatively, MHC class II- binding motifs may be identified using computational threading methods such as those devised by Altuvia et al.
(J. Mol. Biol.
249 244-250 (1995)); in these methods, consecutive overlapping peptides from the V-region sequences are testing for their binding energies to MHC class II proteins.
This data can then be combined with information on other sequence features which relate to successfully presented peptides, such as amphipathicity, Rothbard motifs, and cleavage sites for cathepsin B and other processing enzymes.
Once potential second species (e.g. human) T-cell epitopes have been identified, they are eliminated by the alteration of one or more amino acids. The modified amino acids are usually within the T-cell epitope itself, but may also be adjacent to the epitope in terms of the primary or secondary structure of the protein (and therefore, may not be adjacent in the primary structure). Most typically, the alteration is by way of substitution but, in some circumstances amino acid addition or deletion will be more appropriate.
All alterations can be accomplished by recombinant DNA technology, so that the final molecule may be prepared by expression from a recombinant host using well established methods such as Site Directed Mutagenesis. However, the use of protein chemistry or any other means of molecular alteration is also possible.
Resurfacing This method involves:
(a) determining the conformational structure of the variable region of the non-human (e.g. rodent) antibody (or fragment thereof) by constructing a three-dimensional model of the non-human antibody variable region;
(b) generating sequence alignments using relative accessibility distributions from x-ray crystallographic structures of a sufficient number of non-human and human antibody variable region heavy and light chains to give a set of heavy and light chain framework positions wherein the alignment positions are identical in 98% of the sufficient number of non-human antibody heavy and light chains;
(c) defining for the non-human antibody to be humanized, a set of heavy and light chain surface exposed amino acid residues using the set of framework positions generated in step (b);
(d) identifying from human antibody amino acid sequences a set of heavy and light chain surface exposed amino acid residues that is most closely identical to the set of surface exposed amino acid residues defined in step (c), wherein the heavy and light chain from the human antibody are or are not naturally paired;
(e) substituting, in the amino acid sequence of the non-human antibody to be humanized, the set of heavy and light chain surface exposed amino acid residues defined in step (c) with the set of heavy and light chain surface exposed amino acid residues identified in step (d);
5 (f) constructing a three-dimensional model of the variable region of the non-human antibody resulting from the substituting specified in step (e);
(g) identifying, by comparing the three-dimensional models constructed in steps (a) and (f), any amino acid residues from the sets identified in steps (c) or (d), that are within 5 Angstroms of any atom of any residue of the complementarity determining regions of the 10 non-human antibodt to be humanized; and (h) changing any residues identified in step (g) from the human to the original non-human amino acid residue to thereby define a non-human antibody humanizing set of surface exposed amino acid residues; with the proviso that step (a) need not be conducted first, but must be conducted prior to step (g).
Superhumanization The method compares the non-human sequence with the functional human germline gene repertoire. Those human genes encoding canonical structures identical or closely related to the non-human sequences are selected. Those selected human genes with highest homology within the CDRs are chosen as FR donors. Finally, the non-human CDRs are grafted onto these human FRs. This method is described in patent WO
2005/079479 A2.
Human String Content Optimization This method compares the non-human (e.g. mouse) sequence with the repertoire of human germline genes and the differences are scored as Human String Content (HSC) that quantifies a sequence at the level of potential MHC/T-cell epitopes. The target sequence is then humanized by maximizing its HSC rather than using a global identity measure to generate multiple diverse humanized variants (described in Molecular Immunology, 44, (2007) 1986-1998).
Framework Shuffling The CDRs of the non-human antibody are fused in-frame to cDNA pools encompassing all known heavy and light chain human germline gene frameworks. Humanised antibodies are then selected by e.g. panning of the phage displayed antibody library. This is described in Methods 36, 43-60 (2005).
Examples of cell binding agents include those agents described for use in WO
2007/085930, which is incorporated herein.
Tumour-associate antigens and cognate antibodies for use in embodiments of the present invention are listed below.
TUMOR-ASSOCIATED ANTIGENS AND COGNATE ANTIBODIES
(1) BMPR1B (bone morphogenetic protein receptor-type IB) Nucleotide Genbank accession no. NM_001203 Genbank version no. NM_001203.2 GI:169790809 Genbank record update date: Sep 23, 2012 02:06 PM
Polypeptide Genbank accession no. NP_001194 Genbank version no. NP_001194.1 GI:4502431 Genbank record update date: Sep 23, 2012 02:06 PM
Cross-references ten Dijke,P., et al Science 264 (5155): 101-104 (1994), Oncogene 14 10
Where R2 is C5_7 aryl group, in some embodiments a single substituent may be on a ring 15 atom that is not adjacent the bond to the remainder of the compound, i.e. it may be [3 or y to the bond to the remainder of the compound. Therefore, in embodiments where the C5_7 aryl group is phenyl, the substituent may be in the meta- or para- positions, or may be in the para- position.
Where R2 is a C8_10 aryl group, for example quinolinyl or isoquinolinyl, in some embodiments there may be any number of substituents at any position of the quinoline or isoquinoline rings. In some embodiments, it bears one, two or three substituents, and these may be on either the proximal and distal rings or both (if more than one substituent).
R2 substituents, when R2 is a C5_10 aryl group In embodiments where a substituent on R2 when R2 is a C8_10 aryl group is halo, it may be F
or CI, and in some of these embodiments Cl.
In embodiments where a substituent on R2 when R2 is a C8_10 aryl group is ether, it may in some embodiments be an alkoxy group, for example, a C1_7 alkoxy group (e.g.
methoxy, ethoxy) or it may in some embodiments be a C5_7 aryloxy group (e.g phenoxy, pyridyloxy, furanyloxy). The alkoxy group may itself be further substituted, for example by an amino group (e.g. dimethylamino).
In embodiments where a substituent on R2 when R2 is is a C5-10 aryl group is C1-7 alkyl, it may be a C1-4 alkyl group (e.g. methyl, ethyl, propryl, butyl).
In embodiments where a substituent on R2 when R2 is a C5-10 aryl group is C3-7 heterocyclyl, it may be C6 nitrogen containing heterocyclyl group, e.g. morpholino, thiomorpholino, piperidinyl, piperazinyl. These groups may be bound to the rest of the PBD
moiety via the nitrogen atom. These groups may be further substituted, for example, by C1-4 alkyl groups.
If the C6 nitrogen containing heterocyclyl group is piperazinyl, the said further substituent may be on the second nitrogen ring atom.
In embodiments where a substituent on R2 when R2 is a C5-10 aryl group is bis-oxy-C1-3 alkylene, this may be bis-oxy-methylene or bis-oxy-ethylene.
In embodiments where a substituent on R2 when R2 is a C5_10 aryl group is ester, this is preferably methyl ester or ethyl ester.
In some embodiments, substituents when R2 is a C5_10 aryl group may include methoxy, ethoxy, fluoro, chloro, cyano, bis-oxy-methylene, methyl-piperazinyl, morpholino, methyl-thiophenyl, dimethylaminopropyloxy and carboxy.
In some embodiments, R2 may be selected from 4-methoxy-phenyl, 3-methoxyphenyl, 4-ethoxy-phenyl, 3-ethoxy-phenyl, 4-fluoro-phenyl, 4-chloro-phenyl, 3,4-bisoxymethylene-phenyl, 4-methylthiophenyl, 4-cyanophenyl, 4-phenoxyphenyl, quinolin-3-y1 and quinolin-6-yl, isoquinolin-3-y1 and isoquinolin-6-yl, 2-thienyl, 2-furanyl, methoxynaphthyl, naphthyl, 4-nitrophenyl, 4-(4-methylpiperazin-1-yl)phenyl and 3,4-bisoxymethylene-phenyl.
When R2 is C1_5 saturated aliphatic alkyl, it may be methyl, ethyl, propyl, butyl or pentyl. In some embodiments, it may be methyl, ethyl or propyl (n-pentyl or isopropyl).
In some of these embodiments, it may be methyl. In other embodiments, it may be butyl or pentyl, which may be linear or branched.
When R2 is C3-6 saturated cycloalkyl, it may be cyclopropyl, cyclobutyl, cyclopentyl or cyclohexyl. In some embodiments, it may be cyclopropyl.
,sfyR33 When R2 is R31 , in some embodiments, the total number of carbon atoms in the R2 group is no more than 4 or no more than 3.
In some embodiments, one of R31, R32 and R33 is H, with the other two groups being selected from H, C1_3 saturated alkyl, C2_3 alkenyl, C2_3 alkynyl and cyclopropyl.
In other embodiments, two of R31, R32 and R33 are H, with the other group being selected from H, C1_3 saturated alkyl, C2-3 alkenyl, C2_3 alkynyl and cyclopropyl.
In some embodiments, the groups that are not H are selected from methyl and ethyl. In some of these embodiments, the groups that are not H are methyl.
In some embodiments, R31 is H.
In some embodiments, R32 is H.
In some embodiments, R33 is H.
In some embodiments, R31 and R32 are H.
In some embodiments, R31 and R33 are H.
In some embodiments, R32 and R33 are H.
A R2 group of particular interest is: .
R35b .sR35a When R2 is , in some embodiments, the group (R35a or R35b) which is not H is optionally substituted phenyl. If the phenyl optional substituent is halo, it may be fluoro.
In some embodiment, the phenyl group is unsubstituted.
When R2 is .st R34 , in some embodiments where R34 is phenyl, it is unsubstituted. In other embodiments, the phenyl group bears a single fluoro substituent. In other emboidments, R14 is selected from H, methyl, ethyl, ethenyl and ethynyl. In some of these embodiments, R14 is selected from H and methyl.
When R2 is halo, in some embodiments, it is fluoro.
R36a 1.6b When there is a single bond present between C2 and C3, R2 is R .
In some embodiments, R36a and R36b are both H.
In other embodiments, R36a and R36b are both methyl.
In further embodiments, one of R36a and R36b is H, and the other is selected from C1_4 saturated alkyl, C2_3 alkenyl, which alkyl and alkenyl groups are optionally substituted. In some of these further embodiment, the group which is not H may be selected from methyl and ethyl.
The above preferences for R2 when there is a double bond present between C2 and C3 apply equally to R22, when there is a double bond present between C2' and C3'.
The above preferences for R2 when there is a single bond present between C2 and C3 apply equally to R22, when there is a single bond present between C2' and C3'.
In some embodiment, R1 is H, and R" is OH, ORA, where RA is C1_4 alkyl. In some of these embodiments, R" is OH. In others of these embodiments, R11 is ORA, where RA is alkyl. In some of these embodiments, RA is methyl.
In some embodiments, R1 and R" form a nitrogen-carbon double bond between the nitrogen and carbon atoms to which they are bound.
In some embodiments, R1 is H and R11 is OSO,M, where z is 2 or 3 and M is a monovalent pharmaceutically acceptable cation. In some of these embodiments, M is a monovalent pharmaceutically acceptable cation, and may be Na. Furthermore, in some embodiments z is 3.
In some embodiments where R1 is (d-iii), there may be an additional ntiro group on the benzene ring, e.g. ortho to Rz.
In some embodiments, R11 is OH or ORA, where RA is C1_4 alkyl and R1 is selected from:
R10a Ph I
0=S= 0 H
--.
Riob I
¨
Rloc r N
0 N, el v R1Od 0 Me )( _ R10e 0, 0 ........,.
R1of 0 OMe 0, 0 ¨
Riog OH
H 0õ,,).,s 0 H
.070 SI OH
¨
Rion H zc 0 xlNyX2sl\lR
H
¨
-C(=0)-X1-NHC(=0)X2-NH- represent a dipeptide. The amino acids in the dipeptide may be any combination of natural amino acids. The dipeptide may be the site of action for cathepsin-mediated cleavage.
In one embodiment, the dipeptide, -C(=0)-X1-NHC(=0)X2-NH-, is selected from:
-Phe-Lys-, -Val-Ala-, -Val-Lys-, 10 -Ala-Lys-, -Val-Cit-, -Phe-Cit-, -Leu-Cit-, -1Ie-Cit-, 15 -Phe-Arg-, -Trp-Cit-where Cit is citrulline.
Preferably, the dipeptide, -C(=0)-X1-NHC(=0)X2-NH-, is selected from:
-Phe-Lys-, -Val-Ala-, -Val-Lys-, -Ala-Lys-, -Val-Cit-.
Most preferably, the dipeptide, -C(=0)-X1-NHC(=0)X2-NH-, is -Phe-Lys- or -Val-Ala-.
Other dipeptide combinations may be used, including those described by Dubowchik et al., Bioconjugate Chemistry, 2002, 13,855-869, which is incorporated herein by reference.
In one embodiment, the amino acid side chain is derivatised, where appropriate. For example, an amino group or carboxy group of an amino acid side chain may be derivatised.
In one embodiment, an amino group NH2 of a side chain amino acid, such as lysine, is a derivatised form selected from the group consisting of NHR and NRR'.
In one embodiment, a carboxy group COOH of a side chain amino acid, such as aspartic acid, is a derivatised form selected from the group consisting of COOR, CONH2, CONHR
and CONRR'.
In one embodiment, the amino acid side chain is chemically protected, where appropriate.
The side chain protecting group may be a group as discussed above. The present inventors have established that protected amino acid sequences are cleavable by enzymes.
For example, it has been established that a dipeptide sequence comprising a Boc side chain-protected Lys residue is cleavable by cathepsin.
Protecting groups for the side chains of amino acids are well known in the art and are described in the Novabiochem Catalog. Additional protecting group strategies are set out in Protective Groups in Organic Synthesis, Greene and Wuts.
Possible side chain protecting groups are shown below for those amino acids having reactive side chain functionality:
Arg: Z, Mtr, Tos;
Asn: Trt, Xan;
Asp: BzI, t-Bu;
Cys: Acm, BzI, Bz1-0Me, Bzl-Me, Trt;
Glu: BzI, t-Bu;
Gln: Trt, Xan;
His: Boc, Dnp, Tos, Trt;
Lys: Boc, Z-CI, Fmoc, Z, Alloc;
Ser: BzI, TBDMS, TBDPS;
Thr: Bz;
Trp: Boc;
Tyr: BzI, Z, Z-Br.
In one embodiment, the side chain protection is selected to be orthogonal to a group provided as, or as part of, a capping group, where present. Thus, the removal of the side chain protecting group does not remove the capping group, or any protecting group functionality that is part of the capping group.
In other embodiments of the invention, the amino acids selected are those having no reactive side chain functionality. For example, the amino acids may be selected from: Ala, Gly, Ile, Leu, Met, Phe, Pro, and Val.
It is particularly preferred in the present invention, that if L1 comprises a dipeptide, then -C(=0)-X1-NHC(=0)X2-NH- is the same dipeptide.
Other preferred R1 groups include:
OH
and ¨
The above preferences apply equally to R2 and R21.
R and R' In some embodiments, R is independently selected from optionally substituted C1_12 alkyl, C3_20 heterocyclyl and C5_20 aryl groups. These groups are each defined in the substituents section below.
In some embodiments, R is independently optionally substituted C1-12 alkyl. In other embodiments, R is independently optionally substituted C3-20 heterocyclyl. In further embodiments, R is independently optionally substituted C5-20 aryl. In further embodiments, R
is independently optionally substituted C1-12 alkyl.
Described above in relation to R2 are various embodiments relating to preferred alkyl and aryl groups and the identity and number of optional substituents. The preferences set out for R2 as it applies to R are applicable, where appropriate, to all other groups R.
The preferences for R apply also to R'.
In some embodiments of the invention there is provided a compound having a substituent group -NRR'. In one embodiment, R and R' together with the nitrogen atom to which they are attached form an optionally substituted 4-, 5-, 6- or 7-membered heterocyclic ring. The ring may contain a further heteroatom, for example N, 0 or S. In some of these embodiments, the heterocyclic ring is itself substituted with a group R. Where a further N
heteroatom is present, the substituent may be on the N heteroatom.
Dimers In some embodiments, the groups X', D, R16, R19, R29 and R21 are the same as the groups X, D', R6, R9, R19 and R11 respectively. In these embodiments, the PBD monomer units have the same substituents except for at the 7 position.
Particularly preferred compounds of the first aspect of the present invention may be of formula la:
la R2a, OR1a Y R2a where R10, R11, R20, .-.21 1-< and Y are as defined above;
m is 1 or 3;
Rla is methyl or phenyl; and R2a is selected from:
*
(a) Me0 (b) ;
(c) ;
(d) =
(e) (f) < 0 VI
(0) ;and =
(h) Particularly preferred compounds of the first aspect of the present invention may be of formula lb:
R
lb ORia where R10, R11, R20, .-.21 1-< and Y are as defined above;
m is 1 or 3; and Rla is methyl or phenyl.
Particularly preferred compounds of the second aspect of the present invention may be of formula Ila:
R \ Rii H N 0 õ..4.....--.),..,.0 0 N H
-,, m Ila L
R2 a8---: 1401 ORla Y ¨ 1\1Ij-..,R2a where 5 R10, R11, R20, R21 and s r 4_ are as defined above;
m is 1 or 3;
R1 a is methyl or phenyl; and R2a is selected from:
O*
(a) Me0 .
, 10 (b) =
(c) ;
*
I.
(d) =
, .V.* .
(e) (f) =
, <O
15 (g) ;and rN SI
,Nj (h) Particularly preferred compounds of the second aspect of the present invention may be of formula Ilb:
R
R
Ilb ORia where R10, R11, R20, R21 an r s-L
are as defined above;
m is 1 or 3; and IRla is methyl or phenyl.
Particularly preferred compounds of the third aspect of the present invention may be of formula Illa:
R
¨N 00 Illa =
la N OR
R2a R2a where R10, R11, R20, R21 an r s-c are as defined above;
m is 1 or 3;
IRla is methyl or phenyl; and R2a is selected from:
*
(a) Me0 (b) (c) ;
(d) =
(e) (f) \z oo is (0) ;and Nj (h) .
Particularly preferred compounds of the third aspect of the present invention may be of formula Illb:
R
rc / R Illb11 -'-.
N 0 C)i a m c *I \ N
OR Y N
where R10, R11, R20, R21 and Y s-c are as defined above;
m is 1 or 3; and Rla is methyl or phenyl.
Z1, Z2, Z3 In some embodiments, Z1 is methylene. In some embodiments, Z1 is ethylene. In some embodiments, Z1 is propylene.
In some embodiments, Z2 is methylene. In some embodiments, Z2 is ethylene. In some embodiments, Z2 is propylene.
In some embodiments, Z3 is methylene. In some embodiments, Z3 is ethylene. In some embodiments, Z3 is propylene.
n (Y, YL) In some embodiments, n (in Y or YL) is an integer between 0 and 24.
In some embodiments, n (in Y or YL) is an integer between 0 and 12.
In some embodiments, n (in Y or YL) is an integer between 0 and 8.
In some embodiments, n (in Y or YL) is an integer between 0 and 6.
In some embodiments, n (in Y or Y) is 0.
In some embodiments, n (in Y or Y) is 1.
In some embodiments, n (in Y or Y) is 2.
In some embodiments, n (in Y or Y) is 3.
In some embodiments, n (in Y or Y) is 4.
In some embodiments, n (in Y or Y) is 5.
In some embodiments, n (in Y or Y) is 6.
In some embodiments, n (in Y or Y) is 7.
In some embodiments, n (in Y or Y) is 8.
In some embodiments, Z1 is methylene and n is 3.
In some embodiments, Z2 is propylene and n is 8.
L and G
L is a linker connected to the cell binding agent in the conjugate conmpound.
G is a linker for connecting the PBD dimer to the cell binding agent to form the conjugate compound.
Preferably, the linker contains an electrophilic functional group for reaction with a nucleophilic functional group on the cell binding agent. Nucleophilic groups on antibodies include, but are not limited to: (i) N-terminal amine groups, (ii) side chain amine groups, e.g.
lysine, (iii) side chain thiol groups, e.g. cysteine, and (iv) sugar hydroxyl or amino groups where the antibody is glycosylated. Amine, thiol, and hydroxyl groups are nucleophilic and capable of reacting to form covalent bonds with electrophilic groups on linker moieties and linker reagents including: (i) maleimide groups (ii) activated disulfides, (iii) active esters such as NHS (N-hydroxysuccinimide) esters, HOBt (N-hydroxybenzotriazole) esters, haloformates, and acid halides; (iv) alkyl and benzyl halides such as haloacetamides; and (v) aldehydes, ketones, carboxyl, and, some of which are exemplified as follows:
\ 1 H
,,O...................
/ Br,...................,--......õwõ...........v Br\
._...N( H
\ 0 Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges. Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol). Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol. Reactive thiol groups may be introduced into the antibody (or fragment thereof) by introducing one, two, three, four, or more cysteine residues (e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues). US
7521541 teaches engineering antibodies by introduction of reactive cysteine amino acids.
In some embodiments, a Linker has a reactive nucleophilic group which is reactive with an electrophilic group present on an antibody. Useful electrophilic groups on an antibody include, but are not limited to, aldehyde and ketone carbonyl groups. The heteroatom of a nucleophilic group of a Linker can react with an electrophilic group on an antibody and form a covalent bond to an antibody unit. Useful nucleophilic groups on a Linker include, but are not limited to, hydrazide, oxime, amino, hydroxyl, hydrazine, thiosemicarbazone, hydrazine carboxylate, and arylhydrazide. The electrophilic group on an antibody provides a convenient site for attachment to a Linker.
In one embodiment, the group L is:
o o where the asterisk indicates the point of attachment to the rest of group Y, the wavy line indicates the point of attachment to the cell binding agent, and m is 0 to 6. In one 5 embodiment, m is 5.
In one embodiment, the connection between the cell binding agent and L is through a thiol residue of the cell binding agent and a maleimide group of L.
10 In one embodiment, the connection between the cell binding agent and L
is:
0 *
_ti,L\I
S
¨\--\--\¨\/ 0 where the asterisk indicates the point of attachment to the remaining portion of the L
group or the remaining portion of the Y group and the wavy line indicates the point of attachment to the remaining portion of the cell binding agent. In this embodiment, the S
15 atom is typically derived from the cell binding agent.
In each of the embodiments above, an alternative functionality may be used in place of the maleimide-derived group shown below:
/ N *
20 where the wavy line indicates the point of attachment to the cell binding agent as before, and the asterisk indicates the bond to the remaining portion of the L
group or the remaining portion of the Y group.
In one embodiment, the maleimide-derived group is replaced with the group:
Hi 0 where the wavy line indicates point of attachment to the cell binding agent, and the asterisk indicates the bond to the remaining portion of the L group or the remaining portion of the Y group.
In one embodiment, the maleimide-derived group is replaced with a group, which optionally together with the cell binding agent, is selected from:
-C(=O)N H-, -C(=0)0-, -NHC(=0)-, -0C(=0)-, -0C(=0)0-, -NHC(=0)0-, -0C(=0)NH-, -NHC(=0)NH-, -NHC(=0)NH, -C(=0)NHC(=0)-, -S-, -S-S-, -CH2C(=0)--C(=0)CH2-, =N-NH-, and -NH-N=.
In one embodiment, the maleimide-derived group is replaced with a group, which optionally together with the cell binding agent, is selected from:
/-'-rs'- /--/-/-/--\ \
N,* N
1\tµ j N\\
N N
*
where the wavy line indicates either the point of attachment to the cell binding agent or the bond to the remaining portion of the L group or the remaining portion of the Y group, and the asterisk indicates the other of the point of attachment to the cell binding agent or the bond to the remaining portion of the L group or the remaining portion of the Y
group.
Other groups that can be used as L for connecting the remaining portion of the Y group to the cell binding agent are described in WO 2005/082023.
Thus, in embodiments of the present invention, L is of formula:
-LA-(CH2)m-Where m is from 0 to 6; and LA is selected from:
(01-1) _______________________________________________________________________ 0 (06) CBA
CBA NA
\
(01_2) 0 (LA7) CBA1 CBA N' y (LA2) ________________________________________________________________________ 0 (08_1) CBA
A 1\1 N N
(03-1) (08-2) N __ L. CBA
CBA >I1 S I\ µI\1 (L A3-2) _________________________________ (L A9-1 ) N \ N
CBI_ s)---I \
CBA
(LA4 ) al (LA9-2) N
IN
CBA
(LA5) 0 CBA1 ,/
O¨
where Ar represents a C5_6 arylene group, e.g. phenylene.
Thus, in embodiments of the present invention, G is of formula:
GA-(CH2)m-Where m is from 0 to 6; and GA is selected from:
(GA1-1) 0 (GA4) ..... ei, / ./
\ Hal N-1 H
Where Hal = I, Br, Cl (GA1-2) 0 \
(GA2) 0 (GA5) 0 Hal _1\(C))-(GA3-1) >1, (GA6) 0 S-S
/ ( 0 24 \ N
+/ ti\/1 (No2) where the NO2 group is optional (GA3-2) >1, (GA7) Br¨,.õ
s¨s it (No2) where the NO2 group is optional (GA3-3) (G A8) \\ j.
S-S)---1 ( \ N
02N ¨/
where the NO2 group is optional (GA3-4) (GA9) N3 S-S)--I
where the NO2 group is optional where Ar represents a C5_6 arylene group, e.g. phenylene.
In some embodiments, m may be 2 or 5.
Cell Binding Agent A cell binding agent may be of any kind, and include peptides and non-peptides. These can include antibodies or a fragment of an antibody that contains at least one binding site, lymphokines, hormones, hormone mimetics, vitamins, growth factors, nutrient-transport molecules, or any other cell binding molecule or substance.
Peptides In one embodiment, the cell binding agent is a linear or cyclic peptide comprising 4-30, preferably 6-20, contiguous amino acid residues. In this embodiment, it is preferred that one cell binding agent is linked to one monomer or dimer pyrrolobenzodiazepine compound.
In one embodiment the cell binding agent comprises a peptide that binds integrin av[36. The peptide may be selective for av[36 over XYS.
In one embodiment the cell binding agent comprises the A2OFMDV-Cys polypeptide. The A2OFMDV-Cys has the sequence: NAVPNLRGDLQVLAQKVARTC. Alternatively, a variant of the A2OFMDV-Cys sequence may be used wherein one, two, three, four, five, six, seven, eight, nine or ten amino acid residues are substituted with another amino acid residue.
Furthermore, the polypeptide may have the sequence NAVXXXXXXXXXXXXXXXRTC.
Antibodies The term "antibody" herein is used in the broadest sense and specifically covers monoclonal antibodies, polyclonal antibodies, dimers, multimers, multispecific antibodies (e.g., bispecific antibodies), and antibody fragments, so long as they exhibit the desired biological activity (Miller et al (2003) Jour. of Immunology 170:4854-4861). Antibodies may be murine, human, humanized, chimeric, or derived from other species. An antibody is a protein generated by the immune system that is capable of recognizing and binding to a specific antigen.
(Janeway, C., Travers, P., Wa!port, M., Shlomchik (2001) Immuno Biology, 5th Ed., Garland Publishing, New York). A target antigen generally has numerous binding sites, also called 5 epitopes, recognized by CDRs on multiple antibodies. Each antibody that specifically binds to a different epitope has a different structure. Thus, one antigen may have more than one corresponding antibody. An antibody includes a full-length immunoglobulin molecule or an immunologically active portion of a full-length immunoglobulin molecule, i.e., a molecule that contains an antigen binding site that immunospecifically binds an antigen of a target of 10 interest or part thereof, such targets including but not limited to, cancer cell or cells that produce autoimmune antibodies associated with an autoimmune disease. The immunoglobulin can be of any type (e.g. IgG, IgE, IgM, IgD, and IgA), class (e.g. IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2) or subclass of immunoglobulin molecule. The immunoglobulins can be derived from any species, including human, murine, or rabbit origin.
"Antibody fragments" comprise a portion of a full length antibody, generally the antigen binding or variable region thereof. Examples of antibody fragments include Fab, Fab', F(ab1)2, and scFv fragments; diabodies; linear antibodies; fragments produced by a Fab expression library, anti-idiotypic (anti-ld) antibodies, CDR (complementary determining region), and epitope-binding fragments of any of the above which immunospecifically bind to cancer cell antigens, viral antigens or microbial antigens, single-chain antibody molecules;
and multispecific antibodies formed from antibody fragments.
The term "monoclonal antibody" as used herein refers to an antibody obtained from a population of substantially homogeneous antibodies, i.e. the individual antibodies comprising the population are identical except for possible naturally occurring mutations that may be present in minor amounts. Monoclonal antibodies are highly specific, being directed against a single antigenic site. Furthermore, in contrast to polyclonal antibody preparations which include different antibodies directed against different determinants (epitopes), each monoclonal antibody is directed against a single determinant on the antigen.
In addition to their specificity, the monoclonal antibodies are advantageous in that they may be synthesized uncontaminated by other antibodies. The modifier "monoclonal"
indicates the character of the antibody as being obtained from a substantially homogeneous population of antibodies, and is not to be construed as requiring production of the antibody by any particular method. For example, the monoclonal antibodies to be used in accordance with the present invention may be made by the hybridoma method first described by Kohler et al (1975) Nature 256:495, or may be made by recombinant DNA methods (see, US
4816567).
The monoclonal antibodies may also be isolated from phage antibody libraries using the techniques described in Clackson et al (1991) Nature, 352:624-628; Marks et al (1991) J.
Mol. Biol., 222:581-597 or from transgenic mice carrying a fully human immunoglobulin system (Lonberg (2008) Curr. Opinion 20(4):450-459).
The monoclonal antibodies herein specifically include "chimeric" antibodies in which a portion of the heavy and/or light chain is identical with or homologous to corresponding sequences in antibodies derived from a particular species or belonging to a particular antibody class or subclass, while the remainder of the chain(s) is identical with or homologous to corresponding sequences in antibodies derived from another species or belonging to another antibody class or subclass, as well as fragments of such antibodies, so long as they exhibit the desired biological activity (US 4816567; and Morrison et al (1984) Proc. Natl. Acad. Sci. USA, 81:6851-6855). Chimeric antibodies include "primatized"
antibodies comprising variable domain antigen-binding sequences derived from a non-human primate (e.g. Old World Monkey or Ape) and human constant region sequences.
An "intact antibody" herein is one comprising a VL and VH domains, as well as a light chain constant domain (CL) and heavy chain constant domains, CH1, CH2 and CH3. The constant domains may be native sequence constant domains (e.g. human native sequence constant domains) or amino acid sequence variant thereof. The intact antibody may have one or more "effector functions" which refer to those biological activities attributable to the Fc region (a native sequence Fc region or amino acid sequence variant Fc region) of an antibody. Examples of antibody effector functions include C1q binding;
complement dependent cytotoxicity; Fc receptor binding; antibody-dependent cell-mediated cytotoxicity (ADCC); phagocytosis; and down regulation of cell surface receptors such as B
cell receptor and BCR.
Depending on the amino acid sequence of the constant domain of their heavy chains, intact antibodies can be assigned to different "classes." There are five major classes of intact antibodies: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into "subclasses" (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA, and IgA2. The heavy-chain constant domains that correspond to the different classes of antibodies are called a, 6, E, y, and p, respectively. The subunit structures and three-dimensional configurations of different classes of immunoglobulins are well known.
Humanisation Techniques to reduce the in vivo immunogenicity of a non-human antibody or antibody fragment include those termed "humanisation".
A "humanized antibody" refers to a polypeptide comprising at least a portion of a modified variable region of a human antibody wherein a portion of the variable region, preferably a portion substantially less than the intact human variable domain, has been substituted by the corresponding sequence from a non-human species and wherein the modified variable region is linked to at least another part of another protein, preferably the constant region of a human antibody. The expression "humanized antibodies" includes human antibodies in which one or more complementarity determining region ("CDR") amino acid residues and/or one or more framework region ("FW" or "FR") amino acid residues are substituted by amino acid residues from analogous sites in rodent or other non-human antibodies.
The expression "humanized antibody" also includes an immunoglobulin amino acid sequence variant or fragment thereof that comprises an FR having substantially the amino acid sequence of a human immunoglobulin and a CDR having substantially the amino acid sequence of a non-human immunoglobulin.
"Humanized" forms of non-human (e.g., murine) antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulin. Or, looked at another way, a humanized antibody is a human antibody that also contains selected sequences from non-human (e.g. murine) antibodies in place of the human sequences. A
humanized antibody can include conservative amino acid substitutions or non-natural residues from the same or different species that do not significantly alter its binding and/or biologic activity.
Such antibodies are chimeric antibodies that contain minimal sequence derived from non-human immunoglobulins.
There are a range of humanisation techniques, including 'CDR grafting', 'guided selection', `deimmunization', 'resurfacing' (also known as Veneering'), 'composite antibodies', 'Human String Content Optimisation' and framework shuffling.
CDR grafting In this technique, the humanized antibodies are human immunoglobulins (recipient antibody) in which residues from a complementary-determining region (CDR) of the recipient antibody are replaced by residues from a CDR of a non-human species (donor antibody) such as mouse, rat, camel, bovine, goat, or rabbit having the desired properties (in effect, the non-human CDRs are 'grafted' onto the human framework). In some instances, framework region (FR) residues of the human immunoglobulin are replaced by corresponding non-human residues (this may happen when, for example, a particular FR residue has significant effect on antigen binding).
Furthermore, humanized antibodies can comprise residues that are found neither in the recipient antibody nor in the imported CDR or framework sequences. These modifications are made to further refine and maximize antibody performance. Thus, in general, a humanized antibody will comprise all of at least one, and in one aspect two, variable domains, in which all or all of the hypervariable loops correspond to those of a non-human immunoglobulin and all or substantially all of the FR regions are those of a human immunoglobulin sequence. The humanized antibody optionally also will comprise at least a portion of an immunoglobulin constant region (Fc), or that of a human immunoglobulin.
Guided selection The method consists of combining the VH or VI_ domain of a given non-human antibody specific for a particular epitope with a human VH or VI_ library and specific human V domains are selected against the antigen of interest. This selected human VH is then combined with a VL library to generate a completely human VHxVL combination. The method is described in Nature Biotechnology (N.Y.) 12, (1994) 899-903.
Composite antibodies In this method, two or more segments of amino acid sequence from a human antibody are combined within the final antibody molecule. They are constructed by combining multiple human VH and VL sequence segments in combinations which limit or avoid human T
cell epitopes in the final composite antibody V regions. Where required, T cell epitopes are limited or avoided by, exchanging V region segments contributing to or encoding a T cell epitope with alternative segments which avoid T cell epitopes. This method is described in US 2008/0206239 Al.
Deimmunization This method involves the removal of human (or other second species) T-cell epitopes from the V regions of the therapeutic antibody (or other molecule). The therapeutic antibodies V-region sequence is analysed for the presence of MHC class II- binding motifs by, for example, comparison with databases of MHC-binding motifs (such as the "motifs"
database hosted at vvww.wehi.edu.au). Alternatively, MHC class II- binding motifs may be identified using computational threading methods such as those devised by Altuvia et al.
(J. Mol. Biol.
249 244-250 (1995)); in these methods, consecutive overlapping peptides from the V-region sequences are testing for their binding energies to MHC class II proteins.
This data can then be combined with information on other sequence features which relate to successfully presented peptides, such as amphipathicity, Rothbard motifs, and cleavage sites for cathepsin B and other processing enzymes.
Once potential second species (e.g. human) T-cell epitopes have been identified, they are eliminated by the alteration of one or more amino acids. The modified amino acids are usually within the T-cell epitope itself, but may also be adjacent to the epitope in terms of the primary or secondary structure of the protein (and therefore, may not be adjacent in the primary structure). Most typically, the alteration is by way of substitution but, in some circumstances amino acid addition or deletion will be more appropriate.
All alterations can be accomplished by recombinant DNA technology, so that the final molecule may be prepared by expression from a recombinant host using well established methods such as Site Directed Mutagenesis. However, the use of protein chemistry or any other means of molecular alteration is also possible.
Resurfacing This method involves:
(a) determining the conformational structure of the variable region of the non-human (e.g. rodent) antibody (or fragment thereof) by constructing a three-dimensional model of the non-human antibody variable region;
(b) generating sequence alignments using relative accessibility distributions from x-ray crystallographic structures of a sufficient number of non-human and human antibody variable region heavy and light chains to give a set of heavy and light chain framework positions wherein the alignment positions are identical in 98% of the sufficient number of non-human antibody heavy and light chains;
(c) defining for the non-human antibody to be humanized, a set of heavy and light chain surface exposed amino acid residues using the set of framework positions generated in step (b);
(d) identifying from human antibody amino acid sequences a set of heavy and light chain surface exposed amino acid residues that is most closely identical to the set of surface exposed amino acid residues defined in step (c), wherein the heavy and light chain from the human antibody are or are not naturally paired;
(e) substituting, in the amino acid sequence of the non-human antibody to be humanized, the set of heavy and light chain surface exposed amino acid residues defined in step (c) with the set of heavy and light chain surface exposed amino acid residues identified in step (d);
5 (f) constructing a three-dimensional model of the variable region of the non-human antibody resulting from the substituting specified in step (e);
(g) identifying, by comparing the three-dimensional models constructed in steps (a) and (f), any amino acid residues from the sets identified in steps (c) or (d), that are within 5 Angstroms of any atom of any residue of the complementarity determining regions of the 10 non-human antibodt to be humanized; and (h) changing any residues identified in step (g) from the human to the original non-human amino acid residue to thereby define a non-human antibody humanizing set of surface exposed amino acid residues; with the proviso that step (a) need not be conducted first, but must be conducted prior to step (g).
Superhumanization The method compares the non-human sequence with the functional human germline gene repertoire. Those human genes encoding canonical structures identical or closely related to the non-human sequences are selected. Those selected human genes with highest homology within the CDRs are chosen as FR donors. Finally, the non-human CDRs are grafted onto these human FRs. This method is described in patent WO
2005/079479 A2.
Human String Content Optimization This method compares the non-human (e.g. mouse) sequence with the repertoire of human germline genes and the differences are scored as Human String Content (HSC) that quantifies a sequence at the level of potential MHC/T-cell epitopes. The target sequence is then humanized by maximizing its HSC rather than using a global identity measure to generate multiple diverse humanized variants (described in Molecular Immunology, 44, (2007) 1986-1998).
Framework Shuffling The CDRs of the non-human antibody are fused in-frame to cDNA pools encompassing all known heavy and light chain human germline gene frameworks. Humanised antibodies are then selected by e.g. panning of the phage displayed antibody library. This is described in Methods 36, 43-60 (2005).
Examples of cell binding agents include those agents described for use in WO
2007/085930, which is incorporated herein.
Tumour-associate antigens and cognate antibodies for use in embodiments of the present invention are listed below.
TUMOR-ASSOCIATED ANTIGENS AND COGNATE ANTIBODIES
(1) BMPR1B (bone morphogenetic protein receptor-type IB) Nucleotide Genbank accession no. NM_001203 Genbank version no. NM_001203.2 GI:169790809 Genbank record update date: Sep 23, 2012 02:06 PM
Polypeptide Genbank accession no. NP_001194 Genbank version no. NP_001194.1 GI:4502431 Genbank record update date: Sep 23, 2012 02:06 PM
Cross-references ten Dijke,P., et al Science 264 (5155): 101-104 (1994), Oncogene 14 10
(11):1377-1382 (1997)); W02004/063362 (Claim 2); W02003/042661 (Claim 12);
U52003/134790-A1 (Page 38-39); W02002/102235 (Claim 13; Page 296);
(Page 91-92); W02002/99122 (Example 2; Page 528-530); W02003/029421 (Claim 6);
W02003/024392 (Claim 2; Fig 112); W02002/98358 (Claim 1; Page 183);
(Page 100-101); W02002/59377(Page 349-350); W02002/30268 (Claim 27; Page 376);
15 W02001/48204 (Example; Fig 4); NP_001194 bone morphogenetic protein receptor, type IB /pid=NP_001194.1.; MIM:603248; AY065994 (2) E16 (LAT1, SLC7A5) Nucleotide Genbank accession no. NM_003486 Genbank version no. NM_003486.5 GI:71979931 Genbank record update date: Jun 27, 2012 12:06 PM
Polypeptide Genbank accession no. NP_003477 Genbank version no. NP_003477.4 GI:71979932 Genbank record update date: Jun 27, 2012 12:06 PM
Cross references Biochem. Biophys. Res.
Commun. 255 (2), 283-288 (1999), Nature 395 (6699):288-291 (1998), Gaugitsch, H.W., et 20 al (1992) J. Biol. Chem. 267 (16):11267-11273); W02004/048938 (Example 2);
W02004/032842 (Example IV); W02003/042661 (Claim 12); W02003/016475 (Claim 1);
W02002/78524 (Example 2); W02002/99074 (Claim 19; Page 127-129); W02002/86443 (Claim 27; Pages 222, 393); W02003/003906 (Claim 10; Page 293); W02002/64798 (Claim 33; Page 93-95); W02000/14228 (Claim 5; Page 133-136); US2003/224454 (Fig 3);
25 W02003/025138 (Claim 12; Page 150); NP_003477 solute carrier family 7 (cationic amino acid transporter, y+system), member 5 /pid=NP_003477.3 - Homo sapiens;
MIM:600182;; NM_015923.
(3) STEAP1 (six transmembrane epithelial antigen of prostate) Nucleotide Genbank accession no. NM_012449 Genbank version no. NM_012449.2 GI:22027487 Genbank record update date: Sep 9, 2012 02:57 PM
Polypeptide Genbank accession no. NP_036581 Genbank version no. NP_036581.1 GI:9558759 Genbank record update date: Sep 9, 2012 02:57 PM
Cross references Cancer Res. 61 (15), 5857-5860 (2001), Hubert, R.S., et al (1999) Proc. Natl.
Acad. Sci. U.S.A. 96 (25):14523-14528); W02004/065577 (Claim 6); W02004/027049 (Fig 14 EP1394274 (Example 11); W02004/016225 (Claim 2); W02003/042661 (Claim 12);
U52003/157089 (Example 5); U52003/185830 (Example 5); U52003/064397 (Fig 2);
W02002/89747 (Example 5; Page 618-619); W02003/022995 (Example 9; Fig 13A, Example 53; Page 173, Example 2; Fig 2A); six transmembrane epithelial 35 antigen of the prostate; MIM:604415.
(4) 0772P (CA125, MUC16) Nucleotide Genbank accession no. AF361486 Genbank version no. AF361486.3 GI:34501466 Genbank record update date: Mar 11, 2010 07:56 AM
Polypeptide Genbank accession no. AAK74120 Genbank version no. AAK74120.3 GI:34501467 Genbank record update date: Mar 11, 2010 07:56 AM
Cross references J. Biol. Chem. 276 (29):27371-27375 (2001)); W02004/045553 (Claim 14);
(Claim 6; Fig 12); W02002/83866 (Claim 15; Page 116-121); US2003/124140 (Example 16);
GI:34501467;
(5) MPF (MPF, MSLN, SMR, megakaryocyte potentiating factor, mesothelin) Nucleotide Genbank accession no. NM_005823 Genbank version no. NM_005823.5 GI:293651528 Genbank record update date: Sep 2, 2012 01:47 PM
Polypeptide Genbank accession no. NP_005814 Genbank version no. NP_005814.2 GI:53988378 Genbank record update date: Sep 2, 2012 01:47 PM
Cross references Yamaguchi, N., et al Biol. Chem. 269 (2), 805-808 (1994), Proc. Natl. Acad.
Sci. U.S.A. 96 (20):11531-11536 (1999), Proc. Natl. Acad. Sci. U.S.A. 93 10 (1):136-140 (1996), J. Biol.
Chem. 270 (37):21984-21990 (1995)); W02003/101283 (Claim 14); (W02002/102235 (Claim 13; Page 287-288); W02002/101075 (Claim 4; Page 308- 309); W02002/71928 (Page 320-321); W094/10312 (Page 52-57); IM:601051.
(6) Napi3b (NAPI-3B, NPTIlb, 5LC34A2, solute carrier family 34 (sodium phosphate), member 2, type 11 sodium-dependent phosphate transporter 3b) Nucleotide Genbank accession no. NM_006424 Genbank version no. NM_006424.2 GI:110611905 Genbank record update date: Jul 22, 2012 03:39 PM
Polypeptide Genbank accession no. NP_006415 Genbank version no. NP_006415.2 GI:110611906 Genbank record update date: Jul 22, 2012 03:39 PM
Cross references J. Biol. Chem. 277 (22):19665-19672 (2002), Genomics 62 (2):281-284 (1999), Feild, J.A., et al (1999) Biochem. Biophys. Res. Commun. 258 (3):578-582); W02004/022778 (Claim 2);
EP1394274 (Example 11); W02002/102235 (Claim 13; Page 20 326); EP0875569 (Claim 1;
Page 17-19); W02001/57188 (Claim 20; Page 329); W02004/032842 (Example IV);
W02001/75177 (Claim 24; Page 139-140); MIM:604217.
(7) Sema 5b (FLJ10372, KIAA1445, Mm.42015, SEMA58, SEMAG, Semaphorin 5b Hlog, sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane 20 domain (TM) and short cytoplasmic domain, (semaphorin) 58) Nucleotide Genbank accession no. AB040878 Genbank version no. AB040878.1 GI:7959148 Genbank record update date: Aug 2, 2006 05:40 PM
Polypeptide Genbank accession no. BAA95969 Genbank version no. BAA95969.1 GI:7959149 Genbank record update date: Aug 2, 2006 05:40 PM
Cross references Nagase T., et al (2000) DNA Res. 7 (2):143-150); W02004/000997 (Claim 1);
W02003/003984 (Claim 1); W02002/06339 (Claim 1; Page 50); W02001/88133 (Claim 1;
Page 41-43, 48-58); W02003/054152 (Claim 20); W02003/101400 (Claim 11);
Accession:
30 Q9P283; Genew; HGNC:10737 (8) PSCA hlg (2700050C12Rik, C530008016Rik, RIKEN cDNA 2700050C12, RIKEN cDNA
2700050C12 gene) Nucleotide Genbank accession no. AY358628 5 Genbank version no. AY358628.1 GI:37182377 Genbank record update date: Dec 1, 2009 04:15 AM
Polypeptide Genbank accession no. AAQ88991 10 Genbank version no. AAQ88991.1 GI:37182378 Genbank record update date: Dec 1, 2009 04:15 AM
Cross references Ross et al (2002) Cancer Res. 62:2546-2553; US2003/129192 (Claim 2);
15 (Claim 12); U52004/044179 35 (Claim 11); U52003/096961 (Claim 11);
(Example 5); W02003/105758 16 (Claim 12); U52003/206918 (Example 5); EP1347046 (Claim 1); W02003/025148 (Claim 20); GI:37182378.
(9) ETBR (Endothelin type B receptor) 20 Nucleotide Genbank accession no. AY275463 Genbank version no. AY275463.1 GI:30526094 Genbank record update date: Mar 11, 2010 02:26 AM
25 Polypeptide Genbank accession no. AAP32295 Genbank version no. AAP32295.1 GI:30526095 Genbank record update date: Mar 11, 2010 02:26 AM
30 Cross references Nakamuta M., et al Biochem. Biophys. Res. Commun. 177, 34-39, 1991; Ogawa Y., et al Biochem. Biophys. Res. Commun. 178, 248-255, 1991; Arai H., et al Jpn. Circ.
J. 56, 1303-1307, 1992; Arai H., et al J. Biol. Chem. 268, 3463-3470, 1993; Sakamoto A., Yanagisawa M., et al Biochem. Biophys. Res. Commun. 178, 656-663, 1991; Elshourbagy N.A., et al J.
35 Biol. Chem. 268, 3873-3879, 1993; Haendler B., et al J. Cardiovasc.
Pharmacol. 20, s1-54, 1992; Tsutsumi M., et al Gene 228, 43-49, 1999; Strausberg R.L., et al Proc.
Natl. Acad. Sci.
U.S.A. 99, 16899-16903, 2002; Bourgeois C., et al J. Clin. Endocrinol. Metab.
82, 3116-3123, 1997;
Okamoto Y., et al Biol. Chem. 272, 21589-21596, 1997; Verheij J.B., et al Am.
J. Med.
Genet. 108, 223-225, 2002; Hofstra R.M.W., et al Eur. J. Hum. Genet. 5, 180-185, 1997;
Puffenberger E.G., et al Cell 79, 1257-1266, 1994; Attie T., et al, Hum. Mol.
Genet. 4, 2407-2409, 1995; Auricchio A., et al Hum. Mol. Genet. 5:351-354, 1996; Amiel J., et al Hum.
Mol.
Genet. 5, 355-357, 1996; Hofstra R.M.W., et al Nat. Genet. 12, 445-447, 1996;
Svensson P.J., et al Hum. Genet. 103, 145-148, 1998; Fuchs S., et al Mol. Med. 7, 115-124, 2001;
10 Pingault V., et al (2002) Hum. Genet. 111, 198-206; W02004/045516 (Claim 1);
W02004/048938 (Example 2); W02004/040000 (Claim 151); W02003/087768 (Claim 1);
W02003/016475 (Claim 1); W02003/016475 (Claim 1); W02002/61087 (Fig 1);
W02003/016494 (Fig 6); W02003/025138 (Claim 12; Page 144); W02001/98351 (Claim 1;
Page 124-125); EP0522868 (Claim 8; Fig 2); W02001/77172 (Claim 1; Page 297-299);
15 US2003/109676; US6518404 (Fig 3); U55773223 (Claim la; Col 31-34);
W02004/001004.
(10) M5G783 (RNF124, hypothetical protein FLJ20315) Nucleotide Genbank accession no. NM_017763 20 Genbank version no. NM_017763.4 GI:167830482 Genbank record update date: Jul 22, 2012 12:34 AM
Polypeptide Genbank accession no. NP_060233 Genbank version no. NP_060233.3 GI:56711322 Genbank record update date: Jul 22, 2012 12:34 AM
Cross references W02003/104275 (Claim 1); W02004/046342 (Example 2); W02003/042661 (Claim 12);
W02003/083074 (Claim 14; Page 61); W02003/018621 (Claim 1); W02003/024392 (Claim 2; Fig 93); W02001/66689 (Example 6); LocusID:54894.
(11) STEAP2 (HGNC 8639, IPCA-1, PCANAP1, STAMP1, STEAP2, STMP, prostate cancer associated gene 1, prostate cancer associated protein 1, six transmembrane epithelial antigen of prostate 2, six transmembrane prostate protein) Nucleotide Genbank accession no. AF455138 Genbank version no. AF455138.1 GI:22655487 Genbank record update date: Mar 11, 2010 01:54 AM
Polypeptide Genbank accession no. AAN04080 Genbank version no. AAN04080.1 GI:22655488 Genbank record update date: Mar 11, 2010 01:54 AM
Cross references Lab. Invest. 82 (11):1573-1582 (2002)); W02003/087306; US2003/064397 (Claim 1;
Fig 1);
W02002/72596 (Claim 13; Page 54-55); W02001/72962 (Claim 1; Fig 4B); 35 W02003/104270 (Claim 11); W02003/104270 (Claim 16); US2004/005598 (Claim 22);
W02003/042661 (Claim 12); US2003/060612 (Claim 12; Fig 10); W02002/26822 (Claim 23;
Fig 2); W02002/16429 (Claim 12; Fig 10); GI:22655488.
U52003/134790-A1 (Page 38-39); W02002/102235 (Claim 13; Page 296);
(Page 91-92); W02002/99122 (Example 2; Page 528-530); W02003/029421 (Claim 6);
W02003/024392 (Claim 2; Fig 112); W02002/98358 (Claim 1; Page 183);
(Page 100-101); W02002/59377(Page 349-350); W02002/30268 (Claim 27; Page 376);
15 W02001/48204 (Example; Fig 4); NP_001194 bone morphogenetic protein receptor, type IB /pid=NP_001194.1.; MIM:603248; AY065994 (2) E16 (LAT1, SLC7A5) Nucleotide Genbank accession no. NM_003486 Genbank version no. NM_003486.5 GI:71979931 Genbank record update date: Jun 27, 2012 12:06 PM
Polypeptide Genbank accession no. NP_003477 Genbank version no. NP_003477.4 GI:71979932 Genbank record update date: Jun 27, 2012 12:06 PM
Cross references Biochem. Biophys. Res.
Commun. 255 (2), 283-288 (1999), Nature 395 (6699):288-291 (1998), Gaugitsch, H.W., et 20 al (1992) J. Biol. Chem. 267 (16):11267-11273); W02004/048938 (Example 2);
W02004/032842 (Example IV); W02003/042661 (Claim 12); W02003/016475 (Claim 1);
W02002/78524 (Example 2); W02002/99074 (Claim 19; Page 127-129); W02002/86443 (Claim 27; Pages 222, 393); W02003/003906 (Claim 10; Page 293); W02002/64798 (Claim 33; Page 93-95); W02000/14228 (Claim 5; Page 133-136); US2003/224454 (Fig 3);
25 W02003/025138 (Claim 12; Page 150); NP_003477 solute carrier family 7 (cationic amino acid transporter, y+system), member 5 /pid=NP_003477.3 - Homo sapiens;
MIM:600182;; NM_015923.
(3) STEAP1 (six transmembrane epithelial antigen of prostate) Nucleotide Genbank accession no. NM_012449 Genbank version no. NM_012449.2 GI:22027487 Genbank record update date: Sep 9, 2012 02:57 PM
Polypeptide Genbank accession no. NP_036581 Genbank version no. NP_036581.1 GI:9558759 Genbank record update date: Sep 9, 2012 02:57 PM
Cross references Cancer Res. 61 (15), 5857-5860 (2001), Hubert, R.S., et al (1999) Proc. Natl.
Acad. Sci. U.S.A. 96 (25):14523-14528); W02004/065577 (Claim 6); W02004/027049 (Fig 14 EP1394274 (Example 11); W02004/016225 (Claim 2); W02003/042661 (Claim 12);
U52003/157089 (Example 5); U52003/185830 (Example 5); U52003/064397 (Fig 2);
W02002/89747 (Example 5; Page 618-619); W02003/022995 (Example 9; Fig 13A, Example 53; Page 173, Example 2; Fig 2A); six transmembrane epithelial 35 antigen of the prostate; MIM:604415.
(4) 0772P (CA125, MUC16) Nucleotide Genbank accession no. AF361486 Genbank version no. AF361486.3 GI:34501466 Genbank record update date: Mar 11, 2010 07:56 AM
Polypeptide Genbank accession no. AAK74120 Genbank version no. AAK74120.3 GI:34501467 Genbank record update date: Mar 11, 2010 07:56 AM
Cross references J. Biol. Chem. 276 (29):27371-27375 (2001)); W02004/045553 (Claim 14);
(Claim 6; Fig 12); W02002/83866 (Claim 15; Page 116-121); US2003/124140 (Example 16);
GI:34501467;
(5) MPF (MPF, MSLN, SMR, megakaryocyte potentiating factor, mesothelin) Nucleotide Genbank accession no. NM_005823 Genbank version no. NM_005823.5 GI:293651528 Genbank record update date: Sep 2, 2012 01:47 PM
Polypeptide Genbank accession no. NP_005814 Genbank version no. NP_005814.2 GI:53988378 Genbank record update date: Sep 2, 2012 01:47 PM
Cross references Yamaguchi, N., et al Biol. Chem. 269 (2), 805-808 (1994), Proc. Natl. Acad.
Sci. U.S.A. 96 (20):11531-11536 (1999), Proc. Natl. Acad. Sci. U.S.A. 93 10 (1):136-140 (1996), J. Biol.
Chem. 270 (37):21984-21990 (1995)); W02003/101283 (Claim 14); (W02002/102235 (Claim 13; Page 287-288); W02002/101075 (Claim 4; Page 308- 309); W02002/71928 (Page 320-321); W094/10312 (Page 52-57); IM:601051.
(6) Napi3b (NAPI-3B, NPTIlb, 5LC34A2, solute carrier family 34 (sodium phosphate), member 2, type 11 sodium-dependent phosphate transporter 3b) Nucleotide Genbank accession no. NM_006424 Genbank version no. NM_006424.2 GI:110611905 Genbank record update date: Jul 22, 2012 03:39 PM
Polypeptide Genbank accession no. NP_006415 Genbank version no. NP_006415.2 GI:110611906 Genbank record update date: Jul 22, 2012 03:39 PM
Cross references J. Biol. Chem. 277 (22):19665-19672 (2002), Genomics 62 (2):281-284 (1999), Feild, J.A., et al (1999) Biochem. Biophys. Res. Commun. 258 (3):578-582); W02004/022778 (Claim 2);
EP1394274 (Example 11); W02002/102235 (Claim 13; Page 20 326); EP0875569 (Claim 1;
Page 17-19); W02001/57188 (Claim 20; Page 329); W02004/032842 (Example IV);
W02001/75177 (Claim 24; Page 139-140); MIM:604217.
(7) Sema 5b (FLJ10372, KIAA1445, Mm.42015, SEMA58, SEMAG, Semaphorin 5b Hlog, sema domain, seven thrombospondin repeats (type 1 and type 1-like), transmembrane 20 domain (TM) and short cytoplasmic domain, (semaphorin) 58) Nucleotide Genbank accession no. AB040878 Genbank version no. AB040878.1 GI:7959148 Genbank record update date: Aug 2, 2006 05:40 PM
Polypeptide Genbank accession no. BAA95969 Genbank version no. BAA95969.1 GI:7959149 Genbank record update date: Aug 2, 2006 05:40 PM
Cross references Nagase T., et al (2000) DNA Res. 7 (2):143-150); W02004/000997 (Claim 1);
W02003/003984 (Claim 1); W02002/06339 (Claim 1; Page 50); W02001/88133 (Claim 1;
Page 41-43, 48-58); W02003/054152 (Claim 20); W02003/101400 (Claim 11);
Accession:
30 Q9P283; Genew; HGNC:10737 (8) PSCA hlg (2700050C12Rik, C530008016Rik, RIKEN cDNA 2700050C12, RIKEN cDNA
2700050C12 gene) Nucleotide Genbank accession no. AY358628 5 Genbank version no. AY358628.1 GI:37182377 Genbank record update date: Dec 1, 2009 04:15 AM
Polypeptide Genbank accession no. AAQ88991 10 Genbank version no. AAQ88991.1 GI:37182378 Genbank record update date: Dec 1, 2009 04:15 AM
Cross references Ross et al (2002) Cancer Res. 62:2546-2553; US2003/129192 (Claim 2);
15 (Claim 12); U52004/044179 35 (Claim 11); U52003/096961 (Claim 11);
(Example 5); W02003/105758 16 (Claim 12); U52003/206918 (Example 5); EP1347046 (Claim 1); W02003/025148 (Claim 20); GI:37182378.
(9) ETBR (Endothelin type B receptor) 20 Nucleotide Genbank accession no. AY275463 Genbank version no. AY275463.1 GI:30526094 Genbank record update date: Mar 11, 2010 02:26 AM
25 Polypeptide Genbank accession no. AAP32295 Genbank version no. AAP32295.1 GI:30526095 Genbank record update date: Mar 11, 2010 02:26 AM
30 Cross references Nakamuta M., et al Biochem. Biophys. Res. Commun. 177, 34-39, 1991; Ogawa Y., et al Biochem. Biophys. Res. Commun. 178, 248-255, 1991; Arai H., et al Jpn. Circ.
J. 56, 1303-1307, 1992; Arai H., et al J. Biol. Chem. 268, 3463-3470, 1993; Sakamoto A., Yanagisawa M., et al Biochem. Biophys. Res. Commun. 178, 656-663, 1991; Elshourbagy N.A., et al J.
35 Biol. Chem. 268, 3873-3879, 1993; Haendler B., et al J. Cardiovasc.
Pharmacol. 20, s1-54, 1992; Tsutsumi M., et al Gene 228, 43-49, 1999; Strausberg R.L., et al Proc.
Natl. Acad. Sci.
U.S.A. 99, 16899-16903, 2002; Bourgeois C., et al J. Clin. Endocrinol. Metab.
82, 3116-3123, 1997;
Okamoto Y., et al Biol. Chem. 272, 21589-21596, 1997; Verheij J.B., et al Am.
J. Med.
Genet. 108, 223-225, 2002; Hofstra R.M.W., et al Eur. J. Hum. Genet. 5, 180-185, 1997;
Puffenberger E.G., et al Cell 79, 1257-1266, 1994; Attie T., et al, Hum. Mol.
Genet. 4, 2407-2409, 1995; Auricchio A., et al Hum. Mol. Genet. 5:351-354, 1996; Amiel J., et al Hum.
Mol.
Genet. 5, 355-357, 1996; Hofstra R.M.W., et al Nat. Genet. 12, 445-447, 1996;
Svensson P.J., et al Hum. Genet. 103, 145-148, 1998; Fuchs S., et al Mol. Med. 7, 115-124, 2001;
10 Pingault V., et al (2002) Hum. Genet. 111, 198-206; W02004/045516 (Claim 1);
W02004/048938 (Example 2); W02004/040000 (Claim 151); W02003/087768 (Claim 1);
W02003/016475 (Claim 1); W02003/016475 (Claim 1); W02002/61087 (Fig 1);
W02003/016494 (Fig 6); W02003/025138 (Claim 12; Page 144); W02001/98351 (Claim 1;
Page 124-125); EP0522868 (Claim 8; Fig 2); W02001/77172 (Claim 1; Page 297-299);
15 US2003/109676; US6518404 (Fig 3); U55773223 (Claim la; Col 31-34);
W02004/001004.
(10) M5G783 (RNF124, hypothetical protein FLJ20315) Nucleotide Genbank accession no. NM_017763 20 Genbank version no. NM_017763.4 GI:167830482 Genbank record update date: Jul 22, 2012 12:34 AM
Polypeptide Genbank accession no. NP_060233 Genbank version no. NP_060233.3 GI:56711322 Genbank record update date: Jul 22, 2012 12:34 AM
Cross references W02003/104275 (Claim 1); W02004/046342 (Example 2); W02003/042661 (Claim 12);
W02003/083074 (Claim 14; Page 61); W02003/018621 (Claim 1); W02003/024392 (Claim 2; Fig 93); W02001/66689 (Example 6); LocusID:54894.
(11) STEAP2 (HGNC 8639, IPCA-1, PCANAP1, STAMP1, STEAP2, STMP, prostate cancer associated gene 1, prostate cancer associated protein 1, six transmembrane epithelial antigen of prostate 2, six transmembrane prostate protein) Nucleotide Genbank accession no. AF455138 Genbank version no. AF455138.1 GI:22655487 Genbank record update date: Mar 11, 2010 01:54 AM
Polypeptide Genbank accession no. AAN04080 Genbank version no. AAN04080.1 GI:22655488 Genbank record update date: Mar 11, 2010 01:54 AM
Cross references Lab. Invest. 82 (11):1573-1582 (2002)); W02003/087306; US2003/064397 (Claim 1;
Fig 1);
W02002/72596 (Claim 13; Page 54-55); W02001/72962 (Claim 1; Fig 4B); 35 W02003/104270 (Claim 11); W02003/104270 (Claim 16); US2004/005598 (Claim 22);
W02003/042661 (Claim 12); US2003/060612 (Claim 12; Fig 10); W02002/26822 (Claim 23;
Fig 2); W02002/16429 (Claim 12; Fig 10); GI:22655488.
(12) TrpM4 (BR22450, FLJ20041, TRPM4, TRPM4B, transient receptor potential cation 5 channel, subfamily M, member 4) Nucleotide Genbank accession no. NM_017636 Genbank version no. NM_017636.3 GI:304766649 Genbank record update date: Jun 29, 2012 11:27 AM
Polypeptide Genbank accession no. NP_060106 Genbank version no. NP_060106.2 GI:21314671 Genbank record update date: Jun 29, 2012 11:27 AM
Cross references Xu, X.Z., et al Proc. Natl. Acad. Sci. U.S.A. 98 (19):10692-10697 (2001), Cell 109 (3):397-407 (2002), J. Biol. Chem. 278 (33):30813-30820 (2003)); U52003/143557 (Claim 4);
W02000/40614 (Claim 14; Page 100-103); W02002/10382 (Claim 1; Fig 9A);
W02003/042661 (Claim 12); W02002/30268 (Claim 27; Page 391); U52003/219806 (Claim 4); W02001/62794 (Claim 10 14; Fig 1A-D); MIM:606936.
Polypeptide Genbank accession no. NP_060106 Genbank version no. NP_060106.2 GI:21314671 Genbank record update date: Jun 29, 2012 11:27 AM
Cross references Xu, X.Z., et al Proc. Natl. Acad. Sci. U.S.A. 98 (19):10692-10697 (2001), Cell 109 (3):397-407 (2002), J. Biol. Chem. 278 (33):30813-30820 (2003)); U52003/143557 (Claim 4);
W02000/40614 (Claim 14; Page 100-103); W02002/10382 (Claim 1; Fig 9A);
W02003/042661 (Claim 12); W02002/30268 (Claim 27; Page 391); U52003/219806 (Claim 4); W02001/62794 (Claim 10 14; Fig 1A-D); MIM:606936.
(13) CRIPTO (CR, CR1, CRGF, CRIPTO, TDGF1, teratocarcinoma-derived growth factor) Nucleotide Genbank accession no. NM_003212 Genbank version no. NM_003212.3 GI:292494881 Genbank record update date: Sep 23, 2012 02:27 PM
Polypeptide Genbank accession no. NP_003203 Genbank version no. NP_003203.1 GI:4507425 Genbank record update date: Sep 23, 2012 02:27 PM
Cross references Ciccodicola, A., et al EMBO J. 8 (7):1987-1991 (1989), Am. J. Hum. Genet. 49 (3):555-565 (1991)); US2003/224411 (Claim 1); W02003/083041 (Example 1); W02003/034984 (Claim 12); W02002/88170 (Claim 2; Page 52-53); W02003/024392 (Claim 2; Fig 58);
W02002/16413 (Claim 1; Page 94-95, 105); W02002/22808 (Claim 2; Fig 1);
(Example 2; Col 17-18); U55792616 (Fig 2); MIM:187395.
Polypeptide Genbank accession no. NP_003203 Genbank version no. NP_003203.1 GI:4507425 Genbank record update date: Sep 23, 2012 02:27 PM
Cross references Ciccodicola, A., et al EMBO J. 8 (7):1987-1991 (1989), Am. J. Hum. Genet. 49 (3):555-565 (1991)); US2003/224411 (Claim 1); W02003/083041 (Example 1); W02003/034984 (Claim 12); W02002/88170 (Claim 2; Page 52-53); W02003/024392 (Claim 2; Fig 58);
W02002/16413 (Claim 1; Page 94-95, 105); W02002/22808 (Claim 2; Fig 1);
(Example 2; Col 17-18); U55792616 (Fig 2); MIM:187395.
(14) CD21 (CR2 (Complement receptor 2) or C3DR (C3d/Epstein Barr virus receptor) or Hs.73792) Nucleotide Genbank accession no M26004 Genbank version no. M26004.1 GI:181939 Genbank record update date: Jun 23, 2010 08:47 AM
Polypeptide Genbank accession no. AAA35786 Genbank version no. AAA35786.1 GI:181940 Genbank record update date: Jun 23, 2010 08:47 AM
Cross references Fujisaku et al (1989) J. Biol. Chem. 264 (4):2118-2125); Weis J.J., et al J.
Exp. Med. 167, 1047-1066, 1988; Moore M., et al Proc. Natl. Acad. Sci. U.S.A. 84, 9194-9198, 1987; Barel M., et al Mol. Immunol. 35, 1025-1031, 1998; Weis J.J., et al Proc. Natl.
Acad. Sci. U.S.A.
83, 5639-5643, 1986; Sinha S.K., et al (1993) J. Immunol. 150, 5311-5320;
(Example 4); U52004/005538 (Example 1); W02003/062401 (Claim 9); W02004/045520 (Example 4); W091/02536 (Fig 9.1-9.9); W02004/020595 (Claim 1); Accession:
P20023;
Q13866; Q14212; EMBL; M26004; AAA35786.1.
Polypeptide Genbank accession no. AAA35786 Genbank version no. AAA35786.1 GI:181940 Genbank record update date: Jun 23, 2010 08:47 AM
Cross references Fujisaku et al (1989) J. Biol. Chem. 264 (4):2118-2125); Weis J.J., et al J.
Exp. Med. 167, 1047-1066, 1988; Moore M., et al Proc. Natl. Acad. Sci. U.S.A. 84, 9194-9198, 1987; Barel M., et al Mol. Immunol. 35, 1025-1031, 1998; Weis J.J., et al Proc. Natl.
Acad. Sci. U.S.A.
83, 5639-5643, 1986; Sinha S.K., et al (1993) J. Immunol. 150, 5311-5320;
(Example 4); U52004/005538 (Example 1); W02003/062401 (Claim 9); W02004/045520 (Example 4); W091/02536 (Fig 9.1-9.9); W02004/020595 (Claim 1); Accession:
P20023;
Q13866; Q14212; EMBL; M26004; AAA35786.1.
(15) CD79b (CD798, CD7913, IGb (immunoglobulin-associated beta), 829) Nucleotide Genbank accession no NM_000626 Genbank version no. NM_000626.2 GI:90193589 Genbank record update date: Jun 26, 2012 01:53 PM
Polypeptide Genbank accession no. NP_000617 Genbank version no. NP_000617.1 GI:11038674 Genbank record update date: Jun 26, 2012 01:53 PM
Cross references Proc. Natl. Acad. Sci. U.S.A. (2003) 100 (7):4126-4131, Blood (2002) 100(9):3068-3076, Muller. et al (1992) Eur. J. Immunol.
22(6):1621-1625); W02004/016225 (claim 2, Fig 140); W02003/087768, US2004/101874 (claim 1, page 102); W02003/062401 (claim 9); W02002/78524 (Example 2); US2002/150573 (claim 35 5, page 15); US5644033; W02003/048202 (claim 1, pages 306 and 309); WO
99/58658, U56534482 (claim 13, Fig 17A/B); W02000/55351 (claim 11, pages 1145-1146);
MIM:147245
Polypeptide Genbank accession no. NP_000617 Genbank version no. NP_000617.1 GI:11038674 Genbank record update date: Jun 26, 2012 01:53 PM
Cross references Proc. Natl. Acad. Sci. U.S.A. (2003) 100 (7):4126-4131, Blood (2002) 100(9):3068-3076, Muller. et al (1992) Eur. J. Immunol.
22(6):1621-1625); W02004/016225 (claim 2, Fig 140); W02003/087768, US2004/101874 (claim 1, page 102); W02003/062401 (claim 9); W02002/78524 (Example 2); US2002/150573 (claim 35 5, page 15); US5644033; W02003/048202 (claim 1, pages 306 and 309); WO
99/58658, U56534482 (claim 13, Fig 17A/B); W02000/55351 (claim 11, pages 1145-1146);
MIM:147245
(16) FcRH2 (IFGP4, IRTA4, SPAP1A (SH2 domain containing phosphatase anchor protein 5 la), SPAP18, SPAP1C) Nucleotide Genbank accession no NM_030764 Genbank version no. NM_030764.3 GI:227430280 Genbank record update date: Jun 30, 2012 12:30 AM
Polypeptide Genbank accession no. NP_110391 Genbank version no. NP_110391.2 GI:19923629 Genbank record update date: Jun 30, 2012 12:30 AM
Cross references AY358130); Genome Res. 13 (10):2265-2270 (2003), Immunogenetics 54 (2):87-95 (2002), Blood 99 (8):2662-2669 (2002), Proc. Natl. Acad. Sci. U.S.A. 98 (17):9772-9777 (2001), Xu, M.J., et al (2001) Biochem. Biophys. Res. Commun. 280 (3):768-775;
(Claim 2); W02003/077836; W02001/38490 (Claim 5; Fig 18D-1-18D-2);
5 (Claim 12);
10 W02003/089624 (Claim 25);: MIM:606509.
Polypeptide Genbank accession no. NP_110391 Genbank version no. NP_110391.2 GI:19923629 Genbank record update date: Jun 30, 2012 12:30 AM
Cross references AY358130); Genome Res. 13 (10):2265-2270 (2003), Immunogenetics 54 (2):87-95 (2002), Blood 99 (8):2662-2669 (2002), Proc. Natl. Acad. Sci. U.S.A. 98 (17):9772-9777 (2001), Xu, M.J., et al (2001) Biochem. Biophys. Res. Commun. 280 (3):768-775;
(Claim 2); W02003/077836; W02001/38490 (Claim 5; Fig 18D-1-18D-2);
5 (Claim 12);
10 W02003/089624 (Claim 25);: MIM:606509.
(17) HER2 (ErbB2) Nucleotide 10 Genbank accession no M11730 Genbank version no. M11730.1 GI:183986 Genbank record update date: Jun 23, 2010 08:47 AM
Polypeptide 15 Genbank accession no. AAA75493 Genbank version no. AAA75493.1 GI:306840 Genbank record update date: Jun 23, 2010 08:47 AM
Cross references 20 Coussens L., et al Science (1985) 230(4730):1132-1139); Yamamoto T., et al Nature 319, 230-234, 1986; Semba K., et al Proc. Natl. Acad. Sci. U.S.A. 82, 6497-6501, 1985; Swiercz J.M., et al J. Cell Biol. 165, 869- 15 880, 2004; Kuhns J.J., et al J. Biol.
Chem. 274, 36422-36427, 1999; Cho H.-S., et al Nature 421, 756-760, 2003; Ehsani A., et al (1993) Genomics 15, 426-429; W02004/048938 (Example 2); W02004/027049 (Fig 11); W02004/009622;
25 W02003/081210;
W02003/089904 (Claim 9); W02003/016475 (Claim 1); U52003/118592; W02003/008537 (Claim 1); W02003/055439 (Claim 29; Fig 1A-B); W02003/025228 (Claim 37; Fig 5C);
20 W02002/22636 (Example 13; Page 95-107); W02002/12341 (Claim 68; Fig 7);
W02002/13847 (Page 71-74); W02002/14503 (Page 114-117); W02001/53463 (Claim 2;
30 Page 41-46); W02001/41787 (Page 15); W02000/44899 (Claim 52; Fig 7);
(Claim 3; Fig 2); U55869445 (Claim 3; Col 31-38); W09630514 (Claim 2; Page 56-61);
EP1439393 (Claim 7); W02004/043361 (Claim 7); W02004/022709; W02001/00244 25 (Example 3; Fig 4); Accession: P04626; EMBL; M11767; AAA35808.1. EMBL;
M11761;
AAA35808.1 ANTIBODIES
Abbott: US20110177095 For example, an antibody comprising CDRs having overall at least 80% sequence identity to CDRs having amino acid sequences of SEQ ID NO:3 (CDR-H1), SEQ ID
NO:4 (CDR-H2), SEQ ID NO:5 (CDR-H3), SEQ ID NO:104 and/or SEQ ID NO:6 (CDR-L1), SEQ ID NO:7 (CDR-L2), and SEQ ID NO:8 (CDR-L3), wherein the anti-HER2 antibody or anti-HER2 binding fragment has reduced immunogenicity as compared to an antibody having a VH of SEQ ID NO:1 and a VL of SEQ ID NO:2.
Biogen: U520100119511 For example, ATCC accession numbers: PTA-10355, PTA-10356, PTA-10357, For example, a purified antibody molecule that binds to HER2 comprising a all six CDR's from an antibody selected from the group consisting of BIIB71F10 (SEQ ID
NOs:11, 13), BIIB69A09 (SEQ ID NOs:15, 17); BIIB67F10 (SEQ ID NOs:19, 21);
BIIB67F11 (SEQ ID NOs:23, 25), BIIB66Al2 (SEQ ID NOs:27, 29), BIIB66C01 (SEQ
ID NOs:31, 33), BIIB65C10 (SEQ ID NOs:35, 37), BIIB65H09 (SEQ ID NOs:39, 41) and B111365603 (SEQ ID NOs:43, 45), or CDRs which are identical or which have no more than two alterations from said CDRs.
Herceptin (Genentech) - U56,054,297; ATCC accession no. CRL-10463 (Genentech) Pertuzumab (Genentech) for example, see SEQ IDs No. 15&16, SEQ IDs No. 17&18, SEQ IDs No.
23&24 & ATCC accession numbers HB-12215, HB-12216, CRL 10463, HB-12697.
for example, ATCC accession numbers: HB-12215, HB-12216, CRL 10463, HB-12698.
- for example, ATCC accession numbers: HB-12215, HB-12216 - for example, an antibody comprising the variable light and variable heavy amino acid sequences in SEQ ID Nos. 3 and 4, respectively.
- for example, an antibody comprising a light chain amino acid sequence selected from SEQ ID No. 15 and 23, and a heavy chain amino acid sequence selected from SEQ ID No. 16 and 24 - for example, ATCC accession numbers: (7C2) HB-12215, (7F3) HB-12216, (4D5) CRL-10463, (2C4) HB-12697.
- for example, an antibody comprising the amino acid sequence in SEQ ID
No. 23, or a deamidated and/or oxidized variant thereof.
- for example, an antibody having a light chain variable domain comprising the hypervariable regions of SEQ ID NO: 1".
- For example, an antibody having a heavy chain variable domain comprising the hypervariable regions of SEQ ID NO: 2.
Glycotope: TrasGEX antibody http://vvww.glycotope.com/pipeline For example, see International Joint Cancer Institute and Changhai Hospital Cancer Cent: HMTI-Fc Ab - Gao J., et al BMB Rep. 2009 Oct 31;42(10):636-41.
Symphogen: U5201 10217305 Union Stem Cell &Gene Engineering, China - Liu HQ., et al Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2010 May;26(5):456-8.
Polypeptide 15 Genbank accession no. AAA75493 Genbank version no. AAA75493.1 GI:306840 Genbank record update date: Jun 23, 2010 08:47 AM
Cross references 20 Coussens L., et al Science (1985) 230(4730):1132-1139); Yamamoto T., et al Nature 319, 230-234, 1986; Semba K., et al Proc. Natl. Acad. Sci. U.S.A. 82, 6497-6501, 1985; Swiercz J.M., et al J. Cell Biol. 165, 869- 15 880, 2004; Kuhns J.J., et al J. Biol.
Chem. 274, 36422-36427, 1999; Cho H.-S., et al Nature 421, 756-760, 2003; Ehsani A., et al (1993) Genomics 15, 426-429; W02004/048938 (Example 2); W02004/027049 (Fig 11); W02004/009622;
25 W02003/081210;
W02003/089904 (Claim 9); W02003/016475 (Claim 1); U52003/118592; W02003/008537 (Claim 1); W02003/055439 (Claim 29; Fig 1A-B); W02003/025228 (Claim 37; Fig 5C);
20 W02002/22636 (Example 13; Page 95-107); W02002/12341 (Claim 68; Fig 7);
W02002/13847 (Page 71-74); W02002/14503 (Page 114-117); W02001/53463 (Claim 2;
30 Page 41-46); W02001/41787 (Page 15); W02000/44899 (Claim 52; Fig 7);
(Claim 3; Fig 2); U55869445 (Claim 3; Col 31-38); W09630514 (Claim 2; Page 56-61);
EP1439393 (Claim 7); W02004/043361 (Claim 7); W02004/022709; W02001/00244 25 (Example 3; Fig 4); Accession: P04626; EMBL; M11767; AAA35808.1. EMBL;
M11761;
AAA35808.1 ANTIBODIES
Abbott: US20110177095 For example, an antibody comprising CDRs having overall at least 80% sequence identity to CDRs having amino acid sequences of SEQ ID NO:3 (CDR-H1), SEQ ID
NO:4 (CDR-H2), SEQ ID NO:5 (CDR-H3), SEQ ID NO:104 and/or SEQ ID NO:6 (CDR-L1), SEQ ID NO:7 (CDR-L2), and SEQ ID NO:8 (CDR-L3), wherein the anti-HER2 antibody or anti-HER2 binding fragment has reduced immunogenicity as compared to an antibody having a VH of SEQ ID NO:1 and a VL of SEQ ID NO:2.
Biogen: U520100119511 For example, ATCC accession numbers: PTA-10355, PTA-10356, PTA-10357, For example, a purified antibody molecule that binds to HER2 comprising a all six CDR's from an antibody selected from the group consisting of BIIB71F10 (SEQ ID
NOs:11, 13), BIIB69A09 (SEQ ID NOs:15, 17); BIIB67F10 (SEQ ID NOs:19, 21);
BIIB67F11 (SEQ ID NOs:23, 25), BIIB66Al2 (SEQ ID NOs:27, 29), BIIB66C01 (SEQ
ID NOs:31, 33), BIIB65C10 (SEQ ID NOs:35, 37), BIIB65H09 (SEQ ID NOs:39, 41) and B111365603 (SEQ ID NOs:43, 45), or CDRs which are identical or which have no more than two alterations from said CDRs.
Herceptin (Genentech) - U56,054,297; ATCC accession no. CRL-10463 (Genentech) Pertuzumab (Genentech) for example, see SEQ IDs No. 15&16, SEQ IDs No. 17&18, SEQ IDs No.
23&24 & ATCC accession numbers HB-12215, HB-12216, CRL 10463, HB-12697.
for example, ATCC accession numbers: HB-12215, HB-12216, CRL 10463, HB-12698.
- for example, ATCC accession numbers: HB-12215, HB-12216 - for example, an antibody comprising the variable light and variable heavy amino acid sequences in SEQ ID Nos. 3 and 4, respectively.
- for example, an antibody comprising a light chain amino acid sequence selected from SEQ ID No. 15 and 23, and a heavy chain amino acid sequence selected from SEQ ID No. 16 and 24 - for example, ATCC accession numbers: (7C2) HB-12215, (7F3) HB-12216, (4D5) CRL-10463, (2C4) HB-12697.
- for example, an antibody comprising the amino acid sequence in SEQ ID
No. 23, or a deamidated and/or oxidized variant thereof.
- for example, an antibody having a light chain variable domain comprising the hypervariable regions of SEQ ID NO: 1".
- For example, an antibody having a heavy chain variable domain comprising the hypervariable regions of SEQ ID NO: 2.
Glycotope: TrasGEX antibody http://vvww.glycotope.com/pipeline For example, see International Joint Cancer Institute and Changhai Hospital Cancer Cent: HMTI-Fc Ab - Gao J., et al BMB Rep. 2009 Oct 31;42(10):636-41.
Symphogen: U5201 10217305 Union Stem Cell &Gene Engineering, China - Liu HQ., et al Xi Bao Yu Fen Zi Mian Yi Xue Za Zhi. 2010 May;26(5):456-8.
(18) NCA (CEACAM6) Nucleotide Genbank accession no M18728 Genbank version no. M18728.1 GI:189084 Genbank record update date: Jun 23, 2010 08:48 AM
Polypeptide Genbank accession no. AAA59907 Genbank version no. AAA59907.1 GI:189085 Genbank record update date: Jun 23, 2010 08:48 AM
Cross references Barnett T., et al Genomics 3, 59-66, 1988; Tawaragi Y., et al Biochem.
Biophys. Res.
Commun. 150, 89-96, 1988; Strausberg R.L., et al Proc. Natl. Acad. Sci. U.S.A.
99:16899-16903, 2002; W02004/063709; EP1439393 (Claim 7); W02004/044178 (Example 4);
W02004/031238; W02003/042661 (Claim 12); W02002/78524 (Example 2);
W02002/86443 (Claim 27; Page 427); W02002/60317 (Claim 2); Accession: P40199;
Q14920; EMBL; M29541; AAA59915.1.
EMBL; M18728.
Polypeptide Genbank accession no. AAA59907 Genbank version no. AAA59907.1 GI:189085 Genbank record update date: Jun 23, 2010 08:48 AM
Cross references Barnett T., et al Genomics 3, 59-66, 1988; Tawaragi Y., et al Biochem.
Biophys. Res.
Commun. 150, 89-96, 1988; Strausberg R.L., et al Proc. Natl. Acad. Sci. U.S.A.
99:16899-16903, 2002; W02004/063709; EP1439393 (Claim 7); W02004/044178 (Example 4);
W02004/031238; W02003/042661 (Claim 12); W02002/78524 (Example 2);
W02002/86443 (Claim 27; Page 427); W02002/60317 (Claim 2); Accession: P40199;
Q14920; EMBL; M29541; AAA59915.1.
EMBL; M18728.
(19) MDP (DPEP1) Nucleotide Genbank accession no BC017023 Genbank version no. BC017023.1 GI:16877538 Genbank record update date: Mar 6, 2012 01:00 PM
Polypeptide Genbank accession no. AAH17023 Genbank version no. AAH17023.1 GI:16877539 Genbank record update date: Mar 6, 2012 01:00 PM
Cross references Proc. Natl. Acad. Sci. U.S.A. 99 (26):16899-16903 (2002)); W02003/016475 (Claim 1);
W02002/64798 (Claim 33; Page 85- 87); JP05003790 (Fig 6-8); W099/46284 (Fig 9);
MIM:179780.
Polypeptide Genbank accession no. AAH17023 Genbank version no. AAH17023.1 GI:16877539 Genbank record update date: Mar 6, 2012 01:00 PM
Cross references Proc. Natl. Acad. Sci. U.S.A. 99 (26):16899-16903 (2002)); W02003/016475 (Claim 1);
W02002/64798 (Claim 33; Page 85- 87); JP05003790 (Fig 6-8); W099/46284 (Fig 9);
MIM:179780.
(20) IL20R-alpha (IL2ORa, ZCYTOR7) Nucleotide Genbank accession no AF184971 Genbank version no. AF184971.1 GI:6013324 Genbank record update date: Mar 10, 2010 10:00 PM
Polypeptide Genbank accession no. AAF01320 Genbank version no. AAF01320.1 GI:6013325 Genbank record update date: Mar 10, 2010 10:00 PM
Cross references Clark H.F., et al Genome Res. 13, 2265-2270, 2003; Mungall A.J., et al Nature 425, 805-811, 2003; Blumberg H., et al Ce// 104, 9-19, 2001; Dumoutier L., et al J.
Immunol. 167, 3545-3549, 2001; Parrish-Novak J., et al J. Biol. Chem. 277, 47517-47523, 2002; Pletnev S., et al (2003) Biochemistty 42:12617-12624; Sheikh F., et al (2004) J. Immunol. 172, 2006-2010;
EP1394274 (Example 11); US2004/005320 (Example 5); W02003/029262 (Page 74-75);
10 W02003/002717 (Claim 2; Page 63); W02002/22153 (Page 45-47);
US2002/042366 (Page 20-21); W02001/46261 (Page 57-59); W02001/46232 (Page 63-65); W098/37193 (Claim 1;
Page 55-59); Accession: Q9UHF4; Q6UWA9; Q965H8; EMBL; AF184971; AAF01320.1.
Polypeptide Genbank accession no. AAF01320 Genbank version no. AAF01320.1 GI:6013325 Genbank record update date: Mar 10, 2010 10:00 PM
Cross references Clark H.F., et al Genome Res. 13, 2265-2270, 2003; Mungall A.J., et al Nature 425, 805-811, 2003; Blumberg H., et al Ce// 104, 9-19, 2001; Dumoutier L., et al J.
Immunol. 167, 3545-3549, 2001; Parrish-Novak J., et al J. Biol. Chem. 277, 47517-47523, 2002; Pletnev S., et al (2003) Biochemistty 42:12617-12624; Sheikh F., et al (2004) J. Immunol. 172, 2006-2010;
EP1394274 (Example 11); US2004/005320 (Example 5); W02003/029262 (Page 74-75);
10 W02003/002717 (Claim 2; Page 63); W02002/22153 (Page 45-47);
US2002/042366 (Page 20-21); W02001/46261 (Page 57-59); W02001/46232 (Page 63-65); W098/37193 (Claim 1;
Page 55-59); Accession: Q9UHF4; Q6UWA9; Q965H8; EMBL; AF184971; AAF01320.1.
(21) Brevican (BCAN, BEHAB) Nucleotide Genbank accession no AF229053 Genbank version no. AF229053.1 GI:10798902 Genbank record update date: Mar 11, 2010 12:58 AM
Polypeptide Genbank accession no. AAG23135 Genbank version no. AAG23135.1 GI:10798903 Genbank record update date: Mar 11, 2010 12:58 AM
Cross references Gary S.C., et al Gene 256, 139-147, 2000; Clark H.F., et al Genome Res. 13, 2265-2270, 2003; Strausberg R.L., et al Proc. Natl. Acad. Sci. U.S.A. 99, 16899-16903, 2002;
U52003/186372 (Claim 11); U52003/186373 (Claim 11); U52003/119131 (Claim 1;
Fig 52);
U52003/119122 (Claim 1; 20 Fig 52); U52003/119126 (Claim 1); U52003/119121 (Claim 1;
Fig 52); U52003/119129 (Claim 1); U52003/119130 (Claim 1); U52003/119128 (Claim 1;
Fig 52); U52003/119125 (Claim 1); W02003/016475 (Claim 1); W02002/02634 (Claim 1)
Polypeptide Genbank accession no. AAG23135 Genbank version no. AAG23135.1 GI:10798903 Genbank record update date: Mar 11, 2010 12:58 AM
Cross references Gary S.C., et al Gene 256, 139-147, 2000; Clark H.F., et al Genome Res. 13, 2265-2270, 2003; Strausberg R.L., et al Proc. Natl. Acad. Sci. U.S.A. 99, 16899-16903, 2002;
U52003/186372 (Claim 11); U52003/186373 (Claim 11); U52003/119131 (Claim 1;
Fig 52);
U52003/119122 (Claim 1; 20 Fig 52); U52003/119126 (Claim 1); U52003/119121 (Claim 1;
Fig 52); U52003/119129 (Claim 1); U52003/119130 (Claim 1); U52003/119128 (Claim 1;
Fig 52); U52003/119125 (Claim 1); W02003/016475 (Claim 1); W02002/02634 (Claim 1)
(22) EphB2R (DRT, ERK, Hek5, EPHT3, Tyro5) Nucleotide Genbank accession no NM_004442 Genbank version no. NM_004442.6 GI:111118979 Genbank record update date: Sep 8, 2012 04:43 PM
Polypeptide 5 Genbank accession no. NP_004433 Genbank version no. NP_004433.2 GI:21396504 Genbank record update date: Sep 8, 2012 04:43 PM
Cross references 10 Chan,J. and Watt, V.M., Oncogene 6 (6), 1057-1061 (1991) Oncogene 10 (5):897-905 (1995), Annu. Rev. Neurosci. 21:309-345 (1998), Int. Rev. Cytol. 196:177-244 (2000));
W02003042661 (Claim 12); W0200053216 (Claim 1; Page 41); W02004065576 (Claim 1);
W02004020583 (Claim 9); W02003004529 (Page 128-132); W0200053216 (Claim 1;
Page 42); MIM:600997.
Polypeptide 5 Genbank accession no. NP_004433 Genbank version no. NP_004433.2 GI:21396504 Genbank record update date: Sep 8, 2012 04:43 PM
Cross references 10 Chan,J. and Watt, V.M., Oncogene 6 (6), 1057-1061 (1991) Oncogene 10 (5):897-905 (1995), Annu. Rev. Neurosci. 21:309-345 (1998), Int. Rev. Cytol. 196:177-244 (2000));
W02003042661 (Claim 12); W0200053216 (Claim 1; Page 41); W02004065576 (Claim 1);
W02004020583 (Claim 9); W02003004529 (Page 128-132); W0200053216 (Claim 1;
Page 42); MIM:600997.
(23) ASLG659 (B7h) Nucleotide Genbank accession no. AX092328 Genbank version no. AX092328.1 GI:13444478 Genbank record update date: Jan 26, 2011 07:37 AM
Cross references US2004/0101899 (Claim 2); W02003104399 (Claim 11); W02004000221 (Fig 3);
U52003/165504 (Claim 1); U52003/124140 (Example 2); U52003/065143 (Fig 60);
W02002/102235 (Claim 13; Page 299); U52003/091580 (Example 2); W02002/10187 (Claim 6; Fig 10); W02001/94641 (Claim 12; Fig 7b); W02002/02624 (Claim 13;
Fig 1A-1B);
U52002/034749 (Claim 54; Page 45-46); W02002/06317 (Example 2; Page 320-321, Claim 34; Page 321-322); W02002/71928 (Page 468-469); W02002/02587 (Example 1; Fig 1);
W02001/40269 (Example 3; Pages 190-192); W02000/36107 (Example 2; Page 205-207);
W02004/053079 (Claim 12); W02003/004989 (Claim 1); W02002/71928 (Page 233-234, 452-453); WO 01/16318.
Cross references US2004/0101899 (Claim 2); W02003104399 (Claim 11); W02004000221 (Fig 3);
U52003/165504 (Claim 1); U52003/124140 (Example 2); U52003/065143 (Fig 60);
W02002/102235 (Claim 13; Page 299); U52003/091580 (Example 2); W02002/10187 (Claim 6; Fig 10); W02001/94641 (Claim 12; Fig 7b); W02002/02624 (Claim 13;
Fig 1A-1B);
U52002/034749 (Claim 54; Page 45-46); W02002/06317 (Example 2; Page 320-321, Claim 34; Page 321-322); W02002/71928 (Page 468-469); W02002/02587 (Example 1; Fig 1);
W02001/40269 (Example 3; Pages 190-192); W02000/36107 (Example 2; Page 205-207);
W02004/053079 (Claim 12); W02003/004989 (Claim 1); W02002/71928 (Page 233-234, 452-453); WO 01/16318.
(24) PSCA (Prostate stem cell antigen precursor) Nucleotide Genbank accession no AJ297436 Genbank version no. AJ297436.1 GI:9367211 Genbank record update date: Feb 1, 2011 11:25 AM
Polypeptide Genbank accession no. CAB97347 Genbank version no. CAB97347.1 GI:9367212 Genbank record update date: Feb 1, 2011 11:25 AM
Cross references Reiter R.E., et al Proc. Natl. Acad. Sci. U.S.A. 95, 1735-1740, 1998; Gu Z., et al Oncogene 19, 1288-1296, 2000; Biochem. Biophys. Res. Commun. (2000) 275(3):783-788;
W02004/022709; EP1394274 (Example 11); US2004/018553 (Claim 17); W02003/008537 (Claim 1); W02002/81646 (Claim 1; Page 164); W02003/003906 (Claim 10; Page 288);
W02001/40309 (Example 1; Fig 17); US2001/055751 (Example 1; Fig lb);
(Claim 18; Fig 1); W098/51805 (Claim 17; Page 97); W098/51824 (Claim 10; Page 94);
W098/40403 (Claim 2; Fig 1B); Accession: 043653; EMBL; AF043498; AAC39607.1
Polypeptide Genbank accession no. CAB97347 Genbank version no. CAB97347.1 GI:9367212 Genbank record update date: Feb 1, 2011 11:25 AM
Cross references Reiter R.E., et al Proc. Natl. Acad. Sci. U.S.A. 95, 1735-1740, 1998; Gu Z., et al Oncogene 19, 1288-1296, 2000; Biochem. Biophys. Res. Commun. (2000) 275(3):783-788;
W02004/022709; EP1394274 (Example 11); US2004/018553 (Claim 17); W02003/008537 (Claim 1); W02002/81646 (Claim 1; Page 164); W02003/003906 (Claim 10; Page 288);
W02001/40309 (Example 1; Fig 17); US2001/055751 (Example 1; Fig lb);
(Claim 18; Fig 1); W098/51805 (Claim 17; Page 97); W098/51824 (Claim 10; Page 94);
W098/40403 (Claim 2; Fig 1B); Accession: 043653; EMBL; AF043498; AAC39607.1
(25) GEDA
Nucleotide Genbank accession no AY260763 Genbank version no. AY260763.1 GI:30102448 Genbank record update date: Mar 11, 2010 02:24 AM
Polypeptide Genbank accession no. AAP14954 Genbank version no. AAP14954.1 GI:30102449 Genbank record update date: Mar 11, 2010 02:24 AM
Cross references AP14954 lipoma HMGIC fusion-partnerlike protein /pid=AAP14954.1 - Homo sapiens (human); W02003/054152 (Claim 20); W02003/000842 (Claim 1); W02003/023013 (Example 3, Claim 20); US2003/194704 (Claim 45); GI:30102449;
Nucleotide Genbank accession no AY260763 Genbank version no. AY260763.1 GI:30102448 Genbank record update date: Mar 11, 2010 02:24 AM
Polypeptide Genbank accession no. AAP14954 Genbank version no. AAP14954.1 GI:30102449 Genbank record update date: Mar 11, 2010 02:24 AM
Cross references AP14954 lipoma HMGIC fusion-partnerlike protein /pid=AAP14954.1 - Homo sapiens (human); W02003/054152 (Claim 20); W02003/000842 (Claim 1); W02003/023013 (Example 3, Claim 20); US2003/194704 (Claim 45); GI:30102449;
(26) BAFF-R (B cell -activating factor receptor, BLyS receptor 3, BR3) Nucleotide Genbank accession no AF116456 Genbank version no. AF116456.1 GI:4585274 Genbank record update date: Mar 10, 2010 09:44 PM
Polypeptide Genbank accession no. AAD25356 Genbank version no. AAD25356.1 GI:4585275 Genbank record update date: Mar 10, 2010 09:44 PM
Cross references BAFF receptor /pid=NP_443177.1 - Homo sapiens: Thompson, J.S., et al Science (5537), 2108-2111 (2001); W02004/058309; W02004/011611; W02003/045422 (Example;
Page 32-33); W02003/014294 (Claim 35; Fig 6B); W02003/035846 (Claim 70; Page 616); W02002/94852 (Col 136-137); W02002/38766 25 (Claim 3; Page 133);
W02002/24909 (Example 3; Fig 3); MIM:606269; NP_443177.1; NM_052945_1;
Polypeptide Genbank accession no. AAD25356 Genbank version no. AAD25356.1 GI:4585275 Genbank record update date: Mar 10, 2010 09:44 PM
Cross references BAFF receptor /pid=NP_443177.1 - Homo sapiens: Thompson, J.S., et al Science (5537), 2108-2111 (2001); W02004/058309; W02004/011611; W02003/045422 (Example;
Page 32-33); W02003/014294 (Claim 35; Fig 6B); W02003/035846 (Claim 70; Page 616); W02002/94852 (Col 136-137); W02002/38766 25 (Claim 3; Page 133);
W02002/24909 (Example 3; Fig 3); MIM:606269; NP_443177.1; NM_052945_1;
(27) CD22 (B-cell receptor CD22-Bisoform, BL-CAM, Lyb-8, Lyb8, SIGLEC-2, FLJ22814) Nucleotide Genbank accession no AK026467 Genbank version no. AK026467.1 GI:10439337 Genbank record update date: Sep 11, 2006 11:24 PM
Polypeptide Genbank accession no. BAB15489 Genbank version no. BAB15489.1 GI:10439338 Genbank record update date: Sep 11, 2006 11:24 PM
Cross references Wilson et al (1991) J. Exp. Med. 173:137-146; 30 W02003/072036 (Claim 1; Fig 1);
IM:107266; NP_001762.1; NM_001771_1.
(27a) CD22 (CD22 molecule) Nucleotide Genbank accession no X52785 Genbank version no. X52785.1 GI:29778 Genbank record update date: Feb 2, 2011 10:09 AM
Polypeptide Genbank accession no. CAA36988 Genbank version no. CAA36988.1 GI:29779 Genbank record update date: Feb 2, 2011 10:09 AM
Cross references Stamenkovic I. et al., Nature 345 (6270), 74-77 (1990) Other information Official Symbol: CD22 Other Aliases: SIGLEC-2, SIGLEC2 Other Designations: B-cell receptor CD22; B-lymphocyte cell adhesion molecule;
BL-CAM; CD22 antigen; T-cell surface antigen Leu-14; sialic acid binding lg-like lectin 2; sialic acid-binding lg-like lectin 2 ANTIBODIES
G5/44 (Inotuzumab): DiJoseph JF.,et al Cancer Immunol Immunother. 2005 Jan;54(1):11-24.
Epratuzumab- Goldenberg DM., et al Expert Rev Anticancer Ther. 6(10): 1341-53, 2006.
Polypeptide Genbank accession no. BAB15489 Genbank version no. BAB15489.1 GI:10439338 Genbank record update date: Sep 11, 2006 11:24 PM
Cross references Wilson et al (1991) J. Exp. Med. 173:137-146; 30 W02003/072036 (Claim 1; Fig 1);
IM:107266; NP_001762.1; NM_001771_1.
(27a) CD22 (CD22 molecule) Nucleotide Genbank accession no X52785 Genbank version no. X52785.1 GI:29778 Genbank record update date: Feb 2, 2011 10:09 AM
Polypeptide Genbank accession no. CAA36988 Genbank version no. CAA36988.1 GI:29779 Genbank record update date: Feb 2, 2011 10:09 AM
Cross references Stamenkovic I. et al., Nature 345 (6270), 74-77 (1990) Other information Official Symbol: CD22 Other Aliases: SIGLEC-2, SIGLEC2 Other Designations: B-cell receptor CD22; B-lymphocyte cell adhesion molecule;
BL-CAM; CD22 antigen; T-cell surface antigen Leu-14; sialic acid binding lg-like lectin 2; sialic acid-binding lg-like lectin 2 ANTIBODIES
G5/44 (Inotuzumab): DiJoseph JF.,et al Cancer Immunol Immunother. 2005 Jan;54(1):11-24.
Epratuzumab- Goldenberg DM., et al Expert Rev Anticancer Ther. 6(10): 1341-53, 2006.
(28) CD79a (CD79A, CD79alpha), immunoglobulin-associated alpha, a B cell-specific protein that covalently interacts with Ig beta (CD79B) and forms a complex on the surface with Ig M
35 molecules, transduces a signal involved in B-cell differentiation), pl:
4.84, MW: 25028 TM:
[P] Gene Chromosome: 19q13.2).
Nucleotide Genbank accession no NM_001783 Genbank version no. NM_001783.3 GI:90193587 Genbank record update date: Jun 26, 2012 01:48 PM
Polypeptide Genbank accession no. NP_001774 Genbank version no. NP_001774.1 GI:4502685 Genbank record update date: Jun 26, 2012 01:48 PM
Cross references W02003/088808, US2003/0228319; W02003/062401 (claim 9); US2002/150573 (claim 4, pages 13-14); W099/58658 (claim 13, Fig 16); W092/07574 (Fig 1); US5644033; Ha et al (1992) J. lmmunol. 148(5):1526-1531; Muller. et al (1992) Eur. J. lmmunol..
22:1621-1625;
Hashimoto et al (1994) lmmunogenetics 40(4):287-295; Preud'homme et al (1992) Clin. Exp.
5 lmmunol. 90(1):141-146; Yu et al (1992) J. lmmunol. 148(2) 633-637;
Sakaguchi et al (1988) EMBO J. 7(11):3457-3464
35 molecules, transduces a signal involved in B-cell differentiation), pl:
4.84, MW: 25028 TM:
[P] Gene Chromosome: 19q13.2).
Nucleotide Genbank accession no NM_001783 Genbank version no. NM_001783.3 GI:90193587 Genbank record update date: Jun 26, 2012 01:48 PM
Polypeptide Genbank accession no. NP_001774 Genbank version no. NP_001774.1 GI:4502685 Genbank record update date: Jun 26, 2012 01:48 PM
Cross references W02003/088808, US2003/0228319; W02003/062401 (claim 9); US2002/150573 (claim 4, pages 13-14); W099/58658 (claim 13, Fig 16); W092/07574 (Fig 1); US5644033; Ha et al (1992) J. lmmunol. 148(5):1526-1531; Muller. et al (1992) Eur. J. lmmunol..
22:1621-1625;
Hashimoto et al (1994) lmmunogenetics 40(4):287-295; Preud'homme et al (1992) Clin. Exp.
5 lmmunol. 90(1):141-146; Yu et al (1992) J. lmmunol. 148(2) 633-637;
Sakaguchi et al (1988) EMBO J. 7(11):3457-3464
(29) CXCR5 (Burkitt's lymphoma receptor 1, a G protein-coupled receptor that is activated by the CXCL13 chemokine, functions in lymphocyte migration and humoral defense, plays a 10 role in HIV-2 infection and perhaps development of AIDS, lymphoma, myeloma, and leukemia); 372 aa, pl: 8.54 MW: 41959 TM: 7 [P] Gene Chromosome: 11q23.3, Nucleotide Genbank accession no NM_001716 Genbank version no. NM_001716.4 GI:342307092 Genbank record update date: Sep 30, 2012 01:49 PM
Polypeptide Genbank accession no. NP_001707 Genbank version no. NP_001707.1 GI:4502415 Genbank record update date: Sep 30, 2012 01:49 PM
Cross references W02004/040000; W02004/015426; U52003/105292 (Example 2); U56555339 (Example 2);
W02002/61087 (Fig 1); W02001/57188 (Claim 20, page 269); W02001/72830 (pages 13); W02000/22129 (Example 1, pages 152-153, 15 Example 2, pages 254-256);
W099/28468 (claim 1, page 38); U55440021 (Example 2, col 49-52); W094/28931 (pages 56-58); W092/17497 (claim 7, Fig 5); Dobner et al (1992) Eur. J. lmmunol.
22:2795-2799;
Barella et al (1995) Biochem. J. 309:773-779
Polypeptide Genbank accession no. NP_001707 Genbank version no. NP_001707.1 GI:4502415 Genbank record update date: Sep 30, 2012 01:49 PM
Cross references W02004/040000; W02004/015426; U52003/105292 (Example 2); U56555339 (Example 2);
W02002/61087 (Fig 1); W02001/57188 (Claim 20, page 269); W02001/72830 (pages 13); W02000/22129 (Example 1, pages 152-153, 15 Example 2, pages 254-256);
W099/28468 (claim 1, page 38); U55440021 (Example 2, col 49-52); W094/28931 (pages 56-58); W092/17497 (claim 7, Fig 5); Dobner et al (1992) Eur. J. lmmunol.
22:2795-2799;
Barella et al (1995) Biochem. J. 309:773-779
(30) HLA-DOB (Beta subunit of MHC class II molecule (la antigen) that binds peptides and 20 presents them to CD4+ T lymphocytes); 273 aa, pl: 6.56, MW: 30820. TM: 1 [P] Gene Chromosome: 6p21.3) Nucleotide Genbank accession no NM_002120 Genbank version no. NM_002120.3 GI:118402587 Genbank record update date: Sep 8, 2012 04:46 PM
5 Polypeptide Genbank accession no. NP_002111 Genbank version no. NP_002111.1 GI:4504403 Genbank record update date: Sep 8, 2012 04:46 PM
10 Cross references TonneIle et al (1985) EMBO J. 4(11):2839-2847; Jonsson et al (1989) Immunogenetics 29(6):411-413; Beck et al (1992) J. Mol. Biol. 228:433-441; Strausberg et al (2002) Proc.
Natl. Acad. Sci USA 99:16899- 16903; Servenius et al (1987) J. Biol. Chem.
262:8759-8766;
Beck et al (1996) J. Mol. Biol. 25 255:1-13; Naruse et al (2002) Tissue Antigens 59:512-519;
15 W099/58658 (claim 13, Fig 15); U56153408 (Col 35-38); U55976551 (col 168-170);
U56011146 (col 145-146); Kasahara et al (1989) Immunogenetics 30(1):66-68;
Larhammar et al (1985) J. Biol. Chem. 260(26):14111-14119
5 Polypeptide Genbank accession no. NP_002111 Genbank version no. NP_002111.1 GI:4504403 Genbank record update date: Sep 8, 2012 04:46 PM
10 Cross references TonneIle et al (1985) EMBO J. 4(11):2839-2847; Jonsson et al (1989) Immunogenetics 29(6):411-413; Beck et al (1992) J. Mol. Biol. 228:433-441; Strausberg et al (2002) Proc.
Natl. Acad. Sci USA 99:16899- 16903; Servenius et al (1987) J. Biol. Chem.
262:8759-8766;
Beck et al (1996) J. Mol. Biol. 25 255:1-13; Naruse et al (2002) Tissue Antigens 59:512-519;
15 W099/58658 (claim 13, Fig 15); U56153408 (Col 35-38); U55976551 (col 168-170);
U56011146 (col 145-146); Kasahara et al (1989) Immunogenetics 30(1):66-68;
Larhammar et al (1985) J. Biol. Chem. 260(26):14111-14119
(31) P2X5 (Purinergic receptor P2X ligand-gated ion channel 5, an ion channel gated by 20 extracellular ATP, may be involved in synaptic transmission and neurogenesis, deficiency may contribute to the pathophysiology of idiopathic detrusor instability); 422 aa), pl: 7.63, MW: 47206 TM: 1 [P] Gene Chromosome: 17p13.3).
Nucleotide Genbank accession no NM_002561 25 Genbank version no. NM_002561.3 GI:325197202 Genbank record update date: Jun 27, 2012 12:41 AM
Polypeptide Genbank accession no. NP_002552 30 Genbank version no. NP_002552.2 GI:28416933 Genbank record update date: Jun 27, 2012 12:41 AM
Cross references Le et al (1997) FEBS Lett. 418(1-2):195-199; W02004/047749; W02003/072035 (claim 10);
35 Touchman et al (2000) Genome Res. 10:165-173; W02002/22660 (claim 20);
W02003/093444 (claim 1); W02003/087768 (claim 1); W02003/029277 (page 82)
Nucleotide Genbank accession no NM_002561 25 Genbank version no. NM_002561.3 GI:325197202 Genbank record update date: Jun 27, 2012 12:41 AM
Polypeptide Genbank accession no. NP_002552 30 Genbank version no. NP_002552.2 GI:28416933 Genbank record update date: Jun 27, 2012 12:41 AM
Cross references Le et al (1997) FEBS Lett. 418(1-2):195-199; W02004/047749; W02003/072035 (claim 10);
35 Touchman et al (2000) Genome Res. 10:165-173; W02002/22660 (claim 20);
W02003/093444 (claim 1); W02003/087768 (claim 1); W02003/029277 (page 82)
(32) CD72 (B-cell differentiation antigen CD72, Lyb-2); 359 aa, pl: 8.66, MW:
40225, TM: 1 [P] Gene Chromosome: 9p13.3).
Nucleotide 5 Genbank accession no NM_001782 Genbank version no. NM_001782.2 GI:194018444 Genbank record update date: Jun 26, 2012 01:43 PM
Polypeptide Genbank accession no. NP_001773 Genbank version no. NP_001773.1 GI:4502683 Genbank record update date: Jun 26, 2012 01:43 PM
Cross references W02004042346 (claim 65); W02003/026493 (pages 51-52, 57-58); W02000/75655 (pages 105-106); Von Hoegen et al (1990) J. Immunol. 144(12):4870-4877; Strausberg et al (2002) Proc. Natl. Acad. Sci USA 99:16899-16903.
40225, TM: 1 [P] Gene Chromosome: 9p13.3).
Nucleotide 5 Genbank accession no NM_001782 Genbank version no. NM_001782.2 GI:194018444 Genbank record update date: Jun 26, 2012 01:43 PM
Polypeptide Genbank accession no. NP_001773 Genbank version no. NP_001773.1 GI:4502683 Genbank record update date: Jun 26, 2012 01:43 PM
Cross references W02004042346 (claim 65); W02003/026493 (pages 51-52, 57-58); W02000/75655 (pages 105-106); Von Hoegen et al (1990) J. Immunol. 144(12):4870-4877; Strausberg et al (2002) Proc. Natl. Acad. Sci USA 99:16899-16903.
(33) LY64 (Lymphocyte antigen 64 (RP105), type I membrane protein of the leucine rich repeat (LRR) family, regulates B-cell activation and apoptosis, loss of function is associated with increased disease activity in patients with systemic lupus etythematosis); 661 aa, pl:
6.20, MW: 74147 TM: 1 [P] Gene Chromosome: 5q12).
Nucleotide Genbank accession no NM_005582 Genbank version no. NM_005582.2 GI:167555126 Genbank record update date: Sep 2, 2012 01:50 PM
Polypeptide Genbank accession no. NP_005573 Genbank version no. NP_005573.2 GI:167555127 Genbank record update date: Sep 2, 2012 01:50 PM
Cross references U52002/193567; W097/07198 (claim 11, pages 39-42); Miura et al (1996) 15 Genomics 38(3):299-304; Miura et al (1998) Blood 92:2815-2822; W02003/083047;
(claim 8, pages 57-61); W02000/12130 (pages 24-26).
6.20, MW: 74147 TM: 1 [P] Gene Chromosome: 5q12).
Nucleotide Genbank accession no NM_005582 Genbank version no. NM_005582.2 GI:167555126 Genbank record update date: Sep 2, 2012 01:50 PM
Polypeptide Genbank accession no. NP_005573 Genbank version no. NP_005573.2 GI:167555127 Genbank record update date: Sep 2, 2012 01:50 PM
Cross references U52002/193567; W097/07198 (claim 11, pages 39-42); Miura et al (1996) 15 Genomics 38(3):299-304; Miura et al (1998) Blood 92:2815-2822; W02003/083047;
(claim 8, pages 57-61); W02000/12130 (pages 24-26).
(34) FcRH1 (Fc receptor-like protein 1, a putative receptor for the immunoglobulin Fc domain that contains C2 type Ig-like and ITAM domains, may have a role in B-lymphocyte 20 differentiation); 429 aa, pl: 5.28, MW: 46925 TM: 1 [P] Gene Chromosome:
1q21-1q22) Nucleotide Genbank accession no NM_052938 Genbank version no. NM_052938.4 GI:226958543 Genbank record update date: Sep 2, 2012 01:43 PM
Polypeptide Genbank accession no. NP_443170 Genbank version no. NP_443170.1 GI:16418419 Genbank record update date: Sep 2, 2012 01:43 PM
Cross references W02003/077836; W02001/38490 (claim 6, Fig 18E-1-18-E-2); Davis et al (2001) Proc. Natl.
Acad. Sci USA 98(17):9772-9777; W02003/089624 (claim 8); EP1347046 (claim 1);
W02003/089624 (claim 7).
1q21-1q22) Nucleotide Genbank accession no NM_052938 Genbank version no. NM_052938.4 GI:226958543 Genbank record update date: Sep 2, 2012 01:43 PM
Polypeptide Genbank accession no. NP_443170 Genbank version no. NP_443170.1 GI:16418419 Genbank record update date: Sep 2, 2012 01:43 PM
Cross references W02003/077836; W02001/38490 (claim 6, Fig 18E-1-18-E-2); Davis et al (2001) Proc. Natl.
Acad. Sci USA 98(17):9772-9777; W02003/089624 (claim 8); EP1347046 (claim 1);
W02003/089624 (claim 7).
(35) IRTA2 (Immunoglobulin superfamily receptor translocation associated 2, a putative immunoreceptor with possible roles in B cell development and lymphomagenesis;
deregulation of the gene by translocation occurs in some B cell malignancies);
977 aa, pl:
6.88, MW: 106468, TM: 1 [P] Gene Chromosome: 1q21) Nucleotide Genbank accession no AF343662 Genbank version no. AF343662.1 GI:13591709 Genbank record update date: Mar 11, 2010 01:16 AM
Polypeptide Genbank accession no. AAK31325 Genbank version no. AAK31325.1 GI:13591710 Genbank record update date: Mar 11, 2010 01:16 AM
Cross references AF343663, AF343664, AF343665, AF369794, AF397453, AK090423, AK090475, AL834187, AY358085; Mouse:AK089756, AY158090, AY506558; NP_112571.1;
W02003/024392 (claim 2, Fig 97); Nakayama et al (2000) Biochem. Biophys. Res.
Commun. 277(1):124-127; W02003/077836; W02001/38490 (claim 3, Fig 18B-1-18B-2).
deregulation of the gene by translocation occurs in some B cell malignancies);
977 aa, pl:
6.88, MW: 106468, TM: 1 [P] Gene Chromosome: 1q21) Nucleotide Genbank accession no AF343662 Genbank version no. AF343662.1 GI:13591709 Genbank record update date: Mar 11, 2010 01:16 AM
Polypeptide Genbank accession no. AAK31325 Genbank version no. AAK31325.1 GI:13591710 Genbank record update date: Mar 11, 2010 01:16 AM
Cross references AF343663, AF343664, AF343665, AF369794, AF397453, AK090423, AK090475, AL834187, AY358085; Mouse:AK089756, AY158090, AY506558; NP_112571.1;
W02003/024392 (claim 2, Fig 97); Nakayama et al (2000) Biochem. Biophys. Res.
Commun. 277(1):124-127; W02003/077836; W02001/38490 (claim 3, Fig 18B-1-18B-2).
(36) TENB2 (TMEFF2, tomoregulin, TPEF, HPP1, TR, putative transmembrane 35 proteoglycan, related to the EGF/heregulin family of growth factors and foffistatin); 374 aa) Nucleotide Genbank accession no AF179274 Genbank version no. AF179274.2 GI:12280939 Genbank record update date: Mar 11, 2010 01:05 AM
Polypeptide Genbank accession no. AAD55776 Genbank version no. AAD55776.2 GI:12280940 Genbank record update date: Mar 11, 2010 01:05 AM
Cross references NCB! Accession: AAD55776, AAF91397, AAG49451, NCB! RefSeq: NP_057276; NCB!
Gene: 23671; OMIM: 605734; SwissProt Q9UIK5; AY358907, CAF85723, CQ782436;
W02004/074320; JP2004113151; W02003/042661; W02003/009814; EP1295944 (pages 69-70); W02002/30268 (page 329); W02001/90304; US2004/249130; U52004/022727;
W02004/063355; U52004/197325; U52003/232350; 5 U52004/005563; U52003/124579;
Horie et al (2000) Genomics 67:146-152; Uchida et al (1999) Biochem. Biophys.
Res.
Commun. 266:593-602; Liang et al (2000) Cancer Res. 60:4907-12; Glynne-Jones et al (2001) Int J Cancer. Oct 15; 94(2):178-84.
Polypeptide Genbank accession no. AAD55776 Genbank version no. AAD55776.2 GI:12280940 Genbank record update date: Mar 11, 2010 01:05 AM
Cross references NCB! Accession: AAD55776, AAF91397, AAG49451, NCB! RefSeq: NP_057276; NCB!
Gene: 23671; OMIM: 605734; SwissProt Q9UIK5; AY358907, CAF85723, CQ782436;
W02004/074320; JP2004113151; W02003/042661; W02003/009814; EP1295944 (pages 69-70); W02002/30268 (page 329); W02001/90304; US2004/249130; U52004/022727;
W02004/063355; U52004/197325; U52003/232350; 5 U52004/005563; U52003/124579;
Horie et al (2000) Genomics 67:146-152; Uchida et al (1999) Biochem. Biophys.
Res.
Commun. 266:593-602; Liang et al (2000) Cancer Res. 60:4907-12; Glynne-Jones et al (2001) Int J Cancer. Oct 15; 94(2):178-84.
(37) PSMA ¨ FOLH1 (Folate hydrolase (prostate-specific membrane antigen) 1) Nucleotide Genbank accession no M99487 Genbank version no. M99487.1 GI:190663 Genbank record update date: Jun 23, 2010 08:48 AM
Polypeptide Genbank accession no. AAA60209 Genbank version no. AAA60209.1 GI:190664 Genbank record update date: Jun 23, 2010 08:48 AM
Cross references Israeli R.S., et al Cancer Res. 53 (2), 227-230 (1993) Other information Official Symbol: FOLH1 Other Aliases: GIG27, FGCP, FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA, mGCP
Other Designations: N-acetylated alpha-linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; NAALADase I; cell growth-inhibiting gene 27 protein; folylpoly-gamma-glutamate carboxypeptidase; glutamate carboxylase II; glutamate carboxypeptidase 2; glutamate carboxypeptidase II; membrane glutamate carboxypeptidase;
prostate specific membrane antigen variant F; pteroylpoly-gamma-glutamate carboxypeptidase ANTIBODIES
US 7,666,425:
Antibodies produces by Hybridomas having the following ATCC references:ATCC
accession No. HB-12101, ATCC accession No. HB-12109, ATCC accession No. HB-12127 and ATCC
accession No. HB-12126.
Proscan: a monoclonal antibody selected from the group consisting of 8H12, 3E11, 17G1, 2964, 30C1 and 20F2 (US 7,811,564; Moffett S., et al Hybridoma (Larchmt). 2007 Dec;26(6):363-72).
Cytogen: monoclonal antibodies 7E11-05 (ATCC accession No. HB 10494) and 9H10-(ATCC accession No. H611430) ¨ US 5,763,202 GlycoMimetics: NUH2 - ATCC accession No. HB 9762 (US 7,135,301) Human Genome Science: HPRAJ70 - ATCC accession No. 97131 (US 6,824,993); Amino acid sequence encoded by the cDNA clone (HPRAJ70) deposited as American Type Culture Collection ("ATCC") Deposit No. 97131 Medarex: Anti-PSMA antibodies that lack fucosyl residues - US 7,875,278 Mouse anti-PSMA antibodies include the 3F5.4G6, 3D7.1.1, 4E10-1.14, 3E11, 4D8, 3E6, 3C9, 2C7, 1G3, 3C4, 3C6, 4D4, 1G9, 5C8B9, 3G6, 4C8B9, and monoclonal antibodies.
Hybridomas secreting 3F5.4G6, 3D7.1.1, 4E10-1.14, 3E11, 4D8, 3E6, 3C9, 2C7, 1G3, 3C4, 5 3C6, 4D4, 1G9, 5C8B9, 3G6 or 4C8B9 have been publicly deposited and are described in U.S. Pat. No. 6,159,508. Relevant hybridomas have been publicly deposited and are described in U.S. Pat. No. 6,107,090. Moreover, humanized anti-PSMA
antibodies, including a humanized version of J591, are described in further detail in PCT
Publication WO
02/098897.
Other mouse anti-human PSMA antibodies have been described in the art, such as mAb 107-1A4 (Wang, S. et al. (2001) Int. J. Cancer 92:871-876) and mAb 2C9 (Kato, K. et al.
(2003) Int. J. Urol. 10:439-444).
Examples of human anti-PSMA monoclonal antibodies include the 4A3, 7F12, 8C12, 8A11, 16F9, 2A10, 2C6, 2F5 and 1C3 antibodies, isolated and structurally characterized as originally described in PCT Publications WO 01/09192 and WO 03/064606 and in U.S.
Provisional Application Ser. No. 60/654,125, entitled "Human Monoclonal Antibodies to Prostate Specific Membrane Antigen (PSMA)", filed on Feb. 18, 2005. The VH amino acid sequences of 4A3, 7F12, 8C12, 8A11, 16F9, 2A10, 2C6, 2F5 and 1C3 are shown in SEQ ID NOs: 1-9, respectively. The VL amino acid sequences of 4A3, 7F12, 8C12, 8A11, 16F9, 2A10, 2C6, 2F5 and 1C3 are shown in SEQ ID NOs: 10-18, respectively.
Other human anti-PSMA antibodies include the antibodies disclosed in PCT
Publication WO
03/034903 and US Application No. 2004/0033229.
NW Biotherapeutics: A hybridoma cell line selected from the group consisting of 3F5.4G6 having ATCC accession number HB12060, 3D7-1.I. having ATCC accession number HB12309, 4E10-1.14 having ATCC accession number HB12310, 3E11 (ATCC HB12488), 4D8 (ATCC HB12487), 3E6 (ATCC HB12486), 3C9 (ATCC HB12484), 2C7 (ATCC
HB12490), 1G3 (ATCC HB12489), 3C4 (ATCC HB12494), 3C6 (ATCC HB12491), 4D4 (ATCC HB12493), 1G9 (ATCC HB12495), 5C8B9 (ATCC HB12492) and 3G6 (ATCC
HB12485)- see US 6,150,508 PSMA Development Company / Progenics / Cytogen ¨ Seattle Genetics: mAb 3.9, produced by the hybridoma deposited under ATCC Accession No. PTA-3258 or mAb 10.3, produced by the hybridoma deposited under ATCC Accession No. PTA-3347 - US 7,850,971 PSMA Development Company¨ Compositions of PSMA antibodies (US 20080286284, Table 1) This application is a divisional of U.S. patent application Ser. No.
10/395,894, filed on Mar. 21, 2003 (US 7,850,971) University Hospital Freiburg, Germany - mAbs 3/Al2, 3/E7, and 3/F11 (Wolf P., et al Prostate. 2010 Apr 1;70(5):562-9).
Polypeptide Genbank accession no. AAA60209 Genbank version no. AAA60209.1 GI:190664 Genbank record update date: Jun 23, 2010 08:48 AM
Cross references Israeli R.S., et al Cancer Res. 53 (2), 227-230 (1993) Other information Official Symbol: FOLH1 Other Aliases: GIG27, FGCP, FOLH, GCP2, GCPII, NAALAD1, NAALAdase, PSM, PSMA, mGCP
Other Designations: N-acetylated alpha-linked acidic dipeptidase 1; N-acetylated-alpha-linked acidic dipeptidase I; NAALADase I; cell growth-inhibiting gene 27 protein; folylpoly-gamma-glutamate carboxypeptidase; glutamate carboxylase II; glutamate carboxypeptidase 2; glutamate carboxypeptidase II; membrane glutamate carboxypeptidase;
prostate specific membrane antigen variant F; pteroylpoly-gamma-glutamate carboxypeptidase ANTIBODIES
US 7,666,425:
Antibodies produces by Hybridomas having the following ATCC references:ATCC
accession No. HB-12101, ATCC accession No. HB-12109, ATCC accession No. HB-12127 and ATCC
accession No. HB-12126.
Proscan: a monoclonal antibody selected from the group consisting of 8H12, 3E11, 17G1, 2964, 30C1 and 20F2 (US 7,811,564; Moffett S., et al Hybridoma (Larchmt). 2007 Dec;26(6):363-72).
Cytogen: monoclonal antibodies 7E11-05 (ATCC accession No. HB 10494) and 9H10-(ATCC accession No. H611430) ¨ US 5,763,202 GlycoMimetics: NUH2 - ATCC accession No. HB 9762 (US 7,135,301) Human Genome Science: HPRAJ70 - ATCC accession No. 97131 (US 6,824,993); Amino acid sequence encoded by the cDNA clone (HPRAJ70) deposited as American Type Culture Collection ("ATCC") Deposit No. 97131 Medarex: Anti-PSMA antibodies that lack fucosyl residues - US 7,875,278 Mouse anti-PSMA antibodies include the 3F5.4G6, 3D7.1.1, 4E10-1.14, 3E11, 4D8, 3E6, 3C9, 2C7, 1G3, 3C4, 3C6, 4D4, 1G9, 5C8B9, 3G6, 4C8B9, and monoclonal antibodies.
Hybridomas secreting 3F5.4G6, 3D7.1.1, 4E10-1.14, 3E11, 4D8, 3E6, 3C9, 2C7, 1G3, 3C4, 5 3C6, 4D4, 1G9, 5C8B9, 3G6 or 4C8B9 have been publicly deposited and are described in U.S. Pat. No. 6,159,508. Relevant hybridomas have been publicly deposited and are described in U.S. Pat. No. 6,107,090. Moreover, humanized anti-PSMA
antibodies, including a humanized version of J591, are described in further detail in PCT
Publication WO
02/098897.
Other mouse anti-human PSMA antibodies have been described in the art, such as mAb 107-1A4 (Wang, S. et al. (2001) Int. J. Cancer 92:871-876) and mAb 2C9 (Kato, K. et al.
(2003) Int. J. Urol. 10:439-444).
Examples of human anti-PSMA monoclonal antibodies include the 4A3, 7F12, 8C12, 8A11, 16F9, 2A10, 2C6, 2F5 and 1C3 antibodies, isolated and structurally characterized as originally described in PCT Publications WO 01/09192 and WO 03/064606 and in U.S.
Provisional Application Ser. No. 60/654,125, entitled "Human Monoclonal Antibodies to Prostate Specific Membrane Antigen (PSMA)", filed on Feb. 18, 2005. The VH amino acid sequences of 4A3, 7F12, 8C12, 8A11, 16F9, 2A10, 2C6, 2F5 and 1C3 are shown in SEQ ID NOs: 1-9, respectively. The VL amino acid sequences of 4A3, 7F12, 8C12, 8A11, 16F9, 2A10, 2C6, 2F5 and 1C3 are shown in SEQ ID NOs: 10-18, respectively.
Other human anti-PSMA antibodies include the antibodies disclosed in PCT
Publication WO
03/034903 and US Application No. 2004/0033229.
NW Biotherapeutics: A hybridoma cell line selected from the group consisting of 3F5.4G6 having ATCC accession number HB12060, 3D7-1.I. having ATCC accession number HB12309, 4E10-1.14 having ATCC accession number HB12310, 3E11 (ATCC HB12488), 4D8 (ATCC HB12487), 3E6 (ATCC HB12486), 3C9 (ATCC HB12484), 2C7 (ATCC
HB12490), 1G3 (ATCC HB12489), 3C4 (ATCC HB12494), 3C6 (ATCC HB12491), 4D4 (ATCC HB12493), 1G9 (ATCC HB12495), 5C8B9 (ATCC HB12492) and 3G6 (ATCC
HB12485)- see US 6,150,508 PSMA Development Company / Progenics / Cytogen ¨ Seattle Genetics: mAb 3.9, produced by the hybridoma deposited under ATCC Accession No. PTA-3258 or mAb 10.3, produced by the hybridoma deposited under ATCC Accession No. PTA-3347 - US 7,850,971 PSMA Development Company¨ Compositions of PSMA antibodies (US 20080286284, Table 1) This application is a divisional of U.S. patent application Ser. No.
10/395,894, filed on Mar. 21, 2003 (US 7,850,971) University Hospital Freiburg, Germany - mAbs 3/Al2, 3/E7, and 3/F11 (Wolf P., et al Prostate. 2010 Apr 1;70(5):562-9).
(38) SST ( Somatostatin Receptor; note that there are5 subtypes) (38.1) SSTR2 (Somatostatin receptor 2) Nucleotide Genbank accession no NM_001050 Genbank version no. NM_001050.2 GI:44890054 Genbank record update date: Aug 19, 2012 01:37 PM
Polypeptide Genbank accession no. NP_001041 Genbank version no. NP_001041.1 GI:4557859 Genbank record update date: Aug 19, 2012 01:37 PM
Cross references Yamada Y., et al Proc. Natl. Acad. Sci. U.S.A. 89 (1), 251-255 (1992); Susini C., et al Ann Oncol. 2006 Dec;17(12):1 733-42 Other information Official Symbol: SSTR2 Other Designations: SRIF-1; 552R; somatostatin receptor type 2 (38.2) SSTR5 (Somatostatin receptor 5) Nucleotide Genbank accession no D16827 Genbank version no. D16827.1 GI:487683 Genbank record update date: Aug 1, 2006 12:45 PM
Polypeptide Genbank accession no. BAA04107 Genbank version no. BAA04107.1 GI:487684 Genbank record update date: Aug 1, 2006 12:45 PM
Cross references Yamada,Y., et al Biochem. Biophys. Res. Commun. 195 (2), 844-852 (1993) Other information Official Symbol: SSTR5 Other Aliases: SS-5-R
Other Designations: Somatostatin receptor subtype 5; somatostatin receptor type 5 (38.3) SSTR1 (38.4)SSTR3 (38.5) SSTR4 AvB6 ¨ Both subunits (39+40)
Polypeptide Genbank accession no. NP_001041 Genbank version no. NP_001041.1 GI:4557859 Genbank record update date: Aug 19, 2012 01:37 PM
Cross references Yamada Y., et al Proc. Natl. Acad. Sci. U.S.A. 89 (1), 251-255 (1992); Susini C., et al Ann Oncol. 2006 Dec;17(12):1 733-42 Other information Official Symbol: SSTR2 Other Designations: SRIF-1; 552R; somatostatin receptor type 2 (38.2) SSTR5 (Somatostatin receptor 5) Nucleotide Genbank accession no D16827 Genbank version no. D16827.1 GI:487683 Genbank record update date: Aug 1, 2006 12:45 PM
Polypeptide Genbank accession no. BAA04107 Genbank version no. BAA04107.1 GI:487684 Genbank record update date: Aug 1, 2006 12:45 PM
Cross references Yamada,Y., et al Biochem. Biophys. Res. Commun. 195 (2), 844-852 (1993) Other information Official Symbol: SSTR5 Other Aliases: SS-5-R
Other Designations: Somatostatin receptor subtype 5; somatostatin receptor type 5 (38.3) SSTR1 (38.4)SSTR3 (38.5) SSTR4 AvB6 ¨ Both subunits (39+40)
(39) ITGAV (Integrin, alpha V;
Nucleotide Genbank accession no M14648 J02826 M18365 Genbank version no. M14648.1 GI:340306 Genbank record update date: Jun 23, 2010 08:56 AM
Polypeptide Genbank accession no. AAA36808 Genbank version no. AAA36808.1 GI:340307 Genbank record update date: Jun 23, 2010 08:56 AM
Cross references Suzuki S., et al Proc. Natl. Acad. Sci. U.S.A. 83 (22), 8614-8618 (1986) Other information Official Symbol: ITGAV
Other Aliases: CD51, MSK8, VNRA, VTNR
Other Designations: antigen identified by monoclonal antibody L230; integrin alpha-V;
integrin alphaVbeta3; integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51); vitronectin receptor subunit alpha
Nucleotide Genbank accession no M14648 J02826 M18365 Genbank version no. M14648.1 GI:340306 Genbank record update date: Jun 23, 2010 08:56 AM
Polypeptide Genbank accession no. AAA36808 Genbank version no. AAA36808.1 GI:340307 Genbank record update date: Jun 23, 2010 08:56 AM
Cross references Suzuki S., et al Proc. Natl. Acad. Sci. U.S.A. 83 (22), 8614-8618 (1986) Other information Official Symbol: ITGAV
Other Aliases: CD51, MSK8, VNRA, VTNR
Other Designations: antigen identified by monoclonal antibody L230; integrin alpha-V;
integrin alphaVbeta3; integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51); vitronectin receptor subunit alpha
(40) ITGB6 (Integrin, beta 6) Nucleotide Genbank accession no NM_000888 Genbank version no. NM_000888.3 GI:9966771 Genbank record update date: Jun 27, 2012 12:46 AM
Polypeptide Genbank accession no. NP_000879 Genbank version no. NP_000879.2 GI:9625002 Genbank record update date: Jun 27, 2012 12:46 AM
Cross references Sheppard D.J., et al Biol. Chem. 265 (20), 11502-11507 (1990) Other information Official Symbol: ITGB6 Other Designations: integrin beta-6 ANTIBODIES
Biogen: US 7,943,742 - Hybridoma clones 6.3G9 and 6.8G6 were deposited with the ATCC, accession numbers ATCC PTA-3649 and -3645, respectively.
Biogen: U57,465,449 - In some embodiments, the antibody comprises the same heavy and light chain polypeptide sequences as an antibody produced by hybridoma 6.1A8, 6.3G9, 6.8G6, 6.2131, 6.21310, 6.2A1, 6.2E5, 7.1G10, 7.7G5, or 7.105.
Centocor (J&J): U57,550,142; U57,163,681 For example in US 7,550,142 - an antibody having human heavy chain and human light chain variable regions comprising the amino acid sequences shown in SEQ
ID
NO: 7 and SEQ ID NO: 8.
Seattle Genetics: 15H3 (Ryan MC., et al Cancer Res April 15, 2012; 72(8 Supplement): 4630)
Polypeptide Genbank accession no. NP_000879 Genbank version no. NP_000879.2 GI:9625002 Genbank record update date: Jun 27, 2012 12:46 AM
Cross references Sheppard D.J., et al Biol. Chem. 265 (20), 11502-11507 (1990) Other information Official Symbol: ITGB6 Other Designations: integrin beta-6 ANTIBODIES
Biogen: US 7,943,742 - Hybridoma clones 6.3G9 and 6.8G6 were deposited with the ATCC, accession numbers ATCC PTA-3649 and -3645, respectively.
Biogen: U57,465,449 - In some embodiments, the antibody comprises the same heavy and light chain polypeptide sequences as an antibody produced by hybridoma 6.1A8, 6.3G9, 6.8G6, 6.2131, 6.21310, 6.2A1, 6.2E5, 7.1G10, 7.7G5, or 7.105.
Centocor (J&J): U57,550,142; U57,163,681 For example in US 7,550,142 - an antibody having human heavy chain and human light chain variable regions comprising the amino acid sequences shown in SEQ
ID
NO: 7 and SEQ ID NO: 8.
Seattle Genetics: 15H3 (Ryan MC., et al Cancer Res April 15, 2012; 72(8 Supplement): 4630)
(41) CEACAM5 (Carcinoembtyonic antigen-related cell adhesion molecule 5) Nucleotide Genbank accession no M17303 Genbank version no. M17303.1 GI:178676 Genbank record update date: Jun 23, 2010 08:47 AM
Polypeptide Genbank accession no. AAB59513 Genbank version no. AAB59513.1 GI:178677 Genbank record update date: Jun 23, 2010 08:47 AM
Cross references Beauchemin N., et al Mo/. Cell. Biol. 7 (9), 3221-3230 (1987) Other information Official Symbol: CEACAM5 Other Aliases: CD66e, CEA
Other Designations: meconium antigen 100 ANTIBODIES
AstraZeneca-MedImmune:US 20100330103; U520080057063;
- for example an antibody having complementarity determining regions (CDRs) with the following sequences: heavy chain; CDR1 - DNYMH, CDR2 - WIDPENGDTE YAPKFRG, CDR3 - LIYAGYLAMD Y; and light chain CDR1 - SASSSVTYMH, CDR2 - STSNLAS, CDR3 - QQRSTYPLT.
- Hybridoma 806.077 deposited as European Collection of Cell Cultures (ECACC) deposit no. 96022936.
Research Corporation Technologies, Inc.:US5,047,507 Bayer Corporation: US6,013,772 5 BioAlliance: US7,982,017; U57,674,605 = US 7,674,605 - an antibody comprising the heavy chain variable region sequence from the amino acid sequence of SEQ ID NO: 1, and the light chain variable region sequence from the amino acid sequence of SEQ ID NO:2.
10 - an antibody comprising the heavy chain variable region sequence from the amino acid sequence of SEQ ID NO:5, and the light chain variable region sequence from the amino acid sequence of SEQ ID NO:6.
Celltech Therapeutics Limited: US5,877,293 The Dow Chemical Company: US5,472,693; U56,417,337; U56,333,405 US5,472,693 ¨ for example, ATCC No. CRL-11215 US6,417,337 ¨ for example, ATCC CRL-12208 U56,333,405 ¨ for example, ATCC CRL-12208 lmmunomedics, Inc: U57,534,431; U57,230,084; U57,300,644; U56,730,300;
- an antibody having CDRs of the light chain variable region comprise:
CDR1 comprises KASQDVGTSVA (SEQ ID NO: 20); CDR2 comprises WTSTRHT (SEQ ID NO: 21); and CDR3 comprises QQYSLYRS (SEQ ID
NO: 22);
and the CDRs of the heavy chain variable region of said anti-CEA
antibody comprise: CDR1 comprises TYWMS (SEQ ID NO: 23); CDR2 comprises EIHPDSSTINYAPSLKD (SEQ ID NO: 24); and CDR3 comprises LYFGFPWFAY (SEQ ID NO: 25).
U520100221 175; U520090092598; U520070202044; U5201 10064653;
U520090185974; U520080069775.
Polypeptide Genbank accession no. AAB59513 Genbank version no. AAB59513.1 GI:178677 Genbank record update date: Jun 23, 2010 08:47 AM
Cross references Beauchemin N., et al Mo/. Cell. Biol. 7 (9), 3221-3230 (1987) Other information Official Symbol: CEACAM5 Other Aliases: CD66e, CEA
Other Designations: meconium antigen 100 ANTIBODIES
AstraZeneca-MedImmune:US 20100330103; U520080057063;
- for example an antibody having complementarity determining regions (CDRs) with the following sequences: heavy chain; CDR1 - DNYMH, CDR2 - WIDPENGDTE YAPKFRG, CDR3 - LIYAGYLAMD Y; and light chain CDR1 - SASSSVTYMH, CDR2 - STSNLAS, CDR3 - QQRSTYPLT.
- Hybridoma 806.077 deposited as European Collection of Cell Cultures (ECACC) deposit no. 96022936.
Research Corporation Technologies, Inc.:US5,047,507 Bayer Corporation: US6,013,772 5 BioAlliance: US7,982,017; U57,674,605 = US 7,674,605 - an antibody comprising the heavy chain variable region sequence from the amino acid sequence of SEQ ID NO: 1, and the light chain variable region sequence from the amino acid sequence of SEQ ID NO:2.
10 - an antibody comprising the heavy chain variable region sequence from the amino acid sequence of SEQ ID NO:5, and the light chain variable region sequence from the amino acid sequence of SEQ ID NO:6.
Celltech Therapeutics Limited: US5,877,293 The Dow Chemical Company: US5,472,693; U56,417,337; U56,333,405 US5,472,693 ¨ for example, ATCC No. CRL-11215 US6,417,337 ¨ for example, ATCC CRL-12208 U56,333,405 ¨ for example, ATCC CRL-12208 lmmunomedics, Inc: U57,534,431; U57,230,084; U57,300,644; U56,730,300;
- an antibody having CDRs of the light chain variable region comprise:
CDR1 comprises KASQDVGTSVA (SEQ ID NO: 20); CDR2 comprises WTSTRHT (SEQ ID NO: 21); and CDR3 comprises QQYSLYRS (SEQ ID
NO: 22);
and the CDRs of the heavy chain variable region of said anti-CEA
antibody comprise: CDR1 comprises TYWMS (SEQ ID NO: 23); CDR2 comprises EIHPDSSTINYAPSLKD (SEQ ID NO: 24); and CDR3 comprises LYFGFPWFAY (SEQ ID NO: 25).
U520100221 175; U520090092598; U520070202044; U5201 10064653;
U520090185974; U520080069775.
(42) MET (met proto-oncogene; hepatocyte growth factor receptor) Nucleotide Genbank accession no M35073 Genbank version no. M35073.1 GI:187553 Genbank record update date: Mar 6, 2012 11:12 AM
Polypeptide Genbank accession no. AAA59589 Genbank version no. AAA59589.1 GI:553531 Genbank record update date: Mar 6, 2012 11:12 AM
Cross references Dean M., et al Nature 318 (6044), 385-388 (1985) Other information Official Symbol: MET
Other Aliases: AUTS9, HGFR, RCCP2, c-Met Other Designations: HGF receptor; HGF/SF receptor; SF receptor; hepatocyte growth factor receptor; met proto-oncogene tyrosine kinase; proto-oncogene c-Met; scatter factor receptor;
tyrosine-protein kinase Met ANTIBODIES
Abgenix/Pfizer: U520100040629 for example, the antibody produced by hybridoma 13.3.2 having American Type Culture Collection (ATCC) accession number PTA-5026; the antibody produced by hybridoma 9.1.2 having ATCC accession number PTA-5027; the antibody produced by hybridoma 8.70.2 having ATCC accession number PTA-5028; or the antibody produced by hybridoma 6.90.3 having ATCC accession number PTA-5029.
Amgen/Pfizer: US20050054019 for example, an antibody comprising a heavy chain having the amino acid sequences set forth in SEQ ID NO: 2 where X2 is glutamate and X4 is serine and a light chain having the amino acid sequence set forth in SEQ ID NO: 4 where X8 is alanine, without the signal sequences; an antibody comprising a heavy chain having the amino acid sequences set forth in SEQ ID NO: 6 and a light chain having the amino acid sequence set forth in SEQ ID NO: 8, without the signal sequences; an antibody comprising a heavy chain having the amino acid sequences set forth in SEQ ID
NO:
10 and a light chain having the amino acid sequence set forth in SEQ ID NO:
12, without the signal sequences; or an antibody comprising a heavy chain having the amino acid sequences set forth in SEQ ID NO: 14 and a light chain having the amino acid sequence set forth in SEQ ID NO: 16, without the signal sequences.
Agouron Pharmaceuticals (Now Pfizer): US20060035907 Eli Lilly: U520100129369 Genentech: U55,686,292; U520100028337; U520100016241; US20070129301;
U520070098707; U520070092520, U520060270594; U520060134104; U520060035278;
U520050233960; U520050037431 US 5,686,292 ¨ for example, ATCC HB-11894 and ATCC HB-11895 U520100016241 ¨ for example, ATCC HB-11894 (hybridoma 1A3.3.13) or HB-11895 (hybridoma 5D5.11.6) National Defense Medical Center, Taiwan: Lu RM., et al Biomaterials. 2011 Apr;32(12):3265-74.
Novartis: U520090175860 - for example, an antibody comprising the sequences of CDR1, CDR2 and CDR3 of heavy chain 4687, wherein the sequences of CDR1, CDR2, and CDR3 of heavy chain 4687 are residues 26-35, 50-65, and 98-102, respectively, of SEQ ID NO: 58; and the sequences of CDR1, CDR2, and CDR3 of light chain 5097, wherein the sequences of CDR1, CDR2, and CDR3 oflight chain 5097 are residues 24-39,55-61, and 94-100 of SEQ ID
NO: 37.
Pharmacia Corporation: U520040166544 Pierre Fabre: U5201 10239316, U5201 10097262, U5201001 15639 Sumsung: US 20110129481 ¨ for example a monoclonal antibody produced from a hybridoma cell having accession number KCLRF-BP-00219 or accession number of KCLRF-BP-00223.
Samsung: US 20110104176 ¨ for example an antibody produced by a hybridoma cell having Accession Number: KCLRF-BP-00220.
University of Turin Medical School: DN-30 Pacchiana G., et al J Biol Chem.
2010 Nov 12;285(46):36149-57 Van Andel Research Institute: Jiao Y., et al Mo/ Biotechnol. 2005 Sep;31(1):41-54.
Polypeptide Genbank accession no. AAA59589 Genbank version no. AAA59589.1 GI:553531 Genbank record update date: Mar 6, 2012 11:12 AM
Cross references Dean M., et al Nature 318 (6044), 385-388 (1985) Other information Official Symbol: MET
Other Aliases: AUTS9, HGFR, RCCP2, c-Met Other Designations: HGF receptor; HGF/SF receptor; SF receptor; hepatocyte growth factor receptor; met proto-oncogene tyrosine kinase; proto-oncogene c-Met; scatter factor receptor;
tyrosine-protein kinase Met ANTIBODIES
Abgenix/Pfizer: U520100040629 for example, the antibody produced by hybridoma 13.3.2 having American Type Culture Collection (ATCC) accession number PTA-5026; the antibody produced by hybridoma 9.1.2 having ATCC accession number PTA-5027; the antibody produced by hybridoma 8.70.2 having ATCC accession number PTA-5028; or the antibody produced by hybridoma 6.90.3 having ATCC accession number PTA-5029.
Amgen/Pfizer: US20050054019 for example, an antibody comprising a heavy chain having the amino acid sequences set forth in SEQ ID NO: 2 where X2 is glutamate and X4 is serine and a light chain having the amino acid sequence set forth in SEQ ID NO: 4 where X8 is alanine, without the signal sequences; an antibody comprising a heavy chain having the amino acid sequences set forth in SEQ ID NO: 6 and a light chain having the amino acid sequence set forth in SEQ ID NO: 8, without the signal sequences; an antibody comprising a heavy chain having the amino acid sequences set forth in SEQ ID
NO:
10 and a light chain having the amino acid sequence set forth in SEQ ID NO:
12, without the signal sequences; or an antibody comprising a heavy chain having the amino acid sequences set forth in SEQ ID NO: 14 and a light chain having the amino acid sequence set forth in SEQ ID NO: 16, without the signal sequences.
Agouron Pharmaceuticals (Now Pfizer): US20060035907 Eli Lilly: U520100129369 Genentech: U55,686,292; U520100028337; U520100016241; US20070129301;
U520070098707; U520070092520, U520060270594; U520060134104; U520060035278;
U520050233960; U520050037431 US 5,686,292 ¨ for example, ATCC HB-11894 and ATCC HB-11895 U520100016241 ¨ for example, ATCC HB-11894 (hybridoma 1A3.3.13) or HB-11895 (hybridoma 5D5.11.6) National Defense Medical Center, Taiwan: Lu RM., et al Biomaterials. 2011 Apr;32(12):3265-74.
Novartis: U520090175860 - for example, an antibody comprising the sequences of CDR1, CDR2 and CDR3 of heavy chain 4687, wherein the sequences of CDR1, CDR2, and CDR3 of heavy chain 4687 are residues 26-35, 50-65, and 98-102, respectively, of SEQ ID NO: 58; and the sequences of CDR1, CDR2, and CDR3 of light chain 5097, wherein the sequences of CDR1, CDR2, and CDR3 oflight chain 5097 are residues 24-39,55-61, and 94-100 of SEQ ID
NO: 37.
Pharmacia Corporation: U520040166544 Pierre Fabre: U5201 10239316, U5201 10097262, U5201001 15639 Sumsung: US 20110129481 ¨ for example a monoclonal antibody produced from a hybridoma cell having accession number KCLRF-BP-00219 or accession number of KCLRF-BP-00223.
Samsung: US 20110104176 ¨ for example an antibody produced by a hybridoma cell having Accession Number: KCLRF-BP-00220.
University of Turin Medical School: DN-30 Pacchiana G., et al J Biol Chem.
2010 Nov 12;285(46):36149-57 Van Andel Research Institute: Jiao Y., et al Mo/ Biotechnol. 2005 Sep;31(1):41-54.
(43) MUC1 (Mucin 1, cell surface associated) Nucleotide Genbank accession no J05581 Genbank version no. J05581.1 GI:188869 Genbank record update date: Jun 23, 2010 08:48 AM
Polypeptide Genbank accession no. AAA59876 Genbank version no. AAA59876.1 GI:188870 Genbank record update date: Jun 23, 2010 08:48 AM
Cross references Gendler S.J., et al J. Biol. Chem. 265 (25), 15286-15293 (1990) Other information Official Symbol: MUC1 Other Aliases: RP11-263K19.2, CD227, EMA, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, PEM, PEMT, PUM
Other Designations: DF3 antigen; H23 antigen; breast carcinoma-associated antigen DF3;
carcinoma-associated mucin; episialin; krebs von den Lungen-6; mucin 1, transmembrane;
mucin-1; peanut-reactive urinary mucin; polymorphic epithelial mucin; tumor associated epithelial mucin; tumor-associated epithelial membrane antigen; tumor-associated mucin ANTIBODIES
AltaRex- Quest Pharma Tech: US 6,716,966 ¨ for example an Alt-1 antibody produced by the hybridoma ATCC No PTA-975.
AltaRex- Quest Pharma Tech: U57,147,850 CRT: 5E5 - Sorensen AL., et al Glycobiology vol. 16 no. 2 pp. 96-107, 2006;
HMFG2 ¨
Burchell J., et al Cancer Res., 47, 5476-5482 (1987) Glycotope GT-MAB: GT-MAB 2.5-GEX (Website:
http://vvvvvv.glycotope.com/pipeline/pankomab-gex) lmmunogen: US7,202,346 - for example, antibody MJ-170: hybridoma cell line MJ-170 ATCC
accession no. PTA-5286Monoclonal antibody MJ-171: hybridoma cell line MJ-171 ATCC accession no. PTA-5287; monoclonal antibody MJ-172:
hybridoma cell line MJ-172 ATCC accession no. PTA-5288; or monoclonal antibody MJ-173: hybridoma cell line MJ-173 ATCC
accession no. PTA-5302 lmmunomedics: US 6,653,104 Ramot Tel Aviv Uni: U57,897,351 Regents Uni. CA: US 7,183,388; U520040005647; U520030077676.
Roche GlycArt: U58,021,856 Russian National Cancer Research Center: lmuteran- lvanov PK., et al Biotechnol J. 2007 Jul;2(7):863-70 Technische Univ Braunschweig: (1166, HT186-137, HT186-D11, HT186-G2, HT200-3A-C1, HT220-M-D1, HT220-M-G8) - Thie H., et al PLoS One. 2011 Jan 14;6(1):e15921
Polypeptide Genbank accession no. AAA59876 Genbank version no. AAA59876.1 GI:188870 Genbank record update date: Jun 23, 2010 08:48 AM
Cross references Gendler S.J., et al J. Biol. Chem. 265 (25), 15286-15293 (1990) Other information Official Symbol: MUC1 Other Aliases: RP11-263K19.2, CD227, EMA, H23AG, KL-6, MAM6, MUC-1, MUC-1/SEC, MUC-1/X, MUC1/ZD, PEM, PEMT, PUM
Other Designations: DF3 antigen; H23 antigen; breast carcinoma-associated antigen DF3;
carcinoma-associated mucin; episialin; krebs von den Lungen-6; mucin 1, transmembrane;
mucin-1; peanut-reactive urinary mucin; polymorphic epithelial mucin; tumor associated epithelial mucin; tumor-associated epithelial membrane antigen; tumor-associated mucin ANTIBODIES
AltaRex- Quest Pharma Tech: US 6,716,966 ¨ for example an Alt-1 antibody produced by the hybridoma ATCC No PTA-975.
AltaRex- Quest Pharma Tech: U57,147,850 CRT: 5E5 - Sorensen AL., et al Glycobiology vol. 16 no. 2 pp. 96-107, 2006;
HMFG2 ¨
Burchell J., et al Cancer Res., 47, 5476-5482 (1987) Glycotope GT-MAB: GT-MAB 2.5-GEX (Website:
http://vvvvvv.glycotope.com/pipeline/pankomab-gex) lmmunogen: US7,202,346 - for example, antibody MJ-170: hybridoma cell line MJ-170 ATCC
accession no. PTA-5286Monoclonal antibody MJ-171: hybridoma cell line MJ-171 ATCC accession no. PTA-5287; monoclonal antibody MJ-172:
hybridoma cell line MJ-172 ATCC accession no. PTA-5288; or monoclonal antibody MJ-173: hybridoma cell line MJ-173 ATCC
accession no. PTA-5302 lmmunomedics: US 6,653,104 Ramot Tel Aviv Uni: U57,897,351 Regents Uni. CA: US 7,183,388; U520040005647; U520030077676.
Roche GlycArt: U58,021,856 Russian National Cancer Research Center: lmuteran- lvanov PK., et al Biotechnol J. 2007 Jul;2(7):863-70 Technische Univ Braunschweig: (1166, HT186-137, HT186-D11, HT186-G2, HT200-3A-C1, HT220-M-D1, HT220-M-G8) - Thie H., et al PLoS One. 2011 Jan 14;6(1):e15921
(44) CA9 (Carbonic anhydrase IX) Nucleotide Genbank accession no . X66839 Genbank version no. X66839.1 GI:1000701 Genbank record update date: Feb 2, 2011 10:15 AM
Polypeptide Genbank accession no. CAA47315 Genbank version no. CAA47315.1 GI:1000702 Genbank record update date: Feb 2, 2011 10:15 AM
Cross references 5 Pastorek J., et al Oncogene 9 (10), 2877-2888 (1994) Other information Official Symbol: CA9 Other Aliases: CAIX, MN
10 Other Designations: CA-IX; P54/58N; RCC-associated antigen G250; RCC-associated protein G250; carbonate dehydratase IX; carbonic anhydrase 9; carbonic dehydratase;
membrane antigen MN; pMW1; renal cell carcinoma-associated antigen G250 ANTIBODIES
15 Abgenix/Amgen: US20040018198 Affibody: Anti-CAIX Affibody molecules (http://vvww.affibody.com/en/Product-Portfolio/Pipeline/) 20 Bayer: US7,462,696 Bayer/Morphosys: 3ee9 mAb - Petrul HM., et al Mo/ Cancer Ther. 2012 Feb;11(2):340-9 Harvard Medical School: Antibodies G10, G36, G37, G39, G45, G57, G106, G119, G6, G27, 25 G40 and G125. Xu C., et al PLoS One. 2010 Mar 10;5(3):e9625 Institute of Virology, Slovak Academy of Sciences (Bayer) - US5,955,075 - for example, M75- ATCC Accession No. HB 11128 or MN12 ¨ ATCC
Accession No. HB 11647 Institute of Virology, Slovak Academy of Sciences: U57,816,493 - for example the M75 monoclonal antibody that is secreted from the hybridoma VU-M75, which was deposited at the American Type Culture Collection under ATCC No. HB 11128; or the V/10 monoclonal antibody secreted from the hybridoma V/10-VU, which was deposited at the International Depository Authority of the Belgian Coordinated Collection of Microorganisms (BCCM) at the Laboratorium voor Moleculaire Biologie-Plasmidencollectie (LMBP) at the Universeit Gent in Gent, Belgium, under Accession No. LMBP 6009CB.
Institute of Virology, Slovak Academy of Sciences US20080177046;
U520080176310;
US20080176258; US20050031623 Novartis: U520090252738 Wilex: U57,691,375 ¨ for example the antibody produced by the hybridoma cell line DSM
ASC 2526.
Wilex: U5201 10123537; Rencarex: Kennett RH., et al Curr Opin Mol Ther. 2003 Feb;5(1):70-5 Xencor: U520090162382
Polypeptide Genbank accession no. CAA47315 Genbank version no. CAA47315.1 GI:1000702 Genbank record update date: Feb 2, 2011 10:15 AM
Cross references 5 Pastorek J., et al Oncogene 9 (10), 2877-2888 (1994) Other information Official Symbol: CA9 Other Aliases: CAIX, MN
10 Other Designations: CA-IX; P54/58N; RCC-associated antigen G250; RCC-associated protein G250; carbonate dehydratase IX; carbonic anhydrase 9; carbonic dehydratase;
membrane antigen MN; pMW1; renal cell carcinoma-associated antigen G250 ANTIBODIES
15 Abgenix/Amgen: US20040018198 Affibody: Anti-CAIX Affibody molecules (http://vvww.affibody.com/en/Product-Portfolio/Pipeline/) 20 Bayer: US7,462,696 Bayer/Morphosys: 3ee9 mAb - Petrul HM., et al Mo/ Cancer Ther. 2012 Feb;11(2):340-9 Harvard Medical School: Antibodies G10, G36, G37, G39, G45, G57, G106, G119, G6, G27, 25 G40 and G125. Xu C., et al PLoS One. 2010 Mar 10;5(3):e9625 Institute of Virology, Slovak Academy of Sciences (Bayer) - US5,955,075 - for example, M75- ATCC Accession No. HB 11128 or MN12 ¨ ATCC
Accession No. HB 11647 Institute of Virology, Slovak Academy of Sciences: U57,816,493 - for example the M75 monoclonal antibody that is secreted from the hybridoma VU-M75, which was deposited at the American Type Culture Collection under ATCC No. HB 11128; or the V/10 monoclonal antibody secreted from the hybridoma V/10-VU, which was deposited at the International Depository Authority of the Belgian Coordinated Collection of Microorganisms (BCCM) at the Laboratorium voor Moleculaire Biologie-Plasmidencollectie (LMBP) at the Universeit Gent in Gent, Belgium, under Accession No. LMBP 6009CB.
Institute of Virology, Slovak Academy of Sciences US20080177046;
U520080176310;
US20080176258; US20050031623 Novartis: U520090252738 Wilex: U57,691,375 ¨ for example the antibody produced by the hybridoma cell line DSM
ASC 2526.
Wilex: U5201 10123537; Rencarex: Kennett RH., et al Curr Opin Mol Ther. 2003 Feb;5(1):70-5 Xencor: U520090162382
(45) EGFRvIll ( Epidermal growth factor receptor (EGFR), transcript variant 3, Nucleotide Genbank accession no. NM_201283 Genbank version no. NM_201283.1 GI:41327733 Genbank record update date: Sep 30, 2012 01:47 PM
Polypeptide Genbank accession no. NP_958440 Genbank version no. NP_958440.1 GI:41327734 Genbank record update date: Sep 30, 2012 01:47 PM
Cross-references Batra SK., et al Cell Growth Differ 1995;6:1251-1259.
ANTIBODIES:
U57,628,986 and U57,736,644 (Amgen) For example, a heavy chain variable region amino acid sequence selected from the group consisting of SEQ ID NO: 142 and variants & a light chain variable region amino acid sequence selected from the group consisting of: SEQ ID NO: 144 and variants.
US20100111979 (Amgen) For example, an antibody comprising a heavy chain amino acid sequence comprising:
CDR1 consisting of a sequence selected from the group consisting of the amino acid sequences for the CDR1 region of antibodies 13.1.2 (SEQ ID NO: 138), 131 (SEQ
ID
NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID NO: 7), 250 (SEQ
ID
NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO: 12), 124 (SEQ ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17);
CDR2 consisting of a sequence selected from the group consisting of the amino acid sequences for the CDR2 region of antibodies 13.1.2 (SEQ ID NO: 138), 131 (SEQ
ID
NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID NO: 7), 250 (SEQ
ID
NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO: 12), 124 (SEQ ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17); and CDR3 consisting of a sequence selected from the group consisting of the amino acid sequences for the CDR3 region of antibodies 13.1.2 (SEQ ID NO: 138), 131 (SEQ
ID
NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID NO: 7), 250 (SEQ
ID
NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO: 12), 124 (SEQ ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17).
U520090240038 (Amgen) For example, an antibody having at least one of the heavy or light chain polypeptides comprises an amino acid sequence that is at least 90% identical to the amino acid sequence selected from the group consisting of: SEQ ID NO: 2, SEQ ID NO: 19, SEQ ID NO: 142, SEQ ID NO: 144, and any combination thereof.
U520090175887 (Amgen) For example, an antibody having a heavy chain amino acid sequence selected from the group consisting of the heavy chain amino acid sequence of antibody 13.1.2 (SEQ ID NO: 138), 131 (SEQ ID NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID NO: 7), 250 (SEQ ID NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO:
12), 124 (SEQ ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17).
US20090156790 (Amgen) For example, antibody having heavy chain polypeptide and a light chain polypeptide, wherein at least one of the heavy or light chain polypeptides comprises an amino acid sequence that is at least 90% identical to the amino acid sequence selected from the group consisting of: SEQ ID NO: 2, SEQ ID NO: 19, SEQ ID NO: 142, SEQ
ID NO: 144, and any combination thereof.
U520090155282, U520050059087 and U520050053608 (Amgen) For example, an antibody heavy chain amino acid sequence selected from the group consisting of the heavy chain amino acid sequence of antibody 13.1.2 (SEQ ID
NO:
138), 131 (SEQ ID NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID
NO: 7), 250 (SEQ ID NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO: 12), 124 (SEQ
ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17).
MR1-1 (U57,129,332; Duke) For example, a variant antibody having the sequence of SEQ ID NO.18 with the substitutions 598P-T99Y in the CDR3 VH, and F92W in CDR3 VL.
L8A4, H10, Y10 (Wikstrand CJ., et al Cancer Res. 1995 Jul 15;55(14):3140-8;
Duke) U52009031 1803 (Harvard University) For example, SEQ ID NO:9 for antibody heavy chain variable region, and SEQ ID
NO: 3 for light chain variable region amino acid sequences U520070274991 (EMD72000, also known as matuzumab; Harvard University) For example, SEQ ID NOs: 3 & 9 for light chain and heavy chain respectively U56,129,915 (Schering) For example, SEQ. ID NOs: 1, 2, 3, 4, 5 and 6.
mAb CH12 - Wang H., et al FASEB J. 2012 Jan;26(1):73-80 (Shanghai Cancer Institute).
RAbDMvIll - Gupta P., et al BMC Biotechnol. 2010 Oct 7;10:72 (Stanford University Medical Center).
mAb Ua30 - Ohman L., et al Tumour Biol. 2002 Mar-Apr;23(2):61-9 (Uppsala University).
Han DG., et al Nan Fang Yi Ke Da Xue Xue Bao. 2010 Jan;30(1):25-9 (Xi'an Jiaotong University).
Polypeptide Genbank accession no. NP_958440 Genbank version no. NP_958440.1 GI:41327734 Genbank record update date: Sep 30, 2012 01:47 PM
Cross-references Batra SK., et al Cell Growth Differ 1995;6:1251-1259.
ANTIBODIES:
U57,628,986 and U57,736,644 (Amgen) For example, a heavy chain variable region amino acid sequence selected from the group consisting of SEQ ID NO: 142 and variants & a light chain variable region amino acid sequence selected from the group consisting of: SEQ ID NO: 144 and variants.
US20100111979 (Amgen) For example, an antibody comprising a heavy chain amino acid sequence comprising:
CDR1 consisting of a sequence selected from the group consisting of the amino acid sequences for the CDR1 region of antibodies 13.1.2 (SEQ ID NO: 138), 131 (SEQ
ID
NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID NO: 7), 250 (SEQ
ID
NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO: 12), 124 (SEQ ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17);
CDR2 consisting of a sequence selected from the group consisting of the amino acid sequences for the CDR2 region of antibodies 13.1.2 (SEQ ID NO: 138), 131 (SEQ
ID
NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID NO: 7), 250 (SEQ
ID
NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO: 12), 124 (SEQ ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17); and CDR3 consisting of a sequence selected from the group consisting of the amino acid sequences for the CDR3 region of antibodies 13.1.2 (SEQ ID NO: 138), 131 (SEQ
ID
NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID NO: 7), 250 (SEQ
ID
NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO: 12), 124 (SEQ ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17).
U520090240038 (Amgen) For example, an antibody having at least one of the heavy or light chain polypeptides comprises an amino acid sequence that is at least 90% identical to the amino acid sequence selected from the group consisting of: SEQ ID NO: 2, SEQ ID NO: 19, SEQ ID NO: 142, SEQ ID NO: 144, and any combination thereof.
U520090175887 (Amgen) For example, an antibody having a heavy chain amino acid sequence selected from the group consisting of the heavy chain amino acid sequence of antibody 13.1.2 (SEQ ID NO: 138), 131 (SEQ ID NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID NO: 7), 250 (SEQ ID NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO:
12), 124 (SEQ ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17).
US20090156790 (Amgen) For example, antibody having heavy chain polypeptide and a light chain polypeptide, wherein at least one of the heavy or light chain polypeptides comprises an amino acid sequence that is at least 90% identical to the amino acid sequence selected from the group consisting of: SEQ ID NO: 2, SEQ ID NO: 19, SEQ ID NO: 142, SEQ
ID NO: 144, and any combination thereof.
U520090155282, U520050059087 and U520050053608 (Amgen) For example, an antibody heavy chain amino acid sequence selected from the group consisting of the heavy chain amino acid sequence of antibody 13.1.2 (SEQ ID
NO:
138), 131 (SEQ ID NO: 2), 170 (SEQ ID NO: 4), 150 (SEQ ID NO: 5), 095 (SEQ ID
NO: 7), 250 (SEQ ID NO: 9), 139 (SEQ ID NO: 10), 211 (SEQ ID NO: 12), 124 (SEQ
ID NO: 13), 318 (SEQ ID NO: 15), 342 (SEQ ID NO: 16), and 333 (SEQ ID NO: 17).
MR1-1 (U57,129,332; Duke) For example, a variant antibody having the sequence of SEQ ID NO.18 with the substitutions 598P-T99Y in the CDR3 VH, and F92W in CDR3 VL.
L8A4, H10, Y10 (Wikstrand CJ., et al Cancer Res. 1995 Jul 15;55(14):3140-8;
Duke) U52009031 1803 (Harvard University) For example, SEQ ID NO:9 for antibody heavy chain variable region, and SEQ ID
NO: 3 for light chain variable region amino acid sequences U520070274991 (EMD72000, also known as matuzumab; Harvard University) For example, SEQ ID NOs: 3 & 9 for light chain and heavy chain respectively U56,129,915 (Schering) For example, SEQ. ID NOs: 1, 2, 3, 4, 5 and 6.
mAb CH12 - Wang H., et al FASEB J. 2012 Jan;26(1):73-80 (Shanghai Cancer Institute).
RAbDMvIll - Gupta P., et al BMC Biotechnol. 2010 Oct 7;10:72 (Stanford University Medical Center).
mAb Ua30 - Ohman L., et al Tumour Biol. 2002 Mar-Apr;23(2):61-9 (Uppsala University).
Han DG., et al Nan Fang Yi Ke Da Xue Xue Bao. 2010 Jan;30(1):25-9 (Xi'an Jiaotong University).
(46) CD33 (CD33 molecule) Nucleotide Genbank accession no. M_23197 Genbank version no. NM_23197.1 GI:180097 Genbank record update date: Jun 23, 2010 08:47 AM
Polypeptide Genbank accession no. AAA51948 Genbank version no. AAA51948.1 GI:188098 Genbank record update date: Jun 23, 2010 08:47 AM
Cross-references Simmons D., et al J. Immunol. 141 (8), 2797-2800 (1988) Other information Official Symbol: CD33 Other Aliases: SIGLEC-3, SIGLEC3, p67 Other Designations: CD33 antigen (gp67); gp67; myeloid cell surface antigen CD33; sialic acid binding lg-like lectin 3; sialic acid-binding lg-like lectin ANTIBODIES
H195 (Lintuzumab)- Raza A., et al Leuk Lymphoma. 2009 Aug;50(8):1336-44;
U56,759,045 (Seattle Genetics/Immunomedics) mAb OKT9: Sutherland, D.R. et al. Proc Natl Acad Sci USA 78(7): 4515-4519 1981, Schneider,C., et al J Biol Chem 257, 8516-8522 (1982) mAb E6: Hoogenboom,H.R., et al J Immunol 144, 3211-3217(1990) U56,590,088 (Human Genome Sciences) For example, SEQ ID NOs: 1 and 2 and ATCC accession no. 97521 US7,557,189 (Immunogen) For example, an antibody or fragment thereof comprising a heavy chain variable region which comprises three CDRs having the amino acid sequences of SEQ ID
NOs:1-3 and a light chain variable region comprising three CDRs having the amino 5 acid sequences of SEQ ID NOs:4-6.
Polypeptide Genbank accession no. AAA51948 Genbank version no. AAA51948.1 GI:188098 Genbank record update date: Jun 23, 2010 08:47 AM
Cross-references Simmons D., et al J. Immunol. 141 (8), 2797-2800 (1988) Other information Official Symbol: CD33 Other Aliases: SIGLEC-3, SIGLEC3, p67 Other Designations: CD33 antigen (gp67); gp67; myeloid cell surface antigen CD33; sialic acid binding lg-like lectin 3; sialic acid-binding lg-like lectin ANTIBODIES
H195 (Lintuzumab)- Raza A., et al Leuk Lymphoma. 2009 Aug;50(8):1336-44;
U56,759,045 (Seattle Genetics/Immunomedics) mAb OKT9: Sutherland, D.R. et al. Proc Natl Acad Sci USA 78(7): 4515-4519 1981, Schneider,C., et al J Biol Chem 257, 8516-8522 (1982) mAb E6: Hoogenboom,H.R., et al J Immunol 144, 3211-3217(1990) U56,590,088 (Human Genome Sciences) For example, SEQ ID NOs: 1 and 2 and ATCC accession no. 97521 US7,557,189 (Immunogen) For example, an antibody or fragment thereof comprising a heavy chain variable region which comprises three CDRs having the amino acid sequences of SEQ ID
NOs:1-3 and a light chain variable region comprising three CDRs having the amino 5 acid sequences of SEQ ID NOs:4-6.
(47) CD19 (CD19 molecule) Nucleotide Genbank accession no. NM_001178098 10 Genbank version no. NM_001178098.1 GI:296010920 Genbank record update date: Sep 10, 2012 12:43 AM
Polypeptide Genbank accession no. NP_001171569 15 Genbank version no. NP_001171569.1 GI:296010921 Genbank record update date: Sep 10, 2012 12:43 AM
Cross-references Tedder TF., et al J. lmmunol. 143 (2): 712-7 (1989) Other information Official Symbol: CD19 Other Aliases: B4, CVID3 Other Designations: B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; T-cell surface antigen Leu-12; differentiation antigen CD19 ANTIBODIES
lmmunogen: HuB4 - Al-Katib AM., et al Clin Cancer Res. 2009 Jun 15;15(12):4038-45.
4G7: Kugler M., et al Protein Eng Des Sel. 2009 Mar;22(3):135-47 For example, sequences in Fig. 3 of of Knappik, A. et al. J Mol Biol 2000 Feb;296(1):57-AstraZeneca /Medlmmune: MEDI-551 - Herbst R., et al J Pharmacol Exp Ther. 2010 Oct;335(1):213-22 Glenmark Pharmaceuticals: GBR-401 - Hou S., et al Mol Cancer Ther November (Meeting Abstract Supplement) C164 US7,109,304 (Immunomedics) For example, an antibody comprising the sequence of hA19Vk (SEQ ID NO:7) and the sequence of hA19VH (SEQ ID NO:10) U57,902,338 (Immunomedics) For example, an antibody or antigen-binding fragment thereof that comprises the light chain complementarity determining region CDR sequences CDR1 of SEQ ID NO: 16 (KASQSVDYDGDSYLN); CDR2 of SEQ ID NO: 17 (DASNLVS); and CDR3 of SEQ
ID NO: 18 (QQSTEDPWT) and the heavy chain CDR sequences CDR1 of SEQ ID
NO: 19 (SYWMN); CDR2 of SEQ ID NO: 20 (QIWPGDGDTNYNGKFKG) and CDR3 of SEQ ID NO: 21 (RETTTVGRYYYAMDY) and also comprises human antibody framework (FR) and constant region sequences with one or more framework region amino acid residues substituted from the corresponding framework region sequences of the parent murine antibody, and wherein said substituted FR residues comprise the substitution of serine for phenylalanine at Kabat residue 91 of the heavy chain variable region.
Medarex: MDX-1342 ¨ Cardarelli PM., et al Cancer. Immunol Immunother. 2010 Feb;59(2):257-65.
MorphoSys /Xencor: MOR-208/XmAb-5574 - Zalevsky J., et al Blood. 2009 Apr 16;113(16):3735-43 U57,968,687 (Seattle Genetics) An antibody or antigen-binding fragment comprising a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:9 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 24.
4G7 chim - Lang P., et al Blood. 2004 May 15;103(10):3982-5 (University of Tubingen) For example, fig. 6 and SEQ ID No: 80 of U520120082664 Zhejiang University School of Medicine: 2E8 - Zhang J., et al J Drug Target.
Nov;18(9):675-8
Polypeptide Genbank accession no. NP_001171569 15 Genbank version no. NP_001171569.1 GI:296010921 Genbank record update date: Sep 10, 2012 12:43 AM
Cross-references Tedder TF., et al J. lmmunol. 143 (2): 712-7 (1989) Other information Official Symbol: CD19 Other Aliases: B4, CVID3 Other Designations: B-lymphocyte antigen CD19; B-lymphocyte surface antigen B4; T-cell surface antigen Leu-12; differentiation antigen CD19 ANTIBODIES
lmmunogen: HuB4 - Al-Katib AM., et al Clin Cancer Res. 2009 Jun 15;15(12):4038-45.
4G7: Kugler M., et al Protein Eng Des Sel. 2009 Mar;22(3):135-47 For example, sequences in Fig. 3 of of Knappik, A. et al. J Mol Biol 2000 Feb;296(1):57-AstraZeneca /Medlmmune: MEDI-551 - Herbst R., et al J Pharmacol Exp Ther. 2010 Oct;335(1):213-22 Glenmark Pharmaceuticals: GBR-401 - Hou S., et al Mol Cancer Ther November (Meeting Abstract Supplement) C164 US7,109,304 (Immunomedics) For example, an antibody comprising the sequence of hA19Vk (SEQ ID NO:7) and the sequence of hA19VH (SEQ ID NO:10) U57,902,338 (Immunomedics) For example, an antibody or antigen-binding fragment thereof that comprises the light chain complementarity determining region CDR sequences CDR1 of SEQ ID NO: 16 (KASQSVDYDGDSYLN); CDR2 of SEQ ID NO: 17 (DASNLVS); and CDR3 of SEQ
ID NO: 18 (QQSTEDPWT) and the heavy chain CDR sequences CDR1 of SEQ ID
NO: 19 (SYWMN); CDR2 of SEQ ID NO: 20 (QIWPGDGDTNYNGKFKG) and CDR3 of SEQ ID NO: 21 (RETTTVGRYYYAMDY) and also comprises human antibody framework (FR) and constant region sequences with one or more framework region amino acid residues substituted from the corresponding framework region sequences of the parent murine antibody, and wherein said substituted FR residues comprise the substitution of serine for phenylalanine at Kabat residue 91 of the heavy chain variable region.
Medarex: MDX-1342 ¨ Cardarelli PM., et al Cancer. Immunol Immunother. 2010 Feb;59(2):257-65.
MorphoSys /Xencor: MOR-208/XmAb-5574 - Zalevsky J., et al Blood. 2009 Apr 16;113(16):3735-43 U57,968,687 (Seattle Genetics) An antibody or antigen-binding fragment comprising a heavy chain variable domain comprising the amino acid sequence of SEQ ID NO:9 and a light chain variable domain comprising the amino acid sequence of SEQ ID NO: 24.
4G7 chim - Lang P., et al Blood. 2004 May 15;103(10):3982-5 (University of Tubingen) For example, fig. 6 and SEQ ID No: 80 of U520120082664 Zhejiang University School of Medicine: 2E8 - Zhang J., et al J Drug Target.
Nov;18(9):675-8
(48) IL2RA (Interleukin 2 receptor, alpha); NCBI Reference Sequence: NM
000417.2);
Nucleotide Genbank accession no. NM_000417 Genbank version no. NM_000417.2 GI:269973860 Genbank record update date: Sep 09, 2012 04:59 PM
Polypeptide Genbank accession no. NP_000408 Genbank version no. NP_000408.1 GI:4557667 Genbank record update date: Sep 09, 2012 04:59 PM
Cross-references Kuziel W.A., et al J. Invest. Dermatol. 94 (6 SUPPL), 27S-32S (1990) Other information Official Symbol: IL2RA
Other Aliases: RP11-536K7.1, CD25, IDDM10, IL2R, TCGFR
Other Designations: FIL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; 1L2-RA;
TAC antigen; interleukin-2 receptor subunit alpha; p55 ANTIBODIES
U56,383,487 (Novartis/UCL: Baxilisimab [Simulect]) U56,521,230 (Novartis/UCL: Baxilisimab [Simulect]) For example, an antibody having an antigen binding site comprises at least one domain which comprises CDR1 having the amino acid sequence in SEQ. ID. NO: 7, CDR2 having the amino acid sequence in SEQ. ID. NO: 8, and CDR3 chaving the amino acid sequence in SEQ. ID. NO: 9; or said CDR1, CDR2 and CDR3 taken in sequence as a whole comprise an amino acid sequence which is at least 90%
identical to SEQ. ID. NOs: 7, 8 and 9 taken in sequence as a whole.
Daclizumab ¨ Rech AJ., et al Ann N Y Acad Sci. 2009 Sep;1174:99-106 (Roche)
000417.2);
Nucleotide Genbank accession no. NM_000417 Genbank version no. NM_000417.2 GI:269973860 Genbank record update date: Sep 09, 2012 04:59 PM
Polypeptide Genbank accession no. NP_000408 Genbank version no. NP_000408.1 GI:4557667 Genbank record update date: Sep 09, 2012 04:59 PM
Cross-references Kuziel W.A., et al J. Invest. Dermatol. 94 (6 SUPPL), 27S-32S (1990) Other information Official Symbol: IL2RA
Other Aliases: RP11-536K7.1, CD25, IDDM10, IL2R, TCGFR
Other Designations: FIL-2 receptor subunit alpha; IL-2-RA; IL-2R subunit alpha; 1L2-RA;
TAC antigen; interleukin-2 receptor subunit alpha; p55 ANTIBODIES
U56,383,487 (Novartis/UCL: Baxilisimab [Simulect]) U56,521,230 (Novartis/UCL: Baxilisimab [Simulect]) For example, an antibody having an antigen binding site comprises at least one domain which comprises CDR1 having the amino acid sequence in SEQ. ID. NO: 7, CDR2 having the amino acid sequence in SEQ. ID. NO: 8, and CDR3 chaving the amino acid sequence in SEQ. ID. NO: 9; or said CDR1, CDR2 and CDR3 taken in sequence as a whole comprise an amino acid sequence which is at least 90%
identical to SEQ. ID. NOs: 7, 8 and 9 taken in sequence as a whole.
Daclizumab ¨ Rech AJ., et al Ann N Y Acad Sci. 2009 Sep;1174:99-106 (Roche)
(49) AXL (AXL receptor tyrosine kinase) Nucleotide Genbank accession no. M76125 Genbank version no. M76125.1 GI:292869 Genbank record update date: Jun 23, 2010 08:53 AM
Polypeptide Genbank accession no. AAA61243 Genbank version no. AAA61243.1 GI:29870 Genbank record update date: Jun 23, 2010 08:53 AM
Cross-references O'Bryan J.P., et al Ma Cell. Biol. 11 (10), 5016-5031 (1991); Bergsagel P.L., et al J.
Immunol. 148 (2), 590-596 (1992) Other information Official Symbol: AXL
Other Aliases: JTK11, UFO
Other Designations: AXL oncogene; AXL transforming sequence/gene; oncogene AXL;
tyrosine-protein kinase receptor UFO
ANTIBODIES
YW327.6S2 - Ye X., et al Oncogene. 2010 Sep 23;29(38):5254-64. (Genentech) BergenBio: BGB324 (http://vvww.bergenbio.com/BGB324)
Polypeptide Genbank accession no. AAA61243 Genbank version no. AAA61243.1 GI:29870 Genbank record update date: Jun 23, 2010 08:53 AM
Cross-references O'Bryan J.P., et al Ma Cell. Biol. 11 (10), 5016-5031 (1991); Bergsagel P.L., et al J.
Immunol. 148 (2), 590-596 (1992) Other information Official Symbol: AXL
Other Aliases: JTK11, UFO
Other Designations: AXL oncogene; AXL transforming sequence/gene; oncogene AXL;
tyrosine-protein kinase receptor UFO
ANTIBODIES
YW327.6S2 - Ye X., et al Oncogene. 2010 Sep 23;29(38):5254-64. (Genentech) BergenBio: BGB324 (http://vvww.bergenbio.com/BGB324)
(50) CD30 - TNFRSF8 (Tumor necrosis factor receptor superfamily, member 8) Nucleotide Genbank accession no. M83554 Genbank version no. M83554.1 GI:180095 Genbank record update date: Jun 23, 2010 08:53 AM
Polypeptide Genbank accession no. AAA51947 Genbank version no. AAA51947.1 GI:180096 Genbank record update date: Jun 23, 2010 08:53 AM
Cross-references Durkop H., et al Ce// 68 (3), 421-427 (1992) Other information Official Symbol: TNFRSF8 Other Aliases: CD30, D1S166E, Ki-1 Other Designations: CD3OL receptor; Ki-1 antigen; cytokine receptor CD30;
lymphocyte activation antigen CD30; tumor necrosis factor receptor superfamily member 8
Polypeptide Genbank accession no. AAA51947 Genbank version no. AAA51947.1 GI:180096 Genbank record update date: Jun 23, 2010 08:53 AM
Cross-references Durkop H., et al Ce// 68 (3), 421-427 (1992) Other information Official Symbol: TNFRSF8 Other Aliases: CD30, D1S166E, Ki-1 Other Designations: CD3OL receptor; Ki-1 antigen; cytokine receptor CD30;
lymphocyte activation antigen CD30; tumor necrosis factor receptor superfamily member 8
(51) BCMA (B-cell maturation antigen) - TNFRSF17 (Tumor necrosis factor receptor superfamily, member 17) Nucleotide Genbank accession no. Z29574 Genbank version no. Z29574.1 GI:471244 Genbank record update date: Feb 02, 2011 10:40 AM
Polypeptide Genbank accession no. CAA82690 Genbank version no. CAA82690.1 GI:471245 Genbank record update date: Feb 02, 2011 10:40 AM
Cross-references Laabi Y., et al Nucleic Acids Res. 22 (7), 1147-1154 (1994) Other information Official Symbol: TNFRSF17 Other Aliases: BCM, BCMA, CD269 Other Designations: B cell maturation antigen; B-cell maturation factor; B-cell maturation protein; tumor necrosis factor receptor superfamily member 17
Polypeptide Genbank accession no. CAA82690 Genbank version no. CAA82690.1 GI:471245 Genbank record update date: Feb 02, 2011 10:40 AM
Cross-references Laabi Y., et al Nucleic Acids Res. 22 (7), 1147-1154 (1994) Other information Official Symbol: TNFRSF17 Other Aliases: BCM, BCMA, CD269 Other Designations: B cell maturation antigen; B-cell maturation factor; B-cell maturation protein; tumor necrosis factor receptor superfamily member 17
(52) CT Ags ¨ CTA (Cancer Testis Antigens) Cross-references Fratta E., et al. Mo/ Oncol. 2011 Apr;5(2):164-82; Lim SH., at al Am J Blood Res.
2012;2(1):29-35.
2012;2(1):29-35.
(53) CD174 (Lewis Y) - FUT3 (fucosyltransferase 3 (galactoside 3(4)-L-fucosyltransferase, Lewis blood group) Nucleotide Genbank accession no. NM000149 5 Genbank version no. NM000149.3 GI:148277008 Genbank record update date: Jun 26, 2012 04:49 PM
Polypeptide Genbank accession no. NP_000140 10 Genbank version no. NP_000140.1 GI:4503809 Genbank record update date: Jun 26, 2012 04:49 PM
Cross-references Kukowska-Latallo,J.F., et al Genes Dev. 4 (8), 1288-1303 (1990) Other information Official Symbol: FUT3 Other Aliases: CD174, FT3B, FucT-III, LE, Les Other Designations: Lewis FT; alpha-(1,3/1,4)-fucosyltransferase; blood group Lewis alpha-4-fucosyltransferase; fucosyltransferase III; galactoside 3(4)-L-fucosyltransferase
Polypeptide Genbank accession no. NP_000140 10 Genbank version no. NP_000140.1 GI:4503809 Genbank record update date: Jun 26, 2012 04:49 PM
Cross-references Kukowska-Latallo,J.F., et al Genes Dev. 4 (8), 1288-1303 (1990) Other information Official Symbol: FUT3 Other Aliases: CD174, FT3B, FucT-III, LE, Les Other Designations: Lewis FT; alpha-(1,3/1,4)-fucosyltransferase; blood group Lewis alpha-4-fucosyltransferase; fucosyltransferase III; galactoside 3(4)-L-fucosyltransferase
(54) CLEC14A (C-type lectin domain family 14, member A; Genbank accession no.
NM175060) Nucleotide Genbank accession no. NM175060 Genbank version no. NM175060.2 GI:371123930 Genbank record update date: Apr 01, 2012 03:34 PM
Polypeptide Genbank accession no. NP_778230 Genbank version no. NP_778230.1 GI:28269707 Genbank record update date: Apr 01, 2012 03:34 PM
Other information Official Symbol: CLEC14A
Other Aliases: UNQ236/PR0269, C14orf27, CEG1, EGFR-5 Other Designations: C-type lectin domain family 14 member A; CIECT and EGF-like domain containing protein; epidermal growth factor receptor 5
NM175060) Nucleotide Genbank accession no. NM175060 Genbank version no. NM175060.2 GI:371123930 Genbank record update date: Apr 01, 2012 03:34 PM
Polypeptide Genbank accession no. NP_778230 Genbank version no. NP_778230.1 GI:28269707 Genbank record update date: Apr 01, 2012 03:34 PM
Other information Official Symbol: CLEC14A
Other Aliases: UNQ236/PR0269, C14orf27, CEG1, EGFR-5 Other Designations: C-type lectin domain family 14 member A; CIECT and EGF-like domain containing protein; epidermal growth factor receptor 5
(55) GRP78 ¨ HSPA5 (heat shock 70kDa protein 5 (glucose-regulated protein, 78kDa) Nucleotide Genbank accession no. NM005347 Genbank version no. NM005347.4 GI:305855105 Genbank record update date: Sep 30, 2012 01:42 PM
Polypeptide Genbank accession no. NP_005338 Genbank version no. NP_005338.1 GI:16507237 Genbank record update date: Sep 30, 2012 01:42 PM
Cross-references Ting J., et al DNA 7 (4), 275-286 (1988) Other infromation Official Symbol: HSPA5 Other Aliases: BIP, GRP78, MIF2 Other Designations: 78 kDa glucose-regulated protein; endoplasmic reticulum lumenal Ca(2+)-binding protein grp78; immunoglobulin heavy chain-binding protein
Polypeptide Genbank accession no. NP_005338 Genbank version no. NP_005338.1 GI:16507237 Genbank record update date: Sep 30, 2012 01:42 PM
Cross-references Ting J., et al DNA 7 (4), 275-286 (1988) Other infromation Official Symbol: HSPA5 Other Aliases: BIP, GRP78, MIF2 Other Designations: 78 kDa glucose-regulated protein; endoplasmic reticulum lumenal Ca(2+)-binding protein grp78; immunoglobulin heavy chain-binding protein
(56) CD70 (CD70 molecule) L08096 Nucleotide Genbank accession no. L08096 Genbank version no. L08096.1 GI:307127 Genbank record update date: Jun 23, 2012 08:54 AM
Polypeptide Genbank accession no. AAA36175 Genbank version no. AAA36175.1 GI:307128 Genbank record update date: Jun 23, 2012 08:54 AM
Cross-references Goodwin R.G., et al Ce// 73 (3), 447-456 (1993) Other information Official Symbol: CD70 Other Aliases: CD27L, CD27LG, TNFSF7 Other Designations: CD27 ligand; CD27-L; CD70 antigen; Ki-24 antigen; surface antigen CD70; tumor necrosis factor (ligand) superfamily, member 7; tumor necrosis factor ligand superfamily member 7 ANTIBODIES
MDX-1411 against CD70 (Medarex) h1F6 (Oflazoglu, E., et al, Clin Cancer Res. 2008 Oct 1;14(19):6171-80;
Seattle Genetics) For example, see U520060083736 SEQ ID NOs: 1, 2, 11 and 12 and Fig. 1.
Polypeptide Genbank accession no. AAA36175 Genbank version no. AAA36175.1 GI:307128 Genbank record update date: Jun 23, 2012 08:54 AM
Cross-references Goodwin R.G., et al Ce// 73 (3), 447-456 (1993) Other information Official Symbol: CD70 Other Aliases: CD27L, CD27LG, TNFSF7 Other Designations: CD27 ligand; CD27-L; CD70 antigen; Ki-24 antigen; surface antigen CD70; tumor necrosis factor (ligand) superfamily, member 7; tumor necrosis factor ligand superfamily member 7 ANTIBODIES
MDX-1411 against CD70 (Medarex) h1F6 (Oflazoglu, E., et al, Clin Cancer Res. 2008 Oct 1;14(19):6171-80;
Seattle Genetics) For example, see U520060083736 SEQ ID NOs: 1, 2, 11 and 12 and Fig. 1.
(57) Stem Cell specific antigens. For example:
= 5T4 (see entry (63) below) = CD25 (see entry (48) above) = CD32 0 Polypeptide = Genbank accession no. ABK42161 = Genbank version no. ABK42161.1 GI:117616286 = Genbank record update date: Jul 25, 2007 03:00 PM
= LGR5/GPR49 0 Nucleotide = Genbank accession no. NM_003667 = Genbank version no. NM_003667.2 GI:24475886 = Genbank record update date: Jul 22, 2012 03:38 PM
0 Polypeptide = Genbank accession no. NP_003658 = Genbank version no. NP_003658.1 GI:4504379 = Genbank record update date: Jul 22, 2012 03:38 PM
= Prominin/CD133 0 Nucleotide = Genbank accession no. NM_006017 = Genbank version no. NM_006017.2 GI:224994187 = Genbank record update date: Sep 30, 2012 01:47 PM
0 Polypeptide = Genbank accession no. NP_006008 = Genbank version no. NP_006008.1 GI:5174387 = Genbank record update date: Sep 30, 2012 01:47 PM
= 5T4 (see entry (63) below) = CD25 (see entry (48) above) = CD32 0 Polypeptide = Genbank accession no. ABK42161 = Genbank version no. ABK42161.1 GI:117616286 = Genbank record update date: Jul 25, 2007 03:00 PM
= LGR5/GPR49 0 Nucleotide = Genbank accession no. NM_003667 = Genbank version no. NM_003667.2 GI:24475886 = Genbank record update date: Jul 22, 2012 03:38 PM
0 Polypeptide = Genbank accession no. NP_003658 = Genbank version no. NP_003658.1 GI:4504379 = Genbank record update date: Jul 22, 2012 03:38 PM
= Prominin/CD133 0 Nucleotide = Genbank accession no. NM_006017 = Genbank version no. NM_006017.2 GI:224994187 = Genbank record update date: Sep 30, 2012 01:47 PM
0 Polypeptide = Genbank accession no. NP_006008 = Genbank version no. NP_006008.1 GI:5174387 = Genbank record update date: Sep 30, 2012 01:47 PM
(58) ASG-5 Cross-references (Smith L.M., et.al AACR 2010 Annual Meeting (abstract #2590); Gudas J.M., et.al. AACR
2010 Annual Meeting (abstract #4393) ANTIBODIES
Anti- AGS-5 Antibody: M6.131 (Smith, L.M., et.al AACR 2010 Annual Meeting (abstract #2590)
2010 Annual Meeting (abstract #4393) ANTIBODIES
Anti- AGS-5 Antibody: M6.131 (Smith, L.M., et.al AACR 2010 Annual Meeting (abstract #2590)
(59) ENPP3 (Ectonucleotide pyrophosphatase/phosphodiesterase 3) Nucleotide Genbank accession no. AF005632 Genbank version no. AF005632.2 GI:4432589 Genbank record update date: Mar 10, 2010 09:41 PM
Polypeptide Genbank accession no. AAC51813 Genbank version no. AAC51813.1 GI:2465540 Genbank record update date: Mar 10, 2010 09:41 PM
Cross-references Jin-Hua P., et al Genomics 45 (2), 412-415 (1997) Other information Official Symbol: ENPP3 Other Aliases: RP5-988G15.3, B10, CD203c, NPP3, PD-IBETA, PDNP3 Other Designations: E-NPP 3; dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3); dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3);
ectonucleotide pyrophosphatase/phosphodiesterase family member 3; gp13ORB13-6;
phosphodiesterase I beta; phosphodiesterase I/nucleotide pyrophosphatase 3;
phosphodiesterase-I beta
Polypeptide Genbank accession no. AAC51813 Genbank version no. AAC51813.1 GI:2465540 Genbank record update date: Mar 10, 2010 09:41 PM
Cross-references Jin-Hua P., et al Genomics 45 (2), 412-415 (1997) Other information Official Symbol: ENPP3 Other Aliases: RP5-988G15.3, B10, CD203c, NPP3, PD-IBETA, PDNP3 Other Designations: E-NPP 3; dJ1005H11.3 (phosphodiesterase I/nucleotide pyrophosphatase 3); dJ914N13.3 (phosphodiesterase I/nucleotide pyrophosphatase 3);
ectonucleotide pyrophosphatase/phosphodiesterase family member 3; gp13ORB13-6;
phosphodiesterase I beta; phosphodiesterase I/nucleotide pyrophosphatase 3;
phosphodiesterase-I beta
(60) PRR4 (Proline rich 4 (lacrimal)) Nucleotide Genbank accession no. NM_007244 Genbank version no. NM_007244.2 GI:154448885 Genbank record update date: Jun 28, 2012 12:39 PM
Polypeptide Genbank accession no. NP_009175 Genbank version no. NP_009175.2 GI:154448886 Genbank record update date: Jun 28, 2012 12:39 PM
Cross-references Dickinson D.P., et al Invest. Ophthalmol. Vis. Sci. 36 (10), 2020-2031 (1995) Other information Official Symbol: PRR4 Other Aliases: LPRP, PROL4 Other Designations: lacrimal proline-rich protein; nasopharyngeal carcinoma-associated proline-rich protein 4; proline-rich polypeptide 4; proline-rich protein 4
Polypeptide Genbank accession no. NP_009175 Genbank version no. NP_009175.2 GI:154448886 Genbank record update date: Jun 28, 2012 12:39 PM
Cross-references Dickinson D.P., et al Invest. Ophthalmol. Vis. Sci. 36 (10), 2020-2031 (1995) Other information Official Symbol: PRR4 Other Aliases: LPRP, PROL4 Other Designations: lacrimal proline-rich protein; nasopharyngeal carcinoma-associated proline-rich protein 4; proline-rich polypeptide 4; proline-rich protein 4
(61) GCC ¨ GUCY2C (guanylate cyclase 2C (heat stable enterotoxin receptor) Nucleotide Genbank accession no. NM_004963 Genbank version no. NM_004963.3 GI:222080082 Genbank record update date: Sep 02, 2012 01:50 PM
Polypeptide Genbank accession no. NP_004954 Genbank version no. NP_004954.2 GI:222080083 Genbank record update date: Sep 02, 2012 01:50 PM
Cross-references De Sauvage F.J., et al J. Biol. Chem. 266 (27), 17912-17918 (1991); Singh S., et al Biochem. Biophys. Res. Commun. 179 (3), 1455-1463 (1991) Other information 5 Official Symbol: GUCY2C
Other Aliases: DIAR6, GUC2C, MUCIL, STAR
Other Designations: GC-C; STA receptor; guanylyl cyclase C; hSTAR; heat-stable enterotoxin receptor; intestinal guanylate cyclase 10 (62) Liv-1 ¨ SLC39A6 (Solute carrier family 39 (zinc transporter), member 6) Nucleotide Genbank accession no. U41060 Genbank version no. U41060.2 GI:12711792 Genbank record update date: Nov 30, 2009 04:35 PM
Polypeptide Genbank accession no. AAA96258 Genbank version no. AAA96258.2 GI:12711793 Genbank record update date: Nov 30, 2009 04:35 PM
Cross-references Taylor KM., et al Biochim Biophys Acta. 2003 Apr 1;1611(1-2):16-30 Other information Official Symbol: 5LC39A6 Other Aliases: LIV-1 Other Designations: LIV-1 protein, estrogen regulated; ZIP-6; estrogen-regulated protein LIV-1; solute carrier family 39 (metal ion transporter), member 6;
solute carrier family 39 member 6; zinc transporter ZIP6; zrt- and Irt-like protein 6 (63) 5T4, Trophoblast glycoprotein, TPBG ¨ TPBG (trophoblast glycoprotein) Nucleotide Genbank accession no. AJ012159 Genbank version no. AJ012159.1 GI:3805946 Genbank record update date: Feb 01, 2011 10:27 AM
Polypeptide Genbank accession no. CAA09930 Genbank version no. CAA09930.1 GI:3805947 Genbank record update date: Feb 01, 2011 10:27 AM
Cross-references King K.W.,et al Biochim. Biophys. Acta 1445 (3), 257-270 (1999) Other information = Official Symbol: TPBG
= Other Aliases: 5T4, 5T4AG, M6P1 = Other Designations: 5T4 oncofetal antigen; 5T4 oncofetal trophoblast glycoprotein; 5T4 oncotrophoblast glycoprotein (64) CD56¨ NCMA1 (Neural cell adhesion molecule 1) Nucleotide Genbank accession no. NM_000615 Genbank version no. NM_000615.6 GI:336285433 Genbank record update date: Sep 23, 2012 02:32 PM
Polypeptide Genbank accession no. NP_000606 Genbank version no. NP_000606.3 GI:94420689 Genbank record update date: Sep 23, 2012 02:32 PM
Cross-references Dickson,G., et al, Cell SO (7), 1119-1130 (1987) Other information Official Symbol: NCAM1 Other Aliases: CD56, M5K39, NCAM
Other Designations: antigen recognized by monoclonal antibody 5.1H11; neural cell adhesion molecule, NCAM
ANTIBODIES
lmmunogen: HuN901 (Smith SV., et al Curr Opin Mol Ther. 2005 Aug;7(4):394-401) For example, see humanized from murine N901 antibody. See Fig. lb and le of Roguska, M.A., et al. Proc Natl Acad Sci USA Feb 1994;91:969-973.
(65) CanAg (Tumor associated antigen CA242) Cross-references Haglund C., et al Br J Cancer 60:845-851, 1989;Baeckstrom D., et al J Biol Chem 266:21537-21547, 1991 ANTIBODIES
huC242 (Tolcher AW et al., J Clin Oncol. 2003 Jan 15;21(2):211-22; lmmunogen) For example, see U520080138898A1 SEQ ID NO: 1 and 2 (66) FOLR1 (Folate Receptor 1) Nucleotide Genbank accession no. J05013 Genbank version no. J05013.1 GI:182417 Genbank record update date: Jun 23, 2010 08:47 AM
Polypeptide Genbank accession no. AAA35823 Genbank version no. AAA35823.1 GI:182418 Genbank record update date: Jun 23, 2010 08:47 AM
Cross-references Elwood P.C., et al J. Biol. Chem. 264 (25), 14893-14901 (1989) Other information Official Symbol: FOLR1 Other Aliases: FBP, FOLR
Other Designations: FR-alpha; KB cells FBP; adult folate-binding protein;
folate binding protein; folate receptor alpha; folate receptor, adult; ovarian tumor-associated antigen MOv18 ANTIBODIES
M9346A - Whiteman KR., et al Cancer Res April 15, 2012; 72(8 Supplement): 4628 (Immunogen) (67) GPNMB (Glycoprotein (transmembrane) nmb) Nucleotide Genbank accession no. X76534 Genbank version no. X76534.1 GI:666042 Genbank record update date: Feb 02, 2011 10:10 AM
Polypeptide Genbank accession no. CAA54044 Genbank version no. CAA54044.1 GI:666043 Genbank record update date: Feb 02, 2011 10:10 AM
Cross-references Weterman M.A., et al Int. J. Cancer 60 (1), 73-81 (1995) Other information Official Symbol: GPNMB
Other Aliases: UNQ1725/PR09925, HGFIN, NMB
Other Designations: glycoprotein NMB; glycoprotein nmb-like protein;
osteoactivin;
transmembrane glycoprotein HGFIN; transmembrane glycoprotein NMB
ANTIBODIES
Celldex Therapeutics: CR011 (Tse KF., et al Clin Cancer Res. 2006 Feb 15;12(4):1373-82) For example, see EP1827492B1 SEQ ID NO: 22, 24, 26, 31, 33 and 35 (68) TIM-1 ¨ HAVCR1 (Hepatitis A virus cellular receptor 1) Nucleotide Genbank accession no. AF043724 Genbank version no. AF043724.1 GI:2827453 Genbank record update date: Mar 10, 2010 06:24 PM
Polypeptide Genbank accession no. AAC39862 Genbank version no. AAC39862.1 GI:2827454 Genbank record update date: Mar 10, 2010 06:24 PM
Cross-references Feigelstock D., et al J. Virol. 72 (8), 6621-6628 (1998) Other information Official Symbol: HAVCR1 Other Aliases: HAVCR, HAVCR-1, KIM-1, KIM1, TIM, TIM-1, TIM1, TIMD-1, TIMD1 Other Designations: T cell immunoglobin domain and mucin domain protein 1; T-cell membrane protein 1; kidney injury molecule 1 (69) RG-1/Prostate tumor target Mindin ¨ Mindin/RG-1 Cross-references Parry R., et al Cancer Res. 2005 Sep 15;65(18):8397-405 (70) 87-H4 ¨ VTCN1 (V-set domain containing T cell activation inhibitor 1 Nucleotide Genbank accession no. BX648021 Genbank version no. BX648021.1 GI:34367180 Genbank record update date: Feb 02, 2011 08:40 AM
Cross-references Sica GL., et al Immunity. 2003 Jun;18(6):849-61 Other information Official Symbol: VTCN1 Other Aliases: RP11-229A19.4, B7-H4, B7H4, B751, B7X, B7h.5, PR01291, VCTN1 Other Designations: B7 family member, H4; B7 superfamily member 1; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; V-set domain-containing T-cell activation inhibitor 1; immune costimulatory protein B7-H4 (71) PTK7 (PTK7 protein tyrosine kinase 7) Nucleotide Genbank accession no. AF447176 Genbank version no. AF447176.1 GI:17432420 Genbank record update date: Nov 28, 2008 01:51 PM
Polypeptide Genbank accession no. AAL39062 5 Genbank version no. AAL39062.1 GI:17432421 Genbank record update date: Nov 28, 2008 01:51 PM
Cross-references Park S.K.,et al J. Biochem. 119 (2), 235-239 (1996) Other information Official Symbol: PTK7 Other Aliases: CCK-4, CCK4 Other Designations: colon carcinoma kinase 4; inactive tyrosine-protein kinase 7; pseudo tyrosine kinase receptor 7; tyrosine-protein kinase-like 7 (72) CD37 (CD37 molecule) Nucleotide Genbank accession no. NM_001040031 Genbank version no. NM_001040031.1 GI:91807109 Genbank record update date: Jul 29, 2012 02:08 PM
Polypeptide Genbank accession no. NP_001035120 Genbank version no. NP_001035120.1 GI:91807110 Genbank record update date: Jul 29, 2012 02:08 PM
Cross-references Schwartz-Albiez R., et al J. Immunol. 140 (3), 905-914 (1988) Other information Official Symbol: CD37 Other Aliases: GP52-40, TSPAN26 Other Designations: CD37 antigen; cell differentiation antigen 37; leukocyte antigen CD37;
leukocyte surface antigen CD37; tetraspanin-26; tspan-26 ANTIBODIES
Boehringer Ingelheim: mAb 37.1 (Heider KH., et al Blood. 2011 Oct 13;118(15):4159-68) Trubion: CD37-SMIP (G28-1 scFv-Ig) ((Zhao X., et al Blood. 2007;110: 2569-2577) For example, see US20110171208A1 SEQ ID NO: 253 lmmunogen: K7153A (Deckert J., et al Cancer Res April 15, 2012; 72(8 Supplement): 4625) (73) CD138 ¨ SDC1 (syndecan 1) Nucleotide Genbank accession no. AJ551176 Genbank version no. AJ551176.1 GI:29243141 Genbank record update date: Feb 01, 2011 12:09 PM
Polypeptide Genbank accession no. CAD80245 Genbank version no. CAD80245.1 GI:29243142 Genbank record update date: Feb 01, 2011 12:09 PM
Cross-references O'Connell FP., et al Am J Clin Pathol. 2004 Feb;121(2):254-63 Other information Official Symbol: SDC1 Other Aliases: CD138, SDC, SYND1, syndecan Other Designations: CD138 antigen; heparan sulfate proteoglycan fibroblast growth factor receptor; syndecan proteoglycan 1; syndecan-1 ANTIBODIES
Biotest: chimerized MAb (nBT062) - (Jagannath S., et al Poster ASH #3060, 2010; WIPO
Patent Application WO/2010/128087) For example, see U520090232810 SEQ ID NO: 1 and 2 lmmunogen: B-B4 (Tassone P., et al Blood 104_3688-3696) For example, see U520090175863A1 SEQ ID NO: 1 and 2 (74) CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain) Nucleotide Genbank accession no. NM_004355 Genbank version no. NM_004355.1 GI:343403784 Genbank record update date: Sep 23, 2012 02:30 PM
Polypeptide Genbank accession no. NP_004346 Genbank version no. NP_004346.1 GI:10835071 Genbank record update date: Sep 23, 2012 02:30 PM
Cross-references Kudo,J., et al Nucleic Acids Res. 13 (24), 8827-8841 (1985) Other information Official Symbol: CD74 Other Aliases: DHLAG, HLADG, II, la-GAMMA
Other Designations: CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); HLA class II histocompatibility antigen gamma chain;
HLA-DR antigens-associated invariant chain; HLA-DR-gamma; la-associated invariant chain; MHC HLA-DR gamma chain; gamma chain of class II antigens; p33 ANTIBODIES
Immunomedics: hLL1 (Milatuzumab,) - Berkova Z., et al Expert Opin Investig Drugs. 2010 Jan;19(1):141-9) For example, see U520040115193 SEQ ID NOs: 19, 20, 21, 22, 23 and 24 Genmab: HuMax-CD74 (see website) (75) Claudins ¨ CLs (Claudins) Cross-references Offner S., et al Cancer Immunol Immunother. 2005 May; 54(5):431-45, Suzuki H., et al Ann N Y Acad Sci. 2012 Jul;1258:65-70) In humans, 24 members of the family have been described ¨ see literature reference.
(76) EGFR (Epidermal growth factor receptor) Nucleotide Genbank accession no. NM_005228 Genbank version no. NM_005228.3 GI:41927737 Genbank record update date: Sep 30, 2012 01:47 PM
Polypeptide Genbank accession no. NP_005219 Genbank version no. NP_005219.2 GI:29725609 Genbank record update date: Sep 30, 2012 01:47 PM
Cross-references Dhomen NS., et al Crit Rev Oncog. 2012;17(1):31-50 Other information Official Symbol: EGFR
Other Aliases: ERBB, ERBB1, HER1, PIG61, mENA
Other Designations: avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; proto-oncogene c-ErbB-1;
receptor tyrosine-protein kinase erbB-1 ANTIBODIES
BMS: Cetuximab (Erbitux) - Broadbridge VT., et al Expert Rev Anticancer Ther.
May;12(5):555-65.
For example, see U56217866 ¨ ATTC deposit No. 9764.
Amgen: Panitumumab (Vectibix) - Argiles G., et al Future Oncol. 2012 Apr;8(4):373-89 For example, see U56235883 SEQ ID NOs: 23-38.
Genmab: Zalutumumab - Rivera F., et al Expert Opin Biol Ther. 2009 May;9(5):667-74.
YM Biosciences: Nimotuzumab - Ramakrishnan MS., et al MAbs. 2009 Jan-Feb;1(1):41-8.
For example, see U55891996 SEQ ID NOs: 27-34.
(77) Her3 (ErbB3) ¨ ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)) Nucleotide Genbank accession no. M34309 Genbank version no. M34309.1 GI:183990 Genbank record update date: Jun 23, 2010 08:47 PM
Polypeptide Genbank accession no. AAA35979 Genbank version no. AAA35979.1 GI:306841 Genbank record update date: Jun 23, 2010 08:47 PM
Cross-references Plowman,G.D., et al., Proc. Natl. Acad. Sci. U.S.A. 87 (13), 4905-4909 (1990) Other information Official Symbol: ERBB3 Other Aliases: ErbB-3, HER3, LCCS2, MDA-BF-1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3 Other Designations: proto-oncogene-like protein c-ErbB-3; receptor tyrosine-protein kinase erbB-3; tyrosine kinase-type cell surface receptor HER3 ANTIBODIES
Merimack Pharma : MM-121 (Schoeberl B., et al Cancer Res. 2010 Mar 15;70(6):2485-2494) For example, see U52011028129 SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7 and 8.
(78) RON - MST1R (macrophage stimulating 1 receptor (c-met-related tyrosine kinase)) Nucleotide Genbank accession no. X70040 Genbank version no. X70040.1 GI:36109 Genbank record update date: Feb 02, 2011 10:17 PM
Polypeptide Genbank accession no. CCA49634 Genbank version no. CCA49634.1 GI:36110 Genbank record update date: Feb 02, 2011 10:17 PM
Cross-references Ronsin C., et al Oncogene 8 (5), 1195-1202 (1993) Other information Official Symbol: MST1R
Other Aliases: CD136, CDw136, PTK8, RON
Other Designations: MSP receptor; MST1R variant RON30; MST1R variant R0N62;
protein tyrosine kinase 8; RON variant E2E3; c-met-related tyrosine kinase;
macrophage-stimulating protein receptor; p185-Ron; soluble RON variant 1; soluble RON
variant 2;
soluble RON variant 3; soluble RONvariant 4 (79) EPHA2 (EPH receptor A2) Nucleotide Genbank accession no. BC037166 Genbank version no. BC037166.2 GI:33879863 Genbank record update date: Mar 06, 2012 01:59 PM
Polypeptide Genbank accession no. AAH37166 Genbank version no. AAH37166.1 GI:22713539 Genbank record update date: Mar 06, 2012 01:59 PM
Cross-references Strausberg R.L., et al Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) Other information Official Symbol: EPHA2 Other Aliases: ARCC2, CTPA, CTPP1, ECK
Other Designations: ephrin type-A receptor 2; epithelial cell receptor protein tyrosine kinase;
soluble EPHA2 variant 1; tyrosine-protein kinase receptor ECK
ANTIBODIES
Medimmune: 1C1 (Lee JW., et al Clin Cancer Res. 2010 May 1;16(9):2562-2570) For example, see U520090304721A1 Fig. 7 and 8.
(80) CD20 ¨ MS4A1 (membrane-spanning 4-domains, subfamily A, member 1) Nucleotide Genbank accession no. M27394 Genbank version no. M27394.1 GI:179307 Genbank record update date: Nov 30, 2009 11:16 AM
Polypeptide Genbank accession no. AAA35581 Genbank version no. AAA35581.1 GI:179308 Genbank record update date: Nov 30, 2009 11:16 AM
Cross-references Tedder T.F., et al Proc. Natl. Acad. Sci. U.S.A. 85 (1), 208-212 (1988) Other information Official Symbol: MS4A1 Other Aliases: B1, Bp35, CD20, CVID5, LEU-16, MS4A2, S7 Other Designations: B-lymphocyte antigen CD20; B-lymphocyte cell-surface antigen B1;
CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16 ANTIBODIES
Genentech/Roche: Rituximab - Abdulla NE., et al BioDrugs. 2012 Apr 1;26(2):71-82.
For example, see U55736137, ATCC deposit No. HB-69119.
GSK/Genmab: Ofatumumab - Nightingale G., et al Ann Pharmacother. 2011 Oct;45(10):1248-55.
For example, see U520090169550A1 SEQ ID NOs: 2, 4 and 5.
lmmunomedics: Veltuzumab - Goldenberg DM., et al Leuk Lymphoma. 2010 May;51(5):747-55.
For example, see U57919273B2 SEQ ID NOs: 1, 2, 3, 4, 5 and 6.
(81) Tenascin C ¨ TNC (Tenascin C) Nucleotide Genbank accession no. NM_002160 Genbank version no. NM_002160.3 GI:340745336 Genbank record update date: Sep 23, 2012 02:33 PM
Polypeptide Genbank accession no. NP_002151 Genbank version no. NP_002151.2 GI:153946395 Genbank record update date: Sep 23, 2012 02:33 PM
Cross-references Nies D.E., et al J. Biol. Chem. 266 (5), 2818-2823 (1991); Siri A., et al Nucleic Acids Res. 19 (3), 525-531 (1991) Other information Official Symbol: TNC
Other Aliases: 150-225, GMEM, GP, HXB, JI, TN, TN-C
Other Designations: GP 150-225; cytotactin; glioma-associated-extracellular matrix antigen;
hexabrachion (tenascin); myotendinous antigen; neuronectin; tenascin; tenascin-C isoform ANTIBODIES
Philogen : G11 (von Lukowicz T., et al J Nucl Med. 2007 Apr;48(4):582-7) and F16 (Pedretti M., et al Lung Cancer. 2009 Apr;64(1):28-33) For example, see U57968685 SEQ ID NOs: 29, 35, 45 and 47.
(82) FAP (Fibroblast activation protein, alpha) Nucleotide Genbank accession no. U09278 Genbank version no. U09278.1 GI:1888315 Genbank record update date: Jun 23, 2010 09:22 AM
Polypeptide Genbank accession no. AAB49652 Genbank version no. AAB49652.1 GI:1888316 Genbank record update date: Jun 23, 2010 09:22 AM
Cross-references Scanlan,M.J.,et al Proc. Natl. Acad. Sci. U.S.A. 91 (12), 5657-5661 (1994) Other information Official Symbol: FAP
Other Aliases: DPPIV, FAPA
Other Designations: 170 kDa melanoma membrane-bound gelatinase; integral membrane serine protease; seprase (83) DKK-1 (Dickkopf 1 homolog (Xenopus laevis) Nucleotide Genbank accession no. NM_012242 Genbank version no. NM_012242.2 GI:61676924 Genbank record update date: Sep 30, 2012 01:48 PM
Polypeptide Genbank accession no. NP_036374 Genbank version no. NP_036374.1 GI:7110719 Genbank record update date: Sep 30, 2012 01:48 PM
Cross-references Fedi P. et al J. Biol. Chem. 274 (27), 19465-19472 (1999) Other information Official Symbol: DKK1 Other Aliases: UNQ492/PRO1008, DKK-1, SK
Other Designations: dickkopf related protein-1; dickkopf-1 like; dickkopf-like protein 1;
dickkopf-related protein 1; hDkk-1 ANTIBODIES
Novartis: BHQ880 (Fulciniti M., et al Blood. 2009 Jul 9;114(2):371-379) For example, see U520120052070A1 SEQ ID NOs: 100 and 108.
(84) CD52 (CD52 molecule) Nucleotide Genbank accession no. NM_001803 Genbank version no. NM_001803.2 GI :68342029 Genbank record update date: Sep 30, 2012 01:48 PM
Polypeptide Genbank accession no. NP_001794 Genbank version no. NP_001794.2 GI:68342030 Genbank record update date: Sep 30, 2012 01:48 PM
Cross-references Xia M.Q., et al Eur. J. Immunol. 21 (7), 1677-1684 (1991) Other information Official Symbol: CD52 Other Aliases: CDW52 Other Designations: CAMPATH-1 antigen; CD52 antigen (CAMPATH-1 antigen); CDW52 antigen (CAMPATH-1 antigen); cambridge pathology 1 antigen; epididymal secretory protein E5; he5; human epididymis-specific protein 5 ANTIBODIES
Alemtuzumab (Campath) - Skoetz N., et al Cochrane Database Syst Rev. 2012 Feb 15;2:CD008078.
For example, see Drugbank Acc. No. DB00087 (BIOD00109, BTD00109) (85) CS1 - SLAMF7 (SLAM family member 7) Nucleotide Genbank accession no. NM_021181 Genbank version no. NM_021181.3 GI:1993571 Genbank record update date: Jun 29, 2012 11:24 AM
Polypeptide Genbank accession no. NP_067004 Genbank version no. NP_067004.3 GI:19923572 Genbank record update date: Jun 29, 2012 11:24 AM
Cross-references Boles K.S., et al Immunogenetics 52 (3-4), 302-307 (2001) Other information Official Symbol: SLAMF7 Other Aliases: UNQ576/PR01138, 19A, CD319, CRACC, CS1 Other Designations: 19A24 protein; CD2 subset 1; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; membrane protein FOAP-12;
novel LY9 (lymphocyte antigen 9) like protein; protein 19A
ANTIBODIES
BMS: elotuzumab/HuLuc63 (Benson DM., et al J Clin Oncol. 2012 Jun 1;30(16):2013-2015) For example, see US20110206701 SEQ ID NOs: 9, 10, 11, 12, 13, 14, 15 and 16.
(86) Endoglin ¨ ENG (Endoglin) Nucleotide Genbank accession no. AF035753 Genbank version no. AF035753.1 GI:3452260 Genbank record update date: Mar 10, 2010 06:36 PM
Polypeptide Genbank accession no. AAC32802 Genbank version no. AAC32802.1 GI:3452261 Genbank record update date: Mar 10, 2010 06:36 PM
Cross-references Rius C., et al Blood 92 (12), 4677-4690 (1998) Official Symbol: ENG
Other information Other Aliases: RP11-228I315.2, CD105, END, HHT1, ORW, ORW1 Other Designations: CD105 antigen (87) Annexin Al ¨ ANXA1 (Annexin Al) Nucleotide Genbank accession no. X05908 Genbank version no. X05908.1 GI:34387 Genbank record update date: Feb 02, 2011 10:02 AM
Polypeptide Genbank accession no. CCA29338 Genbank version no. CCA29338.1 GI:34388 Genbank record update date: Feb 02, 2011 10:02 AM
Cross-references Wallner B.P.,et al Nature 320 (6057), 77-81 (1986) Other information Official Symbol: ANXA1 Other Aliases: RP11-71A24.1, ANX1, LPC1 Other Designations: annexin I (lipocortin I); annexin-1; calpactin II;
calpactin-2;
chromobindin-9; lipocortin I; p35; phospholipase A2 inhibitory protein (88) V-CAM (CD106) - VCAM1 (Vascular cell adhesion molecule 1) Nucleotide Genbank accession no. M60335 Genbank version no. M60335.1 GI:340193 Genbank record update date: Jun 23, 2010 08:56 AM
Polypeptide Genbank accession no. AAA61269 Genbank version no. AAA61269.1 GI:340194 Genbank record update date: Jun 23, 2010 08:56 AM
Cross-references Hession C., et al J. Biol. Chem. 266 (11), 6682-6685 (1991) Other information Official Symbol VCAM1 Other Aliases: CD106, INCAM-100 Other Designations: CD106 antigen; vascular cell adhesion protein 1 Antibody Sequences Anti-Integrin at/136 RHAB6.2 QVQLVQSGSELKKPGASVKISCKASGFAFTDSYMHVVVRQAPGQGLEWMGWIDPENGDTE
YAPKFQGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCTRGTPTAVPNLRGDLQVLAQKVAG
PYPFDYWGQGTLVTVSS
RHCB6.2 QVQLVQSGAEVKKPGASVKVSCKASGYTFIDSYMHVVVRQAPGQRLEWMGWIDPENGDTE
YAPKFQGRVTITTDTSASTAYMELSSLRSEDTAVYYCARGTPTAVPNLRGDLQVLAQKVAG
PYPFDYWGQGTLVTVSS
RHF
QVQLVQSGAEVKKPGASVKVSCKASGFNFIDSYMHVVVRQAPGQRLEWMGWIDPENGDT
EYAPKFQGRVTFTTDTSASTAYMELSSLRSEDTAVYYCNEGTPTGPYYFDYWGQGTLVTV
SS
QVQLVQSGAEVKKPGASVKVSCKASGFNFIDSYMHVVVRQAPGQRLEWMGWIDPENGDT
EYAPKFQGRVTFTTDTSASTAYMELSSLRSEDTAVYYCNEGTPTAVPNLRGDLQVLAQKVA
GPYYFDYWGQGTLVTVSS
RHAY100bP
QVQLVQSGSELKKPGASVKISCKASGFAFTDSYMHVVVRQAPGQGLEWMGWIDPENGDTE
YAPKFQGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCTRGTPTGPYPFDYWGQGTLVTVSS
RKF
ENVLTQSPGTLSLSPGERATLSCSASSSVSYMHWFQQKPGQAPRLLIYSTSNLASGIPDRF
SGSGSGTDFTLTISRLEPEDFAVYYCQQRSSYPLTFGGGTKVEIK
ENVLTQSPGTLSLSPGERATLSCSASSSVSYMHWLQQKPGQAPRLLIYLTSNLASGIPDRF
SGSGSGTDFTLTISRLEPEDFAVYYCQQRSSYPLTFGGGTKVEIK
RKC
EIVLTQSPGTLSLSPGERATLSCSASSSVSYMHWFQQKPGQAPRLLIYSTSNLASGIPDRFS
GSGSGTDFTLTISRLEPEDFAVYYCQQRSSYPLTFGGGTKVEIK
Anti-CD33 CD33 Hum195 VH
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYN M HVVVRQAPGQG LEWIGYIYPYN GGTG
YNQKFKSKATITADESTNTAYMELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTVSS
CD33 Hum195 VK
DIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYAASNQGSG
VPSRFSGSGSGTDFTLTISSLQP DDFATYYCQQSKEVPWTFGQGTKVEI K
Anti-CD19 CD19 B4 resurfaced VH
QVQLVQPGAEVVKPGASVKLSCKTSGYTFTSNWMHVVVKQRPGQGLEWIGEIDPSDSYTN
YNQNFKGKAKLTVDKSTSTAYMEVSSLRSDDTAVYYCARGSNPYYYAMDYWGQGTSVTV
SS
CD19 B4 resurfaced VK
EIVLTQSPAIMSASPGERVTMTCSASSGVNYMHVVYQQKPGTSPRRWIYDTSKLASGVPAR
FSGSGSGTSYSLTISSMEPEDAATYYCHQRGSYTFGGGTKLEIK
Anti-Her2 Herceptin VH chain EVQLVESGGGLVQPGGSLRLSCAASGFN I KDTYI HVVVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVS
S
Herceptin VL chain DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAVVYQQKPGKAPKWYSASFLYSGVPSR
FSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIK
Anti-CD25 Simulect VK (also known as Basiliximab) QIVSTQSPAIMSASPGEKVTMTCSASSSRSYMQVVYQQKPGTSPKRWIYDTSKLASGVPAR
FSGSGSGTSYSLTISSMEAEDAATYYCHQRSSYTFGGGTKLEI K
Simulect VH
QLQQSGTVLARPGASVKMSCKASGYSFTRYWMHWI KQRPGQG LEWIGAIYPG NS DTSYN
QKFEGKAKLTAVTSASTAYMELSSLTHEDSAVYYCSRDYGYYFDFWGQGTTLTVSS
Anti-PSMA
Deimmunised VH1 EVQLVQSGPEVKKPGATVKISCKTSGYTFTEYTIHVVVKQAPGKGLEWIGNINPNNGGTTYN
QKFEDKATLTVDKSTDTAYMELSSLRSEDTAVYYCAAGWNFDYWGQGTLLTVSS
Deimmunised VK 1 DIQMTQSPSSLSTSVGDRVTLTCKASQDVGTAVDWYQQKPGPSPKLLIYWASTRHTGIPSR
FSGSGSGTDFTLTISSLQPEDFADYYCQQYNSYPLTFGPGTKVDIK
Deimmunised VH1 '5 EVKLVESGGGLVQPGGSMKLSCVASGFTFSNYWMNVVVRQAPGKGLEVVVAEIRSQSNNF
ATHYAESVKGRVTISRDDSKSIVYLQMNNLRAEDTGVYYCTRRWNNFWGQGTTVTVSS
Deimmunised VH2 '5 EVKLVESGGGLVQPGGSLKLSCVASGFTFSNYWMNWVRQAPGKGLEVVVAEIRSQSNNFA
THYAESVKGRVTISRDDSKSIVYLQMNNLRAEDTAVYYCTRRWNNFWGQGTTVTVSS
Deimmunised VH3 '5 EVQLVESGGGLVQPGGSLKLSCVASGFTFSNYWMNVVVRQAPGKGLEVVVAEIRSQSNNFA
THYAESVKGRVTISRDDSKSIVYLQMNNLRAEDTAVYYCTRRWNNFWGQGTTVTVSS
Deimmunised VH4 '5 EVQLVESGGGLVQPGGSLKLSCVASGFTFSNYWMNVVVRQAPGKGLEVVVAEIRSQSNNFA
THYAESVKGRFTISRDDSKSIVYLQMNNLRAEDTAVYYCTRRWNNFWGQGTTVTVSS
Deimmunised VK1 '5 NIVMTQFPSSMSASVGDRVTITCKASENVGTYVSWYQQKPDQSPKMLIYGASNRFTGVPD
RFTGSGSATDFTLTISSLQTEDLADYYCGQSYTFPYTFGQGTKLEMK
Deimmunised VK2 '5 NIVMTQFPSSMSASVGDRVTITCKASENVGTYVSWYQQKPDQSPKMLIYGASNRFTGVPD
RFSGSGSGTDFTLTISSLQAEDLADYYCGQSYTFPYTFGQGTKLEIK
Deimmunised VK3 '5 NIQMTQFPSAMSASVGDRVTITCKASENVGTYVSWYQQKPDQSPKMLIYGASNRFTGVPD
RFSGSGSGTDFTLTISSLQAEDLADYYCGQSYTFPYTFGQGTKLEIK
Deimmunised VK4 '5 NIQMTQFPSAMSASVGDRVTITCKASENVGTYVSWYQQKPDQSPKMLIYGASNRFTGVPD
RFSGSGSGTDFTLTISSLQAEDEADYYCGQSYTFPYTFGQGTKLEIK
Deimmunised VK DI '5 NIVMTQFPKSMSASAGERMTLTCKASENVGTYVSWYQQKPTQSPKMLIYGASNRFTGVPD
RFSGSGSGTDFILTISSVQAEDLVDYYCGQSYTFPYTFGGGTKLEMK
Deimmunised VH DI '5 EVKLEESGGGLVQPGGSMKISCVASGFTFSNYWMNWVRQSPEKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKSSVYLQMNSLRAEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHA '5 EVQLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVGEIRSQSNNFA
THYAESVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHB '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKNTVYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHC '5 EVQLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNVVVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKNTVYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHD '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNVVVRQASGKGLEVVVGEIRSQSNNFA
THYAESVKGRVIISRDDSKNTVYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHE '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRFTISRDDSKNTVYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHF '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKNTAYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHG '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKNTAYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RKA '5 DIQMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKWYGASNRFTGVPSR
FSGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKB '5 DIQMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKWYGASNRFTGVPSR
FSGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKC '5 DIQMTQSPSSVSASVGDRVTITCKASENVGTYVSWYQQKPGTAPKMLIYGASNRFTGVPS
RFSGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKD '5 DIQMTQSPSSVSASVGDRVTITCKASENVGTYVSWYQQKPGTAPKMLIYGASNRFTGVPS
RFSGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKE '5 NIVMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKWYGASNRFTGVPDR
FTGSGSATDFILTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKF '5 NIVMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKMLIYGASNRFTGVPSR
FSGSGSATDFILTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKG '5 NIVMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKMLIYGASNRFTGVPDR
FTGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
The parent antibody may also be a fusion protein comprising an albumin-binding peptide (ABP) sequence (Dennis et al. (2002) "Albumin Binding As A General Strategy For Improving The Pharmacokinetics Of Proteins" J Biol Chem. 277:35035-35043; WO
01/45746). Antibodies of the invention include fusion proteins with ABP
sequences taught by: (i) Dennis et al (2002) J Biol Chem. 277:35035-35043 at Tables III and IV, page 35038;
(ii) US 2004/0001827 at [0076]; and (iii) WO 01/45746 at pages 12-13, and all of which are incorporated herein by reference.
In one embodiment, the antibody has been raised to target specific the tumour related antigen av[36.
The cell binding agent may be labelled, for example to aid detection or purification of the agent either prior to incorporation as a conjugate, or as part of the conjugate. The label may be a biotin label. In another embodiment, the cell binding agent may be labelled with a radioisotope.
Embodiments of the present invention include ConjA wherein the cell binding agent is selected from an antibody to any of the antigens discussed above.
Embodiments of the present invention include ConjB wherein the cell binding agent is selected from an antibody to any of the antigens discussed above.
Embodiments of the present invention include ConjA wherein the cell binding agent is selected from any of the antibodies discussed above.
Embodiments of the present invention include ConjB wherein the cell binding agent is selected from any of the antibodies discussed above.
The present invention may also relate to conjugates where the cell binding agent is selected from an antibody to any of the antigens discussed above and any of the antibodies discussed above linked to different drugs.
Drug loading The drug loading is the average number of PBD drugs per cell binding agent, e.g. antibody.
Where the compounds of the invention are bound to cysteines, drug loading may range from 1 to 8 drugs (D) per cell binding agent, i.e. where 1, 2, 3, 4, 5, 6, 7, and 8 drug moieties are covalently attached to the cell binding agent. Compositions of conjgates include collections of cell binding agents, e.g. antibodies, conjugated with a range of drugs, from 1 to 8.
Where the compounds of the invention are bound to lysines, drug loading may range from 1 to 80 drugs (D) per cell binding agent, although an upper limit of 40, 20, 10 or 8 may be preferred. Compositions of conjgates include collections of cell binding agents, e.g.
antibodies, conjugated with a range of drugs, from 1 to 80, 1 to 40, 1 to 20, 1 to 10 or 1 to 8.
The average number of drugs per antibody in preparations of ADC from conjugation reactions may be characterized by conventional means such as UV, reverse phase HPLC, HIC, mass spectroscopy, ELISA assay, and electrophoresis. The quantitative distribution of ADC in terms of p may also be determined. By ELISA, the averaged value of p in a particular preparation of ADC may be determined (Hamblett et al (2004) Clin.
Cancer Res.
10:7063-7070; Sanderson et al (2005) Clin. Cancer Res. 11:843-852). However, the distribution of p (drug) values is not discernible by the antibody-antigen binding and detection limitation of ELISA. Also, ELISA assay for detection of antibody-drug conjugates does not determine where the drug moieties are attached to the antibody, such as the heavy chain or light chain fragments, or the particular amino acid residues. In some instances, separation, purification, and characterization of homogeneous ADC where p is a certain value from ADC with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis. Such techniques are also applicable to other types of conjugates.
For some antibody-drug conjugates, p may be limited by the number of attachment sites on the antibody. For example, an antibody may have only one or several cysteine thiol groups, or may have only one or several sufficiently reactive thiol groups through which a linker may be attached. Higher drug loading, e.g. p >5, may cause aggregation, insolubility, toxicity, or loss of cellular permeability of certain antibody-drug conjugates.
Typically, fewer than the theoretical maximum of drug moieties are conjugated to an antibody during a conjugation reaction. An antibody may contain, for example, many lysine residues that do not react with the drug-linker intermediate (D-L) or linker reagent. Only the most reactive lysine groups may react with an amine-reactive linker reagent.
Also, only the most reactive cysteine thiol groups may react with a thiol-reactive linker reagent. Generally, antibodies do not contain many, if any, free and reactive cysteine thiol groups which may be linked to a drug moiety. Most cysteine thiol residues in the antibodies of the compounds exist as disulfide bridges and must be reduced with a reducing agent such as dithiothreitol (DTT) or TCEP, under partial or total reducing conditions. The loading (drug/antibody ratio) of an ADC may be controlled in several different manners, including: (i) limiting the molar excess of drug-linker intermediate (D-L) or linker reagent relative to antibody, (ii) limiting the conjugation reaction time or temperature, and (iii) partial or limiting reductive conditions for cysteine thiol modification.
Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges. Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol). Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol. Reactive thiol groups may be introduced into the antibody (or fragment thereof) by engineering one, two, three, four, or more cysteine residues (e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues). US
7521541 teaches engineering antibodies by introduction of reactive cysteine amino acids.
Cysteine amino acids may be engineered at reactive sites in an antibody and which do not form intrachain or intermolecular disulfide linkages (Junutula, et al., 2008b Nature Biotech., 26(8):925-932; Dornan et al (2009) Blood 114(13):2721-2729; US 7521541; US
7723485;
W02009/052249). The engineered cysteine thiols may react with linker reagents or the drug-linker reagents of the present invention which have thiol-reactive, electrophilic groups such as maleimide or alpha-halo amides to form ADC with cysteine engineered antibodies and the PBD drug moieties. The location of the drug moiety can thus be designed, controlled, and known. The drug loading can be controlled since the engineered cysteine thiol groups typically react with thiol-reactive linker reagents or drug-linker reagents in high yield. Engineering an IgG antibody to introduce a cysteine amino acid by substitution at a single site on the heavy or light chain gives two new cysteines on the symmetrical antibody.
A drug loading near 2 can be achieved with near homogeneity of the conjugation product ADC.
Where more than one nucleophilic or electrophilic group of the antibody reacts with a drug-linker intermediate, or linker reagent followed by drug moiety reagent, then the resulting product is a mixture of ADC compounds with a distribution of drug moieties attached to an antibody, e.g. 1, 2, 3, etc. Liquid chromatography methods such as polymeric reverse phase (PLRP) and hydrophobic interaction (HIC) may separate compounds in the mixture by drug loading value. Preparations of ADC with a single drug loading value (p) may be isolated, however, these single loading value ADCs may still be heterogeneous mixtures because the drug moieties may be attached, via the linker, at different sites on the antibody.
Thus the antibody-drug conjugate compositions of the invention include mixtures of antibody-drug conjugate compounds where the antibody has one or more PBD drug moieties and where the drug moieties may be attached to the antibody at various amino acid residues.
In one embodiment, the average number of dimer pyrrolobenzodiazepine groups per cell binding agent is in the range 1 to 20. In some embodiments the range is selected from 1 to 8, 2 to 8, 2 to 6, 2 to 4, and 4 to 8.
In some embodiments, there is one dimer pyrrolobenzodiazepine group per cell binding agent.
Preferred Compounds Particularly preferred compounds of the second aspect of the present invention include:
ff.N ifith C) 0 IW
H
NN
N OMe (0 IW
Particularly preferred compounds of the second aspect of the present invention include:
ONN
H
N
N{
Particularly preferred compounds of the third aspect of the present invention include:
4111113" OMe 0 IW
25 j) Substituents The phrase "optionally substituted" as used herein, pertains to a parent group which may be unsubstituted or which may be substituted.
Unless otherwise specified, the term "substituted" as used herein, pertains to a parent group which bears one or more substituents. The term "substituent" is used herein in the conventional sense and refers to a chemical moiety which is covalently attached to, or if appropriate, fused to, a parent group. A wide variety of substituents are well known, and methods for their formation and introduction into a variety of parent groups are also well known.
In a preferred embodiment, the substituents described herein (which include optional substituents) are limited to those groups that are not reactive to a cell binding agent. The link to the cell binding agent in the present case is formed from the bridge between the two PBD moieties through a linker group to the cell binding agent. Reactive functional groups located at other parts of the PBD structure may be capable of forming additional bonds to the cell binding agent (this may be referred to as crosslinking). These additional bonds may alter transport and biological activity of the conjugate. Therefore, in some embodiment, the additional substituents are limited to those lacking reactive functionality.
In one embodiment, the substituents are selected from the group consisting of R, OR, SR, NRR', NO2, halo, CO2R, COR, CONH2, CONHR, and CONRR'.
In one embodiment, the substituents are selected from the group consisting of R, OR, SR, NRR', NO2, CO2R, COR, CONH2, CONHR, and CONRR'.
In one embodiment, the substituents are selected from the group consisting of R, OR, SR, NRR', NO2, and halo.
In one embodiment, the substituents are selected from the group consisting of R, OR, SR, NRR', and NO2.
Any one of the embodiment mentioned above may be applied to any one of the substituents described herein. Alternatively, the substituents may be selected from one or more of the groups listed below.
Examples of substituents are described in more detail below.
C1-12 alkyl: The term "C1_12 alkyl" as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of a hydrocarbon compound having from 1 to 12 carbon atoms, which may be aliphatic or alicyclic, and which may be saturated or unsaturated (e.g. partially unsaturated, fully unsaturated). Thus, the term "alkyl" includes the sub-classes alkenyl, alkynyl, cycloalkyl, etc., discussed below.
Examples of saturated alkyl groups include, but are not limited to, methyl (C1), ethyl (C2), propyl (C3), butyl (C4), pentyl (C5), hexyl (C6) and heptyl (C7).
Examples of saturated linear alkyl groups include, but are not limited to, methyl (C1), ethyl (C2), n-propyl (C3), n-butyl (C4), n-pentyl (amyl) (C5), n-hexyl (C6) and n-heptyl (C7).
Examples of saturated branched alkyl groups include iso-propyl (C3), iso-butyl (C4), sec-butyl (C4), tert-butyl (C4), iso-pentyl (C5), and neo-pentyl (C5).
An alkyl group may optionally be interrupted by one or more heteroatoms selected from 0, N(H) and S. Such groups may be referred to as "heteroalkyl".
C2_12 Heteroalkyl: The term "C2-12 heteroalkyl" as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of a hydrocarbon compound having from 2 to 12 carbon atoms, and one or more heteroatoms selected from 0, N(H) and S, preferably 0 and S.
Examples of heteroalkyl groups include, but are not limited to those comprising one or more ethylene glycol units of the type -(OCH2CH2)-. The terminal of a heteroalkyl group may be the primary form of a heteroatom, e.g. -OH, -SH or -NH2. In a preferred embodiment, the terminal is -CH3.
C2_12 Alkenyl: The term "C2-12 alkenyl" as used herein, pertains to an alkyl group having one or more carbon-carbon double bonds.
Examples of unsaturated alkenyl groups include, but are not limited to, ethenyl (vinyl, -CH=CH2), 1-propenyl (-CH=CH-CH3), 2-propenyl (allyl, -CH-CH=CH2), isopropenyl (1-methylvinyl, -C(CH3)=CH2), butenyl (C4), pentenyl (C5), and hexenyl (CO.
C2-12 alkynyl: The term "C2-12 alkynyl" as used herein, pertains to an alkyl group having one or more carbon-carbon triple bonds.
Examples of unsaturated alkynyl groups include, but are not limited to, ethynyl (-CECH) and 2-propynyl (propargyl, -CH2-CECH).
C3_12 cycloalkyl: The term "C3_12 cycloalkyl" as used herein, pertains to an alkyl group which is also a cyclyl group; that is, a monovalent moiety obtained by removing a hydrogen atom from an alicyclic ring atom of a cyclic hydrocarbon (carbocyclic) compound, which moiety has from 3 to 7 carbon atoms, including from 3 to 7 ring atoms.
Examples of cycloalkyl groups include, but are not limited to, those derived from:
saturated monocyclic hydrocarbon compounds:
cyclopropane (C3), cyclobutane (C4), cyclopentane (C5), cyclohexane (C6), cycloheptane (C7), methylcyclopropane (C4), dimethylcyclopropane (C5), methylcyclobutane (C5), dimethylcyclobutane (C6), methylcyclopentane (C6), dimethylcyclopentane (C7) and methylcyclohexane (C7);
unsaturated monocyclic hydrocarbon compounds:
cyclopropene (C3), cyclobutene (C4), cyclopentene (C5), cyclohexene (C6), methylcyclopropene (C4), dimethylcyclopropene (C5), methylcyclobutene (C5), dimethylcyclobutene (C6), methylcyclopentene (C6), dimethylcyclopentene (C7) and methylcyclohexene (C7); and saturated polycyclic hydrocarbon compounds:
norcarane (C7), norpinane (C7), norbornane (C7).
C3_20 heterocyclyl: The term "C3_20 heterocycly1" as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from a ring atom of a heterocyclic compound, which moiety has from 3 to 20 ring atoms, of which from 1 to 10 are ring heteroatoms.
Preferably, each ring has from 3 to 7 ring atoms, of which from 1 to 4 are ring heteroatoms.
In this context, the prefixes (e.g. C3-20, C3-7, C6-6, etc.) denote the number of ring atoms, or range of number of ring atoms, whether carbon atoms or heteroatoms. For example, the term "C5_6heterocycly1", as used herein, pertains to a heterocyclyl group having 5 or 6 ring atoms.
Examples of monocyclic heterocyclyl groups include, but are not limited to, those derived from:
N1: aziridine (C3), azetidine (C4), pyrrolidine (tetrahydropyrrole) (C5), pyrroline (e.g., 3-pyrroline, 2,5-dihydropyrrole) (C5), 2H-pyrrole or 3H-pyrrole (isopyrrole, isoazole) (C5), piperidine (C6), dihydropyridine (C6), tetrahydropyridine (C6), azepine (C7);
01: oxirane (C3), oxetane (C4), oxolane (tetranydrofuran) (C5), oxole (dihydrofuran) (C5), oxane (tetrahydropyran) (C6), dihydropyran (C6), pyran (C6), oxepin (C7);
S1: thiirane (C3), thietane (C4), thiolane (tetrahydrothiophene) (C5), thiane (tetrahydrothiopyran) (C6), thiepane (C7);
02: dioxolane (C5), dioxane (C6), and dioxepane (C7);
03: trioxane (C6);
N2: imidazolidine (C5), pyrazolidine (diazolidine) (C5), imidazoline (C5), pyrazoline (dihydropyrazole) (C5), piperazine (CO;
N101: tetrahydrooxazole (C5), dihydrooxazole (C5), tetrahydroisoxazole (C5), dihydroisoxazole (C5), morpholine (C6), tetrahydrooxazine (C6), dihydrooxazine (C6), oxazine (C6);
NISI: thiazoline (C5), thiazolidine (C5), thiomorpholine (C6);
N201: oxadiazine (C6);
OiSi: oxathiole (C5) and oxathiane (thioxane) (C6); and, N10151: oxathiazine (C6).
Examples of substituted monocyclic heterocyclyl groups include those derived from saccharides, in cyclic form, for example, furanoses (C5), such as arabinofuranose, lyxofuranose, ribofuranose, and xylofuranse, and pyranoses (C6), such as allopyranose, altropyranose, glucopyranose, mannopyranose, gulopyranose, idopyranose, galactopyranose, and talopyranose.
C5-20 aryl: The term "C5_20 aryl", as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound, which moiety has from 3 to 20 ring atoms. Preferably, each ring has from 5 to 7 ring atoms.
In this context, the prefixes (e.g. C3-20, C5-7, C5-6, etc.) denote the number of ring atoms, or range of number of ring atoms, whether carbon atoms or heteroatoms. For example, the term "C5_6 aryl" as used herein, pertains to an aryl group having 5 or 6 ring atoms.
The ring atoms may be all carbon atoms, as in "carboaryl groups".
Examples of carboaryl groups include, but are not limited to, those derived from benzene (i.e. phenyl) (C6), naphthalene (C10), azulene (C10), anthracene (C14), phenanthrene (C14), naphthacene (C10), and pyrene (C16).
Examples of aryl groups which comprise fused rings, at least one of which is an aromatic ring, include, but are not limited to, groups derived from indane (e.g. 2,3-dihydro-1H-indene) (C9), indene (C9), isoindene (C9), tetraline (1,2,3,4-tetrahydronaphthalene (C10), acenaphthene (C12), fluorene (C13), phenalene (C13), acephenanthrene (C15), and aceanthrene (C16).
Alternatively, the ring atoms may include one or more heteroatoms, as in "heteroaryl groups". Examples of monocyclic heteroaryl groups include, but are not limited to, those derived from:
N1: Pyrrole (azole) (Cs), pyridine (azine) (C6);
01: furan (oxole) (Cs);
S1: thiophene (thiole) (C5);
N101: oxazole (C5), isoxazole (C5), isoxazine (C6);
N201: oxadiazole (furazan) (C5);
N301: oxatriazole (C5);
NISI: thiazole (C5), isothiazole (Cs);
N2: imidazole (1,3-diazole) (Cs), pyrazole (1,2-diazole) (Cs), Pyridazine (1,2-diazine) (C6), pyrimidine (1,3-diazine) (C6) (e.g., cytosine, thymine, uracil), pyrazine (1,4-diazine) (C6), N3: triazole (C5), triazine (C6); and, N4: tetrazole (C5).
Examples of heteroaryl which comprise fused rings, include, but are not limited to:
C9 (with 2 fused rings) derived from benzofuran (01), isobenzofuran (01), indole (N1), isoindole (N1), indolizine (N1), indoline (N1), isoindoline (N1), purine (N4) (e.g., adenine, guanine), benzimidazole (N2), indazole (N2), benzoxazole (N101), benzisoxazole (N101), benzodioxole (02), benzofurazan (N201), benzotriazole (N3), benzothiofuran (S1), benzothiazole (NISI), benzothiadiazole (N2S);
C10 (with 2 fused rings) derived from chromene (01), isochromene (01), chroman (01), isochroman (01), benzodioxan (02), quinoline (N1), isoquinoline (N1), quinolizine (N1), benzoxazine (N101), benzodiazine (N2), pyridopyridine (N2), quinoxaline (N2), quinazoline (N2), cinnoline (N2), phthalazine (N2), naphthyridine (N2), pteridine (N4);
Cii (with 2 fused rings) derived from benzodiazepine (N2);
C13 (with 3 fused rings) derived from carbazole (N1), dibenzofuran (01), dibenzothiophene (Si), carboline (N2), perimidine (N2), pyridoindole (N2); and, C14 (with 3 fused rings) derived from acridine (N1), xanthene (01), thioxanthene (Si), oxanthrene (02), phenoxathiin (0151), phenazine (N2), phenoxazine (N101), phenothiazine (N151), thianthrene (S2), phenanthridine (N1), phenanthroline (N2), phenazine (N2).
The above groups, whether alone or part of another substituent, may themselves optionally be substituted with one or more groups selected from themselves and the additional substituents listed below.
Halo: -F, -Cl, -Br, and -I.
Hydroxy: -OH.
Ether: -OR, wherein R is an ether substituent, for example, a C1_7 alkyl group (also referred to as a C1_7 alkoxy group, discussed below), a C3_20 heterocyclyl group (also referred to as a C3_20 heterocyclyloxy group), or a C5_20 aryl group (also referred to as a C5_20 aryloxy group), preferably a C1_7a1ky1 group.
Alkoxy: -OR, wherein R is an alkyl group, for example, a C1-7 alkyl group.
Examples of C1-7 alkoxy groups include, but are not limited to, -0Me (methoxy), -0Et (ethoxy), -0(nPr) (n-propoxy), -0(i Pr) (isopropoxy), -0(n Bu) (n-butoxy), -0(sBu) (sec-butoxy), -0(i Bu) (isobutoxy), and -0(tBu) (tert-butoxy).
Acetal: -CH(0R1)(0R2), wherein R1 and R2 are independently acetal substituents, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5-20 aryl group, preferably a C1-7 alkyl group, or, in the case of a "cyclic" acetal group, R1 and R2, taken together with the two oxygen atoms to which they are attached, and the carbon atoms to which they are attached, form a heterocyclic ring having from 4 to 8 ring atoms. Examples of acetal groups include, but are not limited to, -CH(OMe)2, -CH(OEt)2, and -CH(OMe)(0Et).
Hemiacetal: -CH(OH)(0R1), wherein R1 is a hemiacetal substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of hemiacetal groups include, but are not limited to, -CH(OH)(0Me) and -CH(OH)(0Et).
Ketal: -CR(0R1)(0R2), where R1 and R2 are as defined for acetals, and R is a ketal substituent other than hydrogen, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples ketal groups include, but are not limited to, -C(Me)(0Me)2, -C(Me)(0Et)2, -C(Me)(0Me)(0Et), -C(Et)(0Me)2, -C(Et)(0Et)2, and -C(Et)(0Me)(0Et).
Hemiketal: -CR(OH)(0R1), where R1 is as defined for hemiacetals, and R is a hemiketal substituent other than hydrogen, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples of hemiacetal groups include, but are not limited to, -C(Me)(OH)(0Me), -C(Et)(OH)(0Me), -C(Me)(OH)(0Et), and -C(Et)(OH)(0Et).
Oxo (keto, -one): =O.
Thione (thioketone): =S.
Imino (imine): =NR, wherein R is an imino substituent, for example, hydrogen, C1_7 alkyl group, a C3-20 heterocyclyl group, or a C5_20 aryl group, preferably hydrogen or a C1_7 alkyl group. Examples of ester groups include, but are not limited to, =NH, =NMe, =NEt, and =NPh.
Formyl (carbaldehyde, carboxaldehyde): -C(=0)H.
Acyl (keto): -C(=0)R, wherein R is an acyl substituent, for example, a C1_7 alkyl group (also referred to as C1_7 alkylacyl or C1_7 alkanoyl), a C3_20 heterocyclyl group (also referred to as C3_20 heterocyclylacyl), or a C5_20 aryl group (also referred to as C5_20 arylacyl), preferably a C1-7 alkyl group. Examples of acyl groups include, but are not limited to, -C(=0)CH3 (acetyl), -C(=0)CH2CH3 (propionyl), -C(=0)C(CH3)3 (t-butyry1), and -C(=0)Ph (benzoyl, phenone).
Carboxy (carboxylic acid): -C(=0)0H.
Thiocarboxy (thiocarboxylic acid): -C(=S)SH.
Thiolocarboxy (thiolocarboxylic acid): -C(=O)SH.
Thionocarboxy (thionocarboxylic acid): -C(=S)OH.
lmidic acid: -C(=NH)OH.
Hydroxamic acid: -C(=NOH)OH.
Ester (carboxylate, carboxylic acid ester, oxycarbonyl): -C(=0)0R, wherein R
is an ester substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1-7 alkyl group. Examples of ester groups include, but are not limited to, -C(=0)0CH3, -C(=0)0CH2CH3, -C(=0)0C(CH3)3, and -C(=0)0Ph.
Acyloxy (reverse ester): -0C(=0)R, wherein R is an acyloxy substituent, for example, a C1-7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of acyloxy groups include, but are not limited to, -0C(=0)CH3 (acetoxy), -0C(=0)CH2CH3, -0C(=0)C(CH3)3, -0C(=0)Ph, and -0C(=0)CH2Ph.
Oxycarboyloxy: -0C(=0)0R, wherein R is an ester substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of ester groups include, but are not limited to, -0C(=0)0CH3, -0C(=0)0CH2CH3, -0C(=0)0C(CH3)3, and -0C(=0)0Ph.
Amino: -NR1R2, wherein R1 and R2 are independently amino substituents, for example, hydrogen, a C1_7 alkyl group (also referred to as C1_7 alkylamino or di-C17alkylamino), a C3-20 heterocyclyl group, or a C5_20 aryl group, preferably H or a C1_7 alkyl group, or, in the case of a "cyclic" amino group, R1 and R2, taken together with the nitrogen atom to which they are attached, form a heterocyclic ring having from 4 to 8 ring atoms. Amino groups may be primary (-NH2), secondary (-NHR1), or tertiary (-NHR1R2), and in cationic form, may be quaternary (- NR1R2R3). Examples of amino groups include, but are not limited to, -NH2, -NHCH3, -NHC(CH3)2, -N(CH3)2, -N(CH2CH3)2, and -NHPh. Examples of cyclic amino groups include, but are not limited to, aziridino, azetidino, pyrrolidino, piperidino, piperazino, morpholino, and thiomorpholino.
Amido (carbamoyl, carbamyl, aminocarbonyl, carboxamide): -C(=0)NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of amido groups include, but are not limited to, -C(=0)NH2, -C(=0)NHCH3, -C(=0)N(CH3)2, -C(=0)NHCH2CH3, and -C(=0)N(CH2CH3)2, as well as amido groups in which R1 and R2, together with the nitrogen atom to which they are attached, form a heterocyclic structure as in, for example, piperidinocarbonyl, morpholinocarbonyl, thiomorpholinocarbonyl, and piperazinocarbonyl.
Thioamido (thiocarbamyl): -C(=S)NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of amido groups include, but are not limited to, -C(=S)NH2, -C(=S)NHCH3, -C(=S)N(CH3)2, and -C(=S)NHCH2CH3.
Acylamido (acylamino): -NR1C(=0)R2, wherein R1 is an amide substituent, for example, hydrogen, a C17 alkyl group, a C320 heterocyclyl group, or a C520 aryl group, preferably hydrogen or a C17 alkyl group, and R2 is an acyl substituent, for example, a C17 alkylgroup, a C3_20 heterocyclyl group, or a C5_20ary1 group, preferably hydrogen or a C17 alkyl group.
Examples of acylamide groups include, but are not limited to, -NHC(=0)CH3 , -NHC(=0)CH2CH3, and -NHC(=0)Ph. R1 and R2 may together form a cyclic structure, as in, for example, succinimidyl, maleimidyl, and phthalimidyl:
succininnidyl nnaleinnidyl phthalinnidyl Aminocarbonyloxy: -0C(=0)NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of aminocarbonyloxy groups include, but are not limited to, -0C(=0)NH2, -0C(=0)NHMe, -0C(=0)NMe2, and -0C(=0)NEt2.
Ureido: -N(R1)CONR2R3 wherein R2 and R3 are independently amino substituents, as defined for amino groups, and R1 is a ureido substituent, for example, hydrogen, a C17 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably hydrogen or a C17 alkyl group. Examples of ureido groups include, but are not limited to, -NHCONH2, -NHCONHMe, -NHCONHEt, -NHCONMe2, -NHCONEt2, -NMeCONH2, -NMeCONHMe, -NMeCONHEt, -NMeCONMe2, and -NMeCONEt2.
Guanidino: -NH-C(=NH)NH2.
Tetrazolyl: a five membered aromatic ring having four nitrogen atoms and one carbon atom, H
N,N
II
N....-N
lmino: =NR, wherein R is an imino substituent, for example, for example, hydrogen, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably H
or a Cijalkyl group.
Examples of imino groups include, but are not limited to, =NH, =NMe, and =NEt.
Amidine (amidino): -C(=NR)N R2, wherein each R is an amidine substituent, for example, hydrogen, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably H or a C1_7 alkyl group. Examples of amidine groups include, but are not limited to, -C(=NH)NH2, -C(=NH)NMe2, and -C(=NMe)NMe2.
Nitro: -NO2.
Nitroso: -NO.
Azido: -N3.
Cyano (nitrile, carbonitrile): -CN.
lsocyano: -NC.
Cyanato: -OCN.
lsocyanato: -NCO.
Thiocyano (thiocyanato): -SCN.
lsothiocyano (isothiocyanato): -NCS.
Sulfhydryl (thiol, mercapto): -SH.
Thioether (sulfide): -SR, wherein R is a thioether substituent, for example, a C1_7 alkyl group (also referred to as a Cijalkylthio group), a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1-7 alkyl group. Examples of C1-7 alkylthio groups include, but are not limited to, -SCH3 and -SCH2CH3.
Disulfide: -SS-R, wherein R is a disulfide substituent, for example, a C1-7 alkyl group, a C3-20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group (also referred to herein as C1_7 alkyl disulfide). Examples of C1_7 alkyl disulfide groups include, but are not limited to, -SSCH3 and -SSCH2CH3.
Su!fine (sulfinyl, sulfoxide): -S(=0)R, wherein R is a sulfine substituent, for example, a C1-7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of sulfine groups include, but are not limited to, -S(=0)CH3 and -S(=0)CH2CH3.
Sulfone (sulfonyl): -S(=0)2R, wherein R is a sulfone substituent, for example, a C1-7 alkyl group, a C3-20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group, including, for example, a fluorinated or perfluorinated C1_7 alkyl group. Examples of sulfone groups include, but are not limited to, -S(=0)2CH3 (methanesulfonyl, mesyl), -S(=0)2CF3 (triflyl), -S(=0)2CH2CH3 (esyl), -S(=0)2C4F9 (nonaflyl), -S(=0)2CH2CF3 (tresyl), -S(=0)2CH2CH2NH2 (tauryl), -S(=0)2Ph (phenylsulfonyl, besyl), 4-methylphenylsulfonyl (tosyl), 4-chlorophenylsulfonyl (closyl), 4-bromophenylsulfonyl (brosyl), 4-nitrophenyl (nosyl), 2-naphthalenesulfonate (napsyl), and 5-dimethylamino-naphthalen-1-ylsulfonate (dansyl).
Sulfinic acid (sulfino): -S(=0)0H, -502H.
Sulfonic acid (sulfo): -S(=0)20H, -503H.
Sulfinate (sulfinic acid ester): -S(=0)0R; wherein R is a sulfinate substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of sulfinate groups include, but are not limited to, -S(=0)0CH3 (methoxysulfinyl;
methyl sulfinate) and -S(=0)0CH2CH3 (ethoxysulfinyl; ethyl sulfinate).
Sulfonate (sulfonic acid ester): -S(=0)20R, wherein R is a sulfonate substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples of sulfonate groups include, but are not limited to, -S(=0)20CH3 (methoxysulfonyl; methyl sulfonate) and -S(=0)20CH2CH3 (ethoxysulfonyl; ethyl sulfonate).
Sulfinyloxy: -0S(=0)R, wherein R is a sulfinyloxy substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples of sulfinyloxy groups include, but are not limited to, -0S(=0)CH3 and -0S(=0)CH2CH3.
Sulfonyloxy: -0S(=0)2R, wherein R is a sulfonyloxy substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of sulfonyloxy groups include, but are not limited to, -0S(=0)2CH3 (mesylate) and -0S(=0)2CH2CH3 (esylate).
Sulfate: -0S(=0)20R; wherein R is a sulfate substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples of sulfate groups include, but are not limited to, -0S(=0)20CH3 and -S0(=0)20CH2CH3.
Sulfamyl (sulfamoyl; sulfinic acid amide; sulfinamide): -S(=0)NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of sulfamyl groups include, but are not limited to, -S(=0)NH2, -S(=0)NH(CH3), -S(=0)N(CH3)2, -S(=0)NH(CH2CH3), -S(=0)N(CH2CH3)2, and -S(=0)NHPh.
Sulfonamido (sulfinamoyl; sulfonic acid amide; sulfonamide): -S(=0)2NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of sulfonamido groups include, but are not limited to, -S(=0)2NH2, -S(=0)2NH(CH3), -S(=0)2N(CH3)2, -S(=0)2NH(CH2CH3), -S(=0)2N(CH2CH3)2, and -S(=0)2NHPh.
Sulfamino: -NR1S(=0)20H, wherein R1 is an amino substituent, as defined for amino groups.
Examples of sulfamino groups include, but are not limited to, -NHS(=0)20H and -N(CH3)S(=0)20H.
Sulfonamino: -NR1S(=0)2R, wherein R1 is an amino substituent, as defined for amino groups, and R is a sulfonamino substituent, for example, a C1-7 alkyl group, a heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of sulfonamino groups include, but are not limited to, -NHS(=0)2CH3 and -N(CH3)S(=0)2C6H5.
Sulfinamino: -NR1S(=0)R, wherein R1 is an amino substituent, as defined for amino groups, and R is a sulfinamino substituent, for example, a C1_7 alkyl group, a c3_20 heterocyclyl group, or a c5-20 aryl group, preferably a C1-7 alkyl group. Examples of sulfinamino groups include, but are not limited to, -NHS(=0)CH3 and -N(CH3)S(=0)C6H5.
Phosphino (phosphine): -PR2, wherein R is a phosphino substituent, for example, -H, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphino groups include, but are not limited to, -PH2, -P(CH3)2, -P(CH2CH3)2, -P(t-Bu)2, and -P(Ph)2.
Phospho: -P(=0)2.
Phosphinyl (phosphine oxide): -P(=0)R2, wherein R is a phosphinyl substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group or a C5_20 aryl group. Examples of phosphinyl groups include, but are not limited to, -P(=0)(CH3)2, -P(=0)(CH2CH3)2, -P(=0)(t-Bu)2, and -P(=0)(Ph)2.
Phosphonic acid (phosphono): -P(=0)(OH)2.
Phosphonate (phosphono ester): -P(=0)(0R)2, where R is a phosphonate substituent, for example, -H, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphonate groups include, but are not limited to, -P(=0)(OCH3)2, -P(=0)(OCH2CH3)2, -P(=0)(0-t-Bu)2, and -P(=0)(OPh)2.
Phosphoric acid (phosphonooxy): -0P(=0)(OH)2.
Phosphate (phosphonooxy ester): -0P(=0)(0R)2, where R is a phosphate substituent, for example, -H, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphate groups include, but are not limited to, -0P(=0)(OCH3)2, -0P(=0)(OCH2CH3)2, -0P(=0)(0-t-Bu)2, and -0P(=0)(0Ph)2.
Phosphorous acid: -0P(OH)2.
Phosphite: -0P(OR)2, where R is a phosphite substituent, for example, -H, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphite groups include, but are not limited to, -0P(OCH3)2, -0P(OCH2CH3)2, -0P(0-t-Bu)2, and -0P(OP11)2.
Phosphoramidite: -0P(0R1)-NR22, where R1 and R2 are phosphoramidite substituents, for example, -H, a (optionally substituted) C1_7 alkyl group, a C3-20 heterocyclyl group, or a C5-20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphoramidite groups include, but are not limited to, -0P(OCH2CH3)-N(CH3)2, -0P(OCH2CH3)-N(i-Pr)2, and -0P(OCH2CH2CN)-N(i-Pr)2.
Phosphoramidate: -0P(=0)(0R1)-NR22, where R1 and R2 are phosphoramidate substituents, for example, -H, a (optionally substituted) C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group.
Examples of phosphoramidate groups include, but are not limited to, -0P(=0)(OCH2CH3)-N(CH3)2, -0P(=0)(OCH2CH3)-N(i-Pr)2, and -0P(=0)(OCH2CH2CN)-N(i-Pr)2.
Alkylene C3_12 alkylene: The term "C3_12 alkylene", as used herein, pertains to a bidentate moiety obtained by removing two hydrogen atoms, either both from the same carbon atom, or one from each of two different carbon atoms, of a hydrocarbon compound having from 3 to 12 carbon atoms (unless otherwise specified), which may be aliphatic or alicyclic, and which may be saturated, partially unsaturated, or fully unsaturated. Thus, the term "alkylene"
includes the sub-classes alkenylene, alkynylene, cycloalkylene, etc., discussed below.
Examples of linear saturated C3_12 alkylene groups include, but are not limited to, -(CH2)n-where n is an integer from 3 to 12, for example, -CH2CH2CH2- (Propylene), -CH2CH2CH2CH2- (butylene), -CH2CH2CH2CH2CH2- (pentylene) and -CH2CH2CH2CH-2CH2CH2CH2- (heptylene).
Examples of branched saturated C3_12 alkylene groups include, but are not limited to, -CH(CH3)CH2-, -CH(CH3)CH2CH2-, -CH(CH3)CH2CH2CH2-, -CH2CH(CH3)CH2-, -CH2CH(CH3)CH2CH2-, -CH(CH2CH3)-, -CH(CH2CH3)CH2-, and -CH2CH(CH2CH3)CH2-=
Examples of linear partially unsaturated C3_12 alkylene groups (C3_12 alkenylene, and alkynylene groups) include, but are not limited to, -CH=CH-CH2-, -CH2-CH=CH2-, -CH=CH-CH2-CH2-, -CH=CH-CH2-CH2-CH2-, -CH=CH-CH=CH-, -CH=CH-CH=CH-CH2-, -CH=CH-CH=CH-CH2-CH2-, -CH=CH-CH2-CH=CH-, -CH=CH-CH2-CH2-CH=CH-, and -CH2-CEC-CH2-.
Examples of branched partially unsaturated C3_12 alkylene groups (C3_12alkenylene and alkynylene groups) include, but are not limited to, -C(CH3)=CH-, -C(CH3)=CH-CH2-, -CH=CH-CH(CH3)- and -CEC-CH(CH3)-.
Examples of alicyclic saturated C3_12 alkylene groups (C3_12 cycloalkylenes) include, but are not limited to, cyclopentylene (e.g. cyclopent-1,3-ylene), and cyclohexylene (e.g. cyclohex-1,4-ylene).
Examples of alicyclic partially unsaturated C3_12 alkylene groups (C3_12 cycloalkylenes) include, but are not limited to, cyclopentenylene (e.g. 4-cyclopenten-1,3-ylene), cyclohexenylene (e.g. 2-cyclohexen-1,4-ylene; 3-cyclohexen-1,2-ylene; 2,5-cyclohexadien-1,4-ylene).
Includes Other Forms Unless otherwise specified, included in the above are the well known ionic, salt, solvate, and protected forms of these substituents. For example, a reference to carboxylic acid (-COOH) also includes the anionic (carboxylate) form (-000-), a salt or solvate thereof, as well as conventional protected forms. Similarly, a reference to an amino group includes the protonated form (-N HR1R2), a salt or solvate of the amino group, for example, a hydrochloride salt, as well as conventional protected forms of an amino group.
Similarly, a reference to a hydroxyl group also includes the anionic form (-C), a salt or solvate thereof, as well as conventional protected forms.
Salts It may be convenient or desirable to prepare, purify, and/or handle a corresponding salt of the active compound, for example, a pharmaceutically-acceptable salt. Examples of pharmaceutically acceptable salts are discussed in Berge, et al., J. Pharm.
Sci., 66, 1-19 (1977).
For example, if the compound is anionic, or has a functional group which may be anionic (e.g. -COOH may be -000-), then a salt may be formed with a suitable cation.
Examples of suitable inorganic cations include, but are not limited to, alkali metal ions such as Na + and K , alkaline earth cations such as Ca2+ and Mg2 , and other cations such as A1+3. Examples of suitable organic cations include, but are not limited to, ammonium ion (i.e. NH4) and substituted ammonium ions (e.g. NH3R+, NH2R2+, NHR3+, NR4+). Examples of some suitable substituted ammonium ions are those derived from: ethylamine, diethylamine, dicyclohexylamine, triethylamine, butylamine, ethylenediamine, ethanolamine, diethanolamine, piperazine, benzylamine, phenylbenzylamine, choline, meglumine, and tromethamine, as well as amino acids, such as lysine and arginine. An example of a common quaternary ammonium ion is N(CH3)4 .
If the compound is cationic, or has a functional group which may be cationic (e.g. -NH2 may be -NH3), then a salt may be formed with a suitable anion. Examples of suitable inorganic anions include, but are not limited to, those derived from the following inorganic acids:
hydrochloric, hydrobromic, hydroiodic, sulfuric, sulfurous, nitric, nitrous, phosphoric, and phosphorous.
Examples of suitable organic anions include, but are not limited to, those derived from the following organic acids: 2-acetyoxybenzoic, acetic, ascorbic, aspartic, benzoic, camphorsulfonic, cinnamic, citric, edetic, ethanedisulfonic, ethanesulfonic, fumaric, glucheptonic, gluconic, glutamic, glycolic, hydroxymaleic, hydroxynaphthalene carboxylic, isethionic, lactic, lactobionic, lauric, maleic, malic, methanesulfonic, mucic, oleic, oxalic, palmitic, pamoic, pantothenic, phenylacetic, phenylsulfonic, propionic, pyruvic, salicylic, stearic, succinic, sulfanilic, tartaric, toluenesulfonic, trifluoroacetic acid and valeric.
Examples of suitable polymeric organic anions include, but are not limited to, those derived from the following polymeric acids: tannic acid, carboxymethyl cellulose.
Solvates It may be convenient or desirable to prepare, purify, and/or handle a corresponding solvate of the active compound. The term "solvate" is used herein in the conventional sense to refer to a complex of solute (e.g. active compound, salt of active compound) and solvent. If the solvent is water, the solvate may be conveniently referred to as a hydrate, for example, a mono-hydrate, a di-hydrate, a tri-hydrate, etc.
The invention includes compounds where a solvent adds across the imine bond of the PBD
moiety, which is illustrated below where the solvent is water or an alcohol (RAOH, where RA
is C1_4 alkyl):
ORA
yRX7 I HN R2b X . Ob RAOH y R7 OR6 R"
R2b These forms can be called the carbinolamine and carbinolamine ether forms of the PBD (as described in the section relating to R 1 above). The balance of these equilibria depend on the conditions in which the compounds are found, as well as the nature of the moiety itself.
These particular compounds may be isolated in solid form, for example, by lyophilisation.
Isomers Certain compounds of the invention may exist in one or more particular geometric, optical, enantiomeric, diasteriomeric, epimeric, atropic, stereoisomeric, tautomeric, conformational, or anomeric forms, including but not limited to, cis- and trans-forms; E- and Z-forms; c-, t-, and r- forms; endo- and exo-forms; R-, S-, and meso-forms; D- and L-forms; d-and l-forms;
(+) and (-) forms; keto-, enol-, and enolate-forms; syn- and anti-forms;
synclinal- and anticlinal-forms; a- and [3 -f o rm s ; axial and equatorial forms; boat-, chair-, twist-, envelope-, and halfchair-forms; and combinations thereof, hereinafter collectively referred to as "isomers" (or "isomeric forms").
The term "chiral" refers to molecules which have the property of non-superimposability of the mirror image partner, while the term "achiral" refers to molecules which are superimposable on their mirror image partner.
The term "stereoisomers" refers to compounds which have identical chemical constitution, but differ with regard to the arrangement of the atoms or groups in space.
"Diastereomer" refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, and reactivities. Mixtures of diastereomers may separate under high resolution analytical procedures such as electrophoresis and chromatography.
"Enantiomers" refer to two stereoisomers of a compound which are non-superimposable mirror images of one another.
Stereochemical definitions and conventions used herein generally follow S. P.
Parker, Ed., McGraw-Hill Dictionary of Chemical Terms (1984) McGraw-Hill Book Company, New York;
and Eliel, E. and Wilen, S., "Stereochemistry of Organic Compounds", John Wiley & Sons, Inc., New York, 1994. The compounds of the invention may contain asymmetric or chiral centers, and therefore exist in different stereoisomeric forms. It is intended that all stereoisomeric forms of the compounds of the invention, including but not limited to, diastereomers, enantiomers and atropisomers, as well as mixtures thereof such as racemic mixtures, form part of the present invention. Many organic compounds exist in optically active forms, i.e., they have the ability to rotate the plane of plane-polarized light. In describing an optically active compound, the prefixes D and L, or R and S, are used to denote the absolute configuration of the molecule about its chiral center(s).
The prefixes d and I or (+) and (-) are employed to designate the sign of rotation of plane-polarized light by the compound, with (-) or I meaning that the compound is levorotatory. A
compound prefixed with (+) or d is dextrorotatory. For a given chemical structure, these stereoisomers are identical except that they are mirror images of one another. A specific stereoisomer may also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture. A 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which may occur where there has been no stereoselection or stereospecificity in a chemical reaction or process. The terms "racemic mixture" and "racemate"
refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
Note that, except as discussed below for tautomeric forms, specifically excluded from the term "isomers", as used herein, are structural (or constitutional) isomers (i.e. isomers which differ in the connections between atoms rather than merely by the position of atoms in space). For example, a reference to a methoxy group, -OCH3, is not to be construed as a reference to its structural isomer, a hydroxymethyl group, -CH2OH. Similarly, a reference to ortho-chlorophenyl is not to be construed as a reference to its structural isomer, meta-chlorophenyl. However, a reference to a class of structures may well include structurally isomeric forms falling within that class (e.g. C1_7 alkyl includes n-propyl and iso-propyl; butyl includes n-, iso-, sec-, and tert-butyl; methoxyphenyl includes ortho-, meta-, and para-methoxypheny1).
The above exclusion does not pertain to tautomeric forms, for example, keto-, enol-, and enolate-forms, as in, for example, the following tautomeric pairs: keto/enol (illustrated below), imine/enamine, amide/imino alcohol, amidine/amidine, nitroso/oxime, thioketone/enethiol, N-nitroso/hyroxyazo, and nitro/aci-nitro.
,C) ,OH H+
/C=C\ C=C
\ H / \
+
keto enol enolate The term "tautomer" or "tautomeric form" refers to structural isomers of different energies which are interconvertible via a low energy barrier. For example, proton tautomers (also known as prototropic tautomers) include interconversions via migration of a proton, such as keto-enol and imine-enamine isomerizations. Valence tautomers include interconversions by reorganization of some of the bonding electrons.
Note that specifically included in the term "isomer" are compounds with one or more isotopic substitutions. For example, H may be in any isotopic form, including 1H, 2H
(D), and 3H (T);
C may be in any isotopic form, including 13C, and 14C; 0 may be in any isotopic form, including 160 and 180; and the like.
Examples of isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, and chlorine, such as, but not limited to 2H (deuterium, D), 3H (tritium), 11C, 13C, 14C, 15N, 18F, 31p, 32p, 35s, 36C1, and 1261. Various isotopically labeled compounds of the present invention, for example those into which radioactive isotopes such as 3H, 13C, and 14C are incorporated.
Such isotopically labelled compounds may be useful in metabolic studies, reaction kinetic studies, detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug or substrate tissue distribution assays, or in radioactive treatment of patients. Deuterium labelled or substituted therapeutic compounds of the invention may have improved DMPK (drug metabolism and pharmacokinetics) properties, relating to distribution, metabolism, and excretion (ADME).
Substitution with heavier isotopes such as deuterium may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements. An 18F labeled compound may be useful for PET
or SPECT studies. Isotopically labeled compounds of this invention and prodrugs thereof can generally be prepared by carrying out the procedures disclosed in the schemes or in the examples and preparations described below by substituting a readily available isotopically labeled reagent for a non-isotopically labeled reagent. Further, substitution with heavier isotopes, particularly deuterium (i.e., 2H or D) may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements or an improvement in therapeutic index. It is understood that deuterium in this context is regarded as a substituent. The concentration of such a heavier isotope, specifically deuterium, may be defined by an isotopic enrichment factor. In the compounds of this invention any atom not specifically designated as a particular isotope is meant to represent any stable isotope of that atom.
Unless otherwise specified, a reference to a particular compound includes all such isomeric forms, including (wholly or partially) racemic and other mixtures thereof.
Methods for the preparation (e.g. asymmetric synthesis) and separation (e.g. fractional crystallisation and chromatographic means) of such isomeric forms are either known in the art or are readily obtained by adapting the methods taught herein, or known methods, in a known manner.
Biological Activity In vitro cell proliferation assays Generally, the cytotoxic or cytostatic activity of an antibody-drug conjugate (ADC) is measured by: exposing mammalian cells having receptor proteins, e.g. HER2, to the antibody of the ADC in a cell culture medium; culturing the cells for a period from about 6 hours to about 5 days; and measuring cell viability. Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity, and induction of apoptosis (caspase activation) of an ADC of the invention.
The in vitro potency of antibody-drug conjugates can be measured by a cell proliferation assay. The CellTiter-Glo Luminescent Cell Viability Assay is a commercially available (Promega Corp., Madison, WI), homogeneous assay method based on the recombinant expression of Coleoptera luciferase (US Patent Nos. 5583024; 5674713 and 5700670). This cell proliferation assay determines the number of viable cells in culture based on quantitation of the ATP present, an indicator of metabolically active cells (Crouch et al (1993) J. Immunol.
Meth. 160:81-88; US 6602677). The CellTiter-Gle Assay is conducted in 96 well format, making it amenable to automated high-throughput screening (HTS) (Cree et al (1995) AntiCancer Drugs 6:398-404). The homogeneous assay procedure involves adding the single reagent (CellTiter-Glo Reagent) directly to cells cultured in serum-supplemented medium. Cell washing, removal of medium and multiple pipetting steps are not required. The system detects as few as 15 cells/well in a 384-well format in 10 minutes after adding reagent and mixing. The cells may be treated continuously with ADC, or they may be treated and separated from ADC. Generally, cells treated briefly, i.e. 3 hours, showed the same potency effects as continuously treated cells.
The homogeneous "add-mix-measure" format results in cell lysis and generation of a luminescent signal proportional to the amount of ATP present. The amount of ATP is directly proportional to the number of cells present in culture. The CellTiter-Glo Assay generates a "glow-type" luminescent signal, produced by the luciferase reaction, which has a half-life generally greater than five hours, depending on cell type and medium used.
Viable cells are reflected in relative luminescence units (RLU). The substrate, Beetle Luciferin, is oxidatively decarboxylated by recombinant firefly luciferase with concomitant conversion of ATP to AMP
and generation of photons.
The in vitro potency of antibody-drug conjugates can also be measured by a cytotoxicity assay. Cultured adherent cells are washed with PBS, detached with trypsin, diluted in complete medium, containing 10% FCS, centrifuged, re-suspended in fresh medium and counted with a haemocytometer. Suspension cultures are counted directly.
Monodisperse cell suspensions suitable for counting may require agitation of the suspension by repeated aspiration to break up cell clumps.
The cell suspension is diluted to the desired seeding density and dispensed (100p1 per well) into black 96 well plates. Plates of adherent cell lines are incubated overnight to allow adherence. Suspension cell cultures can be used on the day of seeding.
A stock solution (1mI) of ADC (20pg/m1) is made in the appropriate cell culture medium.
Serial 10-fold dilutions of stock ADC are made in 15ml centrifuge tubes by serially transferring 100pIto 900p1 of cell culture medium.
Four replicate wells of each ADC dilution (100p1) are dispensed in 96-well black plates, previously plated with cell suspension (100p1), resulting in a final volume of 200 pl. Control wells receive cell culture medium (100p1).
If the doubling time of the cell line is greater than 30 hours, ADC incubation is for 5 days, otherwise a four day incubation is done.
At the end of the incubation period, cell viability is assessed with the Alamar blue assay.
AlamarBlue (Invitrogen) is dispensed over the whole plate (20p1 per well) and incubated for 4 hours. Alamar blue fluorescence is measured at excitation 570nm, emission 585nm on the Varioskan flash plate reader. Percentage cell survival is calculated from the mean fluorescence in the ADC treated wells compared to the mean fluorescence in the control wells.
In vivo efficacy The in vivo efficacy of antibody-drug conjugates (ADC) of the invention can be measured by tumor xenograft studies in mice. For example, the in vivo efficacy of an anti-HER2 ADC of the invention can be measured by a high expressing HER2 transgenic explant mouse model.
An allograft is propagated from the Fo5 mmtv transgenic mouse which does not respond to, or responds poorly to, HERCEPTIN therapy. Subjects were treated once with ADC
at certain dose levels (mg/kg) and PBD drug exposure (pg/m2); and placebo buffer control (Vehicle) and monitored over two weeks or more to measure the time to tumor doubling, log cell kill, and tumor shrinkage.
Use The conjugates of the invention may be used to provide a PBD conjugate at a target location.
The target location is preferably a proliferative cell population. The antibody is an antibody for an antigen present in a proliferative cell population.
In one embodiment the antigen is absent or present at a reduced level in a non-proliferative cell population compared to the amount of antigen present in the proliferative cell population, for example a tumour cell population.
The target location may be in vitro, in vivo or ex vivo.
The antibody-drug conjugate (ADC) compounds of the invention include those with utility for anticancer activity. In particular, the compounds include an antibody conjugated, i.e.
covalently attached by a linker, to a PBD moiety.
At the target location the linker may not be cleaved. The antibody-drug conjugate (ADC
compounds of the invention may have a cytotoxic effect without the cleavage of the linker to release a PBD drug moiety. The antibody-drug conjugates (ADC) of the invention selectively deliver cytotoxic agent to tumor tissue whereby greater selectivity, i.e. a lower efficacious dose, may be achieved.
Thus, in one aspect, the present invention provides a conjugate compound as described herein for use in therapy.
In a further aspect there is also provides a conjugate compound as described herein for use in the treatment of a proliferative disease. A second aspect of the present invention provides the use of a conjugate compound in the manufacture of a medicament for treating a proliferative disease.
One of ordinary skill in the art is readily able to determine whether or not a candidate conjugate treats a proliferative condition for any particular cell type. For example, assays which may conveniently be used to assess the activity offered by a particular compound are described in the examples below.
The term "proliferative disease" pertains to an unwanted or uncontrolled cellular proliferation of excessive or abnormal cells which is undesired, such as, neoplastic or hyperplastic growth, whether in vitro or in vivo.
Examples of proliferative conditions include, but are not limited to, benign, pre-malignant, and malignant cellular proliferation, including but not limited to, neoplasms and tumours (e.g.
histocytoma, glioma, astrocyoma, osteoma), cancers (e.g. lung cancer, small cell lung cancer, gastrointestinal cancer, bowel cancer, colon cancer, breast carinoma, ovarian carcinoma, prostate cancer, testicular cancer, liver cancer, kidney cancer, bladder cancer, pancreas cancer, brain cancer, sarcoma, osteosarcoma, Kaposi's sarcoma, melanoma), leukemias, psoriasis, bone diseases, fibroproliferative disorders (e.g. of connective tissues), and atherosclerosis. Cancers of particular interest include, but are not limited to, leukemias and ovarian cancers.
Any type of cell may be treated, including but not limited to, lung, gastrointestinal (including, e.g. bowel, colon), breast (mammary), ovarian, prostate, liver (hepatic), kidney (renal), bladder, pancreas, brain, and skin.
In one embodiment, the treatment is of a pancreatic cancer.
In one embodiment, the treatment is of a tumour having av[36 integrin on the surface of the cell.
It is contemplated that the antibody-drug conjugates (ADC) of the present invention may be used to treat various diseases or disorders, e.g. characterized by the overexpression of a tumor antigen. Exemplary conditions or hyperproliferative disorders include benign or malignant tumors; leukemia, haematological, and lymphoid malignancies. Others include neuronal, glial, astrocytal, hypothalamic, glandular, macrophagal, epithelial, stromal, blastocoelic, inflammatory, angiogenic and immunologic, including autoimmune, disorders.
Generally, the disease or disorder to be treated is a hyperproliferative disease such as cancer. Examples of cancer to be treated herein include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g. epithelial squamous cell cancer), lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
Autoimmune diseases for which the ADC compounds may be used in treatment include rheumatologic disorders (such as, for example, rheumatoid arthritis, Sjogren's syndrome, scleroderma, lupus such as SLE and lupus nephritis, polymyositis/dermatomyositis, cryoglobulinemia, anti-phospholipid antibody syndrome, and psoriatic arthritis), osteoarthritis, autoimmune gastrointestinal and liver disorders (such as, for example, inflammatory bowel diseases (e.g. ulcerative colitis and Crohn's disease), autoimmune gastritis and pernicious anemia, autoimmune hepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, and celiac disease), vasculitis (such as, for example, ANCA-associated vasculitis, including Churg-Strauss vasculitis, Wegener's granulomatosis, and polyarteriitis), autoimmune neurological disorders (such as, for example, multiple sclerosis, opsoclonus myoclonus syndrome, myasthenia gravis, neuromyelitis optica, Parkinson's disease, Alzheimer's disease, and autoimmune polyneuropathies), renal disorders (such as, for example, glomerulonephritis, Goodpasture's syndrome, and Berger's disease), autoimmune dermatologic disorders (such as, for example, psoriasis, urticaria, hives, pemphigus vulgaris, bullous pemphigoid, and cutaneous lupus erythematosus), hematologic disorders (such as, for example, thrombocytopenic purpura, thrombotic thrombocytopenic purpura, post-transfusion purpura, and autoimmune hemolytic anemia), atherosclerosis, uveitis, autoimmune hearing diseases (such as, for example, inner ear disease and hearing loss), Behcet's disease, Raynaud's syndrome, organ transplant, and autoimmune endocrine disorders (such as, for example, diabetic-related autoimmune diseases such as insulin-dependent diabetes mellitus (IDDM), Addison's disease, and autoimmune thyroid disease (e.g. Graves' disease and thyroiditis)). More preferred such diseases include, for example, rheumatoid arthritis, ulcerative colitis, ANCA-associated vasculitis, lupus, multiple sclerosis, Sjogren's syndrome, Graves' disease, IDDM, pernicious anemia, thyroiditis, and glomerulonephritis.
Methods of Treatment The conjugates of the present invention may be used in a method of therapy.
Also provided is a method of treatment, comprising administering to a subject in need of treatment a therapeutically-effective amount of a conjugate compound of the invention. The term "therapeutically effective amount" is an amount sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage, is within the responsibility of general practitioners and other medical doctors.
A compound of the invention may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
Examples of treatments and therapies include, but are not limited to, chemotherapy (the administration of active agents, including, e.g. drugs, such as chemotherapeutics); surgery;
and radiation therapy.
A "chemotherapeutic agent" is a chemical compound useful in the treatment of cancer, regardless of mechanism of action. Classes of chemotherapeutic agents include, but are not limited to: alkylating agents, antimetabolites, spindle poison plant alkaloids, cytotoxic/antitumor antibiotics, topoisomerase inhibitors, antibodies, photosensitizers, and kinase inhibitors. Chemotherapeutic agents include compounds used in "targeted therapy"
and conventional chemotherapy.
Examples of chemotherapeutic agents include: erlotinib (TARCEVAO, Genentech/OSI
Pharm.), docetaxel (TAXOTEREO, Sanofi-Aventis), 5-FU (fluorouracil, 5-fluorouracil, CAS
No. 51-21-8), gemcitabine (GEMZARO, Lilly), PD-0325901 (CAS No. 391210-10-9, Pfizer), cisplatin (cis-diamine, dichloroplatinum(II), CAS No. 15663-27-1), carboplatin (CAS No.
41575-94-4), paclitaxel (TAXOLO, Bristol-Myers Squibb Oncology, Princeton, N.J.), trastuzumab (HERCEPTINO, Genentech), temozolomide (4-methyl-5-oxo- 2,3,4,6,8-pentazabicyclo [4.3.0] nona-2,7,9-triene- 9-carboxamide, CAS No. 85622-93-1, TEMODARO, TEMODALO, Schering Plough), tamoxifen ((Z)-244-(1,2-diphenylbut-1-enyl)phenoxy]-N,N-dimethylethanamine, NOLVADEXO, ISTUBALO, VALODEX0), and doxorubicin (ADRIAMYCINO), Akti-1/2, HPPD, and rapamycin.
More examples of chemotherapeutic agents include: oxaliplatin (ELOXATINO, Sanofi), bortezomib (VELCADEO, Millennium Pharm.), sutent (SUNITINIBO, SU11248, Pfizer), letrozole (FEMARAO, Novartis), imatinib mesylate (GLEEVECO, Novartis), XL-518 (Mek inhibitor, Exelixis, WO 2007/044515), ARRY-886 (Mek inhibitor, AZD6244, Array BioPharma, Astra Zeneca), SF-1126 (PI3K inhibitor, Semafore Pharmaceuticals), BEZ-235 (PI3K
inhibitor, Novartis), XL-147 (PI3K inhibitor, Exelixis), PTK787/ZK 222584 (Novartis), fulvestrant (FASLODEXO, AstraZeneca), leucovorin (folinic acid), rapamycin (sirolimus, RAPAMUNEO, Wyeth), lapatinib (TYKERBO, G5K572016, Glaxo Smith Kline), lonafarnib (SARASARTM, SCH 66336, Schering Plough), sorafenib (NEXAVARO, BAY43-9006, Bayer Labs), gefitinib (IRESSAO, AstraZeneca), irinotecan (CAMPTOSARO, CPT-11, Pfizer), tipifarnib (ZARNESTRATm, Johnson & Johnson), ABRAXANETM (Cremophor-free), albumin-engineered nanoparticle formulations of paclitaxel (American Pharmaceutical Partners, Schaumberg, II), vandetanib (rINN, ZD6474, ZACTIMAO, AstraZeneca), chloranmbucil, AG1478, AG1571 (SU 5271; Sugen), temsirolimus (TORISELO, Wyeth), pazopanib (GlaxoSmithKline), canfosfamide (TELCYTAO, Telik), thiotepa and cyclosphosphamide (CYTOXANO, NEOSARO); alkyl sulfonates such as busulfan, improsulfan and piposulfan;
aziridines such as benzodopa, carboquone, meturedopa, and uredopa;
ethylenimines and methylamelamines including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide and trimethylomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analog topotecan);
bryostatin;
callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogs);
cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin;
duocarmycin (including the synthetic analogs, KW-2189 and CB1-TM1); eleutherobin;
pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, chlorophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosoureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g.
calicheamicin, calicheamicin gamma11, calicheamicin omegal1 (Angew Chem. Intl. Ed. Engl.
(1994) 33:183-186); dynemicin, dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, nemorubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU);
folic acid analogs such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone;
aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil;
bisantrene; edatraxate;
defofamine; demecolcine; diaziquone; elfornithine; elliptinium acetate; an epothilone;
etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol;
nitraerine;
pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide;
procarbazine; PSKO polysaccharide complex (JHS Natural Products, Eugene, OR);
razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone;
2,2',2"-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol;
mitolactol;
pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa; 6-thioguanine;
mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin;
vinblastine; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine;
vinorelbine (NAVELBINE0); novantrone; teniposide; edatrexate; daunomycin; aminopterin;
capecitabine (XELODAO, Roche); ibandronate; CPT-11; topoisomerase inhibitor RFS 2000;
difluoromethylornithine (DMF0); retinoids such as retinoic acid; and pharmaceutically acceptable salts, acids and derivatives of any of the above.
Also included in the definition of "chemotherapeutic agent" are: (i) anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEXO; tamoxifen citrate), raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and FARESTONO (toremifine citrate); (ii) aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASEO
(megestrol acetate), AROMASINO (exemestane; Pfizer), formestanie, fad rozole, RIVISORO
(vorozole), FEMARAO (letrozole; Novartis), and ARIMIDEXO (anastrozole;
AstraZeneca);
(iii) anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); (iv) protein kinase inhibitors such as MEK inhibitors (WO 2007/044515); (v) lipid kinase inhibitors; (vi) antisense oligonucleotides, particularly those which inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, for example, PKC-alpha, Raf and H-Ras, such as oblimersen (GENASENSEO, Genta Inc.); (vii) ribozymes such as VEGF expression inhibitors (e.g., ANGIOZYMEO) and HER2 expression inhibitors; (viii) vaccines such as gene therapy vaccines, for example, ALLOVECTINO, LEUVECTINO, and VAXIDO; PROLEUKINO
rIL-2; topoisomerase 1 inhibitors such as LURTOTECANO; ABARELIXO rmRH; (ix) anti-angiogenic agents such as bevacizumab (AVASTINO, Genentech); and pharmaceutically acceptable salts, acids and derivatives of any of the above.
Also included in the definition of "chemotherapeutic agent" are therapeutic antibodies such as alemtuzumab (Campath), bevacizumab (AVASTINO, Genentech); cetuximab (ERBITUXO, lmclone); panitumumab (VECTIBIXO, Amgen), rituximab (RITUXANO, Genentech/Biogen !deo), pertuzumab (OMNITARGTm, 2C4, Genentech), trastuzumab (HERCEPTINO, Genentech), tositumomab (Bexxar, Corixia), and the antibody drug conjugate, gemtuzumab ozogamicin (MYLOTARGO, Wyeth).
Humanized monoclonal antibodies with therapeutic potential as chemotherapeutic agents in combination with the conjugates of the invention include: alemtuzumab, apolizumab, aselizumab, atlizumab, bapineuzumab, bevacizumab, bivatuzumab mertansine, cantuzumab mertansine, cedelizumab, certolizumab pegol, cidfusituzumab, cidtuzumab, daclizumab, eculizumab, efalizumab, epratuzumab, erlizumab, felvizumab, fontolizumab, gemtuzumab ozogamicin, inotuzumab ozogamicin, ipilimumab, labetuzumab, lintuzumab, matuzumab, mepolizumab, motavizumab, motovizumab, natalizumab, nimotuzumab, nolovizumab, numavizumab, ocrelizumab, omalizumab, palivizumab, pascolizumab, pecfusituzumab, pectuzumab, pertuzumab, pexelizumab, ralivizumab, ranibizumab, reslivizumab, reslizumab, resyvizumab, rovelizumab, ruplizumab, sibrotuzumab, siplizumab, sontuzumab, tacatuzumab tetraxetan, tadocizumab, talizumab, tefibazumab, tocilizumab, toralizumab, trastuzumab, tucotuzumab celmoleukin, tucusituzumab, umavizumab, urtoxazumab, and visilizumab.
Pharmaceutical compositions according to the present invention, and for use in accordance with the present invention, may comprise, in addition to the active ingredient, i.e. a conjugate compound, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material will depend on the route of administration, which may be oral, or by injection, e.g. cutaneous, subcutaneous, or intravenous.
Pharmaceutical compositions for oral administration may be in tablet, capsule, powder or liquid form. A tablet may comprise a solid carrier or an adjuvant. Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included. A capsule may comprise a solid carrier such a gelatin.
For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included, as required.
Formulations While it is possible for the conjugate compound to be used (e.g., administered) alone, it is often preferable to present it as a composition or formulation.
In one embodiment, the composition is a pharmaceutical composition (e.g., formulation, preparation, medicament) comprising a conjugate compound, as described herein, and a pharmaceutically acceptable carrier, diluent, or excipient.
In one embodiment, the composition is a pharmaceutical composition comprising at least one conjugate compound, as described herein, together with one or more other pharmaceutically acceptable ingredients well known to those skilled in the art, including, but not limited to, pharmaceutically acceptable carriers, diluents, excipients, adjuvants, fillers, buffers, preservatives, anti-oxidants, lubricants, stabilisers, solubilisers, surfactants (e.g., wetting agents), masking agents, colouring agents, flavouring agents, and sweetening agents.
In one embodiment, the composition further comprises other active agents, for example, other therapeutic or prophylactic agents.
Suitable carriers, diluents, excipients, etc. can be found in standard pharmaceutical texts.
See, for example, Handbook of Pharmaceutical Additives, 2nd Edition (eds. M.
Ash and I.
Ash), 2001 (Synapse Information Resources, Inc., Endicott, New York, USA), Remington's Pharmaceutical Sciences, 20th edition, pub. Lippincott, Williams & Wilkins, 2000; and Handbook of Pharmaceutical Excipients, 2nd edition, 1994.
Another aspect of the present invention pertains to methods of making a pharmaceutical composition comprising admixing at least one [11C]-radiolabelled conjugate or conjugate-like compound, as defined herein, together with one or more other pharmaceutically acceptable ingredients well known to those skilled in the art, e.g., carriers, diluents, excipients, etc. If formulated as discrete units (e.g., tablets, etc.), each unit contains a predetermined amount (dosage) of the active compound.
The term "pharmaceutically acceptable," as used herein, pertains to compounds, ingredients, materials, compositions, dosage forms, etc., which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of the subject in question (e.g., human) without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
Each carrier, diluent, excipient, etc. must also be "acceptable" in the sense of being compatible with the other ingredients of the formulation.
The formulations may be prepared by any methods well known in the art of pharmacy. Such methods include the step of bringing into association the active compound with a carrier which constitutes one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association the active compound with carriers (e.g., liquid carriers, finely divided solid carrier, etc.), and then shaping the product, if necessary.
The formulation may be prepared to provide for rapid or slow release;
immediate, delayed, timed, or sustained release; or a combination thereof.
Formulations suitable for parenteral administration (e.g., by injection), include aqueous or non-aqueous, isotonic, pyrogen-free, sterile liquids (e.g., solutions, suspensions), in which the active ingredient is dissolved, suspended, or otherwise provided (e.g., in a liposome or other microparticulate). Such liquids may additional contain other pharmaceutically acceptable ingredients, such as anti-oxidants, buffers, preservatives, stabilisers, bacteriostats, suspending agents, thickening agents, and solutes which render the formulation isotonic with the blood (or other relevant bodily fluid) of the intended recipient.
Examples of excipients include, for example, water, alcohols, polyols, glycerol, vegetable oils, and the like. Examples of suitable isotonic carriers for use in such formulations include Sodium Chloride Injection, Ringer's Solution, or Lactated Ringer's Injection.
Typically, the concentration of the active ingredient in the liquid is from about 1 ng/ml to about 10 pg/ml, for example from about 10 ng/ml to about 1 pg/ml. The formulations may be presented in unit-dose or multi-dose sealed containers, for example, ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules, and tablets.
Dosage It will be appreciated by one of skill in the art that appropriate dosages of the conjugate compound, and compositions comprising the conjugate compound, can vary from patient to patient. Determining the optimal dosage will generally involve the balancing of the level of therapeutic benefit against any risk or deleterious side effects. The selected dosage level will depend on a variety of factors including, but not limited to, the activity of the particular compound, the route of administration, the time of administration, the rate of excretion of the compound, the duration of the treatment, other drugs, compounds, and/or materials used in combination, the severity of the condition, and the species, sex, age, weight, condition, general health, and prior medical history of the patient. The amount of compound and route of administration will ultimately be at the discretion of the physician, veterinarian, or clinician, although generally the dosage will be selected to achieve local concentrations at the site of action which achieve the desired effect without causing substantial harmful or deleterious side-effects.
Administration can be effected in one dose, continuously or intermittently (e.g., in divided doses at appropriate intervals) throughout the course of treatment. Methods of determining the most effective means and dosage of administration are well known to those of skill in the art and will vary with the formulation used for therapy, the purpose of the therapy, the target cell(s) being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician, veterinarian, or clinician.
In general, a suitable dose of the active compound is in the range of about 100 ng to about 25 mg (more typically about 1 pg to about 10 mg) per kilogram body weight of the subject per day. Where the active compound is a salt, an ester, an amide, a prodrug, or the like, the amount administered is calculated on the basis of the parent compound and so the actual weight to be used is increased proportionately.
In one embodiment, the active compound is administered to a human patient according to the following dosage regime: about 100 mg, 3 times daily.
In one embodiment, the active compound is administered to a human patient according to the following dosage regime: about 150 mg, 2 times daily.
In one embodiment, the active compound is administered to a human patient according to the following dosage regime: about 200 mg, 2 times daily.
However in one embodiment, the conjugate compound is administered to a human patient according to the following dosage regime: about 50 or about 75 mg, 3 or 4 times daily.
In one embodiment, the conjugate compound is administered to a human patient according to the following dosage regime: about 100 or about 125 mg, 2 times daily.
The dosage amounts described above may apply to the conjugate (including the PBD moiety and the linker to the antibody) or to the effective amount of PBD compound provided, for example the amount of compound that is releasable after cleavage of the linker.
For the prevention or treatment of disease, the appropriate dosage of an ADC
of the invention will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the molecule is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The molecule is suitably administered to the patient at one time or over a series of treatments.
Depending on the type and severity of the disease, about 1 g/kg to 15 mg/kg (e.g. 0.1-20 mg/kg) of molecule is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. A typical daily dosage might range from about 1 g/kg to 100 mg/kg or more, depending on the factors mentioned above. An exemplary dosage of ADC to be administered to a patient is in the range of about 0.1 to about 10 mg/kg of patient weight. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of disease symptoms occurs. An exemplary dosing regimen comprises a course of administering an initial loading dose of about 4 mg/kg, followed by additional doses every week, two weeks, or three weeks of an ADC. Other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
Treatment The term "treatment," as used herein in the context of treating a condition, pertains generally to treatment and therapy, whether of a human or an animal (e.g., in veterinary applications), in which some desired therapeutic effect is achieved, for example, the inhibition of the progress of the condition, and includes a reduction in the rate of progress, a halt in the rate of progress, regression of the condition, amelioration of the condition, and cure of the condition. Treatment as a prophylactic measure (i.e., prophylaxis, prevention) is also included.
The term "therapeutically-effective amount," as used herein, pertains to that amount of an active compound, or a material, composition or dosage from comprising an active compound, which is effective for producing some desired therapeutic effect, commensurate with a reasonable benefit/risk ratio, when administered in accordance with a desired treatment regimen.
Similarly, the term "prophylactically-effective amount," as used herein, pertains to that amount of an active compound, or a material, composition or dosage from comprising an active compound, which is effective for producing some desired prophylactic effect, commensurate with a reasonable benefit/risk ratio, when administered in accordance with a desired treatment regimen.
Preparation of Antibody drug conjugates Antibody drug conjugates may be prepared by several routes, employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1) reaction of a nucleophilic group of an antibody with a bivalent linker reagent, to form antibody-linker intermediate Ab-L, via a covalent bond, followed by reaction with an activated drug moiety reagent; and (2) reaction of a drug moiety reagent with a linker reagent, to form drug-linker reagent D-L, via a covalent bond, followed by reaction with the nucleophilic of an antibody.
Conjugation methods (1) and (2) may be employed with a variety of antibodies, and linkers to prepare the antibody-drug conjugates of the invention.
Nucleophilic groups on antibodies include, but are not limited to side chain thiol groups, e.g.
cysteine. Thiol groups are nucleophilic and capable of reacting to form covalent bonds with electrophilic groups on linker moieties such as those of the present invention. Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges.
Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (Cleland's reagent, dithiothreitol) or TCEP (tris(2-carboxyethyl)phosphine hydrochloride; Getz et al (1999) Anal. Biochem. Vol 273:73-80; Soltec Ventures, Beverly, MA). Each cysteine disulfide bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol.
The Subject/Patient The subject/patient may be an animal, mammal, a placental mammal, a marsupial (e.g., kangaroo, wombat), a monotreme (e.g., duckbilled platypus), a rodent (e.g., a guinea pig, a hamster, a rat, a mouse), murine (e.g., a mouse), a lagomorph (e.g., a rabbit), avian (e.g., a bird), canine (e.g., a dog), feline (e.g., a cat), equine (e.g., a horse), porcine (e.g., a pig), ovine (e.g., a sheep), bovine (e.g., a cow), a primate, simian (e.g., a monkey or ape), a monkey (e.g., marmoset, baboon), an ape (e.g., gorilla, chimpanzee, orangutang, gibbon), or a human.
Furthermore, the subject/patient may be any of its forms of development, for example, a foetus. In one preferred embodiment, the subject/patient is a human.
In one embodiment, the patient is a population where each patient has a tumour having av[36 integrin on the surface of the cell.
Synthesis Conjugates of formula A may be synthesised from corresponding drug-linker compounds of formula B by reacting them with cell binding agents under appropriate conditions. Thus, conjugates where Y is of formula Al may be synthesied from drug-linker compounds where YL is of formula B1. Conjugates where Y is of formula A2 may be synthesied from drug-linker compounds where YL is of formula B2. Conjugates where Y is of formula A3 may be synthesied from drug-linker compounds where YL is of formula B3.
The conditions, as described above, will depend on the type of bond being formed between the drug-linker compound and the cell binding agent, which itself will reflect the nature of the binding site on the cell binding agent.
Drug-linker compounds of formula B may be synthesised from corresponding compounds of formula C.
Drug-linker compounds where YL is of formula B1 may be synthesied from compounds where Yc is of formula C1, by reaction with a compound of formula E1:
FN1 \-0 'n1V-\
El in an appropriate solvent. Compounds of formula El may be formed in situ by reaction of compounds of formulae Fl and F2:
o 0 G4 H2N-F\_ o¨N 0 Y -A-\
Fl F2 .
Drug-linker compounds where YL is of formula B2 may be synthesied from compounds where Yc is of formula C2, by reaction with a compound of formula E2:
0(0,--....2,....N)-(G
n H
OH
E2 in an appropriate solvent, in the presence of an amide coupling reagent.
Drug-linker compounds where YL is of formula B3 may be synthesied from compounds where Yc is of formula C3, reaction with a compound of formula E2:
0(0,--....2,....N)-(G
n H
OH
E2 in an appropriate solvent, in the presence of an amide coupling reagent.
Compound of formula C can be made from the corresponding compound of formula G:
H
R6 o D
G .
Compounds of formula C where Yc is of formula C1 may be synthesised by reacting a compound of formula G with a compound of formula H1:
I
Br in the presence of tetrabutylammonium iodide and potassium carbonate.
Compounds of formula C where Yc is of formula C2 may be synthesised by reacting a compound of formula G with a compound of formula H2:
ProtN
i H
Z`
Br where Prot" is an amine protecting group, such as Alloc, in the presence of tetrabutylammonium iodide and potassium carbonate, followed by deprotection of the amine under standard conditions. The protecting group used should be orthogonal to any other protecting groups in the compound.
Compounds of formula C where Yc is of formula C3 may be synthesised by reacting a compound of formula G with a compound of formula H3:
H
N /Br , .
ProtN Z3 where Prot" is an amine protecting group, such as Alloc, in the presence of tetrabutylammonium iodide and potassium carbonate, followed by deprotection of the amine under standard conditions. The protecting group used should be orthogonal to any other protecting groups in the compound.
Alternativelty, compounds of formula C where Yc is of formula C3 may be synthesised by reacting a compound of formula G with a compound of formula H4:
/
02N . Br in the presence of tetrabutylammonium iodide and potassium carbonate, followed by reduction of the nitro group under standard conditions.
Compound of formula G containing a single PBD moiety can be synthesised according to the disclosure of WO 2005/085259, and in particular the discussion from pages 31 to 39, which is incorporated herein be reference. Reference is also made to the teaching of co-pending application PCT/EP2012/070232, filed on 12 October 2012.
The synthesis of PBD compounds containing two imine moieties is extensively discussed in the following references, which discussions are incorporated herein by reference:
a) WO 00/12508 (pages 14 to 30);
b) WO 2005/023814 (pages 3 to 10);
c) WO 2004/043963 (pages 28 to 29);
d) WO 2005/085251 (pages 30 to 39); and e) WO 2011/130598 (pages 126 to 150).
The disclosure of WO 2005/085259 discussed above is also relevant to the synthesis of compounds of formula G which comprise two PBD moieties. The synthesis methods disclosed therein may be modified to include an orthogonally protected hydroxyl group at C7 (i.e.group RA in Scheme 4).
Alternatively, compounds of formula G may be synthesised as described in the above references, but starting from a dimer core of formula J:
02N 0 X' _X I. NO2 I
Prot0 R6 0 J
where Prot is a hydroxyl protecting group. Such compounds of formula J may be made by methods analogous to those in the examples of the present application.
Amine protecting groups Amine protecting groups are well-known to those skilled in the art. Particular reference is made to the disclosure of suitable protecting groups in Greene's Protecting Groups in Organic Synthesis, Fourth Edition, John Wiley & Sons, 2007 (ISBN 978-0-471-69754-1), pages 696-871.
Hydroxyl protecting groups Hydroxyl protecting groups are well-known to those skilled in the art.
Particular reference is made to the disclosure of suitable protecting groups in Greene's Protecting Groups in Organic Synthesis, Fourth Edition, John Wiley & Sons, 2007 (ISBN 978-0-471-69754-1), pages 16-298.
General Conditions Reaction progress was monitored by thin-layer chromatography (TLC) using Merck Kieselgel 60 F254 silica gel, with fluorescent indicator on aluminium plates.
Visualisation of TLC was achieved with UV light or iodine vapour unless otherwise stated. Flash chromatography was performed using Merck Kieselgel 60 F254 silica gel. Extraction and chromatography solvents were bought and used without further purification from Fisher Scientific, U.K.
All chemicals were purchased from Aldrich, VWR, and Combi Blocks.
1H and 13C NMR spectra were obtained on a Bruker Avance 400 spectrometer.
Coupling constants are quoted in hertz (Hz). Chemical shifts are recorded in parts per million (ppm) downfield from tetramethylsilane. Spin multiplicities are described as s (singlet), bs (broad singlet), d (doublet), t (triplet), q (quartet), p (pentuplet) and m (multiplet).
LCMS Method 1 (default when not specified) The HPLC (Waters Alliance 2695) was run using a mobile phase of water (A) (formic acid 0.1%) and acetonitrile (B) (formic acid 0.1%). Gradient: initial composition 5% B held over 1.0 min, then increase from 5% B to 95% B over a 3 min period. The composition was held for 0.1 min at 95% B, then returned to 5% B in 0.03 minutes and hold there for 0.87 min.
Total gradient run time equals 5 min.
Flow rate 3.0 mL/min, 400pL was split via a zero dead volume tee piece which passes into the mass spectrometer. Wavelength detection range: 220 to 400 nm. Function type: diode array (535 scans). Column: Phenomenex Onyx Monolithic C18 50 x 4.60 mm LCMS Method 2 The HPLC (Waters Alliance 2695) was run using a mobile phase of water (A) (formic acid 0.1%) and acetonitrile (B) (formic acid 0.1%). Gradient: initial composition 5% B held over 1.0 min, then increase from 5% B to 95% B over a 2.5 min period. The composition was held for 0.5 min at 95% B, then returned to 5% B in 0.1 minutes and hold there for 0.9 min. Total gradient run time equals 5 min.
Flow rate 3.0 mL/min, 400pL was split via a zero dead volume tee piece which passes into the mass spectrometer. Wavelength detection range: 220 to 400 nm. Function type: diode array (535 scans). Column: Phenomenex Onyx Monolithic C18 50 x 4.60 mm."
LCMS Method 3 The HPLC (Shimazu LCMS-2020) was run using a mobile phase of water (A) (formic acid 0.1%) and acetonitrile (B) (formic acid 0.1%). Gradient: initial composition 5% B held over 0.25 min, then increase from 5% B to 100% B over a 2 min period. The composition was held for 0.50 min at 100% B, then returned to 5% B in 0.05 minutes and hold there for 0.05 min. Total gradient run time equals 3 minutes.
Flow rate 0.8 mL/min. Wavelength detection range: 220 to 400 nm. Column:
Waters Acquity UPLC BEH Shield RP18 1.7pm 2.1x5Omm.
Synthesis of Key Intermediates (a) 5-(benzyloxy)-44(5-(4-carboxy-2-methoxy-5-nitrophenoxy)pentyl)oxy)-2-nitrobenzoic acid (17) H
H 0 so H 0 H Bn0 H 0 is Me0 Me0 HO
H
OMe Bn0 OMe Bn0 02N 0,..0 NO2 02N 00 so N 02 OMe Bn0 OMe Bn0 (i) 3-(benzyloxy)-4-hydroxybenzaldehyde (12) Sodium hydride (51.2 g, 1.27 mol, 2.2 eq) was rinsed twice with hexane in a three-neck flask and anhydrous DMSO (800 mL) was added. The flask was placed in a water bath at room temperature. A solution of 3,4-dihydroxybenzaldehyde II (80 g, 579.2 mmol) in dry DMSO
10 (160 mL) was added dropwise, with an addition funnel, over 40 minutes and the reaction mixture was stirred 30 minutes under Argon. During the addition a lot of hydrogen gas is formed, so an exit with cotton wool and calcium chloride is placed in one of the neck. Benzyl bromide (68.8 mL, 579.2 mmol, 1 eq) was then added dropwise and the reaction was stirred overnight. The reaction mixture was poured into ice and quenched with HCI (1M) until pH
15 acid and extracted with Et0Ac. The organic phase was then washed with brine and was dried over magnesium sulphate, filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to a pad of Silica with pure dichloromethane. The resulting material was precipitated with a minimum of dichloromethane in hexane. The resulting white precipitate was filtered and dried to afford the desired compound (80.7 g, 60 % yield). LC/MS (Method 3) 1.43 min (no ionisation). 1H
NMR (400 MHz, CDCI3) 6 9.81 (s, 1H), 7.51 (d, J = 1.8 Hz, 1H), 7.45 ¨ 7.34 (m, 7H), 7.06 (d, J = 8.1 Hz, 1H), 6.24 (s, 1H), 5.17 (s, 2H).
(ii) 4((5-bromopentyl)oxy)-3-methoxybenzaldehyde (14) Vanillin 13 (50 g, 328 mmol) was dissolved in acetone (1 L). Dibromopentane (227 g, 985 mmol, 3 eq) and potassium carbonate (68 g, 492 mmol, 1.5 eq) were added. The slurry was warmed to 65 C and stirred for 2 hours, and then 80 C for 30 minutes. The resulting potassium carbonate was filtered and the excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to a pad of Silica: 7.5% Et0Ac in Hexane (4 L) then 10% Et0Ac in Hexane (1 L) and 25% Et0Ac in Hexane to afford a white solid (53.7 g, 54 `)/0 yield). LC/MS (Method 3) 1.63 min (ES+) m/z (relative intensity) 302.53 ([M + , 100). 1H NMR (400 MHz, CDCI3) 6 9.83 (s, 1H), 7.42 (dd, J
= 8.1, 1.9 Hz, 1H), 7.40 (d, J= 1.9 Hz, 1H), 6.95 (d, J= 8.1 Hz, 1H), 4.10 (t, J= 6.6 Hz, 2H), 3.91 (s, 3H), 3.43 (t, J = 6.7 Hz, 2H), 1.92 (m, 4H), 1.64 (tt, J = 9.7, 6.2 Hz, 2H).
(iii) 3-(benzyloxy)-44(5-(4-formy1-2-ethoxyphenoxy)pentyl)oxy) benzaldehyde (15) 4-((5-bromopentyl)oxy)-3-methoxybenzaldehyde 14 (40.0 g, 132.81 mmol, 1 eq) and 3-(benzyloxy)-4-hydroxybenzaldehyde 12 (30.3 g, 132.81 mmol, 1 eq) were dissolved in dimethylformamide (200 mL). Potassium carbonate (13.8 g, 99.61 mmol, 0.75 eq) and tetrabutylammonium iodide (4.9 g, 13.28 mmol, 0.1 eq) were added. The reaction mixture was warmed to 80 C and stirred for 12 hours. The resulting potassium carbonate was filtered and the excess solvent was removed by rotary evaporation under reduced pressure.
The resulting residue was dissolved in ethyl acetate and washed subsequently with water, 1N NaOH, 1N HCI, water and brine. The organic phase was dried over magnesium sulphate, filtered and excess solvent was removed by rotary evaporation under reduced pressure to afford the desired compound (75 g, quantitative yield) as a light yellow oil.
LC/MS (Method 3) 1.77 min (ES+) m/z (relative intensity)449.15 [M +
, 471.25 [M + Na]. 1H NMR (400 MHz, CDCI3) 6 9.83 (s, 1H), 9.81 (s, 1H), 7.46 (dd, J = 3.1, 1.4 Hz, 2H), 7.43 (d, J = 1.7 Hz, 2H), 7.41 (dd, J = 8.1, 1.9 Hz, 1H), 7.39 (d, J = 1.8 Hz, 1H), 7.37 - 7.32 (m, 2H), 7.30 (dd, J
= 5.0, 3.6 Hz, 1H), 6.97 (d, J= 8.1 Hz, 1H), 6.92 (d, J= 8.1 Hz, 1H), 5.15 (s, 2H), 4.13 (t, J
= 6.4 Hz, 2H), 4.09 (t, J = 6.6 Hz, 2H), 3.88 (s, 3H), 2.01 - 1.89 (m, 4H), 1.77 - 1.64 (m, 2H).
(iv) 5-(benzyloxy)-44(5-(4-formy1-2-methoxy-5-nitrophenoxy)pentyl)oxy)-2-nitrobenzaldehyde (16) 3-(benzyloxy)-4-((5-(4-formy1-2-ethoxyphenoxy)pentyl)oxy) benzaldehyde 15 (30 g, 66.40 mmol) was dissolved in dichloromethane (60 mL) and added to nitric acid (68%, 60 mL) at 0 C. The reaction mixture was stirred at 0 C for 20 minutes and at room temperature for 3 hours and then cold water was added. The precipitate formed was filtered and washed with water. The white solid was dried by vacuum. 42g of white solid was obtained (>100`)/0 yield due to water remaining). LC/MS (Method 3) 1.88 min, no ionisation. 1H NMR (400 MHz, CDCI3) 6 10.44 (s, 1H), 10.41 (s, 1H), 7.61 (s, 1H), 7.56 (s, 1H), 7.48 (s, 1H), 7.46 ¨ 7.30 (m, 6H), 5.25 (s, 2H), 4.20 (dd, J= 12.2, 5.9 Hz, 2H), 4.13 (dd, J= 15.1, 8.7 Hz, 2H), 3.96 (s, 3H), 2.01 (dt, J= 14.1, 6.4 Hz, 4H), 1.80¨ 1.65 (m, 2H).
(v) 5-(benzyloxy)-4-((5-(4-carboxy-2-methoxy-5-n itrophenoxy)pentyl)oxy)-2-nitrobenzoic acid (/7) A solution of sodium chlorite (35.3 g, 390 mmol, 5 eq) and sodium phosphate (26.2 g, 218.4 mmol, 2.8 eq) in water (250 mL) was added to a solution of 5-(benzyloxy)-4-((5-(4-formy1-2-methoxy-5-nitrophenoxy)pentyl)oxy)-2 nitrobenzaldehyde 16 (42 g, 78 mmol) in THF (200 mL). Hydrogen peroxide (60%, 103 mL, 2.18 mol, 28 eq) was then added quickly.
After 30 min, the reaction wasquenched with 1N HCI and extracted with ethyl acetate.
The organic layer was washed two times with brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was dissolved in a minimum of dichloromethane and precipitated out with ether.
Pale yellow solid (26 g, 58%) was filtered and washed with ether and used as crude for the next reaction.
LC/MS (Method 3) 1.69 min (ES+) tniz (relative intensity) 569.35 [M + H].
(b) (2R,11aS)-2-((tert-butyld imethylsily0oxy)-84(5-(((2R,11 aS)-2-((tert-butyldimethylsily0oxy)-5,11-d ioxo-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2, 3, 5,10,11 ,11 a-hexahydro-1 H-benzo[e]pyrrolo[1, 2-4[1, 4]diazepin-8-y0oxy)pe ntyl)oxy)-7-methoxy-104(2-(trimethylsily0ethoxy)methyl)-2, 3-dihyd ro-1 H-benzolelpyrrolo[1, 2-a][1, 4]diazepine-5,11 (1 OH,11 aH)-dione (113) Me0 04Me M \=0 + 0, ci . 0e2N 0 OMe Bn0 OH OMe Bn0 OMe Me0 0 H H 0 02N AI 0,...,,,,,,s...0 iii NO2 \ r 0 -2.- Cr Will OMe Bn0 IIIIIII)P Na=OTBS TBsoõ, F1'. N SI
C)....'..............Me M1 H: = NI---1 ...N OTBS-' 0 H H 0 0 jEM 1 EM 0 N 411 0,......v.......v.,0 Ali N H N diii 0,............,........_õ..0 Ail H
, tt qijil OMe TIPSO 11111111 - 1,113., -'...
he-N WI OMe TIPSO WI NI----76....
OTBSTBSO OTBS
(i) (2S, 4R)-methyl 1-(44(5-(2-(benzyloxy)-44(2S,4R)-4-hydroxy-2-(methoxycarbonyOpyrrolidine-1-carbony1)-5-nitrophenoxy)pentyl)oxy)-5-methoxy-2-nitrobenzoy1)-4-hydroxypyrrolidine-2-carboxylate (19) Oxalyl chloride (7.6 mL, 89.92 mmol, 3 eq) was added to a solution of 17 (17.1 g, 29.97 mmol) in dichloromethane (150 mL) and DMF (2 mL). After 20 min the solvent was removed by rotary evaporation under reduced pressure and minimum of dichloromethane was added to dissolve the crude and triturated with diethyl ether. The yellow solid formed was filtered and added portion wise to a solution of 18 (13.6 g, 74.93 mmol, 2.5 eq) and triethylamine (20.92 mL, 149.87 mmol, 5eq) in dichloromethane (100 mL) at -40 C. The reaction was complete after few minutes. The solvent was removed by rotary evaporation under reduced pressure and the resulting residue was subjected to flash column chromatography (silica gel;
50% ethyl acetate in hexane to 100% ethyl acetate to collect the mono addition product and then 5% to 20% methanol in dichloromethane). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (15 g, 61% over 3 steps). LC/MS (Method 3) 1.47 min (ES+) tniz (relative intensity) 825.45 ([M +
, 100). 1H NMR (400 MHz, CDC13) 6 7.65 (s, 1H), 7.61 (s, 1H), 7.45 - 7.27 (m, 5H), 6.89 (s, 1H), 6.81 (s, 1H), 5.20 (s, 2H), 4.85 - 4.74 (m, 2H), 4.40 (d, J = 20.3 Hz, 2H), 4.21 -4.02 (m, 4H), 3.91 (s, 3H), 3.79 (s, 6H), 3.53 - 3.41 (m, 2H), 3.13 (d, J= 11.1 Hz, 1H), 3.04 (d, J = 11.0 Hz, 1H), 2.79 - 2.72 (m, J = 4.3 Hz, 1H), 2.63 (s, 1H), 2.42 - 2.32 (m, 2H), 2.21 - 2.06 (m, J = 11.3 Hz, 2H), 2.02 - 1.89 (m, 4H), 1.76 - 1.65 (m, 2H).
(ii) (2S, 4R)-methyl 1-(44(5-(2-(benzyloxy)-44(2S,4R)-4-((tert-butyldimethylsily0oxy)-2-(methoxycarbonyOpyrrolidine-1-carbony1)-5-nitrophenoxy)pentyl)oxy)-5-methoxy-2-nitrobenzoy1)-4-((tert-butyldimethylsily0oxy)pyrrolidine-2-carboxylate (110) 19 (14 g, 16.97 mmol), tert-butyldimethylsilyl chloride (12.8 g, 84.87 mmol, 5 eq) and imidazole (13.9 g, 203.64 mmol, 12 eq) were melted together at 120 C.The reaction was complete after 30 minutes. The resulting residue was subjected to flash column chromatography (silica gel; 10% ethyl acetate in hexane to 100% ethyl acetate). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (17 g, quantitative).
LC/MS (Method 3) 2.17 min. 1H NMR (400 MHz, CDC13) 6 7.69 (s, 1H), 7.65 (s, 1H), 7.43 -7.27 (m, 5H), 6.87 (s, 1H), 6.78 (s, 1H), 5.17 (d, J = 5.6 Hz, 2H), 4.73 -7.79 (m, 2H), 4.45 -4.34 (m, 2H), 4.32 - 4.10 (m, 2H), 4.09 - 4.00 (m, 2H), 3.90 (s, 3H), 3.80 (s, 3H), 3.79 (s, 3H), 3.48 - 3.41 (m, 1H), 3.29 (dd, J= 10.3, 4.6 Hz, 1H), 3.03 (dd, J= 10.4, 2.4 Hz, 2H), 2.96 (dd, J = 10.2, 2.8 Hz, 2H), 2.31 - 2.21 (m, 2H), 2.19 - 2.05 (m, 2H), 2.00 - 1.88 (m, 4H), 1.74- 1.66 (m, 2H), 0.82 (s, 18H), 0.02 (d, J= 1.1 Hz, 6H), -0.03 (d, J=
5.5 Hz, 6H).
(iii) (2R,11aS)-2-((tert-butyldimethylsily0oxy)-84(5-(((2R,11 aS)-2-((tert-butyldimethylsily0oxy)-7-hydroxy-5,11-dioxo-2,3, 5,10,11 ,11a-hexahydro-1 H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-2,3-dihydro-benzolelpyrrolo[1,2-41-1,41diazepine-5,11(10H,11aH)-dione (111) Ammonium formate (106 g, 168 mmol, 10 eq) was added to a solution of 110 (17.7 g, 16.80 mmol) in ethanol (500 mL). Palladium on carbon (1.8 g, 10%) was wetted with ethyl acetate and added to the reaction mixture. The solution was warmed to 70 C. After 20 min, the reaction mixture was then filtered through celite and washed with ethyl acetate. The solvent was removed by rotary evaporation. The residue was dissolved in ethyl acetate and washed with saturated aqueous ammonium chloride and brine, dried over magnesium sulphate;
filtered and excess solvent was removed by rotary evaporation under reduced pressure to give the desired compound (13.9 g, 98%) as a yellow gum.
LC/MS (Method 3) 1.91 min, (ES+) m/z (relative intensity) 839.35 ([M + , 100).
(iv) (2R,11 aS)-2-((tert-butyldimethylsily0oxy)-84(5-(((2R,11 aS)-2-((tert-butyldimethylsily0oxy)-5,11-dioxo-7-((triisopropylsily0oxy)-2, 3, 5,10,11,11 a-hexahyd ro-1 H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-2,3-dihydro-benzolelpyrrolofi , 2-4[1 ,zi]diazepine-5,11(10H,11aH)-dione (112) 111 (13.9 g, 16.56 mmol), triisopropylsilyl chloride (3.6 mL, 18.36 mmol, 1.1 eq) and imidazole (3.4 g, 49.94 mmol, 3 eq) were melted together at 120 C. The reaction was complete after 30 minutes. The resulting residue was subjected to flash column chromatography (silica gel; 10% ethyl acetate in hexane to 100% ethyl acetate). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (15.4 g, 93%). LC/MS
(Method 3) 2.31 min, 1H NMR (400 MHz, CDC13) 6 9.81 (s, 1H), 8.70 (s, 1H), 8.65 (s, 1H), 7.43 (s, 2H), 6.47 (s, 1H), 6.42 (s, 1H), 4.54 ¨ 4.43 (m, 2H), 4.17 (dt, J= 7.6, 3.8 Hz, 2H), 4.00 (t, J= 6.4 Hz, 2H), 3.95 (t, J = 6.2 Hz, 2H), 3.87 (s, 3H), 3.73 ¨ 3.58 (m, 4H), 2.84 ¨
2.76 (m, 2H), 2.09 ¨ 1.96(m, 1H), 1.92¨ 1.85(m, 4H), 1.68¨ 1.62(m, 2H), 1.31 ¨ 1.17(m, 3H), 1.08(d, J=
2.5 Hz, 9H), 1.06 (d, J = 2.5 Hz, 9H), 0.85 (s, 9H), 0.84 (s, 9H), 0.06 (s, 6H), 0.07 (s, 6H).
(v) (2R,11 aS)-2-((tert-butyldimethylsily0oxy)-84(5-(((2R,11aS)-2-((tert-butyldimethylsily0oxy)-5,11-dioxo-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2, 3, 5,10,11 ,11a-hexahydro-1 H-benzo[e]pyrrolo[1, 2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-10-((2-(trimethylsily0ethoxy)methyl)-2, 3-dihyd ro-1 H-benzolelpyrrolo[1, 2-a][1,4]diazepine-5,11 (10H,11aH)-dione (113) 112 (15.4 g, 15.74 mmol) was dissolved in dry tetrahydrofuran (250 mL) and cooled to -30 C
(dry ice / acetone). n-Butyllithium (29 mL, 46.41 mmol, 3 eq) was then added dropwise and the reaction mixture was stirred for 1 hour at -30 C. 2-(Trimethylsilyl)ethoxymethyl chloride (8.2 mL, 46.41 mmol, 3 eq) was then added dropwise and the cold bath was removed. The reaction mixture was stirred at ambient temperature for 12 hours and the solvent was removed by rotary evaporation. The residue was dissolved in ethyl acetate and washed with water and brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to give the desired compound as yellow oil used as crude for the next reaction. 1H NMR (400 MHz, CDC13) 6 7.34 (s, 1H), 7.33 (s, 1H), 7.20 (s, 1H), 7.15 (s, 1H), 5.49 (dd, J= 10.0, 1.8 Hz, 2H), 4.64 (dd, J= 9.9, 7.5 Hz, 2H), 4.56 (dt, J = 8.9, 5.7 Hz, 2H), 4.21 (dt, J = 8.6, 4.4 Hz, 2H), 4.09 ¨ 3.93 (m, 4H), 3.91 (s, 3H), 3.82 ¨ 3.61 (m, 6H), 3.61 ¨ 3.50 (m, 2H), 2.90 ¨ 2.76 (m, 2H), 2.03 ¨ 1.97 (m, 2H), 1.97 ¨ 1.86 (m, 4H), 1.75¨ 1.64 (m, 2H), 1.34¨ 1.19(m, 3H), 1.10 (d, J = 2.7 Hz, 9H), 1.08(d, J = 2.7 Hz, 9H), 0.96 (ddd, J = 9.1, 6.9, 2.0 Hz, 4H), 0.86 (d, J = 2.9 Hz, 9H), 0.85 (d, J = 2.9 Hz, 9H), 0.09 (s, 6H), 0.07 (s, 6H), 0.01 (d, J = 3.2 Hz, 18H).
(c) (S)-7-hydroxy-84(5-(((S)-7-methoxy-2-methy1-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methyl-10-((2-(trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1, 2-a][1,4]diazepine-5,11(10H,11aH)-dione (118) SEM SEMSEM SEM
0 0 0 k 0 He- AiNi , TBSO OOTBS
0 N---/,b1 N OMe TIPSO N OMe TIPSO N
0 i 0 1/5ea OMe TIPSO
N O 1111}111Me TIPSO N
0 115 0 Tf0 0 116 0 OTf 0 k 0 1-,2" N--155,1 OMe TIPSO 411111" N OMe H 0 (i) (2R,11aS)-2-hydroxy-84(5-(((2R,11aS)-2-hydroxy-5,11-dioxo-7-((triisopropylsily0oxy)-10-((2-(trimethylsily0ethoxy)methyl)-2,3,5,10,11,11a-hexahydro-1 H-benzo[e]pyrrolo[1, 2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-10-((2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzolelpyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (114) Crude 113 (15.74 mmol) was dissolved in dry tetrahydrofuran (40 mL) and a solution of 1%
v/v conc. HCI in methanol (120 mL). The reaction mixture was stirred 2 hours at ambient temperature; diluted with ethyl acetate and washed with water (two times), saturated aqueous sodium bicarbonate and brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to give the desired compound as yellow oil used as crude for the next reaction. LC/MS (Method 3) 2.08 min, (ES+) m/z (relative intensity) 1027.40 [M + H], 1H NMR (400 MHz, CDCI3) 6 7.32 (s, 1H), 7.32 (s, 1H), 7.20 (s, 1H), 7.14 (s, 1H), 5.49 (dd, J= 10.0, 3.2 Hz, 2H), 4.69 ¨ 4.57 (m, 3H), 4.33 ¨ 4.24 (m, 2H), 4.16 ¨ 3.93 (m, 4H), 3.88 (s, 3H), 3.89 ¨ 3.55 (m, 6H), 3.00 ¨ 2.88 (m, 2H), 2.53 (br, 1H), 2.17 ¨ 2.05 (m, 2H), 2.00¨ 1.86 (m, 4H), 1.78¨ 1.63 (m, 3H), 1.46¨ 1.39 (m, 2H), 1.36¨ 1.19 (m, 4H), 1.09 (s, 9H), 1.07 (s, 9H), 1.01 ¨0.92 (m, 4H), 0.02(s, 18H).
(ii) (S)-7-methoxy-104(2-(trimethylsily0ethoxy)methyl)-8-((5-(((S)-2,5,11-trioxo-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2,3,5,10,11,11a-hexahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-2,5,11(3H,10H,11aH)-trione (115) TCCA (1.62 g, 7.00 mmol, 1.2 eq) was added to a solution of crude 114 (5.84 mmol), TEMPO (90 mg, 0.58 mmol, 0.1 eq) and sodium acetate (1.14 g, 14.00 mmol, 2.4 eq) in dichloromethane (120 mL) at -10 C (acetone / ice). The reaction was stirred for 30 min and filtered through celite. The reaction mixture was then quenched with saturated aqueous sodium bicarbonate. The organic phase washed with sodium thiosulfate and brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to flash column chromatography (silica gel; 20% to 70% ethyl acetate in hexane). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (3.21 g, 54% over 3 steps). LC/MS (Method 3) 2.17 min, (ES+) m/z (relative intensity) 1023.75 [M + H], 1H NMR (400 MHz, CDCI3) 6 7.32 (s, 2H), 7.23 (s, 1H), 7.18 (s, 1H), 5.53 (dd, J= 10.0, 1.6 Hz, 2H), 4.70 (t, J=
9.6 Hz, 2H), 4.66 ¨ 4.58 (m, 2H), 4.22 (d, J = 20.1 Hz, 2H), 4.13 ¨ 3.95 (m, 4H), 3.91 (s, 3H), 3.89 ¨ 3.74 (m, 4H), 3.72 ¨ 3.62 (m, 2H), 3.56 (ddd, J = 19.2, 5.8, 3.1 Hz, 2H), 2.78 (dd, J =
19.3, 9.9 Hz, 2H), 1.95 (dd, J= 14.6, 7.3 Hz, 4H), 1.76¨ 1.63 (m, 2H), 1.33¨ 1.23 (m, 3H), 1.10 (s, 9H), 1.09 (s, 9H), 1.02 ¨ 0.90 (m, 4H), 0.02 (s, 18H).
(iii) (S)-84(5-(((S)-5,11-dioxo-2-(((trifluoromethyl)sulfonyl)oxy)-7-((triisopropylsily0oxy)-10-((2-(tritnethylsily0ethoxy)tnethyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-2-y1 trifluoromethanesulfonate (116) Anhydrous 2,6-lutidine (2.12 mL, 18.17 mmol, 6.2 eq) was injected in one portion to a solution of 115 (3 g, 2.93 mmol) in dry dichloromethane (40 mL) at -50 C
(acetone / dry ice).
Triflic anhydride (2.12 mL, 18.17 mmol, 6 eq) was then added slowly whilst monitoring the temperature. After 20 minutescold water was added to the still cold reaction mixture and the organic layer was separated and washed with cold saturated sodium bicarbonate, brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to flash column chromatography (silica gel; 5% to 20% ethyl acetate in hexane). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (3.1 g, 82%). LC/MS (Method 3) 2.37 min, no ionisation, 1H NMR (400 MHz, CDC13) 6 7.32 (s, 2H), 7.23 (s, 1H), 7.19 (s, 1H), 7.14 (s, 1H), 7.11 (s, 1H), 5.54 (d, J= 10.0 Hz, 2H), 4.74 - 4.66 (m, 2H), 4.63 (d, J=
11.0 Hz, 2H), 4.09 - 3.96 (m, 4H), 3.94 - 3.87 (m, 2H), 3.90 (s, 3H), 3.82 - 3.76 (m, 2H), 3.69 - 3.65 (m, 2H), 3.22 - 3.08 (m, 2H), 1.99- 1.90 (m, 4H), 1.75- 1.64 (m, 2H), 1.33- 1.21 (m, 3H), 1.11 (d, J= 1.1 Hz, 9H), 1.09 (d, J= 1.1 Hz, 9H), 1.01 -0.91 (m, 4H), 0.02 (s, 18H).
(iv) (S)-7-methoxy-2-methy1-84(5-(((S)-2-methy1-5,11-dioxo-7-((triisopropylsily0oxy)-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-10-((2-(trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (117) Triphenylarsine (588 mg, 1.92 mmol, 0.8 eq) was added to a mixture of triflate 116 (3.1 g, 2.4 mmol, 1 eq), methylboronic acid (1.0 g, 16.8 mmol, 7 eq), silver oxide (4.45 g, 19.2 mmol, 8 eq) and potassium phosphate tribasic (6.1 g, 28.8 mmol, 12 eq) in dry dioxane (40 mL) under an argon atmosphere. The reaction was flushed with argon 3 times and bis(benzonitrile)palladium(11) chloride (184 mg, 0.48 mmol, 0.2 eq) was added.
The reaction was flushed with argon 3 more times before being stirred at 70 C. After 1 hour the reaction was observed to be complete by TLC and filtered through a pad celite. The solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to column flash chromatography (silica gel; 20% to 50% ethyl acetate /
hexane). Pure fractions were collected and combined, and excess eluent was removed by rotary evaporation under reduced pressure afforded the product (1.1 g, 36 %). LC/MS
(Method 3) 2.34 min, no ionisation, 1H NMR (400 MHz, CDC13) 6 7.35 (s, 2H), 7.20 (s, 1H), 7.16 (s, 1H), 6.68 (d, J = 1.3 Hz, 1H), 6.64 (d, J = 1.4 Hz, 1H), 5.53 (s, 1H), 5.51 (s, 1H), 4.67 (t, J =
10.1 Hz, 2H), 4.45 (dt, J = 10.5, 3.2 Hz, 2H), 4.08 - 3.94 (m, 4H), 3.90 (s, 3H), 3.77 (dd, J =
8.9, 7.5 Hz, 2H), 3.68 (dt, J = 10.0, 5.2 Hz, 2H), 3.43 (d, J = 16.5 Hz, 2H), 2.78 (d, J = 10.4 Hz, 2H), 2.00 - 1.86 (m, 4H), 1.83 (s, 3H), 1.82 (s, 3H), 1.72 - 1.68 (m, 2H), 1.30 - 1.25 (m, 3H), 1.09 (s, 9H), 1.06 (s, 9H), 0.99 - 0.94 (m, 4H), 0.02 (s, 18H).
(v) (S)-7-hydroxy-84(5-(((S)-7-methoxy-2-methy1-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methyl-10-((2-(trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1,2-a][1,41diazepine-5,11(10H,11aH)-dione (118) Lithium acetate (110 mg, 1.08 mmol, 1 eq) was added to a solution of compound 117 (1.1 g, 1.08 mmol) in wet dimethylformamide (20 mL, 50:1 DMF/water). The reaction was stirred for 12 hours at ambient temperature and diluted with ethyl acetate and washed with citric acid (pH - 3), brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to provide the product (1.03 g, quantitative).
LC/MS (Method 3) 1.98 min, (ES+) m/z (relative intensity)863.35 [M + H], 1H
NMR (400 MHz, CDC13) 6 7.44 (s, 1H), 7.35 (s, 1H), 7.20 (s, 1H), 7.19 (s, 1H), 6.70 -6.62 (m, 2H), 6.21 (br, 1H), 5.51 (dd, J = 10.0, 5.3 Hz, 2H), 4.66 (dd, J= 11.3, 10.1 Hz, 2H), 4.46 (dd, J=
10.4, 3.2 Hz, 2H), 4.18 - 3.99 (m, 4H), 3.90 (s, 3H), 3.78 (td, J = 9.7, 6.9 Hz, 2H), 3.67 (td, J
= 9.7, 6.8 Hz, 2H), 3.49 - 3.35 (m, 2H), 2.81 - 2.68 (m, 2H), 2.00 - 1.89 (m, 4H), 1.82 (s, 3H), 1.81 (s, 3H), 1.75- 1.63 (m, 2H), 0.97 (ddd, J= 9.9, 6.6, 3.3 Hz, 4H), 0.01 (s, 18H).
(d) (S)-7-hydroxy-2-methylene-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-benzolelpyrrolo[1,2-a][1 ,4]diazepine-5,11 (1 OH,11aH)-dione (123) 1\1-.
HO
HN HO
HO
(S)-7-hydroxy-2-methylene-2,3-dihydro-1 H-benzo[e]pyrrolo[1, 2-a][1,4]diazepine-5,11(10H,11aH)-dione (121) Phenol isatoic anhydride 120 (1.59 g, 8.88 mmol, 1 eq), hydrochloride 119 (1.60 g, 9.7 mmol, 1.1 eq), diisopropylethylamine (2.06 mL, 11.8 mmol, 1.3 eq) were suspended in DMSO
(8mL) and heated at 120 C for 15 minutes. LC/MS monitoring showed total consumption of starting material. The reaction mixture was diluted with water and ice and the resulting precipitate was collected by filtration (1g). The product was recrystallized in acetonitrile to yield the desired product (600 mg). LC/MS (1.97 min (ES-) m/z (relative intensity) 242.7 ([M
- H], 100)); 1H NMR (400 MHz, DMSO) 6 10.24 (s, 1H), 9.64 (s, 1H), 7.15 (d, J=
2.5 Hz, 1H), 7.01 ¨6.90 (m, 2H), 5.08 (s, 2H), 4.31 ¨4.16 (m, 2H), 4.03 (dd, J= 16.2, 1.3 Hz, 1H), 3.20 (d, J= 16.1 Hz, 1H), 2.77 (dd, J= 15.9, 9.4 Hz, 1H).
(ii) (S)-7-hydroxy-2-methylene-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-benzolelpyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (/22) n-Buli (2.51 mL, 4.02 mmol, 2.2 eq ) was added to a suspension of phenol dilactam 121(447 mg, 1.83 mmol, leg) in anhydrous THF at -78 C. SEM chloride (670 mg, 711pL, 4.02 mmol, 2.2 eq) was injected slowly under vigorous stirring. The mixture was allowed to return to room temperature and was treated with dilute HCI in methanol (3 drops of concentrated hydrochloric acid / 50 mL methanol). The mixture was heated at 40 C to accelerate the hydrolysis of phenolic SEM ethers and the reaction was monitored by LC/MS and TLC (ethyl acetate). The mixture was partitioned between ethyl acetate and water, followed by a wash with brine. Flash column chromatography (80/20 Ethyl acetate / hexane) gave the product in 73% yield (502 mg). LC/MS (3.10 min (ES-) m/z (relative intensity) 372.9 ([M -H], 100)).
(e) (S)-8-methoxy-2-(6-methoxynaphthalen-2-y1)-7-((triisopropylsily0oxy)-10-((2-(trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (133) CO2Me Me0 NO2 Me0 NO2s Me0 N
H Me0 401 0 H 0 0- - ...I
Bn0 Bn0 Bn0 N.- ,--(b.,.. Bn0 OTBS
Me0 N
Me0 e0 H 0 ,---/64.1 _... 0 , 40 Bn0 ---(1 NI--lb....N TIMPSO
OTBS OTBS OTBS
SEM SEM SEM
% 0 1 0 \ 0 Me0 Me0 N Me0 N
-2.--3.- Ill N.- .-,..d ...
TIPSO lir TIPSO =
TIPSO 41111111)PPP
0 H 0 OTf SEM
Me0 H
HO Si N ,..,.
0 *0 OMe (i) (2S, 4R)-methyl 1-(5-(benzyloxy)-4-methoxy-2-nitrobenzoy1)-4-hydroxypyrrolidine-2-carboxylate (124) Oxalyl chloride (1.19 mL, 1.73 g, 13.6 mmol) was added to a stirred suspension of the nitrobenzoic acid 123 (2.77 g, 9.1 mmol) and DMF (3 drops) in anhydrous DCM
(50 mL).
Following initial effervescence the reaction suspension became a solution and the mixture was allowed to stir at room temperature for 16 hours. Conversion to the acid chloride was confirmed by treating a sample of the reaction mixture with Me0H and the resulting methyl ester was observed by LC/MS (3.27 min). The majority of solvent was removed by evaporation under reduced pressure; the resulting concentrated solution was re-dissolved in a minimum amount of dry DCM and triturated with diethyl ether. The resulting yellow precipitate was collected by filtration, washed with cold diethyl ether and dried for 1 hour in a vacuum oven at 40 C. The solid acid chloride was added portionwise over a period of 5 min to a stirred suspension of (2S,4R)-methyl-4-hydroxypyrrolidine-2-carboxylate hydrochloride (1.86 g, 10.2 mmol, 1.15 eq) and TEA (3.10 mL, 2.25 g, 22.2 mmol, 2.5 eq) in DCM (40mL) at -40 C (dry ice/CH3CN). Immediately, the reaction was complete as judged by LC/MS (2.70 min (ES+) m/z (relative intensity) 431.01 ([M +
, 100)) and by TLC (ethyl acetate). The mixture was diluted with DCM (20 mL) and washed with 1N HCI ( 30 mL), saturated NaHCO3 (30 mL), brine (40 mL), dried (Mg504), filtered and the solvent evaporated in vacuo to give the pure product as an orange solid (3.7 g, 94%).
LC/MS (2.70 min (ES+) m/z (relative intensity) 431.01 ([M +
, 100)); 1H NMR (400 MHz, CDCI3) 6 7.70 (d, J = 1.8 Hz, 1H), 7.48 - 7.30 (m, 5H), 6.89 (s, 1H), 5.29 (d, J = 5.5 Hz, 1H), 5.25 (d, J =
7.2 Hz, 1H), 4.84 (t, J = 8.1 Hz, 1H), 4.40 (s, 1H), 3.99 (d, J = 10.0 Hz, 3H), 3.82 (s, 3H), 3.46 (s, 1H), 3.33 (dd, J= 11.3, 4.2 Hz, 1H), 3.12 - 2.96 (m, 1H), 2.51 -2.29 (m, 1H), 2.22 -2.07 (m, 1H).
(ii) (2R,11 aS)-7-(benzyloxy)-2-hydroxy-8-methoxy-2,3-dihydro-1 H-benzo[e]pyrrolo[1, 2-a][1,41diazepine-5,11(10H,11aH)-dione (125) Zinc dust (10 g, 153 mmol, 19 eq (excess)) was added to a solution of nitro-ester 124(3.5 g, 8.1 mmol) in 5% formic acid in methanol (70 mL). An exotherm was observed, followed by reduction of the nitro to the aniline. LC/MS (2.47 min (ES+) m/z (relative intensity) 401.03 ([M + , 100)). The resulting suspension was filtered through celite and washed with methanol (30 mL) to give a clear filtrate. The solvent and residual formic acid were removed by evaporation. The residue was redisolved in methanol and hydrazine hydrate (380 pL, 12.2 mmol) was added to the solution and the reaction mixture was heated at 60 C until completion was observed. LC/MS (2.45 min (ES+) m/z (relative intensity) 369.01 ([M + , 100)). The mixture was allowed to cool down to room temperature, the solvent removed under vacuum, the residue triturated with diethyl ether and the precipitate retrieved by filtration and dried in a vacuum desiccator to provide the desired product as a white powder (2.77 g, 92%). LC/MS (2.45 min (ES+) rn/z (relative intensity) 369.01 ([M +
, 100)). 1H
NMR (400 MHz, DMSO) 6 7.95 (s, 1H), 7.52 - 7.34 (m, 6H), 6.77 (s, 1H), 5.14 (s, 2H), 4.33 (dd, J = 8.9, 4.4 Hz, 1H), 4.19 (dd, J = 8.0, 6.0 Hz, 1H), 3.83 (s, 3H), 3.65 (dd, J = 11.8, 3.3 Hz, 1H), 3.50 - 3.42 (m, 1H), 2.70 - 2.60 (m, 1H), 2.03 - 1.91 (m, 1H).
(iii) (2R,11aS)-7-(benzyloxy)-2-((tert-butylditnethylsily0oxy)-8-tnethoxy-2,3-dihydro-1H-benzolelpyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (/26) TBSCI (5.32g, 35.3 mmol) and imidazole (5.76 g, 84.6 mmol) were added to a solution of the dilactam 125 (2.6 g, 7.1 mmol) in anhydrous DMF (30 mL) at 0 C (ice/acetone).
The mixture was allowed to stir under a nitrogen atmosphere for 3 hours after which time the reaction was deemed complete as judged by LC/MS (3.60 min (ES+) rn/z (relative intensity) 483.09 ([M +
, 100)). The reaction mixture was poured onto ice (- 200 mL) and allowed to warm to room temperature with stirring. The resulting white precipitate was collected by vacuum filtration, washed with H20, redisolved in ethyl acetate, and dried over magnesium sulphate followed by rotoevaporation under vacuum. The residue was purified by flash column chromatography (50 /50 ethyl acetate / hexane) to provide the desired compound (2.42 g, 71%). LC/MS (3.60 min (ES+) rn/z (relative intensity) 483.09 ([M +
, 100)). 1H NMR (400 MHz, CDCI3) 6 8.26 (s, 1H), 7.53 (s, 1H), 7.49 - 7.28 (m, 5H), 6.47 (s, 1H), 5.16 (q, J = 11.9 Hz, 2H), 4.51 (p, J = 5.5 Hz, 1H), 4.19 (dd, J = 8.2, 4.3 Hz, 1H), 3.89 (s, 3H), 3.68 (ddd, J =
27.8, 11.9, 5.4 Hz, 2H), 2.82 (dt, J= 12.7, 4.9 Hz, 1H), 2.17- 1.94(m, 1H), 0.92 - 0.81 (m, 9H), 0.08 (d, J = 3.0 Hz, 6H).
(iv) (2R,11aS)-7-(benzyloxy)-2-((tert-butyldimethylsily0oxy)-8-methoxy-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (/27) A solution of n-BuLi (4.7 mL of a 1.6 M solution in hexane, 7.52 mmol) was added dropwise to a stirred suspension of the dilactam 126 (2.42 g, 5.01 mmol) in anhydrous THF (30 mL) at -60 C under a nitrogen atmosphere. The reaction mixture was allowed to stir at this temperature for 1 hour at which point neat SEMCI (1.33 mL, 1.25 g, 7.51 mmol) was added dropwise. The reaction mixture was allowed to slowly warm to room temperature and was stirred for 2 hours under a nitrogen atmosphere. The reaction was deemed complete as judged by TLC (Et0Ac) and LC/MS (4.30 min (ES+) rn/z (relative intensity) 613.16 ([M + , 100)). The THF was removed by evaporation in vacuo and the resulting residue dissolved in Et0Ac (100 mL), washed with H20 (100 mL), brine (30 mL), dried (Mg504) filtered and evaporated in vacuo to provide the crude N10-SEM-protected dilactam (2.23 g, 72%).
Product carried through to next step without purification. LC/MS (4.30 min (ES+) tniz (relative intensity) 613.16 ([M + , 100)). 1H NMR (400 MHz, CDCI3) 6 7.49 -7.28 (m, 6H), 7.24 (s, 1H), 5.55 - 5.49 (m, 1H), 5.18 (q, J= 11.9 Hz, 2H), 4.68 - 4.61 (m, 1H), 4.56 (p, J=
5.8 Hz, 1H), 4.22 (dd, J = 8.2, 3.8 Hz, 1H), 3.89 (s, 3H), 3.83 - 3.58 (m, 4H), 3.58 - 3.50 (m, 1H), 2.84 (ddd, J = 12.8, 5.5, 4.0 Hz, 1H), 2.05 - 1.96 (m, 1H), 1.04 - 0.89 (m, 6H), 0.89 -0.84 (m, 9H), 0.05 - 0.00 (m, 9H).
(v) (2R,11aS)-2-((tert-butyldimethylsily0oxy)-7-hydroxy-8-methoxy-104(2-(trimethylsilyl)ethoxy)methyl)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (128) Benzyl ether 127 (2.23g, 3.63 mmol) was hydrogenated in ethyl acetate (40 mL) at 40 PSI
overnight in Parr hydrogenator in the presence of 10% Pd/C (220 mg, 10% w/w) after which completion was observed by LC/MS. The solids were removed by filtration over celite and the resulting filtrate was concentrated under vacuum. The resulting residue was found to be of satisfactory purity and was carried through to the next steps without further purification.
(1.90 g, 100%). LC/MS (3.87 min (ES+) m/z (relative intensity) 522.81 ([M+
, 100)). 1H
NMR (400 MHz, CDCI3) 6 7.46 (s, 1H), 7.22 (s, 1H), 6.11 (s, 1H), 5.51 (d, J =
9.9 Hz, 1H), 4.66 (d, J = 8.1 Hz, 1H), 4.57 (p, J = 5.8 Hz, 1H), 4.23 (dd, J = 8.2, 3.8 Hz, 1H), 3.92 (s, 3H), 3.84 - 3.50 (m, 4H), 2.92 - 2.74 (m, 1H), 2.10- 1.90 (m, 1H), 1.06 - 0.89 (m, 2H), 0.89 -0.82 (m, 9H), 0.09 (d, J = 0.9 Hz, 6H), 0.03 (d, J = 3.2 Hz, 9H).
(vi) (2R,11aS)-2-((tert-butyldimethylsily0oxy)-8-methoxy-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (/29) Neat triisopropylsilylchloride (1.55 mL, 1.39 g, 7.24 mmol) was added to a mixture of imidazole (743 mg, 10.9 mmol) and the previously prepared phenol 128 (1.90 g, 3.64 mmol) (ground together). The mixture was heated until the phenol and imidazole melted and went into solution (100 C). The reaction mixture was allowed to stir for 5 mins and was then allowed to cool, whereupon a solid was observed to form at the bottom of the flask. The reaction mixture was diluted with 5% Et0Ac/ hexanes and loaded directly onto silica gel and the column was eluted with 5% Et0Ac/ hexanes, followed by 10% Et0Ac/hexanes.
Excess eluent was removed by rotary evaporation under reduced pressure, followed by drying under high vacuum to afford as an oil (2.5 g, 100 %). LC/MS (4.50 min (ES+) tniz (relative intensity) 679.49 ([M+ , 100)). 1H NMR (400 MHz, CDCI3) 6 7.36 (s, 1H), 7.18 (s, 1H), 5.51 (d, J= 9.9 Hz, 1H), 4.63 (d, J= 9.9 Hz, 1H), 4.55 (p, J= 5.6 Hz, 1H), 4.21 (dd, J= 8.1, 4.1 Hz, 1H), 3.83 (s, 3H), 3.72 - 3.51 (m, 4H), 2.91 -2.75 (m, 1H), 2.10- 1.94 (m, 1H), 1.33 - 1.21 (m, 3H), 1.09 (dd, J = 7.4, 2.0 Hz, 18H), 1.00 - 0.89 (m, 2H), 0.89 -0.81 (m, 9H), 0.08 (s, 6H), 0.03 (s, 9H).
(vii) (2R,11aS)-2-hydroxy-8-methoxy-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (130) The secondary TBS ether 129 (2.5 g, 3.68 mmol) was dissolved in a mixture of 1% v/v conc aq HCI in methanol (20 mL) and THF (5 mL). After stirring for 6h at 20 C, analysis of the reaction mixture by TLC (50:50 v/v Et0Ac/Hexane) revealed that the reaction was almost complete. The reaction mixture was dissolved in Et0Ac (100 mL) and washed with water (2 x 100 mL). The combined organic layers were washed with brine (60 mL), dried (MgSO4), filtered and evaporated under reduced pressure to provide the crude product which was taken directly to the next step as a crude. (2.08 g, 3.68 mmol, 100%). LC/MS
3.77 min (ES+) m/z (relative intensity) 565.29 ([M + , 100).
(viii) (S)-8-methoxy-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-1H-benzolelpyrrolo[1,2-a][1 ,4]diazepine-2,5,11(3H,10H,11aH)-trione (131) TCCA (600 mg, 2.58 mmol, 0.7 eq) was added to a stirred solution of 130 (2.08 g, 3.68 mmol, 1 eq) and TEMPO (57 mg, 0.36 mmol, 0.1 eq) in dry dichloromethane (50 mL) at -10 C (ice/acetone bath). The reaction mixture was vigorously stirred for 20 minutes, at which point TLC (25/75 ethyl acetate/hexane) revealed complete consumption of the starting material. The reaction mixture was filtered through celite and the filtrate washed with aqueous saturated sodium bicarbonate (50 mL), sodium thiosulphate (1.5 g in 50 mL), brine (100 mL) and dried over magnesium sulphate. Rotary evaporation under reduced pressure followed by flash column chromatography (gradient elution: 90:10 v/v Hexane/Et0Ac to 80:20 v/v Hexane/Et0Ac) afforded the desired product (1.40 g, 67%). LC/MS 3.87 min (ES+) m/z (relative intensity) 563.05 ([M+ , 100); 1H NMR (400 MHz, CDCI3) 6 7.35 (s, 1H), 7.22 (s, 1H), 5.55 (d, J = 9.9 Hz, 1H), 4.69 (d, J = 9.9 Hz, 1H), 4.63 (dd, J = 9.9, 3.1 Hz, 1H), 4.23 (d, J = 20.1 Hz, 1H), 3.91 - 3.83 (m, 4H), 3.79 (td, J = 9.7, 6.7 Hz, 1H), 3.68 (td, J
= 9.7, 6.7 Hz, 1H), 3.56 (dd, J= 19.2, 3.1 Hz, 1H), 2.78 (dd, J= 18.2, 9.9 Hz, 1H), 1.34 -1.21 (m, 3H), 1.10 (d, J= 7.3 Hz, 18H), 0.98 (ddd, J= 9.6, 6.5, 4.1 Hz, 2H), 0.05 - 0.01 (m, 9H).
(ix) (S)-8-methoxy-5,11-dioxo-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-5,10,11,11 a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-2-y1 trifluoromethanesulfonate (132) Triflic anhydride (1.24 mL, 2.08 g, 7.37 mmol, 3 eq) was injected (temperature controlled) to a vigorously stirred suspension of ketone 131 (1.40 g, 2.49 mmol, 1 eq) in dry dichloromethane (50 mL) in the presence of 2,6-lutidine (1.16 mL, 1.06 g, 9.96 mmol, 4 eq, dried over sieves) at -50 C (acetone/dry ice bath). The reaction mixture was allowed to stir for 1.5 hours when LC/MS, following a mini work-up (water/dichloromethane), revealed the reaction to be complete. Water was added to the still cold reaction mixture and the organic layer was separated and washed with saturated sodium bicarbonate, brine and magnesium sulphate. The organic phase was filtered and excess solvent was removed by rotary evaporation under reduced pressure. The residue was subjected to column flash chromatography (gradient elution: 95:5 v/v Hexane/Et0Ac to 80:20 v/v Hexane/Et0Ac) afforded the desired product (1.34 g, 77%). LC/MS (Method 2) 4.08 min (ES+) tniz (relative intensity) 716.82 ([M+ Na], 100). 1H NMR (400 MHz, CDCI3) 6 7.34 (s, 1H), 7.22 (s, 1H), 7.11 (t, J = 2.0 Hz, 1H), 5.55 (d, J = 9.9 Hz, 1H), 4.69 (d, J = 9.9 Hz, 1H), 4.63 (dd, J = 11.0, 3.7 Hz, 1H), 3.91 (ddd, J= 16.3, 3.7, 1.8 Hz, 1H), 3.86 (s, 3H), 3.80 (td, J=
9.5, 7.1 Hz, 1H), 3.69 (td, J= 9.5, 7.1 Hz, 1H), 3.16 (ddd, J= 16.3, 11.1, 2.4 Hz, 1H), 1.34-1.20 (m, 3H), 1.10 (d, J = 7.2 Hz, 18H), 1.02 - 0.94 (m, 2H), 0.05 - 0.01 (m, 9H).
(x) (S)-8-methoxy-2-(6-methoxynaphthalen-2-y1)-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-1 H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11 (10H,11aH)-dione (/33) Pd(PPh3)4 (112 mg, 95.2 pmol, 0.05 eq) was added to a stirred mixture of enol triflate 132 (1.35 g, 1.94 mmol), 6-methoxy-2-naphthylboronic acid (1.02 g, 5.05 mmol, 2.6 eq), K3PO4 (1.07 g, 5.04 mmol), dioxane (15 mL). The reaction mixture was allowed to stir under a argon atmosphere for 2 hours at 35 C after which time the complete consumption of starting material was observed by TLC (Et0Ac/Hexane) and LC/MS (4.22 min (ES+) tniz (relative intensity) 702.88 ([M + , 100)). The reaction mixture was diluted with Et0Ac (100 mL) and washed with brine (200 mL), dried (Mg504), filtered and evaporated under reduced pressure to provide the crude product. Purification by flash chromatography (gradient elution: 90:10 v/v Hexane/Et0Ac to 70:30 v/v Hexane/Et0Ac) afforded the TIPS
protected C2-aryl which was immediately redissolved in wet DMF (50/1 DMF/water v/v).
Solid lithium acetate (198 mg, 1.94 mmol, 1 eq) was added and the reaction allowed to proceed for 3 hours at 40 C followed by three days at -20 C. The reaction mixture was diluted with ethyl acetate and washed with citric acid (pH - 3), water and brine. The organic layer was dried over magnesium sulphate filtered and excess ethyl acetate was removed by rotary evaporation under reduced pressure to provide the deprotected material (1.17g, Quantitative). : LC/MS (3.33 min (ES+) tniz (relative intensity) 546.77 ([M +
, 100)).
Example 1 SEM SEM
= 111 HO 0 o N
OMe 116 Nis-&
fiqr0 N 11" O HMe 0 11111;11 21µ1 0 /(:)\0./N3 Fff. 00 r" H
cfN,r (a) (S)-7-methoxy-2-methy1-84(5-(((S)-2-methyl-5,11-dioxo-7-(prop-2-yn-1-yloxy)-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,41diazepin-5 8-yl)oxy)pentyl)oxy)-104(2-(trimethylsilyl)ethoxy)methyl)-1 H-benzo[e]pyrrolo[1, 2-a][1,41diazepine-5,11 (10H,11aH)-dione (1) Tetrabutylammonium iodide (34 mg, 0.093 mmol, 0.2 eq), potassium carbonate (96 mg, 0.694 mmol, 1.5 eq) and propargyl bromide (0.1 mL, 0.973 mmol, 2.1 eq) were added to a solution of alcohol 118 (400 mg, 0.463 mmol) of dimethylformamide (10 mL). The reaction mixture was stirred for 1 hour at 70 C after when the reaction was observed to be complete by LC/MS. The reaction mixture was diluted with ethyl acetate and washed with water three times, brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to provide the desired product (448 mg, quantitative). LC/MS (Method 3) 2.04 min, no ionisation, 1H NMR (400 MHz, CDC13) 6 7.52 (s, 1H), 7.35 (s, 1H), 7.23 (s, 1H), 7.20 (s, 1H), 6.67 (s, 2H), 5.52 (dd, J=
10.0, 4.2 Hz, 2H), 4.78 (t, J = 2.5 Hz, 2H), 4.68 (dd, J = 10.0, 7.8 Hz, 2H), 4.46 (dt, J = 10.4, 3.4 Hz, 2H), 4.14 ¨ 4.00 (m, 4H), 3.90 (s, 3H), 3.84 ¨ 3.73 (m, 2H), 3.73 ¨ 3.62 (m, 2H), 3.44 (d, J = 16.6 Hz, 2H), 2.80 ¨ 2.72 (m, 2H), 2.52 (t, J = 2.4 Hz, 1H), 1.99 ¨ 1.92 (m, 4H), 1.83 (s, 3H), 1.83 (s, 3H), 1.75¨ 1.68 (m, 2H), 0.97 (ddd, J= 9.7, 6.7, 3.0 Hz, 4H), 0.01 (s, 18H).
(b) (S)-7-methoxy-2-methyl-84(5-(((S)-2-methyl-5-oxo-7-(prop-2-yn-1 -yloxy)-5,1 la-dihydro-1 H-benzo[e]pyrrolo[1,2-a][1 ,4]diazepin-8-y0oxy)pentyl)oxy)-1H-benzo[e]pyrrolo[1 ,2-41-1,41diazepin-5(11aH)-one (2) Compound 1 (500 mg, 0.55 mmol) was dissolved in dry THF (15 mL) and cooled to -78 C.
Lithium triethylborohydride (1.39 mL, 1.39 mmol, 2.5 eq) was then added dropwise. The reaction was stirred under argon at -78 C. After 30 minutes, the cold bath was removed and water added. The reaction mixture was extracted with ethyl acetate and washed with brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was dissolved with a mixture of dichloromethane / methanol / water (3 / 6 / 1, 6 mL / 12 mL / 2 mL). Silica gel was added until the solution gets thick and left stirring at ambient temperature for 5 days. The reaction mixture was filtered and washed with brine, dried over magnesium sulphate;
filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to column flash chromatography (silica gel; 5% methanol /
chloroform). Pure fractions were collected and combined, and excess eluent was removed by rotary evaporation under reduced pressure afforded the desired product (240 mg, 72 A).
LC/MS (Method 3) 1.88 min, (ES+) m/z (relative intensity) 608.68 [M + H], 1H
NMR (400 MHz, CDCI3) 6 7.80 (d, J = 4.1 Hz, 1H), 7.79 (d, J = 4.1 Hz, 1H), 7.63 (s, 1H), 7.48 (s, 1H), 6.78(s, 1H), 6.77(s, 1H), 6.72 (br, 2H), 4.81 ¨ 4.76 (m, 2H), 4.28 ¨ 4.18 (m, 2H), 4.12 ¨
4.01 (m, 4H), 3.91 (s, 3H), 3.24 ¨ 3.09 (m, 2H), 2.94 (dd, J = 16.8, 5.0 Hz, 2H), 2.52 (t, J =
2.3 Hz, 1H), 1.99 ¨ 1.85 (m, 4H), 1.81 (s, 6H), 1.71 ¨ 1.60 (m, 2H).
(c) 3-(2,5-dioxo-2,5-dihydro-1 H-pyrrol-1-y1)-N-(2-(2-(2-(2-(4-((((S)-84(5-(((S)-7-methoxy-2-methy1-5-oxo-5,1 1 a-dihydro-1 H-benzo[e]pyrrolo[1 ,2-a][1 , 4]diazepin-8-y0oxy)pentyl)oxy)-2-methy1-5-oxo-5,1 1 a-dihydro-1 H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-7-y0oxy)methyl)-1 H-1 ,2,3-triazol-1-yOethoxy)ethoxy)ethoxy)ethyl)propa na mide (5) Azide 4 (64 pL, 0.328 mmol, 1.2 eq) was added to a solution of succinimide 3 (100 mg, 0.375 mmol, 1.3 eq) in dry DMSO (2 mL) and the reaction mixture was stirred at ambient temperature for 12 hours. In another round bottom flask, compound 2 (170 mg, 0.279 mmol) was dissolved in tert-butanol (2 mL). Water (2 mL) was added followed by sodium ascorbate (11 mg, 0.056 mmol, 0.2 eq) and copper sulphate (4 mg, 0.014 mmol, 0.05 eq).
The reaction mixture (with reacted 4 and3) in DMSO was then added to the reaction mixture in water /
tert-butanol. The reaction mixture was degassed with argon and stirred at ambient temperature. The reaction was complete after 1 hour and then diluted with dichloromethane and washed with water two times, brine, dried over magnesium sulphate;
filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to column flash chromatography (silica gel; 2% to 10% methanol /
chloroform). Pure fractions were collected and combined, and excess eluent was removed by rotary evaporation under reduced pressure afforded the desired product (40 mg, 15 A).
LC/MS (Method 3) 1.29 min, (ES+) m/z (relative intensity)978.40 [M +
Example 2 SEM SEM
0 jEM SIEM o 0 0 \ 0 N 1110 '.-c) 6 H OMe 0 IS I\
0 0 0 7 y 0 H N
ALLOC
OMe 0 1111" N OMe 0 111)11 c.
ALLOC
OMe N
(a) allyl (3-(((S)-84(5-(((S)-7-methoxy-2-methy1-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-10 8-y0oxy)pentyl)oxy)-2-methyl-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-7-yl)oxy)propyl)carbamate (7) Tetrabutylammonium iodide (34 mg, 0.093 mmol, 0.2 eq), potassium carbonate (96 mg, 0.694 mmol, 1.5 eq) and 6 (154 mg, 0.695 mmol, 1.5 eq) were added to a solution of alcohol 118 (400 mg, 0.463 mmol) in dimethylformamide (5 mL). The reaction mixture was stirred for 1 hour at 70 C after when the reaction was observed to be complete by LC/MS.
The reaction mixture was diluted with ethyl acetate and washed with water three times, brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to provide the desired product (420 mg, 90%).
LC/MS (Method 3) 2.05 min, (ES+) m/z (relative intensity)863.35 [M + H], 1H
NMR (400 MHz, CDC13) 6 7.33 (s, 1H), 7.31 (s, 1H), 7.18 (s, 1H), 7.17 (s, 1H), 6.64 (br, 2H), 5.87 (ddd, J = 22.7, 10.9, 5.7 Hz, 1H), 5.57 (br, 1H), 5.48 (dd, J = 10.0, 3.0 Hz, 2H), 5.22 (dd, J = 18.3, 1.4 Hz, 1H), 5.15 (dd, J= 10.4, 1.2 Hz, 1H), 4.67 (t, J= 9.9 Hz, 2H), 4.51 (d, J= 5.5 Hz, 2H), 4.44 (ddd, J = 10.4, 5.2, 3.3 Hz, 2H), 4.16 ¨ 3.99 (m, 6H), 3.87 (s, 3H), 3.79 ¨ 3.72 (tdd, 2H), 3.70 ¨ 3.59 (m, 2H), 3.43 (br, 1H), 3.42 ¨ 3.34 (m, 3H), 2.73 (dd, J= 16.6, 10.5 Hz, 2H), 2.04 - 1.88 (m, 6H), 1.80 (s, 6H), 1.66 (d, J = 7.0 Hz, 2H), 0.94 (ddt, J = 9.4, 6.6, 2.5 Hz, 4H), 0.01 (s, 18H).
(b) Allyl (3-(((S)-84(5-(((S)-7-methoxy-2-methy1-5-oxo-5,11a-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methyl-5-oxo-5,11a-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-7-y0oxy)propyl)carbamate (8) Compound 7 (580 mg, 0.55 mmol) was dissolved in dry THF (15 mL) and cooled to -78 C.
Lithium triethylborohydride (1.44 mL, 1.44 mmol, 2.5 eq) was then added dropwise. The reaction was stirred under argon at -78 C. After 30 minutes, the cold bath was removed and water added. The reaction mixture was extracted with ethyl acetate and washed with brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was dissolved with a mixture of dichloromethane / methanol / water (3 / 6 / 1, 6 mL / 12 mL / 2 mL). Silica gel was added until the solution gets thick and left stirring at ambient temperature for 5 days. The reaction mixture was filtered and washed with brine, dried over magnesium sulphate;
filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to column flash chromatography (silica gel; 5% methanol /
chloroform). Pure fractions were collected and combined, and excess eluent was removed by rotary evaporation under reduced pressure afforded the desired product (220 mg, 54 A).
LC/MS (Method 3) 1.41 min, (ES+) m/z (relative intensity)712.40 [M + H], 1H
NMR (400 MHz, CDCI3) 6 7.80 (dd, J = 3.9, 1.0 Hz, 2H), 7.49 (s, 1H), 7.47 (s, 1H), 6.78 (s, 2H), 6.73 (d, J= 1.3 Hz, 2H), 5.96 - 5.83 (m, 1H), 5.68 (br, 1H), 5.27 (d, J= 17.2 Hz, 1H), 5.17 (dd, J=
10.4, 1.2 Hz, 1H), 4.54(d, J= 5.1 Hz, 2H), 4.28 - 4.16 (m, 2H), 4.16 - 4.00 (m, 6H), 3.91 (s, 3H), 3.48 (br, 1H), 3.50 - 3.38 (m, 2H), 3.36 - 3.34 (m, 1H), 3.24 - 3.11 (m, 2H), 2.95 (dd, J
= 16.8, 4.8 Hz, 2H), 2.05 - 2.00 (m, 2H), 1.99 - 1.89 (m, 4H), 1.83 (s, 6H).
(c) (S)-7-(3-aminopropoxy)-84(5-(((S)-7-methoxy-2-methy1-5-oxo-5,11a-dihydro-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methyl-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-5(11aH)-one (9) Tetrakis(triphenylphosphine)palladium(0) (7 mg, 0.006 mmol, 0.06 eq) was added to a solution of 8 (80 mg, 0.112 mmol) and pyrrolidine (23 pL, 0.28 mmol, 2.5 eq) in dry dichloromethane (2 mL). The reaction was flushed with argon three times and stirred 3 hours at room temperature. Then the reaction was diluted with dichloromethane and washed sequentially with saturated aqueous ammonium chloride and brine. The organic phase was dried over magnesium sulphate filtered and excess dichloromethane removed by rotary evaporation under reduced pressure. The resulting residue was used as a crude mixture for the next reaction. LC/MS (Method 3) 1.05 min, (ES+) m/z (relative intensity) 628.35 [M +
H].
(d) 1-(3-(2, 5-dioxo-2, 5-dihydro-1 H-pyrrol-1-yl)propa na mido)-N-(3-(((S)-84(5-(((S)-7-meth oxy-2-methyl-5-oxo-5,11 a-d ihydro-1 H-be nzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methy1-5-oxo-5,11 a-dihyd ro-1 H-benzo[e]pyrrolo[1 ,2-a][1 ,4]diazepi n-7-yl)oxy)propyI)-3, 6,9,12,15,18, 21 ,24-octaoxaheptacosan-27-amide (10) 1-ethyl-3-(3'-dimethylaminopropyl)carbodiimide (EDCI, 11 mg, 0.060 mmol, 1.1 eq) was added to a solution of crude 9 (0.056 mmol) and Mal-(PEG)8-acid (35 mg, 0.060 mmol, 1.1 eq) in dry dichloromethane (2 mL). The reaction was degassed three times with Argon and stirred for 1 hours and the presence of starting material was no longer observed by LC/MS.
The reaction was diluted with dichloromethane and washed sequentially with water and brine. The organic phase was dried over magnesium sulphate filtered and excess dichloromethane removed by rotary evaporation under reduced pressure. The resulting residue was subjected to flash column chromatography (silica gel; 100%
chloroform to 10%
methanol in chloroform). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the desired product (19 mg, 28% over 2 steps). LC/MS (Method 3) 1.30 min, (ES+) m/z (relative intensity) 1202.55 [M +
H]. 1H NMR (400 MHz, CDCI3) 6 7.79 (d, J = 4.0 Hz, 1H), 7.48(d, J= 5.1 Hz, 1H), 6.77(d, J
= 1.8 Hz, 1H), 6.72 (d, J = 3.5 Hz, 1H), 6.68 (s, 2H), 6.45 ¨ 6.34 (m, 1H), 4.59 ¨ 4.48 (m, 1H), 4.28 ¨ 4.20 (m, 1H), 4.18 ¨ 3.95 (m, 6H), 3.91 (s, 2H), 3.86 ¨ 3.75 (m, 4H), 3.75 ¨ 3.67 (m, 2H), 3.63 ¨ 3.58 (m, 28H), 3.54 ¨ 3.49 (m, 2H), 3.49 ¨ 3.36 (m, 6H), 3.35 ¨ 3.34 (m, 1H), 3.20 ¨ 3.13 (m, 2H), 2.94 (d, J= 16.8 Hz, 2H), 2.50 (t, J= 7.2 Hz, 2H), 2.46 ¨
2.37 (m, 2H), 2.07 ¨ 1.99 (m, 2H), 1.97 ¨ 1.91 (m, 4H), 1.82 (s, 3H), 1.77 (s, 3H), 1.69 ¨
1.63 (m, 2H), 0.90 ¨ 0.77 (m, 1H).
Example 3 SEM
k 0 HO 1-/Sla ao 0 +OS u + H 2 () (:)/ N3 (a) (S)-2-methylene-7-(prop-2-yn-1-yloxy)-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzolelpyrrolo[1,2-4-1,41diazepine-5,11(10H,11aH)-dione (11) Propargyl bromide (149 pL, 158 mg, 1.33 mmol, 1.05 eq) was added to a suspension of phenol 122 (477 mg, 1.27 mmol, leg), TBAI (47 mg, 0.127 mmol, 0.1eq), and potassium carbonate (132 mg, 0.96 mmol, 0.75 eq) in dry DMF (10 mL), and stirred at 75 C
for 1 hour when completion was observed. The reaction mixture was partitioned between ethyl acetate (100 mL) and water (100mL). The organics were further washed with water (2 x 100 mL), brine (50 mL) and dried over magnesium sulphate. Yield = 420 mg (80%). LC/MS
(3.43 min (ES+) m/z (relative intensity) 413.07 ([M +
, 100)); 1H NMR (400 MHz, CDCI3) 6 7.63 (dd, J = 9.0, 1.7 Hz, 1H), 7.44 (d, J = 3.1 Hz, 1H), 7.17 - 7.11 (m, 1H), 5.48 (dd, J = 9.9, 1.5 Hz, 1H), 5.22 - 5.07 (m, 2H), 4.74 (d, J = 2.7 Hz, 2H), 4.68 (d, J = 9.2 Hz, 1H), 4.40 - 4.14 (m, 3H), 3.69 (dtd, J= 16.8, 9.6, 7.7 Hz, 2H), 3.43 (d, J= 15.9 Hz, 1H), 2.88 -2.71 (m, 1H), 2.60 - 2.47 (m, 1H), 1.04 - 0.88 (m, 2H), 0.08 - -0.06 (m, 9H).
(b) (S)-2-methylene-7-(prop-2-yn-1-yloxy)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,41diazepin-5(11aH)-one (12) 1M superhydride solution in THF (1.32 mL, 1.3 eq) was injected slowly to a solution of dilactam 11 (420 mg, 1.02 mmol, 1eq ) in THF at -78 C. The reaction was monitored for 1 hour after which time the complete conversion of starting material directly was observed by LC/MS (3.02 min (ES+) m/z (relative intensity) 267.10 ([M +
, 100)). The reaction mixture was carefully diluted with H20 (500 mL) and extracted with ethyl acetate (50 mL). The combined organic layers were washed with water (1 x 50 mL), brine (1 x 20 mL), dried over MgSO4, filtered and evaporated under reduced pressure at 35 C to provide the intermediate SEM-carbinolamine. The white solid were immediately dissolved in Et0H (40 mL), DCM
(15mL) and H20 (5 mL) and treated with flash silica gel (30 g). The thick suspension was allowed to stir at room temperature for 72 hours after which time the formation of a significant quantity of desired product was observed by TLC (95:5 v/v CHC13/Me0H). The reaction mixture was filtered through a very wide porosity 3 sinter funnel and the pad rinsed slowly and thoroughly with 90:10 v/v CHC13/Me0H until no further product eluted (checked by TLC). The filtrate was washed with brine (300 mL), dried (MgSO4), filtered and evaporated in vacuo, followed by high vacuum drying, to provide the crude product.
Purification by flash chromatography (gradient elution: 100% HPLC grade CHCI3 to 98:2 v/v CHC13/Me0H) gave the desired product as a mixture of carbinolamine ethers and imine (155 mg, 57%). In order to obtain an NMR sample, material (10 mg) was treated with HPLC
grade CHCI3 (50 mL) and allowed to stand overnight to promote the formation of the imine form. The solvent was removed by evaporation under reduced pressure, and the residue was again treated with HPLC grade CHCI3 (50 mL) and allowed to stand for 4 hours.
LC/MS (2.28 min (ES+) m/z (relative intensity) 267.10 ([M +
, 100)); 1H NMR (400 MHz, CDCI3) 6 7.71 (d, J = 4.4 Hz, 1H), 7.60 (d, J = 3.0 Hz, 1H), 7.29 (d, J = 8.8 Hz, 1H), 7.17 (dd, J = 8.8, 3.0 Hz, 1H), 5.23 - 5.19 (m, 1H), 5.18 (s, 1H), 4.79 - 4.75 (m, 2H), 4.32 - 4.26 (m, 1H), 3.89 (s, 1H), 3.78 - 3.69 (m, 1H), 3.49 (d, J= 5.5 Hz, 1H), 3.12 (dd, J=
16.1, 9.1 Hz, 1H), 2.96 (dd, J = 3.0, 1.4 Hz, 1H).
(c) (S)-3-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-y1)-N-(2-(2-(2-(2-(4-(((2-methylene-5-oxo-2,3,5, 11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-7-y0oxy)methyl)-1H-1,2,3-triazol-1-yl)ethoxy)ethoxy)ethoxy)ethyl)propanamide (13) Amino-(Peg)3-azide 4 (86.1 mg, 78pL,0.39 mmol 1.05 eq) was added to a solution of maleimide succinimide 3 (100 mg, 0.38 mmol, 1 eq) in DMSO (0.5 mL) at 25 C and reacted for 45 minutes. This solution was added to a mixture of propargyl-PBD 12 (100 mg, 0.38 mmol, 1 eq), sodium ascorbate (15 mg, 0.076 mmol, 0.2 eq), and copper sulphate (4.69 mg, 0.018 mmol, 0.05 eq) in tert-butanol/water 1/1 v/v (1.2 mL). The reaction was degazed and allowed to proceed under argon. After 2 hours, the LC/MS profile of the reaction was judged encouraging with significant formation of product alongside the amino-(peg)3-PBD. When allowed to proceed overnight, the LC/MS profile became poorer. The reaction mixture was partitioned between chloroform/methanol (90/10, v/v) and water. The organics were washed with water, followed by brine and dried over magnesium sulphate. The volatiles were removed by rotoevaporation under vacuum. The residue was purified by flash column chromatography (gradient methanol/chloroform 1/99 to 20/80). The product (dark spot under UV) came as mixed fractions with the amino-(peg)3-PBD (blue glow under UV) and was further purified by preparative TLC (25 mg, 10%). LC/MS (2.28 min (ES+) tniz (relative intensity) 636.16 ([M + , 100)); 1H NMR (400 MHz, CDCI3) 6 7.90 (s, 1H), 7.71 (d, J = 4.4 Hz, 1H), 7.61 (d, J = 2.9 Hz, 1H), 7.29(d, J= 8.8 Hz, 1H), 7.18 (dd, J= 8.8, 3.0 Hz, 1H), 6.67 (s, 2H), 6.46 (s, 1H), 5.26 (d, J = 7.1 Hz, 1H), 5.23 - 5.16 (m, 2H), 4.61 - 4.53 (m, 2H), 4.32 - 4.25 (m, 1H), 3.94 - 3.87 (m, 2H), 3.82 (t, J = 7.2 Hz, 2H), 3.65 -3.53 (m, 10H), 3.52 -3.46 (m, 3H), 3.43 - 3.35 (m, 2H), 3.14 (dd, J= 16.0, 9.0 Hz, 1H), 2.95 (dd, J= 16.0, 1.5 Hz, 1H), 2.49 (t, J= 7.2 Hz, 2H).
Example 4 SEM SEM
HO 4111111fr 0 tilo&
OMe 0 OMe O S + cg N__ H
al OMe 0 H
OMe (a) (S)-8-methoxy-2-(6-methoxynaphthalen-2-y1)-7-(prop-2-yn-1-yloxy)-10-((2-15 (trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11 (10H,11aH)-dione (14) Propargyl bromide (251pL, 2.24 mmol 1.05 eq) was added to a suspension of crude phenol 133 (1.17g, 2.14 mmol, 1 eq), TBAI (79mg, 0.21 mmol, 1 eq) and potassium carbonate (221mg, 1.60 mmol, 0.75 eq) in dry DMF (10 mL), and stirred at 75 C for 1 hour when completion was observed. The reaction mixture was partitioned between ethyl acetate (100 mL) and water (100mL). The organics were further washed with water (2 x 100 mL), brine (50 mL) and dried over magnesium sulphate. The residue was subjected to column flash chromatography (gradient elution: 35:65 v/v Hexane/Et20 to 0:100 v/v Hexane/Et20) afforded the desired product (594 mg, 47% from crude, 52% over three steps).
LC/MS (3.85 min (ES+) m/z (relative intensity) 584.92 ([M + , 100)); [a]21D = +345 (c = 0.229, Chloroform); 1H NMR (400 MHz, CDCI3) 6 7.75 - 7.64 (m, 3H), 7.64 - 7.55 (m, 2H), 7.52 (s, 1H), 7.32(s, 1H), 7.19 - 7.08 (m, 2H), 5.59 (d, J= 10.0 Hz, 1H), 4.92 - 4.77 (m, 2H), 4.71 (dd, J = 10.4, 3.8 Hz, 2H), 4.08 (ddd, J = 16.0, 3.3, 1.7 Hz, 1H), 3.97 - 3.89 (m, 6H), 3.83 (td, J= 9.4, 7.2 Hz, 1H), 3.72 (td, J= 9.4, 7.1 Hz, 1H), 3.27 (ddd, J= 15.9, 10.6, 2.1 Hz, 1H), 2.56 (t, J = 2.4 Hz, 1H), 1.05 - 0.95 (m, 2H), 0.07 - 0.02 (m, 9H).
(b) (S)-8-methoxy-2-(6-methoxynaphthalen-2-y1)-7-(prop-2-yn-1-yloxy)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-5(11aH)-one (15) 1M superhydride solution in THF (1.27 mL, 1.27 mmol, 1.3 eq) was injected slowly to a solution of dilactam 14 (573 mg, 0.98 mmol, 1 eq) in THF (10 mL) at -78 C. The reaction was monitored for 1 hour after which time the complete conversion of starting material directly was observed by LC/MS (3.03 min (ES+) m/z (relative intensity) 456.88 ([M + , 100)). The reaction mixture was carefully diluted with H20 (500 mL) and extracted with chlorofom (50 mL). The combined organic layers were washed with water (1 x 50 mL), brine (1 x 20 mL), dried over Mg504, filtered and evaporated under reduced pressure at 35 C to provide the intermediate SEM-carbinolamine. The white solid were immediately dissolved in Et0H (40 mL), DCM (15mL) and H20 (5 mL) and treated with flash silica gel (30 g). The thick suspension was allowed to stir at room temperature for 72 hours after which time the formation of a significant quantity of desired product was observed by TLC
(95:5 v/v CHC13/Me0H). The reaction mixture was filtered through a very wide porosity 3 sinter funnel and the pad rinsed slowly and thoroughly with 90:10 v/v CHC13/Me0H until no further product eluted (checked by TLC). The filtrate was washed with brine (100 mL), dried (Mg504), filtered and evaporated in vacuo, followed by high vacuum drying, to provide the crude product. Purification by flash chromatography (Ethyl acetate) gave the desired product (100 mg, 23%). In order to obtain an NMR sample, material (10 mg) was treated with HPLC grade CHCI3 (50 mL) and allowed to stand overnight to promote the formation of the imine form. The solvent was removed by evaporation under reduced pressure, and the residue was again treated with HPLC grade CHCI3 (50 mL) and allowed to stand for 4 hours.
LC/MS (3.03 min (ES+) m/z (relative intensity) 456.88 ([M + H2O], 100)); 1H
NMR (500 MHz, CDCI3) 6 7.96 (d, J = 4.0 Hz, 1H), 7.74 - 7.68 (m, 3H), 7.63 - 7.57 (m, 3H), 7.19 -7.09 (m, 2H), 6.87 (s, 1H), 4.87 (dd, J = 4.6, 2.4 Hz, 2H), 4.49 (ddd, J =
11.6, 5.1, 4.1 Hz, 1H), 3.99 - 3.91 (m, 6H), 3.72 (ddd, J= 16.1, 11.5, 2.0 Hz, 1H), 3.53 (ddd, J=
16.2, 5.1, 1.7 Hz, 1H), 2.56 (t, J = 2.4 Hz, 1H).
(c) (S)-3-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-y1)-N-(2-(2-(2-(2-(4-(((8-methoxy-2-(6-methoxyn ap hthale n-2-y1)-5-oxo-5, 11 a-dihyd ro-1 H-benzo[e]pyrrolo[1 , 2-4[1 ,4]diazepin-7-yl)oxy)methyl)-1H-1,2,3-triazol-1-y1)ethoxy)ethoxy)ethoxy)ethyl)propanamide (16) Amino-(Peg)3-azide 4 (34.2pL, 37.6 mg, 0.17 mmol, 0.9 eq) was added to a solution of maleimide succinimide 3 (56.1mg, 0.21 mmol, 1.1 eq) in DMSO (0.5 mL) at 25 C
and reacted for 45 minutes. This solution was added to a mixture of propargyl-PBD
15 (84 mg, 0.19 mmol, 1 eq), sodium ascorbate (7.6 mg, 0.038 mmol, 0.2 eq), and copper sulphate (2.4 mg, 0.010 mmol, 0.05 eq) in tert-butanol/water 1/1 v/v (1 mL). DMSO (2.5 mL) to improve solubility. The reaction was degazed and allowed to proceed under argon. After 5 hours, the LC/MS profile of the reaction showed significant formation of product. The reaction mixture was partitioned between chloroform and water. The organics were washed with water, followed by brine and dried over magnesium sulphate. The volatiles were removed by rotoevaporation under vacuum. The residue was purified by flash column chromatography (gradient methanol/chloroform 1/99 to 5/95) to give the desired product.
Yield: 64 mg (41%).
LC/MS (2.85 min (ES+) m/z (relative intensity) 808.61 ([M + , 100)); 1H NMR
(500 MHz, CDCI3) 6 7.96 (d, J = 4.0 Hz, 1H), 7.94 (s, 1H), 7.74 - 7.68 (m, 3H), 7.64 -7.56 (m, 3H), 7.19 - 7.10 (m, 2H), 6.86 (s, 1H), 6.65 (s, 2H), 6.44(s, 1H), 5.33 (q, J= 11.9 Hz, 2H), 4.60 -4.54 (m, 2H), 4.50 (dt, J = 9.1, 5.0 Hz, 1H), 3.95 - 3.88 (m, 8H), 3.82 (t, J
= 7.3 Hz, 2H), 3.77 - 3.65 (m, 2H), 3.65 - 3.58 (m, 5H), 3.58 - 3.51 (m, 3H), 3.52 - 3.47 (m, 2H), 3.39 (dd, J =
10.6, 5.3 Hz, 2H), 2.49 (td, J = 7.0, 0.8 Hz, 2H).
Example 5 General antibody conjugation procedure Antibodies are diluted to 1-5 mg/mL in a reduction buffer (examples: phosphate buffered saline PBS, histidine buffer, sodium borate buffer,TRIS buffer). A freshly prepared solution of TCEP (tris(2-carboxyethyl)phosphine hydrochloride) is added to selectively reduce cysteine disulfide bridges. The amount of TCEP is proportional to the target level of reduction, within 1 to 4 molar equivalents per antibody, generating 2 to 8 reactive thiols.
After reduction for several hours at 37 C, the mixture is cooled down to room temperature and excess drug-linker (5, 10, 13, 16) added as a diluted DMSO solution (final DMSO content of up to 10%
volume/volume of reaction mixture). The mixture was gently shaken at either 4 C or room temperature for the appropriate time, generally 1-3 hours. Excess reactive thiols can be reacted with a `thiol capping reagent' like N-ethyl maleimide (NEM) at the end of the conjugation. Antibody-drug conjugates are concentrated using centrifugal spin-filters with a molecular weight cut-off of 10 kDa or higher, then purified by tangential flow filtration (TFF) or Fast Protein Liquid Chromatography (FPLC). Corresponding antibody-drug conjugates can be determined by analysis by High-Performance Liquid Chromatography (HPLC) or Ultra-High-Performance Liquid Chromatography (UHPLC) to assess drug-per-antibody ratio (DAR) using reverse-phase chromatography (RP) or Hydrophobic-Interaction Chromatography (HIC), coupled with UV-Visible, Fluorescence or Mass-Spectrometer detection; aggregate level and monomer purity can be analysed by HPLC or UHPLC
using size-exclusion chromatography coupled with UV-Visible, Fluorescence or Mass-Spectrometer detection. Final conjugate concentration is determined by a combination of spectroscopic (absorbance at 280, 214 and 330 nm) and biochemical assay (bicinchonic acid assay BCA; Smith, P.K., et al. (1985) Anal. Biochem. 150 (1): 76-85;
using a known-concentration IgG antibody as reference). Antibody-drug conjugates are generally sterile filtered using 0.2 urn filters under aseptic conditions, and stored at +4 C, -20 C or -80 C.
Examples of particular conjugations are described below.
Conjugate Al (Herceptin-10, ConjA) HerceptinTM (2.0 mg, 13.3 nanomoles) was diluted into 1.8 mL of a reduction buffer containing 10 mM sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 10 mM solution of TCEP was added (2 molar equivalent/antibody, 26.6 nanomoles, 2.66 4) and the reduction mixture was heated at +37 C for 2.5 hours in a heating block. After cooling down to room temperature, compound 10 was added as a DMSO solution (3.5 molar equivalent/antibody, 45 nanomoles, in 0.2 mL DMSO).
The solution was mixed for 2 hour at room temperature, then the conjugation was quenched by addition of N-ethyl maleimide (1 micromole, 104 at 100 mM) followed 15 minutes later by N-acetyl cystein ( 1.5 micromoles, 154 at 100 mM), then injected into a AKTATmFPLC using a GE Healthcare XK16/70 column packed with Superdex 200 PG, eluting with 1.5 mL/min of sterile-filtered Phosphate-buffered saline (PBS). Fractions corresponding to ConjA1 monomer peak were pooled, concentrated using a 15mL Amicon Ultracell 50KDa MWCO
spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjA at 1.49 mg/mL in 1.2 mL, obtained mass of ConjA1 is 1.79 mg (90% yield).
UHPLC analysis on a Shimadzu Prominence system using a Phenomenex Aeris 3.6u XB-C18 150 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjA1 at 280 nm and 330 nm (Compound 10 specific) shows a mixture of light and heavy chains attached to several molecules of compound 10, consistent with a drug-per-antibody ratio (DAR) of 2.7 molecules of compound 10 per antibody.
UHPLC analysis on a Shimadzu Prominence system using a Waters Acquity UPLC
SEC 1.7 um 4.6 x 150 mm column eluting with sterile-filtered Phosphate-buffered saline (PBS) containing 5% isopropanol ( v/v) on a sample of ConjA at 280 nm shows a monomer purity of over 99% with no impurity detected.
Conjugate A2 (Herceptin-10, ConjA2) HerceptinTM (2.0 mg, 13.3 nanomoles) was diluted into 1.8 mL of a reduction buffer containing 10 mM sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 10 mM solution of TCEP was added (2 molar equivalent/antibody, 26.6 nanomoles, 2.66 L) and the reduction mixture was heated at +37 C for 2.5 hours in a heating block. After cooling down to room temperature, compound 10 was added as a DMSO solution (3.5 molar equivalent/antibody, 45 nanomoles, in 0.2 mL DMSO).
The solution was mixed for 2 hours at room temperature, then the conjugation was quenched by addition of N-ethyl maleimide (1 micromole, 10 I_ at 100 mM) followed 15 minutes later by N-acetyl cysteine (1.5 micromoles, 15 I_ at 100 mM), then injected into an AKTATm FPLC
using a GE Healthcare XK16/70 column packed with SuperdexTM 200 PG, eluting with 1.5 mL/min of sterile-filtered phosphate-buffered saline (PBS). Fractions corresponding to ConjA2 monomer peak were pooled, concentrated using a 15mL Amicon Ultracell 50KDa MWCO spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjA2 at 1.49 mg/mL in 1.2 mL, obtained mass of ConjA2 is 1.79 mg (90%
yield).
UHPLC analysis on a Shimadzu Prominence system using a Phenomenex Aeris 3.6u XB-C18 150 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjA2 at 280 nm and 330 nm (compound 10 specific) shows a mixture of light and heavy chains attached to several molecules of compound 10, consistent with a drug-per-antibody ratio (DAR) of 2.7 molecules of compound 10 per antibody.
UHPLC analysis on a Shimadzu Prominence system using a Waters Acquity UPLC
SEC 1.7 um 4.6 x 150 mm column eluting with sterile-filtered phosphate-buffered saline (PBS) containing 5% isopropanol (v/v) on a sample of ConjA2 at 280 nm shows a monomer purity of over 99% with no impurity detected.
Conjugate B (Herceptin-5, ConjB) HerceptinTM (2.0 mg, 13.3 nanomoles) was diluted into 1.8 mL of a reduction buffer containing 10 mM sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 10 mM solution of TCEP was added (2 molar equivalent/antibody, 26.6 nanomoles, 2.66 L) and the reduction mixture was heated at +37 C for 2.0 hours in a heating block. After cooling down to room temperature, compound 5 was added as a DMSO
solution (10 molar equivalent/antibody, 133 nanomoles, in 0.2 mL DMSO). The solution was mixed for 1 hours at room temperature, then the conjugation was injected into an AKTATm FPLC using a GE Healthcare XK16/70 column packed with Superdex 200 PG, eluting with 1.5 mL/min of sterile-filtered phosphate-buffered saline (PBS). Fractions corresponding to ConjB monomer peak were pooled, concentrated using a 15mL Amicon Ultracell 50KDa MWCO spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjB at 3.13 mg/mL in 0.65 mL, obtained mass of ConjB is 1.61 mg (80% yield).
UHPLC analysis on a Shimadzu Prominence system using a Phenomenex Aeris 3.6u XB-C18 150 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjB at 280 nm and 330 nm (compound 5 specific) shows a mixture of light and heavy chains attached to several molecules of compound 5, consistent with a drug-per-antibody ratio (DAR) of 4 molecules of compound 5 per antibody.
UHPLC analysis on a Shimadzu Prominence system using a Waters Acquity UPLC
SEC 1.7 um 4.6 x 150 mm column eluting with sterile-filtered Phosphate-buffered saline (PBS) containing 5% isopropanol (v/v) on a sample of ConjB at 280 nm shows a monomer purity of over 98.6%.
Conjugate C (Herceptin-13, ConjC) HerceptinTm(1.0 mg, 6.7 nanomoles) was diluted into 0.9 mL of a reduction buffer containing 10 mM sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 1 mM solution of TCEP was added (3 molar equivalent/antibody, 20 nanomoles, 20 L) and the reduction mixture was heated at +37 C for 1.5 hours in a heating block. After cooling down to room temperature, compound 13 was added as a DMSO solution (10 molar equivalent/antibody, 67 nanomoles, in 0.1 mL DMSO). The solution was mixed for 1 hour at room temperature, the conjugation mixture was analysed by HPLC and then injected into an AKTATm FPLC using a GE Healthcare XK16/70 column packed with SuperdexTM 200 PG, eluting with 1.5 mL/min of sterile-filtered phosphate-buffered saline (PBS).
Fractions corresponding to ConjC monomer peak were pooled, concentrated using a 15mL
Amicon Ultracell 50KDa MWCO spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjC at 0.70 mg/mL in 1.0 mL, obtained mass of ConjC
is 0.70 mg (70% yield).
UHPLC analysis on a Shimadzu Prominence system using an Agilent Technologies PLRP-S
1000A 5 pm 50 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjC at 280 nm and 330 nm (compound 13 specific) shows a mixture of light and heavy chains attached to several molecules of compound 13, consistent with a drug-per-antibody ratio (DAR) of >2.7 molecules of compound 13 per antibody.
Conjugate D (Herceptin-16, ConjD) HerceptinTM was diluted into 0.9 mL of a reduction buffer containing 10 mM
sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 1 mM
solution of TCEP was added (3 molar equivalent/antibody, 20 nanomoles, 20 L) and the reduction mixture was heated at +37 C for 1.5 hours in a heating block. After cooling down to room temperature, compound 16 was added as a DMSO solution (10 molar equivalent/antibody, 67 nanomoles, in 0.1 mL DMSO). The solution was mixed for 1 hour at room temperature, the conjugation mixture was analysed by HPLC and then injected into an AKTATm FPLC
using a GE Healthcare XK16/70 column packed with SuperdexTM 200 PG, eluting with 1.5 mL/min of sterile-filtered phosphate-buffered saline (PBS). Fractions corresponding to ConjD
monomer peak were pooled, concentrated using a 15mL Amicon Ultracell 50KDa MWCO
spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjD at 0.55 mg/mL in 1.0 mL, obtained mass of ConjD is 0.55 mg (55% yield).
UHPLC analysis on a Shimadzu Prominence system using an Agilent Technologies PLRP-S
1000A 5 pm 50 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjD at 280 nm and 330 nm (compound 16 specific) shows a mixture of light and heavy chains attached to several molecules of compound 16, consistent with a drug-per-antibody ratio (DAR) of 3.56 molecules of compound 16 per antibody.
Example 6: In vivo ADC efficacy studies CB.17 SCID mice, aged 8-12 weeks, may be injected with 1 mm3 tumour fragments sub cutaneously in the flank. When tumours reach an average size of 100 - 150 mg, treatment may be begun. Mice may be weighed twice a week. Tumour size may be measured twice a week. Animals may be monitored individually. The endpoint of the experiment is a tumour volume of 1000 mm3 or 60 days, whichever comes first. Responders can be followed longer.
Groups of 10 xenografted mice can be injected i.v. with 0.2m1 of antibody drug conjugate (ADC), or naked antibody, in phosphate buffered saline (vehicle) or with 0.2m1 of vehicle alone. The concentration of ADC can be adjusted to give, for example, 0.3 or 1.0 mg ADC/
kg body weight in a single dose. Three identical doses may be given to each mouse at intervals of, for example, 1 week.
Example 7: In vitro ADC efficacy studies Medium from subconfluent (about 80-90% confluency) SK-BR-3 cells in a T75 flask was aspirated and PBS (about 20m1) was added to rinse away the culture medium. The PBS was aspirated and Trypsin-EDTA (5m1) added. The flask was returned to the 37 C
gassed incubator for up to about 5 minutes. The flask was rapped sharply to dislodge and dissociate cells from the plastic. The cell suspension was transferred to a sterile 50m1 screw-top centrifuge tube. Medium (McCoy's + 10% FCS) was added to a final volume of 15m1, then the tube was centrifuged (400g for 5 min). The supernatant was aspirated and the pellet re-suspended in 10m1 culture medium. Repeated aspiration (up and down a 10m1 pipette) may be necessary to break up cell clumps and produce monodisperse cell suspensions suitable for counting. Cell suspension (10p1) was mixed with Trypan blue (10p1) and live/dead cells counted with a haemocytometer to determine cell concentration and viability. The cell suspension was diluted to 20x104/m1 and 50plwas dispensed into clear 96 well flat bottomed plates. The cells were incubated overnight to allow recovery before use.
A stock solution (1m1) of antibody drug conjugate (ADC) (20pg/m1) was made by dilution of filter-sterilised ADC into cell culture medium. A set of 8x 10-fold dilutions of stock ADC was made in a 24 well plate by serial transfer of 100p1 onto 900p1 of cell culture medium.
50p1 of each ADC dilution is dispensed into 4 replicate wells of the 96 well plate, containing 50p1 cell suspension seeded the previous day. Control wells receive 50p1 cell culture medium. The 96-well plate containing cells and ADCs was incubated at 37 C in a CO2-gassed incubator for 4 days. At the end of the incubation period, viable cells were measured by MTS assay. MTS (Promega) was dispensed (20p1 per well) into each well and incubated for 4 hours at 37 C in the CO2-gassed incubator. Well absorbance was measured at 490nm. Percentage cell survival is calculated from the mean absorbance in the 4 ADC-treated wells compared to the mean absorbance in the 4 control wells (100%).
ADC EC50 (pg/ml) ConjA 0.06187 Abbreviations Ac acetyl Acm acetamidomethyl Alloc allyloxycarbonyl Boc di-tert-butyl dicarbonate t-Bu tert-butyl Bz1 benzyl, where Bz1-0Me is methoxybenzyl and Bzl-Me is methylbenzene Cbz or Z benzyloxy-carbonyl, where Z-C1 and Z-Br are chloro- and bromobenzyloxy carbonyl respectively DMF N,N-dimethylformamide Dnp dinitrophenyl DTT dithiothreitol Fmoc 9H-fluoren-9-ylmethoxycarbonyl imp N-10 imine protecting group: 3-(2-methoxyethoxy)propanoate-Val-Ala-PAB
MC-0Su maleimidocaproyl-O-N-succinimide Moc methoxycarbonyl MP maleimidopropanamide Mtr 4-methoxy-2,3,6-trimethtylbenzenesulfonyl PAB para-aminobenzyloxycarbonyl PEG ethyleneoxy PNZ p-nitrobenzyl carbamate Psec 2-(phenylsulfonyl)ethoxycarbonyl TBDMS tert-butyldimethylsilyl TBDPS tert-butyldiphenylsilyl Teoc 2-(trimethylsilyl)ethoxycarbonyl Tos tosyl Troc 2,2,2-trichlorethoxycarbonyl chloride Trt trityl Xan xanthyl References The following references are incorporated by reference in their entirety:
Polypeptide Genbank accession no. NP_004954 Genbank version no. NP_004954.2 GI:222080083 Genbank record update date: Sep 02, 2012 01:50 PM
Cross-references De Sauvage F.J., et al J. Biol. Chem. 266 (27), 17912-17918 (1991); Singh S., et al Biochem. Biophys. Res. Commun. 179 (3), 1455-1463 (1991) Other information 5 Official Symbol: GUCY2C
Other Aliases: DIAR6, GUC2C, MUCIL, STAR
Other Designations: GC-C; STA receptor; guanylyl cyclase C; hSTAR; heat-stable enterotoxin receptor; intestinal guanylate cyclase 10 (62) Liv-1 ¨ SLC39A6 (Solute carrier family 39 (zinc transporter), member 6) Nucleotide Genbank accession no. U41060 Genbank version no. U41060.2 GI:12711792 Genbank record update date: Nov 30, 2009 04:35 PM
Polypeptide Genbank accession no. AAA96258 Genbank version no. AAA96258.2 GI:12711793 Genbank record update date: Nov 30, 2009 04:35 PM
Cross-references Taylor KM., et al Biochim Biophys Acta. 2003 Apr 1;1611(1-2):16-30 Other information Official Symbol: 5LC39A6 Other Aliases: LIV-1 Other Designations: LIV-1 protein, estrogen regulated; ZIP-6; estrogen-regulated protein LIV-1; solute carrier family 39 (metal ion transporter), member 6;
solute carrier family 39 member 6; zinc transporter ZIP6; zrt- and Irt-like protein 6 (63) 5T4, Trophoblast glycoprotein, TPBG ¨ TPBG (trophoblast glycoprotein) Nucleotide Genbank accession no. AJ012159 Genbank version no. AJ012159.1 GI:3805946 Genbank record update date: Feb 01, 2011 10:27 AM
Polypeptide Genbank accession no. CAA09930 Genbank version no. CAA09930.1 GI:3805947 Genbank record update date: Feb 01, 2011 10:27 AM
Cross-references King K.W.,et al Biochim. Biophys. Acta 1445 (3), 257-270 (1999) Other information = Official Symbol: TPBG
= Other Aliases: 5T4, 5T4AG, M6P1 = Other Designations: 5T4 oncofetal antigen; 5T4 oncofetal trophoblast glycoprotein; 5T4 oncotrophoblast glycoprotein (64) CD56¨ NCMA1 (Neural cell adhesion molecule 1) Nucleotide Genbank accession no. NM_000615 Genbank version no. NM_000615.6 GI:336285433 Genbank record update date: Sep 23, 2012 02:32 PM
Polypeptide Genbank accession no. NP_000606 Genbank version no. NP_000606.3 GI:94420689 Genbank record update date: Sep 23, 2012 02:32 PM
Cross-references Dickson,G., et al, Cell SO (7), 1119-1130 (1987) Other information Official Symbol: NCAM1 Other Aliases: CD56, M5K39, NCAM
Other Designations: antigen recognized by monoclonal antibody 5.1H11; neural cell adhesion molecule, NCAM
ANTIBODIES
lmmunogen: HuN901 (Smith SV., et al Curr Opin Mol Ther. 2005 Aug;7(4):394-401) For example, see humanized from murine N901 antibody. See Fig. lb and le of Roguska, M.A., et al. Proc Natl Acad Sci USA Feb 1994;91:969-973.
(65) CanAg (Tumor associated antigen CA242) Cross-references Haglund C., et al Br J Cancer 60:845-851, 1989;Baeckstrom D., et al J Biol Chem 266:21537-21547, 1991 ANTIBODIES
huC242 (Tolcher AW et al., J Clin Oncol. 2003 Jan 15;21(2):211-22; lmmunogen) For example, see U520080138898A1 SEQ ID NO: 1 and 2 (66) FOLR1 (Folate Receptor 1) Nucleotide Genbank accession no. J05013 Genbank version no. J05013.1 GI:182417 Genbank record update date: Jun 23, 2010 08:47 AM
Polypeptide Genbank accession no. AAA35823 Genbank version no. AAA35823.1 GI:182418 Genbank record update date: Jun 23, 2010 08:47 AM
Cross-references Elwood P.C., et al J. Biol. Chem. 264 (25), 14893-14901 (1989) Other information Official Symbol: FOLR1 Other Aliases: FBP, FOLR
Other Designations: FR-alpha; KB cells FBP; adult folate-binding protein;
folate binding protein; folate receptor alpha; folate receptor, adult; ovarian tumor-associated antigen MOv18 ANTIBODIES
M9346A - Whiteman KR., et al Cancer Res April 15, 2012; 72(8 Supplement): 4628 (Immunogen) (67) GPNMB (Glycoprotein (transmembrane) nmb) Nucleotide Genbank accession no. X76534 Genbank version no. X76534.1 GI:666042 Genbank record update date: Feb 02, 2011 10:10 AM
Polypeptide Genbank accession no. CAA54044 Genbank version no. CAA54044.1 GI:666043 Genbank record update date: Feb 02, 2011 10:10 AM
Cross-references Weterman M.A., et al Int. J. Cancer 60 (1), 73-81 (1995) Other information Official Symbol: GPNMB
Other Aliases: UNQ1725/PR09925, HGFIN, NMB
Other Designations: glycoprotein NMB; glycoprotein nmb-like protein;
osteoactivin;
transmembrane glycoprotein HGFIN; transmembrane glycoprotein NMB
ANTIBODIES
Celldex Therapeutics: CR011 (Tse KF., et al Clin Cancer Res. 2006 Feb 15;12(4):1373-82) For example, see EP1827492B1 SEQ ID NO: 22, 24, 26, 31, 33 and 35 (68) TIM-1 ¨ HAVCR1 (Hepatitis A virus cellular receptor 1) Nucleotide Genbank accession no. AF043724 Genbank version no. AF043724.1 GI:2827453 Genbank record update date: Mar 10, 2010 06:24 PM
Polypeptide Genbank accession no. AAC39862 Genbank version no. AAC39862.1 GI:2827454 Genbank record update date: Mar 10, 2010 06:24 PM
Cross-references Feigelstock D., et al J. Virol. 72 (8), 6621-6628 (1998) Other information Official Symbol: HAVCR1 Other Aliases: HAVCR, HAVCR-1, KIM-1, KIM1, TIM, TIM-1, TIM1, TIMD-1, TIMD1 Other Designations: T cell immunoglobin domain and mucin domain protein 1; T-cell membrane protein 1; kidney injury molecule 1 (69) RG-1/Prostate tumor target Mindin ¨ Mindin/RG-1 Cross-references Parry R., et al Cancer Res. 2005 Sep 15;65(18):8397-405 (70) 87-H4 ¨ VTCN1 (V-set domain containing T cell activation inhibitor 1 Nucleotide Genbank accession no. BX648021 Genbank version no. BX648021.1 GI:34367180 Genbank record update date: Feb 02, 2011 08:40 AM
Cross-references Sica GL., et al Immunity. 2003 Jun;18(6):849-61 Other information Official Symbol: VTCN1 Other Aliases: RP11-229A19.4, B7-H4, B7H4, B751, B7X, B7h.5, PR01291, VCTN1 Other Designations: B7 family member, H4; B7 superfamily member 1; T cell costimulatory molecule B7x; T-cell costimulatory molecule B7x; V-set domain-containing T-cell activation inhibitor 1; immune costimulatory protein B7-H4 (71) PTK7 (PTK7 protein tyrosine kinase 7) Nucleotide Genbank accession no. AF447176 Genbank version no. AF447176.1 GI:17432420 Genbank record update date: Nov 28, 2008 01:51 PM
Polypeptide Genbank accession no. AAL39062 5 Genbank version no. AAL39062.1 GI:17432421 Genbank record update date: Nov 28, 2008 01:51 PM
Cross-references Park S.K.,et al J. Biochem. 119 (2), 235-239 (1996) Other information Official Symbol: PTK7 Other Aliases: CCK-4, CCK4 Other Designations: colon carcinoma kinase 4; inactive tyrosine-protein kinase 7; pseudo tyrosine kinase receptor 7; tyrosine-protein kinase-like 7 (72) CD37 (CD37 molecule) Nucleotide Genbank accession no. NM_001040031 Genbank version no. NM_001040031.1 GI:91807109 Genbank record update date: Jul 29, 2012 02:08 PM
Polypeptide Genbank accession no. NP_001035120 Genbank version no. NP_001035120.1 GI:91807110 Genbank record update date: Jul 29, 2012 02:08 PM
Cross-references Schwartz-Albiez R., et al J. Immunol. 140 (3), 905-914 (1988) Other information Official Symbol: CD37 Other Aliases: GP52-40, TSPAN26 Other Designations: CD37 antigen; cell differentiation antigen 37; leukocyte antigen CD37;
leukocyte surface antigen CD37; tetraspanin-26; tspan-26 ANTIBODIES
Boehringer Ingelheim: mAb 37.1 (Heider KH., et al Blood. 2011 Oct 13;118(15):4159-68) Trubion: CD37-SMIP (G28-1 scFv-Ig) ((Zhao X., et al Blood. 2007;110: 2569-2577) For example, see US20110171208A1 SEQ ID NO: 253 lmmunogen: K7153A (Deckert J., et al Cancer Res April 15, 2012; 72(8 Supplement): 4625) (73) CD138 ¨ SDC1 (syndecan 1) Nucleotide Genbank accession no. AJ551176 Genbank version no. AJ551176.1 GI:29243141 Genbank record update date: Feb 01, 2011 12:09 PM
Polypeptide Genbank accession no. CAD80245 Genbank version no. CAD80245.1 GI:29243142 Genbank record update date: Feb 01, 2011 12:09 PM
Cross-references O'Connell FP., et al Am J Clin Pathol. 2004 Feb;121(2):254-63 Other information Official Symbol: SDC1 Other Aliases: CD138, SDC, SYND1, syndecan Other Designations: CD138 antigen; heparan sulfate proteoglycan fibroblast growth factor receptor; syndecan proteoglycan 1; syndecan-1 ANTIBODIES
Biotest: chimerized MAb (nBT062) - (Jagannath S., et al Poster ASH #3060, 2010; WIPO
Patent Application WO/2010/128087) For example, see U520090232810 SEQ ID NO: 1 and 2 lmmunogen: B-B4 (Tassone P., et al Blood 104_3688-3696) For example, see U520090175863A1 SEQ ID NO: 1 and 2 (74) CD74 (CD74 molecule, major histocompatibility complex, class II invariant chain) Nucleotide Genbank accession no. NM_004355 Genbank version no. NM_004355.1 GI:343403784 Genbank record update date: Sep 23, 2012 02:30 PM
Polypeptide Genbank accession no. NP_004346 Genbank version no. NP_004346.1 GI:10835071 Genbank record update date: Sep 23, 2012 02:30 PM
Cross-references Kudo,J., et al Nucleic Acids Res. 13 (24), 8827-8841 (1985) Other information Official Symbol: CD74 Other Aliases: DHLAG, HLADG, II, la-GAMMA
Other Designations: CD74 antigen (invariant polypeptide of major histocompatibility complex, class II antigen-associated); HLA class II histocompatibility antigen gamma chain;
HLA-DR antigens-associated invariant chain; HLA-DR-gamma; la-associated invariant chain; MHC HLA-DR gamma chain; gamma chain of class II antigens; p33 ANTIBODIES
Immunomedics: hLL1 (Milatuzumab,) - Berkova Z., et al Expert Opin Investig Drugs. 2010 Jan;19(1):141-9) For example, see U520040115193 SEQ ID NOs: 19, 20, 21, 22, 23 and 24 Genmab: HuMax-CD74 (see website) (75) Claudins ¨ CLs (Claudins) Cross-references Offner S., et al Cancer Immunol Immunother. 2005 May; 54(5):431-45, Suzuki H., et al Ann N Y Acad Sci. 2012 Jul;1258:65-70) In humans, 24 members of the family have been described ¨ see literature reference.
(76) EGFR (Epidermal growth factor receptor) Nucleotide Genbank accession no. NM_005228 Genbank version no. NM_005228.3 GI:41927737 Genbank record update date: Sep 30, 2012 01:47 PM
Polypeptide Genbank accession no. NP_005219 Genbank version no. NP_005219.2 GI:29725609 Genbank record update date: Sep 30, 2012 01:47 PM
Cross-references Dhomen NS., et al Crit Rev Oncog. 2012;17(1):31-50 Other information Official Symbol: EGFR
Other Aliases: ERBB, ERBB1, HER1, PIG61, mENA
Other Designations: avian erythroblastic leukemia viral (v-erb-b) oncogene homolog; cell growth inhibiting protein 40; cell proliferation-inducing protein 61; proto-oncogene c-ErbB-1;
receptor tyrosine-protein kinase erbB-1 ANTIBODIES
BMS: Cetuximab (Erbitux) - Broadbridge VT., et al Expert Rev Anticancer Ther.
May;12(5):555-65.
For example, see U56217866 ¨ ATTC deposit No. 9764.
Amgen: Panitumumab (Vectibix) - Argiles G., et al Future Oncol. 2012 Apr;8(4):373-89 For example, see U56235883 SEQ ID NOs: 23-38.
Genmab: Zalutumumab - Rivera F., et al Expert Opin Biol Ther. 2009 May;9(5):667-74.
YM Biosciences: Nimotuzumab - Ramakrishnan MS., et al MAbs. 2009 Jan-Feb;1(1):41-8.
For example, see U55891996 SEQ ID NOs: 27-34.
(77) Her3 (ErbB3) ¨ ERBB3 (v-erb-b2 erythroblastic leukemia viral oncogene homolog 3 (avian)) Nucleotide Genbank accession no. M34309 Genbank version no. M34309.1 GI:183990 Genbank record update date: Jun 23, 2010 08:47 PM
Polypeptide Genbank accession no. AAA35979 Genbank version no. AAA35979.1 GI:306841 Genbank record update date: Jun 23, 2010 08:47 PM
Cross-references Plowman,G.D., et al., Proc. Natl. Acad. Sci. U.S.A. 87 (13), 4905-4909 (1990) Other information Official Symbol: ERBB3 Other Aliases: ErbB-3, HER3, LCCS2, MDA-BF-1, c-erbB-3, c-erbB3, erbB3-S, p180-ErbB3, p45-sErbB3, p85-sErbB3 Other Designations: proto-oncogene-like protein c-ErbB-3; receptor tyrosine-protein kinase erbB-3; tyrosine kinase-type cell surface receptor HER3 ANTIBODIES
Merimack Pharma : MM-121 (Schoeberl B., et al Cancer Res. 2010 Mar 15;70(6):2485-2494) For example, see U52011028129 SEQ ID NOs: 1, 2, 3, 4, 5, 6, 7 and 8.
(78) RON - MST1R (macrophage stimulating 1 receptor (c-met-related tyrosine kinase)) Nucleotide Genbank accession no. X70040 Genbank version no. X70040.1 GI:36109 Genbank record update date: Feb 02, 2011 10:17 PM
Polypeptide Genbank accession no. CCA49634 Genbank version no. CCA49634.1 GI:36110 Genbank record update date: Feb 02, 2011 10:17 PM
Cross-references Ronsin C., et al Oncogene 8 (5), 1195-1202 (1993) Other information Official Symbol: MST1R
Other Aliases: CD136, CDw136, PTK8, RON
Other Designations: MSP receptor; MST1R variant RON30; MST1R variant R0N62;
protein tyrosine kinase 8; RON variant E2E3; c-met-related tyrosine kinase;
macrophage-stimulating protein receptor; p185-Ron; soluble RON variant 1; soluble RON
variant 2;
soluble RON variant 3; soluble RONvariant 4 (79) EPHA2 (EPH receptor A2) Nucleotide Genbank accession no. BC037166 Genbank version no. BC037166.2 GI:33879863 Genbank record update date: Mar 06, 2012 01:59 PM
Polypeptide Genbank accession no. AAH37166 Genbank version no. AAH37166.1 GI:22713539 Genbank record update date: Mar 06, 2012 01:59 PM
Cross-references Strausberg R.L., et al Proc. Natl. Acad. Sci. U.S.A. 99 (26), 16899-16903 (2002) Other information Official Symbol: EPHA2 Other Aliases: ARCC2, CTPA, CTPP1, ECK
Other Designations: ephrin type-A receptor 2; epithelial cell receptor protein tyrosine kinase;
soluble EPHA2 variant 1; tyrosine-protein kinase receptor ECK
ANTIBODIES
Medimmune: 1C1 (Lee JW., et al Clin Cancer Res. 2010 May 1;16(9):2562-2570) For example, see U520090304721A1 Fig. 7 and 8.
(80) CD20 ¨ MS4A1 (membrane-spanning 4-domains, subfamily A, member 1) Nucleotide Genbank accession no. M27394 Genbank version no. M27394.1 GI:179307 Genbank record update date: Nov 30, 2009 11:16 AM
Polypeptide Genbank accession no. AAA35581 Genbank version no. AAA35581.1 GI:179308 Genbank record update date: Nov 30, 2009 11:16 AM
Cross-references Tedder T.F., et al Proc. Natl. Acad. Sci. U.S.A. 85 (1), 208-212 (1988) Other information Official Symbol: MS4A1 Other Aliases: B1, Bp35, CD20, CVID5, LEU-16, MS4A2, S7 Other Designations: B-lymphocyte antigen CD20; B-lymphocyte cell-surface antigen B1;
CD20 antigen; CD20 receptor; leukocyte surface antigen Leu-16 ANTIBODIES
Genentech/Roche: Rituximab - Abdulla NE., et al BioDrugs. 2012 Apr 1;26(2):71-82.
For example, see U55736137, ATCC deposit No. HB-69119.
GSK/Genmab: Ofatumumab - Nightingale G., et al Ann Pharmacother. 2011 Oct;45(10):1248-55.
For example, see U520090169550A1 SEQ ID NOs: 2, 4 and 5.
lmmunomedics: Veltuzumab - Goldenberg DM., et al Leuk Lymphoma. 2010 May;51(5):747-55.
For example, see U57919273B2 SEQ ID NOs: 1, 2, 3, 4, 5 and 6.
(81) Tenascin C ¨ TNC (Tenascin C) Nucleotide Genbank accession no. NM_002160 Genbank version no. NM_002160.3 GI:340745336 Genbank record update date: Sep 23, 2012 02:33 PM
Polypeptide Genbank accession no. NP_002151 Genbank version no. NP_002151.2 GI:153946395 Genbank record update date: Sep 23, 2012 02:33 PM
Cross-references Nies D.E., et al J. Biol. Chem. 266 (5), 2818-2823 (1991); Siri A., et al Nucleic Acids Res. 19 (3), 525-531 (1991) Other information Official Symbol: TNC
Other Aliases: 150-225, GMEM, GP, HXB, JI, TN, TN-C
Other Designations: GP 150-225; cytotactin; glioma-associated-extracellular matrix antigen;
hexabrachion (tenascin); myotendinous antigen; neuronectin; tenascin; tenascin-C isoform ANTIBODIES
Philogen : G11 (von Lukowicz T., et al J Nucl Med. 2007 Apr;48(4):582-7) and F16 (Pedretti M., et al Lung Cancer. 2009 Apr;64(1):28-33) For example, see U57968685 SEQ ID NOs: 29, 35, 45 and 47.
(82) FAP (Fibroblast activation protein, alpha) Nucleotide Genbank accession no. U09278 Genbank version no. U09278.1 GI:1888315 Genbank record update date: Jun 23, 2010 09:22 AM
Polypeptide Genbank accession no. AAB49652 Genbank version no. AAB49652.1 GI:1888316 Genbank record update date: Jun 23, 2010 09:22 AM
Cross-references Scanlan,M.J.,et al Proc. Natl. Acad. Sci. U.S.A. 91 (12), 5657-5661 (1994) Other information Official Symbol: FAP
Other Aliases: DPPIV, FAPA
Other Designations: 170 kDa melanoma membrane-bound gelatinase; integral membrane serine protease; seprase (83) DKK-1 (Dickkopf 1 homolog (Xenopus laevis) Nucleotide Genbank accession no. NM_012242 Genbank version no. NM_012242.2 GI:61676924 Genbank record update date: Sep 30, 2012 01:48 PM
Polypeptide Genbank accession no. NP_036374 Genbank version no. NP_036374.1 GI:7110719 Genbank record update date: Sep 30, 2012 01:48 PM
Cross-references Fedi P. et al J. Biol. Chem. 274 (27), 19465-19472 (1999) Other information Official Symbol: DKK1 Other Aliases: UNQ492/PRO1008, DKK-1, SK
Other Designations: dickkopf related protein-1; dickkopf-1 like; dickkopf-like protein 1;
dickkopf-related protein 1; hDkk-1 ANTIBODIES
Novartis: BHQ880 (Fulciniti M., et al Blood. 2009 Jul 9;114(2):371-379) For example, see U520120052070A1 SEQ ID NOs: 100 and 108.
(84) CD52 (CD52 molecule) Nucleotide Genbank accession no. NM_001803 Genbank version no. NM_001803.2 GI :68342029 Genbank record update date: Sep 30, 2012 01:48 PM
Polypeptide Genbank accession no. NP_001794 Genbank version no. NP_001794.2 GI:68342030 Genbank record update date: Sep 30, 2012 01:48 PM
Cross-references Xia M.Q., et al Eur. J. Immunol. 21 (7), 1677-1684 (1991) Other information Official Symbol: CD52 Other Aliases: CDW52 Other Designations: CAMPATH-1 antigen; CD52 antigen (CAMPATH-1 antigen); CDW52 antigen (CAMPATH-1 antigen); cambridge pathology 1 antigen; epididymal secretory protein E5; he5; human epididymis-specific protein 5 ANTIBODIES
Alemtuzumab (Campath) - Skoetz N., et al Cochrane Database Syst Rev. 2012 Feb 15;2:CD008078.
For example, see Drugbank Acc. No. DB00087 (BIOD00109, BTD00109) (85) CS1 - SLAMF7 (SLAM family member 7) Nucleotide Genbank accession no. NM_021181 Genbank version no. NM_021181.3 GI:1993571 Genbank record update date: Jun 29, 2012 11:24 AM
Polypeptide Genbank accession no. NP_067004 Genbank version no. NP_067004.3 GI:19923572 Genbank record update date: Jun 29, 2012 11:24 AM
Cross-references Boles K.S., et al Immunogenetics 52 (3-4), 302-307 (2001) Other information Official Symbol: SLAMF7 Other Aliases: UNQ576/PR01138, 19A, CD319, CRACC, CS1 Other Designations: 19A24 protein; CD2 subset 1; CD2-like receptor activating cytotoxic cells; CD2-like receptor-activating cytotoxic cells; membrane protein FOAP-12;
novel LY9 (lymphocyte antigen 9) like protein; protein 19A
ANTIBODIES
BMS: elotuzumab/HuLuc63 (Benson DM., et al J Clin Oncol. 2012 Jun 1;30(16):2013-2015) For example, see US20110206701 SEQ ID NOs: 9, 10, 11, 12, 13, 14, 15 and 16.
(86) Endoglin ¨ ENG (Endoglin) Nucleotide Genbank accession no. AF035753 Genbank version no. AF035753.1 GI:3452260 Genbank record update date: Mar 10, 2010 06:36 PM
Polypeptide Genbank accession no. AAC32802 Genbank version no. AAC32802.1 GI:3452261 Genbank record update date: Mar 10, 2010 06:36 PM
Cross-references Rius C., et al Blood 92 (12), 4677-4690 (1998) Official Symbol: ENG
Other information Other Aliases: RP11-228I315.2, CD105, END, HHT1, ORW, ORW1 Other Designations: CD105 antigen (87) Annexin Al ¨ ANXA1 (Annexin Al) Nucleotide Genbank accession no. X05908 Genbank version no. X05908.1 GI:34387 Genbank record update date: Feb 02, 2011 10:02 AM
Polypeptide Genbank accession no. CCA29338 Genbank version no. CCA29338.1 GI:34388 Genbank record update date: Feb 02, 2011 10:02 AM
Cross-references Wallner B.P.,et al Nature 320 (6057), 77-81 (1986) Other information Official Symbol: ANXA1 Other Aliases: RP11-71A24.1, ANX1, LPC1 Other Designations: annexin I (lipocortin I); annexin-1; calpactin II;
calpactin-2;
chromobindin-9; lipocortin I; p35; phospholipase A2 inhibitory protein (88) V-CAM (CD106) - VCAM1 (Vascular cell adhesion molecule 1) Nucleotide Genbank accession no. M60335 Genbank version no. M60335.1 GI:340193 Genbank record update date: Jun 23, 2010 08:56 AM
Polypeptide Genbank accession no. AAA61269 Genbank version no. AAA61269.1 GI:340194 Genbank record update date: Jun 23, 2010 08:56 AM
Cross-references Hession C., et al J. Biol. Chem. 266 (11), 6682-6685 (1991) Other information Official Symbol VCAM1 Other Aliases: CD106, INCAM-100 Other Designations: CD106 antigen; vascular cell adhesion protein 1 Antibody Sequences Anti-Integrin at/136 RHAB6.2 QVQLVQSGSELKKPGASVKISCKASGFAFTDSYMHVVVRQAPGQGLEWMGWIDPENGDTE
YAPKFQGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCTRGTPTAVPNLRGDLQVLAQKVAG
PYPFDYWGQGTLVTVSS
RHCB6.2 QVQLVQSGAEVKKPGASVKVSCKASGYTFIDSYMHVVVRQAPGQRLEWMGWIDPENGDTE
YAPKFQGRVTITTDTSASTAYMELSSLRSEDTAVYYCARGTPTAVPNLRGDLQVLAQKVAG
PYPFDYWGQGTLVTVSS
RHF
QVQLVQSGAEVKKPGASVKVSCKASGFNFIDSYMHVVVRQAPGQRLEWMGWIDPENGDT
EYAPKFQGRVTFTTDTSASTAYMELSSLRSEDTAVYYCNEGTPTGPYYFDYWGQGTLVTV
SS
QVQLVQSGAEVKKPGASVKVSCKASGFNFIDSYMHVVVRQAPGQRLEWMGWIDPENGDT
EYAPKFQGRVTFTTDTSASTAYMELSSLRSEDTAVYYCNEGTPTAVPNLRGDLQVLAQKVA
GPYYFDYWGQGTLVTVSS
RHAY100bP
QVQLVQSGSELKKPGASVKISCKASGFAFTDSYMHVVVRQAPGQGLEWMGWIDPENGDTE
YAPKFQGRFVFSLDTSVSTAYLQISSLKAEDTAVYYCTRGTPTGPYPFDYWGQGTLVTVSS
RKF
ENVLTQSPGTLSLSPGERATLSCSASSSVSYMHWFQQKPGQAPRLLIYSTSNLASGIPDRF
SGSGSGTDFTLTISRLEPEDFAVYYCQQRSSYPLTFGGGTKVEIK
ENVLTQSPGTLSLSPGERATLSCSASSSVSYMHWLQQKPGQAPRLLIYLTSNLASGIPDRF
SGSGSGTDFTLTISRLEPEDFAVYYCQQRSSYPLTFGGGTKVEIK
RKC
EIVLTQSPGTLSLSPGERATLSCSASSSVSYMHWFQQKPGQAPRLLIYSTSNLASGIPDRFS
GSGSGTDFTLTISRLEPEDFAVYYCQQRSSYPLTFGGGTKVEIK
Anti-CD33 CD33 Hum195 VH
QVQLVQSGAEVKKPGSSVKVSCKASGYTFTDYN M HVVVRQAPGQG LEWIGYIYPYN GGTG
YNQKFKSKATITADESTNTAYMELSSLRSEDTAVYYCARGRPAMDYWGQGTLVTVSS
CD33 Hum195 VK
DIQMTQSPSSLSASVGDRVTITCRASESVDNYGISFMNWFQQKPGKAPKLLIYAASNQGSG
VPSRFSGSGSGTDFTLTISSLQP DDFATYYCQQSKEVPWTFGQGTKVEI K
Anti-CD19 CD19 B4 resurfaced VH
QVQLVQPGAEVVKPGASVKLSCKTSGYTFTSNWMHVVVKQRPGQGLEWIGEIDPSDSYTN
YNQNFKGKAKLTVDKSTSTAYMEVSSLRSDDTAVYYCARGSNPYYYAMDYWGQGTSVTV
SS
CD19 B4 resurfaced VK
EIVLTQSPAIMSASPGERVTMTCSASSGVNYMHVVYQQKPGTSPRRWIYDTSKLASGVPAR
FSGSGSGTSYSLTISSMEPEDAATYYCHQRGSYTFGGGTKLEIK
Anti-Her2 Herceptin VH chain EVQLVESGGGLVQPGGSLRLSCAASGFN I KDTYI HVVVRQAPGKGLEWVARIYPTNGYTRY
ADSVKGRFTISADTSKNTAYLQMNSLRAEDTAVYYCSRWGGDGFYAMDYWGQGTLVTVS
S
Herceptin VL chain DIQMTQSPSSLSASVGDRVTITCRASQDVNTAVAVVYQQKPGKAPKWYSASFLYSGVPSR
FSGSRSGTDFTLTISSLQPEDFATYYCQQHYTTPPTFGQGTKVEIK
Anti-CD25 Simulect VK (also known as Basiliximab) QIVSTQSPAIMSASPGEKVTMTCSASSSRSYMQVVYQQKPGTSPKRWIYDTSKLASGVPAR
FSGSGSGTSYSLTISSMEAEDAATYYCHQRSSYTFGGGTKLEI K
Simulect VH
QLQQSGTVLARPGASVKMSCKASGYSFTRYWMHWI KQRPGQG LEWIGAIYPG NS DTSYN
QKFEGKAKLTAVTSASTAYMELSSLTHEDSAVYYCSRDYGYYFDFWGQGTTLTVSS
Anti-PSMA
Deimmunised VH1 EVQLVQSGPEVKKPGATVKISCKTSGYTFTEYTIHVVVKQAPGKGLEWIGNINPNNGGTTYN
QKFEDKATLTVDKSTDTAYMELSSLRSEDTAVYYCAAGWNFDYWGQGTLLTVSS
Deimmunised VK 1 DIQMTQSPSSLSTSVGDRVTLTCKASQDVGTAVDWYQQKPGPSPKLLIYWASTRHTGIPSR
FSGSGSGTDFTLTISSLQPEDFADYYCQQYNSYPLTFGPGTKVDIK
Deimmunised VH1 '5 EVKLVESGGGLVQPGGSMKLSCVASGFTFSNYWMNVVVRQAPGKGLEVVVAEIRSQSNNF
ATHYAESVKGRVTISRDDSKSIVYLQMNNLRAEDTGVYYCTRRWNNFWGQGTTVTVSS
Deimmunised VH2 '5 EVKLVESGGGLVQPGGSLKLSCVASGFTFSNYWMNWVRQAPGKGLEVVVAEIRSQSNNFA
THYAESVKGRVTISRDDSKSIVYLQMNNLRAEDTAVYYCTRRWNNFWGQGTTVTVSS
Deimmunised VH3 '5 EVQLVESGGGLVQPGGSLKLSCVASGFTFSNYWMNVVVRQAPGKGLEVVVAEIRSQSNNFA
THYAESVKGRVTISRDDSKSIVYLQMNNLRAEDTAVYYCTRRWNNFWGQGTTVTVSS
Deimmunised VH4 '5 EVQLVESGGGLVQPGGSLKLSCVASGFTFSNYWMNVVVRQAPGKGLEVVVAEIRSQSNNFA
THYAESVKGRFTISRDDSKSIVYLQMNNLRAEDTAVYYCTRRWNNFWGQGTTVTVSS
Deimmunised VK1 '5 NIVMTQFPSSMSASVGDRVTITCKASENVGTYVSWYQQKPDQSPKMLIYGASNRFTGVPD
RFTGSGSATDFTLTISSLQTEDLADYYCGQSYTFPYTFGQGTKLEMK
Deimmunised VK2 '5 NIVMTQFPSSMSASVGDRVTITCKASENVGTYVSWYQQKPDQSPKMLIYGASNRFTGVPD
RFSGSGSGTDFTLTISSLQAEDLADYYCGQSYTFPYTFGQGTKLEIK
Deimmunised VK3 '5 NIQMTQFPSAMSASVGDRVTITCKASENVGTYVSWYQQKPDQSPKMLIYGASNRFTGVPD
RFSGSGSGTDFTLTISSLQAEDLADYYCGQSYTFPYTFGQGTKLEIK
Deimmunised VK4 '5 NIQMTQFPSAMSASVGDRVTITCKASENVGTYVSWYQQKPDQSPKMLIYGASNRFTGVPD
RFSGSGSGTDFTLTISSLQAEDEADYYCGQSYTFPYTFGQGTKLEIK
Deimmunised VK DI '5 NIVMTQFPKSMSASAGERMTLTCKASENVGTYVSWYQQKPTQSPKMLIYGASNRFTGVPD
RFSGSGSGTDFILTISSVQAEDLVDYYCGQSYTFPYTFGGGTKLEMK
Deimmunised VH DI '5 EVKLEESGGGLVQPGGSMKISCVASGFTFSNYWMNWVRQSPEKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKSSVYLQMNSLRAEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHA '5 EVQLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVGEIRSQSNNFA
THYAESVKGRFTISRDDSKNTAYLQMNSLKTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHB '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKNTVYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHC '5 EVQLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNVVVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKNTVYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHD '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNVVVRQASGKGLEVVVGEIRSQSNNFA
THYAESVKGRVIISRDDSKNTVYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHE '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRFTISRDDSKNTVYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHF '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKNTAYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RHG '5 EVKLVESGGGLVQPGGSLKLSCAASGFTFSNYWMNWVRQASGKGLEVVVAEIRSQSNNFA
THYAESVKGRVIISRDDSKNTAYLQMNSLRTEDTAVYYCTRRWNNFWGQGTTVTVSS
Humanised RKA '5 DIQMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKWYGASNRFTGVPSR
FSGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKB '5 DIQMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKWYGASNRFTGVPSR
FSGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKC '5 DIQMTQSPSSVSASVGDRVTITCKASENVGTYVSWYQQKPGTAPKMLIYGASNRFTGVPS
RFSGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKD '5 DIQMTQSPSSVSASVGDRVTITCKASENVGTYVSWYQQKPGTAPKMLIYGASNRFTGVPS
RFSGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKE '5 NIVMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKWYGASNRFTGVPDR
FTGSGSATDFILTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKF '5 NIVMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKMLIYGASNRFTGVPSR
FSGSGSATDFILTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
Humanised RKG '5 NIVMTQSPSSVSASVGDRVTITCKASENVGTYVSVVYQQKPGTAPKMLIYGASNRFTGVPDR
FTGSGSATDFTLTINNLQPEDFATYYCGQSYTFPYTFGQGTKVEIK
The parent antibody may also be a fusion protein comprising an albumin-binding peptide (ABP) sequence (Dennis et al. (2002) "Albumin Binding As A General Strategy For Improving The Pharmacokinetics Of Proteins" J Biol Chem. 277:35035-35043; WO
01/45746). Antibodies of the invention include fusion proteins with ABP
sequences taught by: (i) Dennis et al (2002) J Biol Chem. 277:35035-35043 at Tables III and IV, page 35038;
(ii) US 2004/0001827 at [0076]; and (iii) WO 01/45746 at pages 12-13, and all of which are incorporated herein by reference.
In one embodiment, the antibody has been raised to target specific the tumour related antigen av[36.
The cell binding agent may be labelled, for example to aid detection or purification of the agent either prior to incorporation as a conjugate, or as part of the conjugate. The label may be a biotin label. In another embodiment, the cell binding agent may be labelled with a radioisotope.
Embodiments of the present invention include ConjA wherein the cell binding agent is selected from an antibody to any of the antigens discussed above.
Embodiments of the present invention include ConjB wherein the cell binding agent is selected from an antibody to any of the antigens discussed above.
Embodiments of the present invention include ConjA wherein the cell binding agent is selected from any of the antibodies discussed above.
Embodiments of the present invention include ConjB wherein the cell binding agent is selected from any of the antibodies discussed above.
The present invention may also relate to conjugates where the cell binding agent is selected from an antibody to any of the antigens discussed above and any of the antibodies discussed above linked to different drugs.
Drug loading The drug loading is the average number of PBD drugs per cell binding agent, e.g. antibody.
Where the compounds of the invention are bound to cysteines, drug loading may range from 1 to 8 drugs (D) per cell binding agent, i.e. where 1, 2, 3, 4, 5, 6, 7, and 8 drug moieties are covalently attached to the cell binding agent. Compositions of conjgates include collections of cell binding agents, e.g. antibodies, conjugated with a range of drugs, from 1 to 8.
Where the compounds of the invention are bound to lysines, drug loading may range from 1 to 80 drugs (D) per cell binding agent, although an upper limit of 40, 20, 10 or 8 may be preferred. Compositions of conjgates include collections of cell binding agents, e.g.
antibodies, conjugated with a range of drugs, from 1 to 80, 1 to 40, 1 to 20, 1 to 10 or 1 to 8.
The average number of drugs per antibody in preparations of ADC from conjugation reactions may be characterized by conventional means such as UV, reverse phase HPLC, HIC, mass spectroscopy, ELISA assay, and electrophoresis. The quantitative distribution of ADC in terms of p may also be determined. By ELISA, the averaged value of p in a particular preparation of ADC may be determined (Hamblett et al (2004) Clin.
Cancer Res.
10:7063-7070; Sanderson et al (2005) Clin. Cancer Res. 11:843-852). However, the distribution of p (drug) values is not discernible by the antibody-antigen binding and detection limitation of ELISA. Also, ELISA assay for detection of antibody-drug conjugates does not determine where the drug moieties are attached to the antibody, such as the heavy chain or light chain fragments, or the particular amino acid residues. In some instances, separation, purification, and characterization of homogeneous ADC where p is a certain value from ADC with other drug loadings may be achieved by means such as reverse phase HPLC or electrophoresis. Such techniques are also applicable to other types of conjugates.
For some antibody-drug conjugates, p may be limited by the number of attachment sites on the antibody. For example, an antibody may have only one or several cysteine thiol groups, or may have only one or several sufficiently reactive thiol groups through which a linker may be attached. Higher drug loading, e.g. p >5, may cause aggregation, insolubility, toxicity, or loss of cellular permeability of certain antibody-drug conjugates.
Typically, fewer than the theoretical maximum of drug moieties are conjugated to an antibody during a conjugation reaction. An antibody may contain, for example, many lysine residues that do not react with the drug-linker intermediate (D-L) or linker reagent. Only the most reactive lysine groups may react with an amine-reactive linker reagent.
Also, only the most reactive cysteine thiol groups may react with a thiol-reactive linker reagent. Generally, antibodies do not contain many, if any, free and reactive cysteine thiol groups which may be linked to a drug moiety. Most cysteine thiol residues in the antibodies of the compounds exist as disulfide bridges and must be reduced with a reducing agent such as dithiothreitol (DTT) or TCEP, under partial or total reducing conditions. The loading (drug/antibody ratio) of an ADC may be controlled in several different manners, including: (i) limiting the molar excess of drug-linker intermediate (D-L) or linker reagent relative to antibody, (ii) limiting the conjugation reaction time or temperature, and (iii) partial or limiting reductive conditions for cysteine thiol modification.
Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges. Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (dithiothreitol). Each cysteine bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol. Reactive thiol groups may be introduced into the antibody (or fragment thereof) by engineering one, two, three, four, or more cysteine residues (e.g., preparing mutant antibodies comprising one or more non-native cysteine amino acid residues). US
7521541 teaches engineering antibodies by introduction of reactive cysteine amino acids.
Cysteine amino acids may be engineered at reactive sites in an antibody and which do not form intrachain or intermolecular disulfide linkages (Junutula, et al., 2008b Nature Biotech., 26(8):925-932; Dornan et al (2009) Blood 114(13):2721-2729; US 7521541; US
7723485;
W02009/052249). The engineered cysteine thiols may react with linker reagents or the drug-linker reagents of the present invention which have thiol-reactive, electrophilic groups such as maleimide or alpha-halo amides to form ADC with cysteine engineered antibodies and the PBD drug moieties. The location of the drug moiety can thus be designed, controlled, and known. The drug loading can be controlled since the engineered cysteine thiol groups typically react with thiol-reactive linker reagents or drug-linker reagents in high yield. Engineering an IgG antibody to introduce a cysteine amino acid by substitution at a single site on the heavy or light chain gives two new cysteines on the symmetrical antibody.
A drug loading near 2 can be achieved with near homogeneity of the conjugation product ADC.
Where more than one nucleophilic or electrophilic group of the antibody reacts with a drug-linker intermediate, or linker reagent followed by drug moiety reagent, then the resulting product is a mixture of ADC compounds with a distribution of drug moieties attached to an antibody, e.g. 1, 2, 3, etc. Liquid chromatography methods such as polymeric reverse phase (PLRP) and hydrophobic interaction (HIC) may separate compounds in the mixture by drug loading value. Preparations of ADC with a single drug loading value (p) may be isolated, however, these single loading value ADCs may still be heterogeneous mixtures because the drug moieties may be attached, via the linker, at different sites on the antibody.
Thus the antibody-drug conjugate compositions of the invention include mixtures of antibody-drug conjugate compounds where the antibody has one or more PBD drug moieties and where the drug moieties may be attached to the antibody at various amino acid residues.
In one embodiment, the average number of dimer pyrrolobenzodiazepine groups per cell binding agent is in the range 1 to 20. In some embodiments the range is selected from 1 to 8, 2 to 8, 2 to 6, 2 to 4, and 4 to 8.
In some embodiments, there is one dimer pyrrolobenzodiazepine group per cell binding agent.
Preferred Compounds Particularly preferred compounds of the second aspect of the present invention include:
ff.N ifith C) 0 IW
H
NN
N OMe (0 IW
Particularly preferred compounds of the second aspect of the present invention include:
ONN
H
N
N{
Particularly preferred compounds of the third aspect of the present invention include:
4111113" OMe 0 IW
25 j) Substituents The phrase "optionally substituted" as used herein, pertains to a parent group which may be unsubstituted or which may be substituted.
Unless otherwise specified, the term "substituted" as used herein, pertains to a parent group which bears one or more substituents. The term "substituent" is used herein in the conventional sense and refers to a chemical moiety which is covalently attached to, or if appropriate, fused to, a parent group. A wide variety of substituents are well known, and methods for their formation and introduction into a variety of parent groups are also well known.
In a preferred embodiment, the substituents described herein (which include optional substituents) are limited to those groups that are not reactive to a cell binding agent. The link to the cell binding agent in the present case is formed from the bridge between the two PBD moieties through a linker group to the cell binding agent. Reactive functional groups located at other parts of the PBD structure may be capable of forming additional bonds to the cell binding agent (this may be referred to as crosslinking). These additional bonds may alter transport and biological activity of the conjugate. Therefore, in some embodiment, the additional substituents are limited to those lacking reactive functionality.
In one embodiment, the substituents are selected from the group consisting of R, OR, SR, NRR', NO2, halo, CO2R, COR, CONH2, CONHR, and CONRR'.
In one embodiment, the substituents are selected from the group consisting of R, OR, SR, NRR', NO2, CO2R, COR, CONH2, CONHR, and CONRR'.
In one embodiment, the substituents are selected from the group consisting of R, OR, SR, NRR', NO2, and halo.
In one embodiment, the substituents are selected from the group consisting of R, OR, SR, NRR', and NO2.
Any one of the embodiment mentioned above may be applied to any one of the substituents described herein. Alternatively, the substituents may be selected from one or more of the groups listed below.
Examples of substituents are described in more detail below.
C1-12 alkyl: The term "C1_12 alkyl" as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of a hydrocarbon compound having from 1 to 12 carbon atoms, which may be aliphatic or alicyclic, and which may be saturated or unsaturated (e.g. partially unsaturated, fully unsaturated). Thus, the term "alkyl" includes the sub-classes alkenyl, alkynyl, cycloalkyl, etc., discussed below.
Examples of saturated alkyl groups include, but are not limited to, methyl (C1), ethyl (C2), propyl (C3), butyl (C4), pentyl (C5), hexyl (C6) and heptyl (C7).
Examples of saturated linear alkyl groups include, but are not limited to, methyl (C1), ethyl (C2), n-propyl (C3), n-butyl (C4), n-pentyl (amyl) (C5), n-hexyl (C6) and n-heptyl (C7).
Examples of saturated branched alkyl groups include iso-propyl (C3), iso-butyl (C4), sec-butyl (C4), tert-butyl (C4), iso-pentyl (C5), and neo-pentyl (C5).
An alkyl group may optionally be interrupted by one or more heteroatoms selected from 0, N(H) and S. Such groups may be referred to as "heteroalkyl".
C2_12 Heteroalkyl: The term "C2-12 heteroalkyl" as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from a carbon atom of a hydrocarbon compound having from 2 to 12 carbon atoms, and one or more heteroatoms selected from 0, N(H) and S, preferably 0 and S.
Examples of heteroalkyl groups include, but are not limited to those comprising one or more ethylene glycol units of the type -(OCH2CH2)-. The terminal of a heteroalkyl group may be the primary form of a heteroatom, e.g. -OH, -SH or -NH2. In a preferred embodiment, the terminal is -CH3.
C2_12 Alkenyl: The term "C2-12 alkenyl" as used herein, pertains to an alkyl group having one or more carbon-carbon double bonds.
Examples of unsaturated alkenyl groups include, but are not limited to, ethenyl (vinyl, -CH=CH2), 1-propenyl (-CH=CH-CH3), 2-propenyl (allyl, -CH-CH=CH2), isopropenyl (1-methylvinyl, -C(CH3)=CH2), butenyl (C4), pentenyl (C5), and hexenyl (CO.
C2-12 alkynyl: The term "C2-12 alkynyl" as used herein, pertains to an alkyl group having one or more carbon-carbon triple bonds.
Examples of unsaturated alkynyl groups include, but are not limited to, ethynyl (-CECH) and 2-propynyl (propargyl, -CH2-CECH).
C3_12 cycloalkyl: The term "C3_12 cycloalkyl" as used herein, pertains to an alkyl group which is also a cyclyl group; that is, a monovalent moiety obtained by removing a hydrogen atom from an alicyclic ring atom of a cyclic hydrocarbon (carbocyclic) compound, which moiety has from 3 to 7 carbon atoms, including from 3 to 7 ring atoms.
Examples of cycloalkyl groups include, but are not limited to, those derived from:
saturated monocyclic hydrocarbon compounds:
cyclopropane (C3), cyclobutane (C4), cyclopentane (C5), cyclohexane (C6), cycloheptane (C7), methylcyclopropane (C4), dimethylcyclopropane (C5), methylcyclobutane (C5), dimethylcyclobutane (C6), methylcyclopentane (C6), dimethylcyclopentane (C7) and methylcyclohexane (C7);
unsaturated monocyclic hydrocarbon compounds:
cyclopropene (C3), cyclobutene (C4), cyclopentene (C5), cyclohexene (C6), methylcyclopropene (C4), dimethylcyclopropene (C5), methylcyclobutene (C5), dimethylcyclobutene (C6), methylcyclopentene (C6), dimethylcyclopentene (C7) and methylcyclohexene (C7); and saturated polycyclic hydrocarbon compounds:
norcarane (C7), norpinane (C7), norbornane (C7).
C3_20 heterocyclyl: The term "C3_20 heterocycly1" as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from a ring atom of a heterocyclic compound, which moiety has from 3 to 20 ring atoms, of which from 1 to 10 are ring heteroatoms.
Preferably, each ring has from 3 to 7 ring atoms, of which from 1 to 4 are ring heteroatoms.
In this context, the prefixes (e.g. C3-20, C3-7, C6-6, etc.) denote the number of ring atoms, or range of number of ring atoms, whether carbon atoms or heteroatoms. For example, the term "C5_6heterocycly1", as used herein, pertains to a heterocyclyl group having 5 or 6 ring atoms.
Examples of monocyclic heterocyclyl groups include, but are not limited to, those derived from:
N1: aziridine (C3), azetidine (C4), pyrrolidine (tetrahydropyrrole) (C5), pyrroline (e.g., 3-pyrroline, 2,5-dihydropyrrole) (C5), 2H-pyrrole or 3H-pyrrole (isopyrrole, isoazole) (C5), piperidine (C6), dihydropyridine (C6), tetrahydropyridine (C6), azepine (C7);
01: oxirane (C3), oxetane (C4), oxolane (tetranydrofuran) (C5), oxole (dihydrofuran) (C5), oxane (tetrahydropyran) (C6), dihydropyran (C6), pyran (C6), oxepin (C7);
S1: thiirane (C3), thietane (C4), thiolane (tetrahydrothiophene) (C5), thiane (tetrahydrothiopyran) (C6), thiepane (C7);
02: dioxolane (C5), dioxane (C6), and dioxepane (C7);
03: trioxane (C6);
N2: imidazolidine (C5), pyrazolidine (diazolidine) (C5), imidazoline (C5), pyrazoline (dihydropyrazole) (C5), piperazine (CO;
N101: tetrahydrooxazole (C5), dihydrooxazole (C5), tetrahydroisoxazole (C5), dihydroisoxazole (C5), morpholine (C6), tetrahydrooxazine (C6), dihydrooxazine (C6), oxazine (C6);
NISI: thiazoline (C5), thiazolidine (C5), thiomorpholine (C6);
N201: oxadiazine (C6);
OiSi: oxathiole (C5) and oxathiane (thioxane) (C6); and, N10151: oxathiazine (C6).
Examples of substituted monocyclic heterocyclyl groups include those derived from saccharides, in cyclic form, for example, furanoses (C5), such as arabinofuranose, lyxofuranose, ribofuranose, and xylofuranse, and pyranoses (C6), such as allopyranose, altropyranose, glucopyranose, mannopyranose, gulopyranose, idopyranose, galactopyranose, and talopyranose.
C5-20 aryl: The term "C5_20 aryl", as used herein, pertains to a monovalent moiety obtained by removing a hydrogen atom from an aromatic ring atom of an aromatic compound, which moiety has from 3 to 20 ring atoms. Preferably, each ring has from 5 to 7 ring atoms.
In this context, the prefixes (e.g. C3-20, C5-7, C5-6, etc.) denote the number of ring atoms, or range of number of ring atoms, whether carbon atoms or heteroatoms. For example, the term "C5_6 aryl" as used herein, pertains to an aryl group having 5 or 6 ring atoms.
The ring atoms may be all carbon atoms, as in "carboaryl groups".
Examples of carboaryl groups include, but are not limited to, those derived from benzene (i.e. phenyl) (C6), naphthalene (C10), azulene (C10), anthracene (C14), phenanthrene (C14), naphthacene (C10), and pyrene (C16).
Examples of aryl groups which comprise fused rings, at least one of which is an aromatic ring, include, but are not limited to, groups derived from indane (e.g. 2,3-dihydro-1H-indene) (C9), indene (C9), isoindene (C9), tetraline (1,2,3,4-tetrahydronaphthalene (C10), acenaphthene (C12), fluorene (C13), phenalene (C13), acephenanthrene (C15), and aceanthrene (C16).
Alternatively, the ring atoms may include one or more heteroatoms, as in "heteroaryl groups". Examples of monocyclic heteroaryl groups include, but are not limited to, those derived from:
N1: Pyrrole (azole) (Cs), pyridine (azine) (C6);
01: furan (oxole) (Cs);
S1: thiophene (thiole) (C5);
N101: oxazole (C5), isoxazole (C5), isoxazine (C6);
N201: oxadiazole (furazan) (C5);
N301: oxatriazole (C5);
NISI: thiazole (C5), isothiazole (Cs);
N2: imidazole (1,3-diazole) (Cs), pyrazole (1,2-diazole) (Cs), Pyridazine (1,2-diazine) (C6), pyrimidine (1,3-diazine) (C6) (e.g., cytosine, thymine, uracil), pyrazine (1,4-diazine) (C6), N3: triazole (C5), triazine (C6); and, N4: tetrazole (C5).
Examples of heteroaryl which comprise fused rings, include, but are not limited to:
C9 (with 2 fused rings) derived from benzofuran (01), isobenzofuran (01), indole (N1), isoindole (N1), indolizine (N1), indoline (N1), isoindoline (N1), purine (N4) (e.g., adenine, guanine), benzimidazole (N2), indazole (N2), benzoxazole (N101), benzisoxazole (N101), benzodioxole (02), benzofurazan (N201), benzotriazole (N3), benzothiofuran (S1), benzothiazole (NISI), benzothiadiazole (N2S);
C10 (with 2 fused rings) derived from chromene (01), isochromene (01), chroman (01), isochroman (01), benzodioxan (02), quinoline (N1), isoquinoline (N1), quinolizine (N1), benzoxazine (N101), benzodiazine (N2), pyridopyridine (N2), quinoxaline (N2), quinazoline (N2), cinnoline (N2), phthalazine (N2), naphthyridine (N2), pteridine (N4);
Cii (with 2 fused rings) derived from benzodiazepine (N2);
C13 (with 3 fused rings) derived from carbazole (N1), dibenzofuran (01), dibenzothiophene (Si), carboline (N2), perimidine (N2), pyridoindole (N2); and, C14 (with 3 fused rings) derived from acridine (N1), xanthene (01), thioxanthene (Si), oxanthrene (02), phenoxathiin (0151), phenazine (N2), phenoxazine (N101), phenothiazine (N151), thianthrene (S2), phenanthridine (N1), phenanthroline (N2), phenazine (N2).
The above groups, whether alone or part of another substituent, may themselves optionally be substituted with one or more groups selected from themselves and the additional substituents listed below.
Halo: -F, -Cl, -Br, and -I.
Hydroxy: -OH.
Ether: -OR, wherein R is an ether substituent, for example, a C1_7 alkyl group (also referred to as a C1_7 alkoxy group, discussed below), a C3_20 heterocyclyl group (also referred to as a C3_20 heterocyclyloxy group), or a C5_20 aryl group (also referred to as a C5_20 aryloxy group), preferably a C1_7a1ky1 group.
Alkoxy: -OR, wherein R is an alkyl group, for example, a C1-7 alkyl group.
Examples of C1-7 alkoxy groups include, but are not limited to, -0Me (methoxy), -0Et (ethoxy), -0(nPr) (n-propoxy), -0(i Pr) (isopropoxy), -0(n Bu) (n-butoxy), -0(sBu) (sec-butoxy), -0(i Bu) (isobutoxy), and -0(tBu) (tert-butoxy).
Acetal: -CH(0R1)(0R2), wherein R1 and R2 are independently acetal substituents, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5-20 aryl group, preferably a C1-7 alkyl group, or, in the case of a "cyclic" acetal group, R1 and R2, taken together with the two oxygen atoms to which they are attached, and the carbon atoms to which they are attached, form a heterocyclic ring having from 4 to 8 ring atoms. Examples of acetal groups include, but are not limited to, -CH(OMe)2, -CH(OEt)2, and -CH(OMe)(0Et).
Hemiacetal: -CH(OH)(0R1), wherein R1 is a hemiacetal substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of hemiacetal groups include, but are not limited to, -CH(OH)(0Me) and -CH(OH)(0Et).
Ketal: -CR(0R1)(0R2), where R1 and R2 are as defined for acetals, and R is a ketal substituent other than hydrogen, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples ketal groups include, but are not limited to, -C(Me)(0Me)2, -C(Me)(0Et)2, -C(Me)(0Me)(0Et), -C(Et)(0Me)2, -C(Et)(0Et)2, and -C(Et)(0Me)(0Et).
Hemiketal: -CR(OH)(0R1), where R1 is as defined for hemiacetals, and R is a hemiketal substituent other than hydrogen, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples of hemiacetal groups include, but are not limited to, -C(Me)(OH)(0Me), -C(Et)(OH)(0Me), -C(Me)(OH)(0Et), and -C(Et)(OH)(0Et).
Oxo (keto, -one): =O.
Thione (thioketone): =S.
Imino (imine): =NR, wherein R is an imino substituent, for example, hydrogen, C1_7 alkyl group, a C3-20 heterocyclyl group, or a C5_20 aryl group, preferably hydrogen or a C1_7 alkyl group. Examples of ester groups include, but are not limited to, =NH, =NMe, =NEt, and =NPh.
Formyl (carbaldehyde, carboxaldehyde): -C(=0)H.
Acyl (keto): -C(=0)R, wherein R is an acyl substituent, for example, a C1_7 alkyl group (also referred to as C1_7 alkylacyl or C1_7 alkanoyl), a C3_20 heterocyclyl group (also referred to as C3_20 heterocyclylacyl), or a C5_20 aryl group (also referred to as C5_20 arylacyl), preferably a C1-7 alkyl group. Examples of acyl groups include, but are not limited to, -C(=0)CH3 (acetyl), -C(=0)CH2CH3 (propionyl), -C(=0)C(CH3)3 (t-butyry1), and -C(=0)Ph (benzoyl, phenone).
Carboxy (carboxylic acid): -C(=0)0H.
Thiocarboxy (thiocarboxylic acid): -C(=S)SH.
Thiolocarboxy (thiolocarboxylic acid): -C(=O)SH.
Thionocarboxy (thionocarboxylic acid): -C(=S)OH.
lmidic acid: -C(=NH)OH.
Hydroxamic acid: -C(=NOH)OH.
Ester (carboxylate, carboxylic acid ester, oxycarbonyl): -C(=0)0R, wherein R
is an ester substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1-7 alkyl group. Examples of ester groups include, but are not limited to, -C(=0)0CH3, -C(=0)0CH2CH3, -C(=0)0C(CH3)3, and -C(=0)0Ph.
Acyloxy (reverse ester): -0C(=0)R, wherein R is an acyloxy substituent, for example, a C1-7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of acyloxy groups include, but are not limited to, -0C(=0)CH3 (acetoxy), -0C(=0)CH2CH3, -0C(=0)C(CH3)3, -0C(=0)Ph, and -0C(=0)CH2Ph.
Oxycarboyloxy: -0C(=0)0R, wherein R is an ester substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of ester groups include, but are not limited to, -0C(=0)0CH3, -0C(=0)0CH2CH3, -0C(=0)0C(CH3)3, and -0C(=0)0Ph.
Amino: -NR1R2, wherein R1 and R2 are independently amino substituents, for example, hydrogen, a C1_7 alkyl group (also referred to as C1_7 alkylamino or di-C17alkylamino), a C3-20 heterocyclyl group, or a C5_20 aryl group, preferably H or a C1_7 alkyl group, or, in the case of a "cyclic" amino group, R1 and R2, taken together with the nitrogen atom to which they are attached, form a heterocyclic ring having from 4 to 8 ring atoms. Amino groups may be primary (-NH2), secondary (-NHR1), or tertiary (-NHR1R2), and in cationic form, may be quaternary (- NR1R2R3). Examples of amino groups include, but are not limited to, -NH2, -NHCH3, -NHC(CH3)2, -N(CH3)2, -N(CH2CH3)2, and -NHPh. Examples of cyclic amino groups include, but are not limited to, aziridino, azetidino, pyrrolidino, piperidino, piperazino, morpholino, and thiomorpholino.
Amido (carbamoyl, carbamyl, aminocarbonyl, carboxamide): -C(=0)NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of amido groups include, but are not limited to, -C(=0)NH2, -C(=0)NHCH3, -C(=0)N(CH3)2, -C(=0)NHCH2CH3, and -C(=0)N(CH2CH3)2, as well as amido groups in which R1 and R2, together with the nitrogen atom to which they are attached, form a heterocyclic structure as in, for example, piperidinocarbonyl, morpholinocarbonyl, thiomorpholinocarbonyl, and piperazinocarbonyl.
Thioamido (thiocarbamyl): -C(=S)NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of amido groups include, but are not limited to, -C(=S)NH2, -C(=S)NHCH3, -C(=S)N(CH3)2, and -C(=S)NHCH2CH3.
Acylamido (acylamino): -NR1C(=0)R2, wherein R1 is an amide substituent, for example, hydrogen, a C17 alkyl group, a C320 heterocyclyl group, or a C520 aryl group, preferably hydrogen or a C17 alkyl group, and R2 is an acyl substituent, for example, a C17 alkylgroup, a C3_20 heterocyclyl group, or a C5_20ary1 group, preferably hydrogen or a C17 alkyl group.
Examples of acylamide groups include, but are not limited to, -NHC(=0)CH3 , -NHC(=0)CH2CH3, and -NHC(=0)Ph. R1 and R2 may together form a cyclic structure, as in, for example, succinimidyl, maleimidyl, and phthalimidyl:
succininnidyl nnaleinnidyl phthalinnidyl Aminocarbonyloxy: -0C(=0)NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of aminocarbonyloxy groups include, but are not limited to, -0C(=0)NH2, -0C(=0)NHMe, -0C(=0)NMe2, and -0C(=0)NEt2.
Ureido: -N(R1)CONR2R3 wherein R2 and R3 are independently amino substituents, as defined for amino groups, and R1 is a ureido substituent, for example, hydrogen, a C17 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably hydrogen or a C17 alkyl group. Examples of ureido groups include, but are not limited to, -NHCONH2, -NHCONHMe, -NHCONHEt, -NHCONMe2, -NHCONEt2, -NMeCONH2, -NMeCONHMe, -NMeCONHEt, -NMeCONMe2, and -NMeCONEt2.
Guanidino: -NH-C(=NH)NH2.
Tetrazolyl: a five membered aromatic ring having four nitrogen atoms and one carbon atom, H
N,N
II
N....-N
lmino: =NR, wherein R is an imino substituent, for example, for example, hydrogen, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably H
or a Cijalkyl group.
Examples of imino groups include, but are not limited to, =NH, =NMe, and =NEt.
Amidine (amidino): -C(=NR)N R2, wherein each R is an amidine substituent, for example, hydrogen, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably H or a C1_7 alkyl group. Examples of amidine groups include, but are not limited to, -C(=NH)NH2, -C(=NH)NMe2, and -C(=NMe)NMe2.
Nitro: -NO2.
Nitroso: -NO.
Azido: -N3.
Cyano (nitrile, carbonitrile): -CN.
lsocyano: -NC.
Cyanato: -OCN.
lsocyanato: -NCO.
Thiocyano (thiocyanato): -SCN.
lsothiocyano (isothiocyanato): -NCS.
Sulfhydryl (thiol, mercapto): -SH.
Thioether (sulfide): -SR, wherein R is a thioether substituent, for example, a C1_7 alkyl group (also referred to as a Cijalkylthio group), a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1-7 alkyl group. Examples of C1-7 alkylthio groups include, but are not limited to, -SCH3 and -SCH2CH3.
Disulfide: -SS-R, wherein R is a disulfide substituent, for example, a C1-7 alkyl group, a C3-20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group (also referred to herein as C1_7 alkyl disulfide). Examples of C1_7 alkyl disulfide groups include, but are not limited to, -SSCH3 and -SSCH2CH3.
Su!fine (sulfinyl, sulfoxide): -S(=0)R, wherein R is a sulfine substituent, for example, a C1-7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of sulfine groups include, but are not limited to, -S(=0)CH3 and -S(=0)CH2CH3.
Sulfone (sulfonyl): -S(=0)2R, wherein R is a sulfone substituent, for example, a C1-7 alkyl group, a C3-20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group, including, for example, a fluorinated or perfluorinated C1_7 alkyl group. Examples of sulfone groups include, but are not limited to, -S(=0)2CH3 (methanesulfonyl, mesyl), -S(=0)2CF3 (triflyl), -S(=0)2CH2CH3 (esyl), -S(=0)2C4F9 (nonaflyl), -S(=0)2CH2CF3 (tresyl), -S(=0)2CH2CH2NH2 (tauryl), -S(=0)2Ph (phenylsulfonyl, besyl), 4-methylphenylsulfonyl (tosyl), 4-chlorophenylsulfonyl (closyl), 4-bromophenylsulfonyl (brosyl), 4-nitrophenyl (nosyl), 2-naphthalenesulfonate (napsyl), and 5-dimethylamino-naphthalen-1-ylsulfonate (dansyl).
Sulfinic acid (sulfino): -S(=0)0H, -502H.
Sulfonic acid (sulfo): -S(=0)20H, -503H.
Sulfinate (sulfinic acid ester): -S(=0)0R; wherein R is a sulfinate substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of sulfinate groups include, but are not limited to, -S(=0)0CH3 (methoxysulfinyl;
methyl sulfinate) and -S(=0)0CH2CH3 (ethoxysulfinyl; ethyl sulfinate).
Sulfonate (sulfonic acid ester): -S(=0)20R, wherein R is a sulfonate substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples of sulfonate groups include, but are not limited to, -S(=0)20CH3 (methoxysulfonyl; methyl sulfonate) and -S(=0)20CH2CH3 (ethoxysulfonyl; ethyl sulfonate).
Sulfinyloxy: -0S(=0)R, wherein R is a sulfinyloxy substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples of sulfinyloxy groups include, but are not limited to, -0S(=0)CH3 and -0S(=0)CH2CH3.
Sulfonyloxy: -0S(=0)2R, wherein R is a sulfonyloxy substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of sulfonyloxy groups include, but are not limited to, -0S(=0)2CH3 (mesylate) and -0S(=0)2CH2CH3 (esylate).
Sulfate: -0S(=0)20R; wherein R is a sulfate substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group. Examples of sulfate groups include, but are not limited to, -0S(=0)20CH3 and -S0(=0)20CH2CH3.
Sulfamyl (sulfamoyl; sulfinic acid amide; sulfinamide): -S(=0)NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of sulfamyl groups include, but are not limited to, -S(=0)NH2, -S(=0)NH(CH3), -S(=0)N(CH3)2, -S(=0)NH(CH2CH3), -S(=0)N(CH2CH3)2, and -S(=0)NHPh.
Sulfonamido (sulfinamoyl; sulfonic acid amide; sulfonamide): -S(=0)2NR1R2, wherein R1 and R2 are independently amino substituents, as defined for amino groups. Examples of sulfonamido groups include, but are not limited to, -S(=0)2NH2, -S(=0)2NH(CH3), -S(=0)2N(CH3)2, -S(=0)2NH(CH2CH3), -S(=0)2N(CH2CH3)2, and -S(=0)2NHPh.
Sulfamino: -NR1S(=0)20H, wherein R1 is an amino substituent, as defined for amino groups.
Examples of sulfamino groups include, but are not limited to, -NHS(=0)20H and -N(CH3)S(=0)20H.
Sulfonamino: -NR1S(=0)2R, wherein R1 is an amino substituent, as defined for amino groups, and R is a sulfonamino substituent, for example, a C1-7 alkyl group, a heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group.
Examples of sulfonamino groups include, but are not limited to, -NHS(=0)2CH3 and -N(CH3)S(=0)2C6H5.
Sulfinamino: -NR1S(=0)R, wherein R1 is an amino substituent, as defined for amino groups, and R is a sulfinamino substituent, for example, a C1_7 alkyl group, a c3_20 heterocyclyl group, or a c5-20 aryl group, preferably a C1-7 alkyl group. Examples of sulfinamino groups include, but are not limited to, -NHS(=0)CH3 and -N(CH3)S(=0)C6H5.
Phosphino (phosphine): -PR2, wherein R is a phosphino substituent, for example, -H, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphino groups include, but are not limited to, -PH2, -P(CH3)2, -P(CH2CH3)2, -P(t-Bu)2, and -P(Ph)2.
Phospho: -P(=0)2.
Phosphinyl (phosphine oxide): -P(=0)R2, wherein R is a phosphinyl substituent, for example, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably a C1_7 alkyl group or a C5_20 aryl group. Examples of phosphinyl groups include, but are not limited to, -P(=0)(CH3)2, -P(=0)(CH2CH3)2, -P(=0)(t-Bu)2, and -P(=0)(Ph)2.
Phosphonic acid (phosphono): -P(=0)(OH)2.
Phosphonate (phosphono ester): -P(=0)(0R)2, where R is a phosphonate substituent, for example, -H, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphonate groups include, but are not limited to, -P(=0)(OCH3)2, -P(=0)(OCH2CH3)2, -P(=0)(0-t-Bu)2, and -P(=0)(OPh)2.
Phosphoric acid (phosphonooxy): -0P(=0)(OH)2.
Phosphate (phosphonooxy ester): -0P(=0)(0R)2, where R is a phosphate substituent, for example, -H, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphate groups include, but are not limited to, -0P(=0)(OCH3)2, -0P(=0)(OCH2CH3)2, -0P(=0)(0-t-Bu)2, and -0P(=0)(0Ph)2.
Phosphorous acid: -0P(OH)2.
Phosphite: -0P(OR)2, where R is a phosphite substituent, for example, -H, a C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphite groups include, but are not limited to, -0P(OCH3)2, -0P(OCH2CH3)2, -0P(0-t-Bu)2, and -0P(OP11)2.
Phosphoramidite: -0P(0R1)-NR22, where R1 and R2 are phosphoramidite substituents, for example, -H, a (optionally substituted) C1_7 alkyl group, a C3-20 heterocyclyl group, or a C5-20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group. Examples of phosphoramidite groups include, but are not limited to, -0P(OCH2CH3)-N(CH3)2, -0P(OCH2CH3)-N(i-Pr)2, and -0P(OCH2CH2CN)-N(i-Pr)2.
Phosphoramidate: -0P(=0)(0R1)-NR22, where R1 and R2 are phosphoramidate substituents, for example, -H, a (optionally substituted) C1_7 alkyl group, a C3_20 heterocyclyl group, or a C5_20 aryl group, preferably -H, a C1_7 alkyl group, or a C5_20 aryl group.
Examples of phosphoramidate groups include, but are not limited to, -0P(=0)(OCH2CH3)-N(CH3)2, -0P(=0)(OCH2CH3)-N(i-Pr)2, and -0P(=0)(OCH2CH2CN)-N(i-Pr)2.
Alkylene C3_12 alkylene: The term "C3_12 alkylene", as used herein, pertains to a bidentate moiety obtained by removing two hydrogen atoms, either both from the same carbon atom, or one from each of two different carbon atoms, of a hydrocarbon compound having from 3 to 12 carbon atoms (unless otherwise specified), which may be aliphatic or alicyclic, and which may be saturated, partially unsaturated, or fully unsaturated. Thus, the term "alkylene"
includes the sub-classes alkenylene, alkynylene, cycloalkylene, etc., discussed below.
Examples of linear saturated C3_12 alkylene groups include, but are not limited to, -(CH2)n-where n is an integer from 3 to 12, for example, -CH2CH2CH2- (Propylene), -CH2CH2CH2CH2- (butylene), -CH2CH2CH2CH2CH2- (pentylene) and -CH2CH2CH2CH-2CH2CH2CH2- (heptylene).
Examples of branched saturated C3_12 alkylene groups include, but are not limited to, -CH(CH3)CH2-, -CH(CH3)CH2CH2-, -CH(CH3)CH2CH2CH2-, -CH2CH(CH3)CH2-, -CH2CH(CH3)CH2CH2-, -CH(CH2CH3)-, -CH(CH2CH3)CH2-, and -CH2CH(CH2CH3)CH2-=
Examples of linear partially unsaturated C3_12 alkylene groups (C3_12 alkenylene, and alkynylene groups) include, but are not limited to, -CH=CH-CH2-, -CH2-CH=CH2-, -CH=CH-CH2-CH2-, -CH=CH-CH2-CH2-CH2-, -CH=CH-CH=CH-, -CH=CH-CH=CH-CH2-, -CH=CH-CH=CH-CH2-CH2-, -CH=CH-CH2-CH=CH-, -CH=CH-CH2-CH2-CH=CH-, and -CH2-CEC-CH2-.
Examples of branched partially unsaturated C3_12 alkylene groups (C3_12alkenylene and alkynylene groups) include, but are not limited to, -C(CH3)=CH-, -C(CH3)=CH-CH2-, -CH=CH-CH(CH3)- and -CEC-CH(CH3)-.
Examples of alicyclic saturated C3_12 alkylene groups (C3_12 cycloalkylenes) include, but are not limited to, cyclopentylene (e.g. cyclopent-1,3-ylene), and cyclohexylene (e.g. cyclohex-1,4-ylene).
Examples of alicyclic partially unsaturated C3_12 alkylene groups (C3_12 cycloalkylenes) include, but are not limited to, cyclopentenylene (e.g. 4-cyclopenten-1,3-ylene), cyclohexenylene (e.g. 2-cyclohexen-1,4-ylene; 3-cyclohexen-1,2-ylene; 2,5-cyclohexadien-1,4-ylene).
Includes Other Forms Unless otherwise specified, included in the above are the well known ionic, salt, solvate, and protected forms of these substituents. For example, a reference to carboxylic acid (-COOH) also includes the anionic (carboxylate) form (-000-), a salt or solvate thereof, as well as conventional protected forms. Similarly, a reference to an amino group includes the protonated form (-N HR1R2), a salt or solvate of the amino group, for example, a hydrochloride salt, as well as conventional protected forms of an amino group.
Similarly, a reference to a hydroxyl group also includes the anionic form (-C), a salt or solvate thereof, as well as conventional protected forms.
Salts It may be convenient or desirable to prepare, purify, and/or handle a corresponding salt of the active compound, for example, a pharmaceutically-acceptable salt. Examples of pharmaceutically acceptable salts are discussed in Berge, et al., J. Pharm.
Sci., 66, 1-19 (1977).
For example, if the compound is anionic, or has a functional group which may be anionic (e.g. -COOH may be -000-), then a salt may be formed with a suitable cation.
Examples of suitable inorganic cations include, but are not limited to, alkali metal ions such as Na + and K , alkaline earth cations such as Ca2+ and Mg2 , and other cations such as A1+3. Examples of suitable organic cations include, but are not limited to, ammonium ion (i.e. NH4) and substituted ammonium ions (e.g. NH3R+, NH2R2+, NHR3+, NR4+). Examples of some suitable substituted ammonium ions are those derived from: ethylamine, diethylamine, dicyclohexylamine, triethylamine, butylamine, ethylenediamine, ethanolamine, diethanolamine, piperazine, benzylamine, phenylbenzylamine, choline, meglumine, and tromethamine, as well as amino acids, such as lysine and arginine. An example of a common quaternary ammonium ion is N(CH3)4 .
If the compound is cationic, or has a functional group which may be cationic (e.g. -NH2 may be -NH3), then a salt may be formed with a suitable anion. Examples of suitable inorganic anions include, but are not limited to, those derived from the following inorganic acids:
hydrochloric, hydrobromic, hydroiodic, sulfuric, sulfurous, nitric, nitrous, phosphoric, and phosphorous.
Examples of suitable organic anions include, but are not limited to, those derived from the following organic acids: 2-acetyoxybenzoic, acetic, ascorbic, aspartic, benzoic, camphorsulfonic, cinnamic, citric, edetic, ethanedisulfonic, ethanesulfonic, fumaric, glucheptonic, gluconic, glutamic, glycolic, hydroxymaleic, hydroxynaphthalene carboxylic, isethionic, lactic, lactobionic, lauric, maleic, malic, methanesulfonic, mucic, oleic, oxalic, palmitic, pamoic, pantothenic, phenylacetic, phenylsulfonic, propionic, pyruvic, salicylic, stearic, succinic, sulfanilic, tartaric, toluenesulfonic, trifluoroacetic acid and valeric.
Examples of suitable polymeric organic anions include, but are not limited to, those derived from the following polymeric acids: tannic acid, carboxymethyl cellulose.
Solvates It may be convenient or desirable to prepare, purify, and/or handle a corresponding solvate of the active compound. The term "solvate" is used herein in the conventional sense to refer to a complex of solute (e.g. active compound, salt of active compound) and solvent. If the solvent is water, the solvate may be conveniently referred to as a hydrate, for example, a mono-hydrate, a di-hydrate, a tri-hydrate, etc.
The invention includes compounds where a solvent adds across the imine bond of the PBD
moiety, which is illustrated below where the solvent is water or an alcohol (RAOH, where RA
is C1_4 alkyl):
ORA
yRX7 I HN R2b X . Ob RAOH y R7 OR6 R"
R2b These forms can be called the carbinolamine and carbinolamine ether forms of the PBD (as described in the section relating to R 1 above). The balance of these equilibria depend on the conditions in which the compounds are found, as well as the nature of the moiety itself.
These particular compounds may be isolated in solid form, for example, by lyophilisation.
Isomers Certain compounds of the invention may exist in one or more particular geometric, optical, enantiomeric, diasteriomeric, epimeric, atropic, stereoisomeric, tautomeric, conformational, or anomeric forms, including but not limited to, cis- and trans-forms; E- and Z-forms; c-, t-, and r- forms; endo- and exo-forms; R-, S-, and meso-forms; D- and L-forms; d-and l-forms;
(+) and (-) forms; keto-, enol-, and enolate-forms; syn- and anti-forms;
synclinal- and anticlinal-forms; a- and [3 -f o rm s ; axial and equatorial forms; boat-, chair-, twist-, envelope-, and halfchair-forms; and combinations thereof, hereinafter collectively referred to as "isomers" (or "isomeric forms").
The term "chiral" refers to molecules which have the property of non-superimposability of the mirror image partner, while the term "achiral" refers to molecules which are superimposable on their mirror image partner.
The term "stereoisomers" refers to compounds which have identical chemical constitution, but differ with regard to the arrangement of the atoms or groups in space.
"Diastereomer" refers to a stereoisomer with two or more centers of chirality and whose molecules are not mirror images of one another. Diastereomers have different physical properties, e.g. melting points, boiling points, spectral properties, and reactivities. Mixtures of diastereomers may separate under high resolution analytical procedures such as electrophoresis and chromatography.
"Enantiomers" refer to two stereoisomers of a compound which are non-superimposable mirror images of one another.
Stereochemical definitions and conventions used herein generally follow S. P.
Parker, Ed., McGraw-Hill Dictionary of Chemical Terms (1984) McGraw-Hill Book Company, New York;
and Eliel, E. and Wilen, S., "Stereochemistry of Organic Compounds", John Wiley & Sons, Inc., New York, 1994. The compounds of the invention may contain asymmetric or chiral centers, and therefore exist in different stereoisomeric forms. It is intended that all stereoisomeric forms of the compounds of the invention, including but not limited to, diastereomers, enantiomers and atropisomers, as well as mixtures thereof such as racemic mixtures, form part of the present invention. Many organic compounds exist in optically active forms, i.e., they have the ability to rotate the plane of plane-polarized light. In describing an optically active compound, the prefixes D and L, or R and S, are used to denote the absolute configuration of the molecule about its chiral center(s).
The prefixes d and I or (+) and (-) are employed to designate the sign of rotation of plane-polarized light by the compound, with (-) or I meaning that the compound is levorotatory. A
compound prefixed with (+) or d is dextrorotatory. For a given chemical structure, these stereoisomers are identical except that they are mirror images of one another. A specific stereoisomer may also be referred to as an enantiomer, and a mixture of such isomers is often called an enantiomeric mixture. A 50:50 mixture of enantiomers is referred to as a racemic mixture or a racemate, which may occur where there has been no stereoselection or stereospecificity in a chemical reaction or process. The terms "racemic mixture" and "racemate"
refer to an equimolar mixture of two enantiomeric species, devoid of optical activity.
Note that, except as discussed below for tautomeric forms, specifically excluded from the term "isomers", as used herein, are structural (or constitutional) isomers (i.e. isomers which differ in the connections between atoms rather than merely by the position of atoms in space). For example, a reference to a methoxy group, -OCH3, is not to be construed as a reference to its structural isomer, a hydroxymethyl group, -CH2OH. Similarly, a reference to ortho-chlorophenyl is not to be construed as a reference to its structural isomer, meta-chlorophenyl. However, a reference to a class of structures may well include structurally isomeric forms falling within that class (e.g. C1_7 alkyl includes n-propyl and iso-propyl; butyl includes n-, iso-, sec-, and tert-butyl; methoxyphenyl includes ortho-, meta-, and para-methoxypheny1).
The above exclusion does not pertain to tautomeric forms, for example, keto-, enol-, and enolate-forms, as in, for example, the following tautomeric pairs: keto/enol (illustrated below), imine/enamine, amide/imino alcohol, amidine/amidine, nitroso/oxime, thioketone/enethiol, N-nitroso/hyroxyazo, and nitro/aci-nitro.
,C) ,OH H+
/C=C\ C=C
\ H / \
+
keto enol enolate The term "tautomer" or "tautomeric form" refers to structural isomers of different energies which are interconvertible via a low energy barrier. For example, proton tautomers (also known as prototropic tautomers) include interconversions via migration of a proton, such as keto-enol and imine-enamine isomerizations. Valence tautomers include interconversions by reorganization of some of the bonding electrons.
Note that specifically included in the term "isomer" are compounds with one or more isotopic substitutions. For example, H may be in any isotopic form, including 1H, 2H
(D), and 3H (T);
C may be in any isotopic form, including 13C, and 14C; 0 may be in any isotopic form, including 160 and 180; and the like.
Examples of isotopes that can be incorporated into compounds of the invention include isotopes of hydrogen, carbon, nitrogen, oxygen, phosphorous, fluorine, and chlorine, such as, but not limited to 2H (deuterium, D), 3H (tritium), 11C, 13C, 14C, 15N, 18F, 31p, 32p, 35s, 36C1, and 1261. Various isotopically labeled compounds of the present invention, for example those into which radioactive isotopes such as 3H, 13C, and 14C are incorporated.
Such isotopically labelled compounds may be useful in metabolic studies, reaction kinetic studies, detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug or substrate tissue distribution assays, or in radioactive treatment of patients. Deuterium labelled or substituted therapeutic compounds of the invention may have improved DMPK (drug metabolism and pharmacokinetics) properties, relating to distribution, metabolism, and excretion (ADME).
Substitution with heavier isotopes such as deuterium may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements. An 18F labeled compound may be useful for PET
or SPECT studies. Isotopically labeled compounds of this invention and prodrugs thereof can generally be prepared by carrying out the procedures disclosed in the schemes or in the examples and preparations described below by substituting a readily available isotopically labeled reagent for a non-isotopically labeled reagent. Further, substitution with heavier isotopes, particularly deuterium (i.e., 2H or D) may afford certain therapeutic advantages resulting from greater metabolic stability, for example increased in vivo half-life or reduced dosage requirements or an improvement in therapeutic index. It is understood that deuterium in this context is regarded as a substituent. The concentration of such a heavier isotope, specifically deuterium, may be defined by an isotopic enrichment factor. In the compounds of this invention any atom not specifically designated as a particular isotope is meant to represent any stable isotope of that atom.
Unless otherwise specified, a reference to a particular compound includes all such isomeric forms, including (wholly or partially) racemic and other mixtures thereof.
Methods for the preparation (e.g. asymmetric synthesis) and separation (e.g. fractional crystallisation and chromatographic means) of such isomeric forms are either known in the art or are readily obtained by adapting the methods taught herein, or known methods, in a known manner.
Biological Activity In vitro cell proliferation assays Generally, the cytotoxic or cytostatic activity of an antibody-drug conjugate (ADC) is measured by: exposing mammalian cells having receptor proteins, e.g. HER2, to the antibody of the ADC in a cell culture medium; culturing the cells for a period from about 6 hours to about 5 days; and measuring cell viability. Cell-based in vitro assays are used to measure viability (proliferation), cytotoxicity, and induction of apoptosis (caspase activation) of an ADC of the invention.
The in vitro potency of antibody-drug conjugates can be measured by a cell proliferation assay. The CellTiter-Glo Luminescent Cell Viability Assay is a commercially available (Promega Corp., Madison, WI), homogeneous assay method based on the recombinant expression of Coleoptera luciferase (US Patent Nos. 5583024; 5674713 and 5700670). This cell proliferation assay determines the number of viable cells in culture based on quantitation of the ATP present, an indicator of metabolically active cells (Crouch et al (1993) J. Immunol.
Meth. 160:81-88; US 6602677). The CellTiter-Gle Assay is conducted in 96 well format, making it amenable to automated high-throughput screening (HTS) (Cree et al (1995) AntiCancer Drugs 6:398-404). The homogeneous assay procedure involves adding the single reagent (CellTiter-Glo Reagent) directly to cells cultured in serum-supplemented medium. Cell washing, removal of medium and multiple pipetting steps are not required. The system detects as few as 15 cells/well in a 384-well format in 10 minutes after adding reagent and mixing. The cells may be treated continuously with ADC, or they may be treated and separated from ADC. Generally, cells treated briefly, i.e. 3 hours, showed the same potency effects as continuously treated cells.
The homogeneous "add-mix-measure" format results in cell lysis and generation of a luminescent signal proportional to the amount of ATP present. The amount of ATP is directly proportional to the number of cells present in culture. The CellTiter-Glo Assay generates a "glow-type" luminescent signal, produced by the luciferase reaction, which has a half-life generally greater than five hours, depending on cell type and medium used.
Viable cells are reflected in relative luminescence units (RLU). The substrate, Beetle Luciferin, is oxidatively decarboxylated by recombinant firefly luciferase with concomitant conversion of ATP to AMP
and generation of photons.
The in vitro potency of antibody-drug conjugates can also be measured by a cytotoxicity assay. Cultured adherent cells are washed with PBS, detached with trypsin, diluted in complete medium, containing 10% FCS, centrifuged, re-suspended in fresh medium and counted with a haemocytometer. Suspension cultures are counted directly.
Monodisperse cell suspensions suitable for counting may require agitation of the suspension by repeated aspiration to break up cell clumps.
The cell suspension is diluted to the desired seeding density and dispensed (100p1 per well) into black 96 well plates. Plates of adherent cell lines are incubated overnight to allow adherence. Suspension cell cultures can be used on the day of seeding.
A stock solution (1mI) of ADC (20pg/m1) is made in the appropriate cell culture medium.
Serial 10-fold dilutions of stock ADC are made in 15ml centrifuge tubes by serially transferring 100pIto 900p1 of cell culture medium.
Four replicate wells of each ADC dilution (100p1) are dispensed in 96-well black plates, previously plated with cell suspension (100p1), resulting in a final volume of 200 pl. Control wells receive cell culture medium (100p1).
If the doubling time of the cell line is greater than 30 hours, ADC incubation is for 5 days, otherwise a four day incubation is done.
At the end of the incubation period, cell viability is assessed with the Alamar blue assay.
AlamarBlue (Invitrogen) is dispensed over the whole plate (20p1 per well) and incubated for 4 hours. Alamar blue fluorescence is measured at excitation 570nm, emission 585nm on the Varioskan flash plate reader. Percentage cell survival is calculated from the mean fluorescence in the ADC treated wells compared to the mean fluorescence in the control wells.
In vivo efficacy The in vivo efficacy of antibody-drug conjugates (ADC) of the invention can be measured by tumor xenograft studies in mice. For example, the in vivo efficacy of an anti-HER2 ADC of the invention can be measured by a high expressing HER2 transgenic explant mouse model.
An allograft is propagated from the Fo5 mmtv transgenic mouse which does not respond to, or responds poorly to, HERCEPTIN therapy. Subjects were treated once with ADC
at certain dose levels (mg/kg) and PBD drug exposure (pg/m2); and placebo buffer control (Vehicle) and monitored over two weeks or more to measure the time to tumor doubling, log cell kill, and tumor shrinkage.
Use The conjugates of the invention may be used to provide a PBD conjugate at a target location.
The target location is preferably a proliferative cell population. The antibody is an antibody for an antigen present in a proliferative cell population.
In one embodiment the antigen is absent or present at a reduced level in a non-proliferative cell population compared to the amount of antigen present in the proliferative cell population, for example a tumour cell population.
The target location may be in vitro, in vivo or ex vivo.
The antibody-drug conjugate (ADC) compounds of the invention include those with utility for anticancer activity. In particular, the compounds include an antibody conjugated, i.e.
covalently attached by a linker, to a PBD moiety.
At the target location the linker may not be cleaved. The antibody-drug conjugate (ADC
compounds of the invention may have a cytotoxic effect without the cleavage of the linker to release a PBD drug moiety. The antibody-drug conjugates (ADC) of the invention selectively deliver cytotoxic agent to tumor tissue whereby greater selectivity, i.e. a lower efficacious dose, may be achieved.
Thus, in one aspect, the present invention provides a conjugate compound as described herein for use in therapy.
In a further aspect there is also provides a conjugate compound as described herein for use in the treatment of a proliferative disease. A second aspect of the present invention provides the use of a conjugate compound in the manufacture of a medicament for treating a proliferative disease.
One of ordinary skill in the art is readily able to determine whether or not a candidate conjugate treats a proliferative condition for any particular cell type. For example, assays which may conveniently be used to assess the activity offered by a particular compound are described in the examples below.
The term "proliferative disease" pertains to an unwanted or uncontrolled cellular proliferation of excessive or abnormal cells which is undesired, such as, neoplastic or hyperplastic growth, whether in vitro or in vivo.
Examples of proliferative conditions include, but are not limited to, benign, pre-malignant, and malignant cellular proliferation, including but not limited to, neoplasms and tumours (e.g.
histocytoma, glioma, astrocyoma, osteoma), cancers (e.g. lung cancer, small cell lung cancer, gastrointestinal cancer, bowel cancer, colon cancer, breast carinoma, ovarian carcinoma, prostate cancer, testicular cancer, liver cancer, kidney cancer, bladder cancer, pancreas cancer, brain cancer, sarcoma, osteosarcoma, Kaposi's sarcoma, melanoma), leukemias, psoriasis, bone diseases, fibroproliferative disorders (e.g. of connective tissues), and atherosclerosis. Cancers of particular interest include, but are not limited to, leukemias and ovarian cancers.
Any type of cell may be treated, including but not limited to, lung, gastrointestinal (including, e.g. bowel, colon), breast (mammary), ovarian, prostate, liver (hepatic), kidney (renal), bladder, pancreas, brain, and skin.
In one embodiment, the treatment is of a pancreatic cancer.
In one embodiment, the treatment is of a tumour having av[36 integrin on the surface of the cell.
It is contemplated that the antibody-drug conjugates (ADC) of the present invention may be used to treat various diseases or disorders, e.g. characterized by the overexpression of a tumor antigen. Exemplary conditions or hyperproliferative disorders include benign or malignant tumors; leukemia, haematological, and lymphoid malignancies. Others include neuronal, glial, astrocytal, hypothalamic, glandular, macrophagal, epithelial, stromal, blastocoelic, inflammatory, angiogenic and immunologic, including autoimmune, disorders.
Generally, the disease or disorder to be treated is a hyperproliferative disease such as cancer. Examples of cancer to be treated herein include, but are not limited to, carcinoma, lymphoma, blastoma, sarcoma, and leukemia or lymphoid malignancies. More particular examples of such cancers include squamous cell cancer (e.g. epithelial squamous cell cancer), lung cancer including small-cell lung cancer, non-small cell lung cancer, adenocarcinoma of the lung and squamous carcinoma of the lung, cancer of the peritoneum, hepatocellular cancer, gastric or stomach cancer including gastrointestinal cancer, pancreatic cancer, glioblastoma, cervical cancer, ovarian cancer, liver cancer, bladder cancer, hepatoma, breast cancer, colon cancer, rectal cancer, colorectal cancer, endometrial or uterine carcinoma, salivary gland carcinoma, kidney or renal cancer, prostate cancer, vulval cancer, thyroid cancer, hepatic carcinoma, anal carcinoma, penile carcinoma, as well as head and neck cancer.
Autoimmune diseases for which the ADC compounds may be used in treatment include rheumatologic disorders (such as, for example, rheumatoid arthritis, Sjogren's syndrome, scleroderma, lupus such as SLE and lupus nephritis, polymyositis/dermatomyositis, cryoglobulinemia, anti-phospholipid antibody syndrome, and psoriatic arthritis), osteoarthritis, autoimmune gastrointestinal and liver disorders (such as, for example, inflammatory bowel diseases (e.g. ulcerative colitis and Crohn's disease), autoimmune gastritis and pernicious anemia, autoimmune hepatitis, primary biliary cirrhosis, primary sclerosing cholangitis, and celiac disease), vasculitis (such as, for example, ANCA-associated vasculitis, including Churg-Strauss vasculitis, Wegener's granulomatosis, and polyarteriitis), autoimmune neurological disorders (such as, for example, multiple sclerosis, opsoclonus myoclonus syndrome, myasthenia gravis, neuromyelitis optica, Parkinson's disease, Alzheimer's disease, and autoimmune polyneuropathies), renal disorders (such as, for example, glomerulonephritis, Goodpasture's syndrome, and Berger's disease), autoimmune dermatologic disorders (such as, for example, psoriasis, urticaria, hives, pemphigus vulgaris, bullous pemphigoid, and cutaneous lupus erythematosus), hematologic disorders (such as, for example, thrombocytopenic purpura, thrombotic thrombocytopenic purpura, post-transfusion purpura, and autoimmune hemolytic anemia), atherosclerosis, uveitis, autoimmune hearing diseases (such as, for example, inner ear disease and hearing loss), Behcet's disease, Raynaud's syndrome, organ transplant, and autoimmune endocrine disorders (such as, for example, diabetic-related autoimmune diseases such as insulin-dependent diabetes mellitus (IDDM), Addison's disease, and autoimmune thyroid disease (e.g. Graves' disease and thyroiditis)). More preferred such diseases include, for example, rheumatoid arthritis, ulcerative colitis, ANCA-associated vasculitis, lupus, multiple sclerosis, Sjogren's syndrome, Graves' disease, IDDM, pernicious anemia, thyroiditis, and glomerulonephritis.
Methods of Treatment The conjugates of the present invention may be used in a method of therapy.
Also provided is a method of treatment, comprising administering to a subject in need of treatment a therapeutically-effective amount of a conjugate compound of the invention. The term "therapeutically effective amount" is an amount sufficient to show benefit to a patient. Such benefit may be at least amelioration of at least one symptom. The actual amount administered, and rate and time-course of administration, will depend on the nature and severity of what is being treated. Prescription of treatment, e.g. decisions on dosage, is within the responsibility of general practitioners and other medical doctors.
A compound of the invention may be administered alone or in combination with other treatments, either simultaneously or sequentially dependent upon the condition to be treated.
Examples of treatments and therapies include, but are not limited to, chemotherapy (the administration of active agents, including, e.g. drugs, such as chemotherapeutics); surgery;
and radiation therapy.
A "chemotherapeutic agent" is a chemical compound useful in the treatment of cancer, regardless of mechanism of action. Classes of chemotherapeutic agents include, but are not limited to: alkylating agents, antimetabolites, spindle poison plant alkaloids, cytotoxic/antitumor antibiotics, topoisomerase inhibitors, antibodies, photosensitizers, and kinase inhibitors. Chemotherapeutic agents include compounds used in "targeted therapy"
and conventional chemotherapy.
Examples of chemotherapeutic agents include: erlotinib (TARCEVAO, Genentech/OSI
Pharm.), docetaxel (TAXOTEREO, Sanofi-Aventis), 5-FU (fluorouracil, 5-fluorouracil, CAS
No. 51-21-8), gemcitabine (GEMZARO, Lilly), PD-0325901 (CAS No. 391210-10-9, Pfizer), cisplatin (cis-diamine, dichloroplatinum(II), CAS No. 15663-27-1), carboplatin (CAS No.
41575-94-4), paclitaxel (TAXOLO, Bristol-Myers Squibb Oncology, Princeton, N.J.), trastuzumab (HERCEPTINO, Genentech), temozolomide (4-methyl-5-oxo- 2,3,4,6,8-pentazabicyclo [4.3.0] nona-2,7,9-triene- 9-carboxamide, CAS No. 85622-93-1, TEMODARO, TEMODALO, Schering Plough), tamoxifen ((Z)-244-(1,2-diphenylbut-1-enyl)phenoxy]-N,N-dimethylethanamine, NOLVADEXO, ISTUBALO, VALODEX0), and doxorubicin (ADRIAMYCINO), Akti-1/2, HPPD, and rapamycin.
More examples of chemotherapeutic agents include: oxaliplatin (ELOXATINO, Sanofi), bortezomib (VELCADEO, Millennium Pharm.), sutent (SUNITINIBO, SU11248, Pfizer), letrozole (FEMARAO, Novartis), imatinib mesylate (GLEEVECO, Novartis), XL-518 (Mek inhibitor, Exelixis, WO 2007/044515), ARRY-886 (Mek inhibitor, AZD6244, Array BioPharma, Astra Zeneca), SF-1126 (PI3K inhibitor, Semafore Pharmaceuticals), BEZ-235 (PI3K
inhibitor, Novartis), XL-147 (PI3K inhibitor, Exelixis), PTK787/ZK 222584 (Novartis), fulvestrant (FASLODEXO, AstraZeneca), leucovorin (folinic acid), rapamycin (sirolimus, RAPAMUNEO, Wyeth), lapatinib (TYKERBO, G5K572016, Glaxo Smith Kline), lonafarnib (SARASARTM, SCH 66336, Schering Plough), sorafenib (NEXAVARO, BAY43-9006, Bayer Labs), gefitinib (IRESSAO, AstraZeneca), irinotecan (CAMPTOSARO, CPT-11, Pfizer), tipifarnib (ZARNESTRATm, Johnson & Johnson), ABRAXANETM (Cremophor-free), albumin-engineered nanoparticle formulations of paclitaxel (American Pharmaceutical Partners, Schaumberg, II), vandetanib (rINN, ZD6474, ZACTIMAO, AstraZeneca), chloranmbucil, AG1478, AG1571 (SU 5271; Sugen), temsirolimus (TORISELO, Wyeth), pazopanib (GlaxoSmithKline), canfosfamide (TELCYTAO, Telik), thiotepa and cyclosphosphamide (CYTOXANO, NEOSARO); alkyl sulfonates such as busulfan, improsulfan and piposulfan;
aziridines such as benzodopa, carboquone, meturedopa, and uredopa;
ethylenimines and methylamelamines including altretamine, triethylenemelamine, triethylenephosphoramide, triethylenethiophosphoramide and trimethylomelamine; acetogenins (especially bullatacin and bullatacinone); a camptothecin (including the synthetic analog topotecan);
bryostatin;
callystatin; CC-1065 (including its adozelesin, carzelesin and bizelesin synthetic analogs);
cryptophycins (particularly cryptophycin 1 and cryptophycin 8); dolastatin;
duocarmycin (including the synthetic analogs, KW-2189 and CB1-TM1); eleutherobin;
pancratistatin; a sarcodictyin; spongistatin; nitrogen mustards such as chlorambucil, chlornaphazine, chlorophosphamide, estramustine, ifosfamide, mechlorethamine, mechlorethamine oxide hydrochloride, melphalan, novembichin, phenesterine, prednimustine, trofosfamide, uracil mustard; nitrosoureas such as carmustine, chlorozotocin, fotemustine, lomustine, nimustine, and ranimnustine; antibiotics such as the enediyne antibiotics (e.g.
calicheamicin, calicheamicin gamma11, calicheamicin omegal1 (Angew Chem. Intl. Ed. Engl.
(1994) 33:183-186); dynemicin, dynemicin A; bisphosphonates, such as clodronate; an esperamicin; as well as neocarzinostatin chromophore and related chromoprotein enediyne antibiotic chromophores), aclacinomysins, actinomycin, authramycin, azaserine, bleomycins, cactinomycin, carabicin, carminomycin, carzinophilin, chromomycinis, dactinomycin, daunorubicin, detorubicin, 6-diazo-5-oxo-L-norleucine, morpholino-doxorubicin, cyanomorpholino-doxorubicin, 2-pyrrolino-doxorubicin and deoxydoxorubicin), epirubicin, esorubicin, idarubicin, nemorubicin, marcellomycin, mitomycins such as mitomycin C, mycophenolic acid, nogalamycin, olivomycins, peplomycin, porfiromycin, puromycin, quelamycin, rodorubicin, streptonigrin, streptozocin, tubercidin, ubenimex, zinostatin, zorubicin; anti-metabolites such as methotrexate and 5-fluorouracil (5-FU);
folic acid analogs such as denopterin, methotrexate, pteropterin, trimetrexate; purine analogs such as fludarabine, 6-mercaptopurine, thiamiprine, thioguanine; pyrimidine analogs such as ancitabine, azacitidine, 6-azauridine, carmofur, cytarabine, dideoxyuridine, doxifluridine, enocitabine, floxuridine; androgens such as calusterone, dromostanolone propionate, epitiostanol, mepitiostane, testolactone; anti-adrenals such as aminoglutethimide, mitotane, trilostane; folic acid replenisher such as frolinic acid; aceglatone;
aldophosphamide glycoside; aminolevulinic acid; eniluracil; amsacrine; bestrabucil;
bisantrene; edatraxate;
defofamine; demecolcine; diaziquone; elfornithine; elliptinium acetate; an epothilone;
etoglucid; gallium nitrate; hydroxyurea; lentinan; lonidainine; maytansinoids such as maytansine and ansamitocins; mitoguazone; mitoxantrone; mopidanmol;
nitraerine;
pentostatin; phenamet; pirarubicin; losoxantrone; podophyllinic acid; 2-ethylhydrazide;
procarbazine; PSKO polysaccharide complex (JHS Natural Products, Eugene, OR);
razoxane; rhizoxin; sizofiran; spirogermanium; tenuazonic acid; triaziquone;
2,2',2"-trichlorotriethylamine; trichothecenes (especially T-2 toxin, verracurin A, roridin A and anguidine); urethan; vindesine; dacarbazine; mannomustine; mitobronitol;
mitolactol;
pipobroman; gacytosine; arabinoside ("Ara-C"); cyclophosphamide; thiotepa; 6-thioguanine;
mercaptopurine; methotrexate; platinum analogs such as cisplatin and carboplatin;
vinblastine; etoposide (VP-16); ifosfamide; mitoxantrone; vincristine;
vinorelbine (NAVELBINE0); novantrone; teniposide; edatrexate; daunomycin; aminopterin;
capecitabine (XELODAO, Roche); ibandronate; CPT-11; topoisomerase inhibitor RFS 2000;
difluoromethylornithine (DMF0); retinoids such as retinoic acid; and pharmaceutically acceptable salts, acids and derivatives of any of the above.
Also included in the definition of "chemotherapeutic agent" are: (i) anti-hormonal agents that act to regulate or inhibit hormone action on tumors such as anti-estrogens and selective estrogen receptor modulators (SERMs), including, for example, tamoxifen (including NOLVADEXO; tamoxifen citrate), raloxifene, droloxifene, 4-hydroxytamoxifen, trioxifene, keoxifene, LY117018, onapristone, and FARESTONO (toremifine citrate); (ii) aromatase inhibitors that inhibit the enzyme aromatase, which regulates estrogen production in the adrenal glands, such as, for example, 4(5)-imidazoles, aminoglutethimide, MEGASEO
(megestrol acetate), AROMASINO (exemestane; Pfizer), formestanie, fad rozole, RIVISORO
(vorozole), FEMARAO (letrozole; Novartis), and ARIMIDEXO (anastrozole;
AstraZeneca);
(iii) anti-androgens such as flutamide, nilutamide, bicalutamide, leuprolide, and goserelin; as well as troxacitabine (a 1,3-dioxolane nucleoside cytosine analog); (iv) protein kinase inhibitors such as MEK inhibitors (WO 2007/044515); (v) lipid kinase inhibitors; (vi) antisense oligonucleotides, particularly those which inhibit expression of genes in signaling pathways implicated in aberrant cell proliferation, for example, PKC-alpha, Raf and H-Ras, such as oblimersen (GENASENSEO, Genta Inc.); (vii) ribozymes such as VEGF expression inhibitors (e.g., ANGIOZYMEO) and HER2 expression inhibitors; (viii) vaccines such as gene therapy vaccines, for example, ALLOVECTINO, LEUVECTINO, and VAXIDO; PROLEUKINO
rIL-2; topoisomerase 1 inhibitors such as LURTOTECANO; ABARELIXO rmRH; (ix) anti-angiogenic agents such as bevacizumab (AVASTINO, Genentech); and pharmaceutically acceptable salts, acids and derivatives of any of the above.
Also included in the definition of "chemotherapeutic agent" are therapeutic antibodies such as alemtuzumab (Campath), bevacizumab (AVASTINO, Genentech); cetuximab (ERBITUXO, lmclone); panitumumab (VECTIBIXO, Amgen), rituximab (RITUXANO, Genentech/Biogen !deo), pertuzumab (OMNITARGTm, 2C4, Genentech), trastuzumab (HERCEPTINO, Genentech), tositumomab (Bexxar, Corixia), and the antibody drug conjugate, gemtuzumab ozogamicin (MYLOTARGO, Wyeth).
Humanized monoclonal antibodies with therapeutic potential as chemotherapeutic agents in combination with the conjugates of the invention include: alemtuzumab, apolizumab, aselizumab, atlizumab, bapineuzumab, bevacizumab, bivatuzumab mertansine, cantuzumab mertansine, cedelizumab, certolizumab pegol, cidfusituzumab, cidtuzumab, daclizumab, eculizumab, efalizumab, epratuzumab, erlizumab, felvizumab, fontolizumab, gemtuzumab ozogamicin, inotuzumab ozogamicin, ipilimumab, labetuzumab, lintuzumab, matuzumab, mepolizumab, motavizumab, motovizumab, natalizumab, nimotuzumab, nolovizumab, numavizumab, ocrelizumab, omalizumab, palivizumab, pascolizumab, pecfusituzumab, pectuzumab, pertuzumab, pexelizumab, ralivizumab, ranibizumab, reslivizumab, reslizumab, resyvizumab, rovelizumab, ruplizumab, sibrotuzumab, siplizumab, sontuzumab, tacatuzumab tetraxetan, tadocizumab, talizumab, tefibazumab, tocilizumab, toralizumab, trastuzumab, tucotuzumab celmoleukin, tucusituzumab, umavizumab, urtoxazumab, and visilizumab.
Pharmaceutical compositions according to the present invention, and for use in accordance with the present invention, may comprise, in addition to the active ingredient, i.e. a conjugate compound, a pharmaceutically acceptable excipient, carrier, buffer, stabiliser or other materials well known to those skilled in the art. Such materials should be non-toxic and should not interfere with the efficacy of the active ingredient. The precise nature of the carrier or other material will depend on the route of administration, which may be oral, or by injection, e.g. cutaneous, subcutaneous, or intravenous.
Pharmaceutical compositions for oral administration may be in tablet, capsule, powder or liquid form. A tablet may comprise a solid carrier or an adjuvant. Liquid pharmaceutical compositions generally comprise a liquid carrier such as water, petroleum, animal or vegetable oils, mineral oil or synthetic oil. Physiological saline solution, dextrose or other saccharide solution or glycols such as ethylene glycol, propylene glycol or polyethylene glycol may be included. A capsule may comprise a solid carrier such a gelatin.
For intravenous, cutaneous or subcutaneous injection, or injection at the site of affliction, the active ingredient will be in the form of a parenterally acceptable aqueous solution which is pyrogen-free and has suitable pH, isotonicity and stability. Those of relevant skill in the art are well able to prepare suitable solutions using, for example, isotonic vehicles such as Sodium Chloride Injection, Ringer's Injection, Lactated Ringer's Injection.
Preservatives, stabilisers, buffers, antioxidants and/or other additives may be included, as required.
Formulations While it is possible for the conjugate compound to be used (e.g., administered) alone, it is often preferable to present it as a composition or formulation.
In one embodiment, the composition is a pharmaceutical composition (e.g., formulation, preparation, medicament) comprising a conjugate compound, as described herein, and a pharmaceutically acceptable carrier, diluent, or excipient.
In one embodiment, the composition is a pharmaceutical composition comprising at least one conjugate compound, as described herein, together with one or more other pharmaceutically acceptable ingredients well known to those skilled in the art, including, but not limited to, pharmaceutically acceptable carriers, diluents, excipients, adjuvants, fillers, buffers, preservatives, anti-oxidants, lubricants, stabilisers, solubilisers, surfactants (e.g., wetting agents), masking agents, colouring agents, flavouring agents, and sweetening agents.
In one embodiment, the composition further comprises other active agents, for example, other therapeutic or prophylactic agents.
Suitable carriers, diluents, excipients, etc. can be found in standard pharmaceutical texts.
See, for example, Handbook of Pharmaceutical Additives, 2nd Edition (eds. M.
Ash and I.
Ash), 2001 (Synapse Information Resources, Inc., Endicott, New York, USA), Remington's Pharmaceutical Sciences, 20th edition, pub. Lippincott, Williams & Wilkins, 2000; and Handbook of Pharmaceutical Excipients, 2nd edition, 1994.
Another aspect of the present invention pertains to methods of making a pharmaceutical composition comprising admixing at least one [11C]-radiolabelled conjugate or conjugate-like compound, as defined herein, together with one or more other pharmaceutically acceptable ingredients well known to those skilled in the art, e.g., carriers, diluents, excipients, etc. If formulated as discrete units (e.g., tablets, etc.), each unit contains a predetermined amount (dosage) of the active compound.
The term "pharmaceutically acceptable," as used herein, pertains to compounds, ingredients, materials, compositions, dosage forms, etc., which are, within the scope of sound medical judgment, suitable for use in contact with the tissues of the subject in question (e.g., human) without excessive toxicity, irritation, allergic response, or other problem or complication, commensurate with a reasonable benefit/risk ratio.
Each carrier, diluent, excipient, etc. must also be "acceptable" in the sense of being compatible with the other ingredients of the formulation.
The formulations may be prepared by any methods well known in the art of pharmacy. Such methods include the step of bringing into association the active compound with a carrier which constitutes one or more accessory ingredients. In general, the formulations are prepared by uniformly and intimately bringing into association the active compound with carriers (e.g., liquid carriers, finely divided solid carrier, etc.), and then shaping the product, if necessary.
The formulation may be prepared to provide for rapid or slow release;
immediate, delayed, timed, or sustained release; or a combination thereof.
Formulations suitable for parenteral administration (e.g., by injection), include aqueous or non-aqueous, isotonic, pyrogen-free, sterile liquids (e.g., solutions, suspensions), in which the active ingredient is dissolved, suspended, or otherwise provided (e.g., in a liposome or other microparticulate). Such liquids may additional contain other pharmaceutically acceptable ingredients, such as anti-oxidants, buffers, preservatives, stabilisers, bacteriostats, suspending agents, thickening agents, and solutes which render the formulation isotonic with the blood (or other relevant bodily fluid) of the intended recipient.
Examples of excipients include, for example, water, alcohols, polyols, glycerol, vegetable oils, and the like. Examples of suitable isotonic carriers for use in such formulations include Sodium Chloride Injection, Ringer's Solution, or Lactated Ringer's Injection.
Typically, the concentration of the active ingredient in the liquid is from about 1 ng/ml to about 10 pg/ml, for example from about 10 ng/ml to about 1 pg/ml. The formulations may be presented in unit-dose or multi-dose sealed containers, for example, ampoules and vials, and may be stored in a freeze-dried (lyophilised) condition requiring only the addition of the sterile liquid carrier, for example water for injections, immediately prior to use.
Extemporaneous injection solutions and suspensions may be prepared from sterile powders, granules, and tablets.
Dosage It will be appreciated by one of skill in the art that appropriate dosages of the conjugate compound, and compositions comprising the conjugate compound, can vary from patient to patient. Determining the optimal dosage will generally involve the balancing of the level of therapeutic benefit against any risk or deleterious side effects. The selected dosage level will depend on a variety of factors including, but not limited to, the activity of the particular compound, the route of administration, the time of administration, the rate of excretion of the compound, the duration of the treatment, other drugs, compounds, and/or materials used in combination, the severity of the condition, and the species, sex, age, weight, condition, general health, and prior medical history of the patient. The amount of compound and route of administration will ultimately be at the discretion of the physician, veterinarian, or clinician, although generally the dosage will be selected to achieve local concentrations at the site of action which achieve the desired effect without causing substantial harmful or deleterious side-effects.
Administration can be effected in one dose, continuously or intermittently (e.g., in divided doses at appropriate intervals) throughout the course of treatment. Methods of determining the most effective means and dosage of administration are well known to those of skill in the art and will vary with the formulation used for therapy, the purpose of the therapy, the target cell(s) being treated, and the subject being treated. Single or multiple administrations can be carried out with the dose level and pattern being selected by the treating physician, veterinarian, or clinician.
In general, a suitable dose of the active compound is in the range of about 100 ng to about 25 mg (more typically about 1 pg to about 10 mg) per kilogram body weight of the subject per day. Where the active compound is a salt, an ester, an amide, a prodrug, or the like, the amount administered is calculated on the basis of the parent compound and so the actual weight to be used is increased proportionately.
In one embodiment, the active compound is administered to a human patient according to the following dosage regime: about 100 mg, 3 times daily.
In one embodiment, the active compound is administered to a human patient according to the following dosage regime: about 150 mg, 2 times daily.
In one embodiment, the active compound is administered to a human patient according to the following dosage regime: about 200 mg, 2 times daily.
However in one embodiment, the conjugate compound is administered to a human patient according to the following dosage regime: about 50 or about 75 mg, 3 or 4 times daily.
In one embodiment, the conjugate compound is administered to a human patient according to the following dosage regime: about 100 or about 125 mg, 2 times daily.
The dosage amounts described above may apply to the conjugate (including the PBD moiety and the linker to the antibody) or to the effective amount of PBD compound provided, for example the amount of compound that is releasable after cleavage of the linker.
For the prevention or treatment of disease, the appropriate dosage of an ADC
of the invention will depend on the type of disease to be treated, as defined above, the severity and course of the disease, whether the molecule is administered for preventive or therapeutic purposes, previous therapy, the patient's clinical history and response to the antibody, and the discretion of the attending physician. The molecule is suitably administered to the patient at one time or over a series of treatments.
Depending on the type and severity of the disease, about 1 g/kg to 15 mg/kg (e.g. 0.1-20 mg/kg) of molecule is an initial candidate dosage for administration to the patient, whether, for example, by one or more separate administrations, or by continuous infusion. A typical daily dosage might range from about 1 g/kg to 100 mg/kg or more, depending on the factors mentioned above. An exemplary dosage of ADC to be administered to a patient is in the range of about 0.1 to about 10 mg/kg of patient weight. For repeated administrations over several days or longer, depending on the condition, the treatment is sustained until a desired suppression of disease symptoms occurs. An exemplary dosing regimen comprises a course of administering an initial loading dose of about 4 mg/kg, followed by additional doses every week, two weeks, or three weeks of an ADC. Other dosage regimens may be useful. The progress of this therapy is easily monitored by conventional techniques and assays.
Treatment The term "treatment," as used herein in the context of treating a condition, pertains generally to treatment and therapy, whether of a human or an animal (e.g., in veterinary applications), in which some desired therapeutic effect is achieved, for example, the inhibition of the progress of the condition, and includes a reduction in the rate of progress, a halt in the rate of progress, regression of the condition, amelioration of the condition, and cure of the condition. Treatment as a prophylactic measure (i.e., prophylaxis, prevention) is also included.
The term "therapeutically-effective amount," as used herein, pertains to that amount of an active compound, or a material, composition or dosage from comprising an active compound, which is effective for producing some desired therapeutic effect, commensurate with a reasonable benefit/risk ratio, when administered in accordance with a desired treatment regimen.
Similarly, the term "prophylactically-effective amount," as used herein, pertains to that amount of an active compound, or a material, composition or dosage from comprising an active compound, which is effective for producing some desired prophylactic effect, commensurate with a reasonable benefit/risk ratio, when administered in accordance with a desired treatment regimen.
Preparation of Antibody drug conjugates Antibody drug conjugates may be prepared by several routes, employing organic chemistry reactions, conditions, and reagents known to those skilled in the art, including: (1) reaction of a nucleophilic group of an antibody with a bivalent linker reagent, to form antibody-linker intermediate Ab-L, via a covalent bond, followed by reaction with an activated drug moiety reagent; and (2) reaction of a drug moiety reagent with a linker reagent, to form drug-linker reagent D-L, via a covalent bond, followed by reaction with the nucleophilic of an antibody.
Conjugation methods (1) and (2) may be employed with a variety of antibodies, and linkers to prepare the antibody-drug conjugates of the invention.
Nucleophilic groups on antibodies include, but are not limited to side chain thiol groups, e.g.
cysteine. Thiol groups are nucleophilic and capable of reacting to form covalent bonds with electrophilic groups on linker moieties such as those of the present invention. Certain antibodies have reducible interchain disulfides, i.e. cysteine bridges.
Antibodies may be made reactive for conjugation with linker reagents by treatment with a reducing agent such as DTT (Cleland's reagent, dithiothreitol) or TCEP (tris(2-carboxyethyl)phosphine hydrochloride; Getz et al (1999) Anal. Biochem. Vol 273:73-80; Soltec Ventures, Beverly, MA). Each cysteine disulfide bridge will thus form, theoretically, two reactive thiol nucleophiles. Additional nucleophilic groups can be introduced into antibodies through the reaction of lysines with 2-iminothiolane (Traut's reagent) resulting in conversion of an amine into a thiol.
The Subject/Patient The subject/patient may be an animal, mammal, a placental mammal, a marsupial (e.g., kangaroo, wombat), a monotreme (e.g., duckbilled platypus), a rodent (e.g., a guinea pig, a hamster, a rat, a mouse), murine (e.g., a mouse), a lagomorph (e.g., a rabbit), avian (e.g., a bird), canine (e.g., a dog), feline (e.g., a cat), equine (e.g., a horse), porcine (e.g., a pig), ovine (e.g., a sheep), bovine (e.g., a cow), a primate, simian (e.g., a monkey or ape), a monkey (e.g., marmoset, baboon), an ape (e.g., gorilla, chimpanzee, orangutang, gibbon), or a human.
Furthermore, the subject/patient may be any of its forms of development, for example, a foetus. In one preferred embodiment, the subject/patient is a human.
In one embodiment, the patient is a population where each patient has a tumour having av[36 integrin on the surface of the cell.
Synthesis Conjugates of formula A may be synthesised from corresponding drug-linker compounds of formula B by reacting them with cell binding agents under appropriate conditions. Thus, conjugates where Y is of formula Al may be synthesied from drug-linker compounds where YL is of formula B1. Conjugates where Y is of formula A2 may be synthesied from drug-linker compounds where YL is of formula B2. Conjugates where Y is of formula A3 may be synthesied from drug-linker compounds where YL is of formula B3.
The conditions, as described above, will depend on the type of bond being formed between the drug-linker compound and the cell binding agent, which itself will reflect the nature of the binding site on the cell binding agent.
Drug-linker compounds of formula B may be synthesised from corresponding compounds of formula C.
Drug-linker compounds where YL is of formula B1 may be synthesied from compounds where Yc is of formula C1, by reaction with a compound of formula E1:
FN1 \-0 'n1V-\
El in an appropriate solvent. Compounds of formula El may be formed in situ by reaction of compounds of formulae Fl and F2:
o 0 G4 H2N-F\_ o¨N 0 Y -A-\
Fl F2 .
Drug-linker compounds where YL is of formula B2 may be synthesied from compounds where Yc is of formula C2, by reaction with a compound of formula E2:
0(0,--....2,....N)-(G
n H
OH
E2 in an appropriate solvent, in the presence of an amide coupling reagent.
Drug-linker compounds where YL is of formula B3 may be synthesied from compounds where Yc is of formula C3, reaction with a compound of formula E2:
0(0,--....2,....N)-(G
n H
OH
E2 in an appropriate solvent, in the presence of an amide coupling reagent.
Compound of formula C can be made from the corresponding compound of formula G:
H
R6 o D
G .
Compounds of formula C where Yc is of formula C1 may be synthesised by reacting a compound of formula G with a compound of formula H1:
I
Br in the presence of tetrabutylammonium iodide and potassium carbonate.
Compounds of formula C where Yc is of formula C2 may be synthesised by reacting a compound of formula G with a compound of formula H2:
ProtN
i H
Z`
Br where Prot" is an amine protecting group, such as Alloc, in the presence of tetrabutylammonium iodide and potassium carbonate, followed by deprotection of the amine under standard conditions. The protecting group used should be orthogonal to any other protecting groups in the compound.
Compounds of formula C where Yc is of formula C3 may be synthesised by reacting a compound of formula G with a compound of formula H3:
H
N /Br , .
ProtN Z3 where Prot" is an amine protecting group, such as Alloc, in the presence of tetrabutylammonium iodide and potassium carbonate, followed by deprotection of the amine under standard conditions. The protecting group used should be orthogonal to any other protecting groups in the compound.
Alternativelty, compounds of formula C where Yc is of formula C3 may be synthesised by reacting a compound of formula G with a compound of formula H4:
/
02N . Br in the presence of tetrabutylammonium iodide and potassium carbonate, followed by reduction of the nitro group under standard conditions.
Compound of formula G containing a single PBD moiety can be synthesised according to the disclosure of WO 2005/085259, and in particular the discussion from pages 31 to 39, which is incorporated herein be reference. Reference is also made to the teaching of co-pending application PCT/EP2012/070232, filed on 12 October 2012.
The synthesis of PBD compounds containing two imine moieties is extensively discussed in the following references, which discussions are incorporated herein by reference:
a) WO 00/12508 (pages 14 to 30);
b) WO 2005/023814 (pages 3 to 10);
c) WO 2004/043963 (pages 28 to 29);
d) WO 2005/085251 (pages 30 to 39); and e) WO 2011/130598 (pages 126 to 150).
The disclosure of WO 2005/085259 discussed above is also relevant to the synthesis of compounds of formula G which comprise two PBD moieties. The synthesis methods disclosed therein may be modified to include an orthogonally protected hydroxyl group at C7 (i.e.group RA in Scheme 4).
Alternatively, compounds of formula G may be synthesised as described in the above references, but starting from a dimer core of formula J:
02N 0 X' _X I. NO2 I
Prot0 R6 0 J
where Prot is a hydroxyl protecting group. Such compounds of formula J may be made by methods analogous to those in the examples of the present application.
Amine protecting groups Amine protecting groups are well-known to those skilled in the art. Particular reference is made to the disclosure of suitable protecting groups in Greene's Protecting Groups in Organic Synthesis, Fourth Edition, John Wiley & Sons, 2007 (ISBN 978-0-471-69754-1), pages 696-871.
Hydroxyl protecting groups Hydroxyl protecting groups are well-known to those skilled in the art.
Particular reference is made to the disclosure of suitable protecting groups in Greene's Protecting Groups in Organic Synthesis, Fourth Edition, John Wiley & Sons, 2007 (ISBN 978-0-471-69754-1), pages 16-298.
General Conditions Reaction progress was monitored by thin-layer chromatography (TLC) using Merck Kieselgel 60 F254 silica gel, with fluorescent indicator on aluminium plates.
Visualisation of TLC was achieved with UV light or iodine vapour unless otherwise stated. Flash chromatography was performed using Merck Kieselgel 60 F254 silica gel. Extraction and chromatography solvents were bought and used without further purification from Fisher Scientific, U.K.
All chemicals were purchased from Aldrich, VWR, and Combi Blocks.
1H and 13C NMR spectra were obtained on a Bruker Avance 400 spectrometer.
Coupling constants are quoted in hertz (Hz). Chemical shifts are recorded in parts per million (ppm) downfield from tetramethylsilane. Spin multiplicities are described as s (singlet), bs (broad singlet), d (doublet), t (triplet), q (quartet), p (pentuplet) and m (multiplet).
LCMS Method 1 (default when not specified) The HPLC (Waters Alliance 2695) was run using a mobile phase of water (A) (formic acid 0.1%) and acetonitrile (B) (formic acid 0.1%). Gradient: initial composition 5% B held over 1.0 min, then increase from 5% B to 95% B over a 3 min period. The composition was held for 0.1 min at 95% B, then returned to 5% B in 0.03 minutes and hold there for 0.87 min.
Total gradient run time equals 5 min.
Flow rate 3.0 mL/min, 400pL was split via a zero dead volume tee piece which passes into the mass spectrometer. Wavelength detection range: 220 to 400 nm. Function type: diode array (535 scans). Column: Phenomenex Onyx Monolithic C18 50 x 4.60 mm LCMS Method 2 The HPLC (Waters Alliance 2695) was run using a mobile phase of water (A) (formic acid 0.1%) and acetonitrile (B) (formic acid 0.1%). Gradient: initial composition 5% B held over 1.0 min, then increase from 5% B to 95% B over a 2.5 min period. The composition was held for 0.5 min at 95% B, then returned to 5% B in 0.1 minutes and hold there for 0.9 min. Total gradient run time equals 5 min.
Flow rate 3.0 mL/min, 400pL was split via a zero dead volume tee piece which passes into the mass spectrometer. Wavelength detection range: 220 to 400 nm. Function type: diode array (535 scans). Column: Phenomenex Onyx Monolithic C18 50 x 4.60 mm."
LCMS Method 3 The HPLC (Shimazu LCMS-2020) was run using a mobile phase of water (A) (formic acid 0.1%) and acetonitrile (B) (formic acid 0.1%). Gradient: initial composition 5% B held over 0.25 min, then increase from 5% B to 100% B over a 2 min period. The composition was held for 0.50 min at 100% B, then returned to 5% B in 0.05 minutes and hold there for 0.05 min. Total gradient run time equals 3 minutes.
Flow rate 0.8 mL/min. Wavelength detection range: 220 to 400 nm. Column:
Waters Acquity UPLC BEH Shield RP18 1.7pm 2.1x5Omm.
Synthesis of Key Intermediates (a) 5-(benzyloxy)-44(5-(4-carboxy-2-methoxy-5-nitrophenoxy)pentyl)oxy)-2-nitrobenzoic acid (17) H
H 0 so H 0 H Bn0 H 0 is Me0 Me0 HO
H
OMe Bn0 OMe Bn0 02N 0,..0 NO2 02N 00 so N 02 OMe Bn0 OMe Bn0 (i) 3-(benzyloxy)-4-hydroxybenzaldehyde (12) Sodium hydride (51.2 g, 1.27 mol, 2.2 eq) was rinsed twice with hexane in a three-neck flask and anhydrous DMSO (800 mL) was added. The flask was placed in a water bath at room temperature. A solution of 3,4-dihydroxybenzaldehyde II (80 g, 579.2 mmol) in dry DMSO
10 (160 mL) was added dropwise, with an addition funnel, over 40 minutes and the reaction mixture was stirred 30 minutes under Argon. During the addition a lot of hydrogen gas is formed, so an exit with cotton wool and calcium chloride is placed in one of the neck. Benzyl bromide (68.8 mL, 579.2 mmol, 1 eq) was then added dropwise and the reaction was stirred overnight. The reaction mixture was poured into ice and quenched with HCI (1M) until pH
15 acid and extracted with Et0Ac. The organic phase was then washed with brine and was dried over magnesium sulphate, filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to a pad of Silica with pure dichloromethane. The resulting material was precipitated with a minimum of dichloromethane in hexane. The resulting white precipitate was filtered and dried to afford the desired compound (80.7 g, 60 % yield). LC/MS (Method 3) 1.43 min (no ionisation). 1H
NMR (400 MHz, CDCI3) 6 9.81 (s, 1H), 7.51 (d, J = 1.8 Hz, 1H), 7.45 ¨ 7.34 (m, 7H), 7.06 (d, J = 8.1 Hz, 1H), 6.24 (s, 1H), 5.17 (s, 2H).
(ii) 4((5-bromopentyl)oxy)-3-methoxybenzaldehyde (14) Vanillin 13 (50 g, 328 mmol) was dissolved in acetone (1 L). Dibromopentane (227 g, 985 mmol, 3 eq) and potassium carbonate (68 g, 492 mmol, 1.5 eq) were added. The slurry was warmed to 65 C and stirred for 2 hours, and then 80 C for 30 minutes. The resulting potassium carbonate was filtered and the excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to a pad of Silica: 7.5% Et0Ac in Hexane (4 L) then 10% Et0Ac in Hexane (1 L) and 25% Et0Ac in Hexane to afford a white solid (53.7 g, 54 `)/0 yield). LC/MS (Method 3) 1.63 min (ES+) m/z (relative intensity) 302.53 ([M + , 100). 1H NMR (400 MHz, CDCI3) 6 9.83 (s, 1H), 7.42 (dd, J
= 8.1, 1.9 Hz, 1H), 7.40 (d, J= 1.9 Hz, 1H), 6.95 (d, J= 8.1 Hz, 1H), 4.10 (t, J= 6.6 Hz, 2H), 3.91 (s, 3H), 3.43 (t, J = 6.7 Hz, 2H), 1.92 (m, 4H), 1.64 (tt, J = 9.7, 6.2 Hz, 2H).
(iii) 3-(benzyloxy)-44(5-(4-formy1-2-ethoxyphenoxy)pentyl)oxy) benzaldehyde (15) 4-((5-bromopentyl)oxy)-3-methoxybenzaldehyde 14 (40.0 g, 132.81 mmol, 1 eq) and 3-(benzyloxy)-4-hydroxybenzaldehyde 12 (30.3 g, 132.81 mmol, 1 eq) were dissolved in dimethylformamide (200 mL). Potassium carbonate (13.8 g, 99.61 mmol, 0.75 eq) and tetrabutylammonium iodide (4.9 g, 13.28 mmol, 0.1 eq) were added. The reaction mixture was warmed to 80 C and stirred for 12 hours. The resulting potassium carbonate was filtered and the excess solvent was removed by rotary evaporation under reduced pressure.
The resulting residue was dissolved in ethyl acetate and washed subsequently with water, 1N NaOH, 1N HCI, water and brine. The organic phase was dried over magnesium sulphate, filtered and excess solvent was removed by rotary evaporation under reduced pressure to afford the desired compound (75 g, quantitative yield) as a light yellow oil.
LC/MS (Method 3) 1.77 min (ES+) m/z (relative intensity)449.15 [M +
, 471.25 [M + Na]. 1H NMR (400 MHz, CDCI3) 6 9.83 (s, 1H), 9.81 (s, 1H), 7.46 (dd, J = 3.1, 1.4 Hz, 2H), 7.43 (d, J = 1.7 Hz, 2H), 7.41 (dd, J = 8.1, 1.9 Hz, 1H), 7.39 (d, J = 1.8 Hz, 1H), 7.37 - 7.32 (m, 2H), 7.30 (dd, J
= 5.0, 3.6 Hz, 1H), 6.97 (d, J= 8.1 Hz, 1H), 6.92 (d, J= 8.1 Hz, 1H), 5.15 (s, 2H), 4.13 (t, J
= 6.4 Hz, 2H), 4.09 (t, J = 6.6 Hz, 2H), 3.88 (s, 3H), 2.01 - 1.89 (m, 4H), 1.77 - 1.64 (m, 2H).
(iv) 5-(benzyloxy)-44(5-(4-formy1-2-methoxy-5-nitrophenoxy)pentyl)oxy)-2-nitrobenzaldehyde (16) 3-(benzyloxy)-4-((5-(4-formy1-2-ethoxyphenoxy)pentyl)oxy) benzaldehyde 15 (30 g, 66.40 mmol) was dissolved in dichloromethane (60 mL) and added to nitric acid (68%, 60 mL) at 0 C. The reaction mixture was stirred at 0 C for 20 minutes and at room temperature for 3 hours and then cold water was added. The precipitate formed was filtered and washed with water. The white solid was dried by vacuum. 42g of white solid was obtained (>100`)/0 yield due to water remaining). LC/MS (Method 3) 1.88 min, no ionisation. 1H NMR (400 MHz, CDCI3) 6 10.44 (s, 1H), 10.41 (s, 1H), 7.61 (s, 1H), 7.56 (s, 1H), 7.48 (s, 1H), 7.46 ¨ 7.30 (m, 6H), 5.25 (s, 2H), 4.20 (dd, J= 12.2, 5.9 Hz, 2H), 4.13 (dd, J= 15.1, 8.7 Hz, 2H), 3.96 (s, 3H), 2.01 (dt, J= 14.1, 6.4 Hz, 4H), 1.80¨ 1.65 (m, 2H).
(v) 5-(benzyloxy)-4-((5-(4-carboxy-2-methoxy-5-n itrophenoxy)pentyl)oxy)-2-nitrobenzoic acid (/7) A solution of sodium chlorite (35.3 g, 390 mmol, 5 eq) and sodium phosphate (26.2 g, 218.4 mmol, 2.8 eq) in water (250 mL) was added to a solution of 5-(benzyloxy)-4-((5-(4-formy1-2-methoxy-5-nitrophenoxy)pentyl)oxy)-2 nitrobenzaldehyde 16 (42 g, 78 mmol) in THF (200 mL). Hydrogen peroxide (60%, 103 mL, 2.18 mol, 28 eq) was then added quickly.
After 30 min, the reaction wasquenched with 1N HCI and extracted with ethyl acetate.
The organic layer was washed two times with brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was dissolved in a minimum of dichloromethane and precipitated out with ether.
Pale yellow solid (26 g, 58%) was filtered and washed with ether and used as crude for the next reaction.
LC/MS (Method 3) 1.69 min (ES+) tniz (relative intensity) 569.35 [M + H].
(b) (2R,11aS)-2-((tert-butyld imethylsily0oxy)-84(5-(((2R,11 aS)-2-((tert-butyldimethylsily0oxy)-5,11-d ioxo-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2, 3, 5,10,11 ,11 a-hexahydro-1 H-benzo[e]pyrrolo[1, 2-4[1, 4]diazepin-8-y0oxy)pe ntyl)oxy)-7-methoxy-104(2-(trimethylsily0ethoxy)methyl)-2, 3-dihyd ro-1 H-benzolelpyrrolo[1, 2-a][1, 4]diazepine-5,11 (1 OH,11 aH)-dione (113) Me0 04Me M \=0 + 0, ci . 0e2N 0 OMe Bn0 OH OMe Bn0 OMe Me0 0 H H 0 02N AI 0,...,,,,,,s...0 iii NO2 \ r 0 -2.- Cr Will OMe Bn0 IIIIIII)P Na=OTBS TBsoõ, F1'. N SI
C)....'..............Me M1 H: = NI---1 ...N OTBS-' 0 H H 0 0 jEM 1 EM 0 N 411 0,......v.......v.,0 Ali N H N diii 0,............,........_õ..0 Ail H
, tt qijil OMe TIPSO 11111111 - 1,113., -'...
he-N WI OMe TIPSO WI NI----76....
OTBSTBSO OTBS
(i) (2S, 4R)-methyl 1-(44(5-(2-(benzyloxy)-44(2S,4R)-4-hydroxy-2-(methoxycarbonyOpyrrolidine-1-carbony1)-5-nitrophenoxy)pentyl)oxy)-5-methoxy-2-nitrobenzoy1)-4-hydroxypyrrolidine-2-carboxylate (19) Oxalyl chloride (7.6 mL, 89.92 mmol, 3 eq) was added to a solution of 17 (17.1 g, 29.97 mmol) in dichloromethane (150 mL) and DMF (2 mL). After 20 min the solvent was removed by rotary evaporation under reduced pressure and minimum of dichloromethane was added to dissolve the crude and triturated with diethyl ether. The yellow solid formed was filtered and added portion wise to a solution of 18 (13.6 g, 74.93 mmol, 2.5 eq) and triethylamine (20.92 mL, 149.87 mmol, 5eq) in dichloromethane (100 mL) at -40 C. The reaction was complete after few minutes. The solvent was removed by rotary evaporation under reduced pressure and the resulting residue was subjected to flash column chromatography (silica gel;
50% ethyl acetate in hexane to 100% ethyl acetate to collect the mono addition product and then 5% to 20% methanol in dichloromethane). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (15 g, 61% over 3 steps). LC/MS (Method 3) 1.47 min (ES+) tniz (relative intensity) 825.45 ([M +
, 100). 1H NMR (400 MHz, CDC13) 6 7.65 (s, 1H), 7.61 (s, 1H), 7.45 - 7.27 (m, 5H), 6.89 (s, 1H), 6.81 (s, 1H), 5.20 (s, 2H), 4.85 - 4.74 (m, 2H), 4.40 (d, J = 20.3 Hz, 2H), 4.21 -4.02 (m, 4H), 3.91 (s, 3H), 3.79 (s, 6H), 3.53 - 3.41 (m, 2H), 3.13 (d, J= 11.1 Hz, 1H), 3.04 (d, J = 11.0 Hz, 1H), 2.79 - 2.72 (m, J = 4.3 Hz, 1H), 2.63 (s, 1H), 2.42 - 2.32 (m, 2H), 2.21 - 2.06 (m, J = 11.3 Hz, 2H), 2.02 - 1.89 (m, 4H), 1.76 - 1.65 (m, 2H).
(ii) (2S, 4R)-methyl 1-(44(5-(2-(benzyloxy)-44(2S,4R)-4-((tert-butyldimethylsily0oxy)-2-(methoxycarbonyOpyrrolidine-1-carbony1)-5-nitrophenoxy)pentyl)oxy)-5-methoxy-2-nitrobenzoy1)-4-((tert-butyldimethylsily0oxy)pyrrolidine-2-carboxylate (110) 19 (14 g, 16.97 mmol), tert-butyldimethylsilyl chloride (12.8 g, 84.87 mmol, 5 eq) and imidazole (13.9 g, 203.64 mmol, 12 eq) were melted together at 120 C.The reaction was complete after 30 minutes. The resulting residue was subjected to flash column chromatography (silica gel; 10% ethyl acetate in hexane to 100% ethyl acetate). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (17 g, quantitative).
LC/MS (Method 3) 2.17 min. 1H NMR (400 MHz, CDC13) 6 7.69 (s, 1H), 7.65 (s, 1H), 7.43 -7.27 (m, 5H), 6.87 (s, 1H), 6.78 (s, 1H), 5.17 (d, J = 5.6 Hz, 2H), 4.73 -7.79 (m, 2H), 4.45 -4.34 (m, 2H), 4.32 - 4.10 (m, 2H), 4.09 - 4.00 (m, 2H), 3.90 (s, 3H), 3.80 (s, 3H), 3.79 (s, 3H), 3.48 - 3.41 (m, 1H), 3.29 (dd, J= 10.3, 4.6 Hz, 1H), 3.03 (dd, J= 10.4, 2.4 Hz, 2H), 2.96 (dd, J = 10.2, 2.8 Hz, 2H), 2.31 - 2.21 (m, 2H), 2.19 - 2.05 (m, 2H), 2.00 - 1.88 (m, 4H), 1.74- 1.66 (m, 2H), 0.82 (s, 18H), 0.02 (d, J= 1.1 Hz, 6H), -0.03 (d, J=
5.5 Hz, 6H).
(iii) (2R,11aS)-2-((tert-butyldimethylsily0oxy)-84(5-(((2R,11 aS)-2-((tert-butyldimethylsily0oxy)-7-hydroxy-5,11-dioxo-2,3, 5,10,11 ,11a-hexahydro-1 H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-2,3-dihydro-benzolelpyrrolo[1,2-41-1,41diazepine-5,11(10H,11aH)-dione (111) Ammonium formate (106 g, 168 mmol, 10 eq) was added to a solution of 110 (17.7 g, 16.80 mmol) in ethanol (500 mL). Palladium on carbon (1.8 g, 10%) was wetted with ethyl acetate and added to the reaction mixture. The solution was warmed to 70 C. After 20 min, the reaction mixture was then filtered through celite and washed with ethyl acetate. The solvent was removed by rotary evaporation. The residue was dissolved in ethyl acetate and washed with saturated aqueous ammonium chloride and brine, dried over magnesium sulphate;
filtered and excess solvent was removed by rotary evaporation under reduced pressure to give the desired compound (13.9 g, 98%) as a yellow gum.
LC/MS (Method 3) 1.91 min, (ES+) m/z (relative intensity) 839.35 ([M + , 100).
(iv) (2R,11 aS)-2-((tert-butyldimethylsily0oxy)-84(5-(((2R,11 aS)-2-((tert-butyldimethylsily0oxy)-5,11-dioxo-7-((triisopropylsily0oxy)-2, 3, 5,10,11,11 a-hexahyd ro-1 H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-2,3-dihydro-benzolelpyrrolofi , 2-4[1 ,zi]diazepine-5,11(10H,11aH)-dione (112) 111 (13.9 g, 16.56 mmol), triisopropylsilyl chloride (3.6 mL, 18.36 mmol, 1.1 eq) and imidazole (3.4 g, 49.94 mmol, 3 eq) were melted together at 120 C. The reaction was complete after 30 minutes. The resulting residue was subjected to flash column chromatography (silica gel; 10% ethyl acetate in hexane to 100% ethyl acetate). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (15.4 g, 93%). LC/MS
(Method 3) 2.31 min, 1H NMR (400 MHz, CDC13) 6 9.81 (s, 1H), 8.70 (s, 1H), 8.65 (s, 1H), 7.43 (s, 2H), 6.47 (s, 1H), 6.42 (s, 1H), 4.54 ¨ 4.43 (m, 2H), 4.17 (dt, J= 7.6, 3.8 Hz, 2H), 4.00 (t, J= 6.4 Hz, 2H), 3.95 (t, J = 6.2 Hz, 2H), 3.87 (s, 3H), 3.73 ¨ 3.58 (m, 4H), 2.84 ¨
2.76 (m, 2H), 2.09 ¨ 1.96(m, 1H), 1.92¨ 1.85(m, 4H), 1.68¨ 1.62(m, 2H), 1.31 ¨ 1.17(m, 3H), 1.08(d, J=
2.5 Hz, 9H), 1.06 (d, J = 2.5 Hz, 9H), 0.85 (s, 9H), 0.84 (s, 9H), 0.06 (s, 6H), 0.07 (s, 6H).
(v) (2R,11 aS)-2-((tert-butyldimethylsily0oxy)-84(5-(((2R,11aS)-2-((tert-butyldimethylsily0oxy)-5,11-dioxo-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2, 3, 5,10,11 ,11a-hexahydro-1 H-benzo[e]pyrrolo[1, 2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-10-((2-(trimethylsily0ethoxy)methyl)-2, 3-dihyd ro-1 H-benzolelpyrrolo[1, 2-a][1,4]diazepine-5,11 (10H,11aH)-dione (113) 112 (15.4 g, 15.74 mmol) was dissolved in dry tetrahydrofuran (250 mL) and cooled to -30 C
(dry ice / acetone). n-Butyllithium (29 mL, 46.41 mmol, 3 eq) was then added dropwise and the reaction mixture was stirred for 1 hour at -30 C. 2-(Trimethylsilyl)ethoxymethyl chloride (8.2 mL, 46.41 mmol, 3 eq) was then added dropwise and the cold bath was removed. The reaction mixture was stirred at ambient temperature for 12 hours and the solvent was removed by rotary evaporation. The residue was dissolved in ethyl acetate and washed with water and brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to give the desired compound as yellow oil used as crude for the next reaction. 1H NMR (400 MHz, CDC13) 6 7.34 (s, 1H), 7.33 (s, 1H), 7.20 (s, 1H), 7.15 (s, 1H), 5.49 (dd, J= 10.0, 1.8 Hz, 2H), 4.64 (dd, J= 9.9, 7.5 Hz, 2H), 4.56 (dt, J = 8.9, 5.7 Hz, 2H), 4.21 (dt, J = 8.6, 4.4 Hz, 2H), 4.09 ¨ 3.93 (m, 4H), 3.91 (s, 3H), 3.82 ¨ 3.61 (m, 6H), 3.61 ¨ 3.50 (m, 2H), 2.90 ¨ 2.76 (m, 2H), 2.03 ¨ 1.97 (m, 2H), 1.97 ¨ 1.86 (m, 4H), 1.75¨ 1.64 (m, 2H), 1.34¨ 1.19(m, 3H), 1.10 (d, J = 2.7 Hz, 9H), 1.08(d, J = 2.7 Hz, 9H), 0.96 (ddd, J = 9.1, 6.9, 2.0 Hz, 4H), 0.86 (d, J = 2.9 Hz, 9H), 0.85 (d, J = 2.9 Hz, 9H), 0.09 (s, 6H), 0.07 (s, 6H), 0.01 (d, J = 3.2 Hz, 18H).
(c) (S)-7-hydroxy-84(5-(((S)-7-methoxy-2-methy1-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methyl-10-((2-(trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1, 2-a][1,4]diazepine-5,11(10H,11aH)-dione (118) SEM SEMSEM SEM
0 0 0 k 0 He- AiNi , TBSO OOTBS
0 N---/,b1 N OMe TIPSO N OMe TIPSO N
0 i 0 1/5ea OMe TIPSO
N O 1111}111Me TIPSO N
0 115 0 Tf0 0 116 0 OTf 0 k 0 1-,2" N--155,1 OMe TIPSO 411111" N OMe H 0 (i) (2R,11aS)-2-hydroxy-84(5-(((2R,11aS)-2-hydroxy-5,11-dioxo-7-((triisopropylsily0oxy)-10-((2-(trimethylsily0ethoxy)methyl)-2,3,5,10,11,11a-hexahydro-1 H-benzo[e]pyrrolo[1, 2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-10-((2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzolelpyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (114) Crude 113 (15.74 mmol) was dissolved in dry tetrahydrofuran (40 mL) and a solution of 1%
v/v conc. HCI in methanol (120 mL). The reaction mixture was stirred 2 hours at ambient temperature; diluted with ethyl acetate and washed with water (two times), saturated aqueous sodium bicarbonate and brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to give the desired compound as yellow oil used as crude for the next reaction. LC/MS (Method 3) 2.08 min, (ES+) m/z (relative intensity) 1027.40 [M + H], 1H NMR (400 MHz, CDCI3) 6 7.32 (s, 1H), 7.32 (s, 1H), 7.20 (s, 1H), 7.14 (s, 1H), 5.49 (dd, J= 10.0, 3.2 Hz, 2H), 4.69 ¨ 4.57 (m, 3H), 4.33 ¨ 4.24 (m, 2H), 4.16 ¨ 3.93 (m, 4H), 3.88 (s, 3H), 3.89 ¨ 3.55 (m, 6H), 3.00 ¨ 2.88 (m, 2H), 2.53 (br, 1H), 2.17 ¨ 2.05 (m, 2H), 2.00¨ 1.86 (m, 4H), 1.78¨ 1.63 (m, 3H), 1.46¨ 1.39 (m, 2H), 1.36¨ 1.19 (m, 4H), 1.09 (s, 9H), 1.07 (s, 9H), 1.01 ¨0.92 (m, 4H), 0.02(s, 18H).
(ii) (S)-7-methoxy-104(2-(trimethylsily0ethoxy)methyl)-8-((5-(((S)-2,5,11-trioxo-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2,3,5,10,11,11a-hexahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-2,5,11(3H,10H,11aH)-trione (115) TCCA (1.62 g, 7.00 mmol, 1.2 eq) was added to a solution of crude 114 (5.84 mmol), TEMPO (90 mg, 0.58 mmol, 0.1 eq) and sodium acetate (1.14 g, 14.00 mmol, 2.4 eq) in dichloromethane (120 mL) at -10 C (acetone / ice). The reaction was stirred for 30 min and filtered through celite. The reaction mixture was then quenched with saturated aqueous sodium bicarbonate. The organic phase washed with sodium thiosulfate and brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to flash column chromatography (silica gel; 20% to 70% ethyl acetate in hexane). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (3.21 g, 54% over 3 steps). LC/MS (Method 3) 2.17 min, (ES+) m/z (relative intensity) 1023.75 [M + H], 1H NMR (400 MHz, CDCI3) 6 7.32 (s, 2H), 7.23 (s, 1H), 7.18 (s, 1H), 5.53 (dd, J= 10.0, 1.6 Hz, 2H), 4.70 (t, J=
9.6 Hz, 2H), 4.66 ¨ 4.58 (m, 2H), 4.22 (d, J = 20.1 Hz, 2H), 4.13 ¨ 3.95 (m, 4H), 3.91 (s, 3H), 3.89 ¨ 3.74 (m, 4H), 3.72 ¨ 3.62 (m, 2H), 3.56 (ddd, J = 19.2, 5.8, 3.1 Hz, 2H), 2.78 (dd, J =
19.3, 9.9 Hz, 2H), 1.95 (dd, J= 14.6, 7.3 Hz, 4H), 1.76¨ 1.63 (m, 2H), 1.33¨ 1.23 (m, 3H), 1.10 (s, 9H), 1.09 (s, 9H), 1.02 ¨ 0.90 (m, 4H), 0.02 (s, 18H).
(iii) (S)-84(5-(((S)-5,11-dioxo-2-(((trifluoromethyl)sulfonyl)oxy)-7-((triisopropylsily0oxy)-10-((2-(tritnethylsily0ethoxy)tnethyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-7-methoxy-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-2-y1 trifluoromethanesulfonate (116) Anhydrous 2,6-lutidine (2.12 mL, 18.17 mmol, 6.2 eq) was injected in one portion to a solution of 115 (3 g, 2.93 mmol) in dry dichloromethane (40 mL) at -50 C
(acetone / dry ice).
Triflic anhydride (2.12 mL, 18.17 mmol, 6 eq) was then added slowly whilst monitoring the temperature. After 20 minutescold water was added to the still cold reaction mixture and the organic layer was separated and washed with cold saturated sodium bicarbonate, brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to flash column chromatography (silica gel; 5% to 20% ethyl acetate in hexane). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the product (3.1 g, 82%). LC/MS (Method 3) 2.37 min, no ionisation, 1H NMR (400 MHz, CDC13) 6 7.32 (s, 2H), 7.23 (s, 1H), 7.19 (s, 1H), 7.14 (s, 1H), 7.11 (s, 1H), 5.54 (d, J= 10.0 Hz, 2H), 4.74 - 4.66 (m, 2H), 4.63 (d, J=
11.0 Hz, 2H), 4.09 - 3.96 (m, 4H), 3.94 - 3.87 (m, 2H), 3.90 (s, 3H), 3.82 - 3.76 (m, 2H), 3.69 - 3.65 (m, 2H), 3.22 - 3.08 (m, 2H), 1.99- 1.90 (m, 4H), 1.75- 1.64 (m, 2H), 1.33- 1.21 (m, 3H), 1.11 (d, J= 1.1 Hz, 9H), 1.09 (d, J= 1.1 Hz, 9H), 1.01 -0.91 (m, 4H), 0.02 (s, 18H).
(iv) (S)-7-methoxy-2-methy1-84(5-(((S)-2-methy1-5,11-dioxo-7-((triisopropylsily0oxy)-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-10-((2-(trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (117) Triphenylarsine (588 mg, 1.92 mmol, 0.8 eq) was added to a mixture of triflate 116 (3.1 g, 2.4 mmol, 1 eq), methylboronic acid (1.0 g, 16.8 mmol, 7 eq), silver oxide (4.45 g, 19.2 mmol, 8 eq) and potassium phosphate tribasic (6.1 g, 28.8 mmol, 12 eq) in dry dioxane (40 mL) under an argon atmosphere. The reaction was flushed with argon 3 times and bis(benzonitrile)palladium(11) chloride (184 mg, 0.48 mmol, 0.2 eq) was added.
The reaction was flushed with argon 3 more times before being stirred at 70 C. After 1 hour the reaction was observed to be complete by TLC and filtered through a pad celite. The solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to column flash chromatography (silica gel; 20% to 50% ethyl acetate /
hexane). Pure fractions were collected and combined, and excess eluent was removed by rotary evaporation under reduced pressure afforded the product (1.1 g, 36 %). LC/MS
(Method 3) 2.34 min, no ionisation, 1H NMR (400 MHz, CDC13) 6 7.35 (s, 2H), 7.20 (s, 1H), 7.16 (s, 1H), 6.68 (d, J = 1.3 Hz, 1H), 6.64 (d, J = 1.4 Hz, 1H), 5.53 (s, 1H), 5.51 (s, 1H), 4.67 (t, J =
10.1 Hz, 2H), 4.45 (dt, J = 10.5, 3.2 Hz, 2H), 4.08 - 3.94 (m, 4H), 3.90 (s, 3H), 3.77 (dd, J =
8.9, 7.5 Hz, 2H), 3.68 (dt, J = 10.0, 5.2 Hz, 2H), 3.43 (d, J = 16.5 Hz, 2H), 2.78 (d, J = 10.4 Hz, 2H), 2.00 - 1.86 (m, 4H), 1.83 (s, 3H), 1.82 (s, 3H), 1.72 - 1.68 (m, 2H), 1.30 - 1.25 (m, 3H), 1.09 (s, 9H), 1.06 (s, 9H), 0.99 - 0.94 (m, 4H), 0.02 (s, 18H).
(v) (S)-7-hydroxy-84(5-(((S)-7-methoxy-2-methy1-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methyl-10-((2-(trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1,2-a][1,41diazepine-5,11(10H,11aH)-dione (118) Lithium acetate (110 mg, 1.08 mmol, 1 eq) was added to a solution of compound 117 (1.1 g, 1.08 mmol) in wet dimethylformamide (20 mL, 50:1 DMF/water). The reaction was stirred for 12 hours at ambient temperature and diluted with ethyl acetate and washed with citric acid (pH - 3), brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to provide the product (1.03 g, quantitative).
LC/MS (Method 3) 1.98 min, (ES+) m/z (relative intensity)863.35 [M + H], 1H
NMR (400 MHz, CDC13) 6 7.44 (s, 1H), 7.35 (s, 1H), 7.20 (s, 1H), 7.19 (s, 1H), 6.70 -6.62 (m, 2H), 6.21 (br, 1H), 5.51 (dd, J = 10.0, 5.3 Hz, 2H), 4.66 (dd, J= 11.3, 10.1 Hz, 2H), 4.46 (dd, J=
10.4, 3.2 Hz, 2H), 4.18 - 3.99 (m, 4H), 3.90 (s, 3H), 3.78 (td, J = 9.7, 6.9 Hz, 2H), 3.67 (td, J
= 9.7, 6.8 Hz, 2H), 3.49 - 3.35 (m, 2H), 2.81 - 2.68 (m, 2H), 2.00 - 1.89 (m, 4H), 1.82 (s, 3H), 1.81 (s, 3H), 1.75- 1.63 (m, 2H), 0.97 (ddd, J= 9.9, 6.6, 3.3 Hz, 4H), 0.01 (s, 18H).
(d) (S)-7-hydroxy-2-methylene-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-benzolelpyrrolo[1,2-a][1 ,4]diazepine-5,11 (1 OH,11aH)-dione (123) 1\1-.
HO
HN HO
HO
(S)-7-hydroxy-2-methylene-2,3-dihydro-1 H-benzo[e]pyrrolo[1, 2-a][1,4]diazepine-5,11(10H,11aH)-dione (121) Phenol isatoic anhydride 120 (1.59 g, 8.88 mmol, 1 eq), hydrochloride 119 (1.60 g, 9.7 mmol, 1.1 eq), diisopropylethylamine (2.06 mL, 11.8 mmol, 1.3 eq) were suspended in DMSO
(8mL) and heated at 120 C for 15 minutes. LC/MS monitoring showed total consumption of starting material. The reaction mixture was diluted with water and ice and the resulting precipitate was collected by filtration (1g). The product was recrystallized in acetonitrile to yield the desired product (600 mg). LC/MS (1.97 min (ES-) m/z (relative intensity) 242.7 ([M
- H], 100)); 1H NMR (400 MHz, DMSO) 6 10.24 (s, 1H), 9.64 (s, 1H), 7.15 (d, J=
2.5 Hz, 1H), 7.01 ¨6.90 (m, 2H), 5.08 (s, 2H), 4.31 ¨4.16 (m, 2H), 4.03 (dd, J= 16.2, 1.3 Hz, 1H), 3.20 (d, J= 16.1 Hz, 1H), 2.77 (dd, J= 15.9, 9.4 Hz, 1H).
(ii) (S)-7-hydroxy-2-methylene-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-benzolelpyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (/22) n-Buli (2.51 mL, 4.02 mmol, 2.2 eq ) was added to a suspension of phenol dilactam 121(447 mg, 1.83 mmol, leg) in anhydrous THF at -78 C. SEM chloride (670 mg, 711pL, 4.02 mmol, 2.2 eq) was injected slowly under vigorous stirring. The mixture was allowed to return to room temperature and was treated with dilute HCI in methanol (3 drops of concentrated hydrochloric acid / 50 mL methanol). The mixture was heated at 40 C to accelerate the hydrolysis of phenolic SEM ethers and the reaction was monitored by LC/MS and TLC (ethyl acetate). The mixture was partitioned between ethyl acetate and water, followed by a wash with brine. Flash column chromatography (80/20 Ethyl acetate / hexane) gave the product in 73% yield (502 mg). LC/MS (3.10 min (ES-) m/z (relative intensity) 372.9 ([M -H], 100)).
(e) (S)-8-methoxy-2-(6-methoxynaphthalen-2-y1)-7-((triisopropylsily0oxy)-10-((2-(trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (133) CO2Me Me0 NO2 Me0 NO2s Me0 N
H Me0 401 0 H 0 0- - ...I
Bn0 Bn0 Bn0 N.- ,--(b.,.. Bn0 OTBS
Me0 N
Me0 e0 H 0 ,---/64.1 _... 0 , 40 Bn0 ---(1 NI--lb....N TIMPSO
OTBS OTBS OTBS
SEM SEM SEM
% 0 1 0 \ 0 Me0 Me0 N Me0 N
-2.--3.- Ill N.- .-,..d ...
TIPSO lir TIPSO =
TIPSO 41111111)PPP
0 H 0 OTf SEM
Me0 H
HO Si N ,..,.
0 *0 OMe (i) (2S, 4R)-methyl 1-(5-(benzyloxy)-4-methoxy-2-nitrobenzoy1)-4-hydroxypyrrolidine-2-carboxylate (124) Oxalyl chloride (1.19 mL, 1.73 g, 13.6 mmol) was added to a stirred suspension of the nitrobenzoic acid 123 (2.77 g, 9.1 mmol) and DMF (3 drops) in anhydrous DCM
(50 mL).
Following initial effervescence the reaction suspension became a solution and the mixture was allowed to stir at room temperature for 16 hours. Conversion to the acid chloride was confirmed by treating a sample of the reaction mixture with Me0H and the resulting methyl ester was observed by LC/MS (3.27 min). The majority of solvent was removed by evaporation under reduced pressure; the resulting concentrated solution was re-dissolved in a minimum amount of dry DCM and triturated with diethyl ether. The resulting yellow precipitate was collected by filtration, washed with cold diethyl ether and dried for 1 hour in a vacuum oven at 40 C. The solid acid chloride was added portionwise over a period of 5 min to a stirred suspension of (2S,4R)-methyl-4-hydroxypyrrolidine-2-carboxylate hydrochloride (1.86 g, 10.2 mmol, 1.15 eq) and TEA (3.10 mL, 2.25 g, 22.2 mmol, 2.5 eq) in DCM (40mL) at -40 C (dry ice/CH3CN). Immediately, the reaction was complete as judged by LC/MS (2.70 min (ES+) m/z (relative intensity) 431.01 ([M +
, 100)) and by TLC (ethyl acetate). The mixture was diluted with DCM (20 mL) and washed with 1N HCI ( 30 mL), saturated NaHCO3 (30 mL), brine (40 mL), dried (Mg504), filtered and the solvent evaporated in vacuo to give the pure product as an orange solid (3.7 g, 94%).
LC/MS (2.70 min (ES+) m/z (relative intensity) 431.01 ([M +
, 100)); 1H NMR (400 MHz, CDCI3) 6 7.70 (d, J = 1.8 Hz, 1H), 7.48 - 7.30 (m, 5H), 6.89 (s, 1H), 5.29 (d, J = 5.5 Hz, 1H), 5.25 (d, J =
7.2 Hz, 1H), 4.84 (t, J = 8.1 Hz, 1H), 4.40 (s, 1H), 3.99 (d, J = 10.0 Hz, 3H), 3.82 (s, 3H), 3.46 (s, 1H), 3.33 (dd, J= 11.3, 4.2 Hz, 1H), 3.12 - 2.96 (m, 1H), 2.51 -2.29 (m, 1H), 2.22 -2.07 (m, 1H).
(ii) (2R,11 aS)-7-(benzyloxy)-2-hydroxy-8-methoxy-2,3-dihydro-1 H-benzo[e]pyrrolo[1, 2-a][1,41diazepine-5,11(10H,11aH)-dione (125) Zinc dust (10 g, 153 mmol, 19 eq (excess)) was added to a solution of nitro-ester 124(3.5 g, 8.1 mmol) in 5% formic acid in methanol (70 mL). An exotherm was observed, followed by reduction of the nitro to the aniline. LC/MS (2.47 min (ES+) m/z (relative intensity) 401.03 ([M + , 100)). The resulting suspension was filtered through celite and washed with methanol (30 mL) to give a clear filtrate. The solvent and residual formic acid were removed by evaporation. The residue was redisolved in methanol and hydrazine hydrate (380 pL, 12.2 mmol) was added to the solution and the reaction mixture was heated at 60 C until completion was observed. LC/MS (2.45 min (ES+) m/z (relative intensity) 369.01 ([M + , 100)). The mixture was allowed to cool down to room temperature, the solvent removed under vacuum, the residue triturated with diethyl ether and the precipitate retrieved by filtration and dried in a vacuum desiccator to provide the desired product as a white powder (2.77 g, 92%). LC/MS (2.45 min (ES+) rn/z (relative intensity) 369.01 ([M +
, 100)). 1H
NMR (400 MHz, DMSO) 6 7.95 (s, 1H), 7.52 - 7.34 (m, 6H), 6.77 (s, 1H), 5.14 (s, 2H), 4.33 (dd, J = 8.9, 4.4 Hz, 1H), 4.19 (dd, J = 8.0, 6.0 Hz, 1H), 3.83 (s, 3H), 3.65 (dd, J = 11.8, 3.3 Hz, 1H), 3.50 - 3.42 (m, 1H), 2.70 - 2.60 (m, 1H), 2.03 - 1.91 (m, 1H).
(iii) (2R,11aS)-7-(benzyloxy)-2-((tert-butylditnethylsily0oxy)-8-tnethoxy-2,3-dihydro-1H-benzolelpyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (/26) TBSCI (5.32g, 35.3 mmol) and imidazole (5.76 g, 84.6 mmol) were added to a solution of the dilactam 125 (2.6 g, 7.1 mmol) in anhydrous DMF (30 mL) at 0 C (ice/acetone).
The mixture was allowed to stir under a nitrogen atmosphere for 3 hours after which time the reaction was deemed complete as judged by LC/MS (3.60 min (ES+) rn/z (relative intensity) 483.09 ([M +
, 100)). The reaction mixture was poured onto ice (- 200 mL) and allowed to warm to room temperature with stirring. The resulting white precipitate was collected by vacuum filtration, washed with H20, redisolved in ethyl acetate, and dried over magnesium sulphate followed by rotoevaporation under vacuum. The residue was purified by flash column chromatography (50 /50 ethyl acetate / hexane) to provide the desired compound (2.42 g, 71%). LC/MS (3.60 min (ES+) rn/z (relative intensity) 483.09 ([M +
, 100)). 1H NMR (400 MHz, CDCI3) 6 8.26 (s, 1H), 7.53 (s, 1H), 7.49 - 7.28 (m, 5H), 6.47 (s, 1H), 5.16 (q, J = 11.9 Hz, 2H), 4.51 (p, J = 5.5 Hz, 1H), 4.19 (dd, J = 8.2, 4.3 Hz, 1H), 3.89 (s, 3H), 3.68 (ddd, J =
27.8, 11.9, 5.4 Hz, 2H), 2.82 (dt, J= 12.7, 4.9 Hz, 1H), 2.17- 1.94(m, 1H), 0.92 - 0.81 (m, 9H), 0.08 (d, J = 3.0 Hz, 6H).
(iv) (2R,11aS)-7-(benzyloxy)-2-((tert-butyldimethylsily0oxy)-8-methoxy-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (/27) A solution of n-BuLi (4.7 mL of a 1.6 M solution in hexane, 7.52 mmol) was added dropwise to a stirred suspension of the dilactam 126 (2.42 g, 5.01 mmol) in anhydrous THF (30 mL) at -60 C under a nitrogen atmosphere. The reaction mixture was allowed to stir at this temperature for 1 hour at which point neat SEMCI (1.33 mL, 1.25 g, 7.51 mmol) was added dropwise. The reaction mixture was allowed to slowly warm to room temperature and was stirred for 2 hours under a nitrogen atmosphere. The reaction was deemed complete as judged by TLC (Et0Ac) and LC/MS (4.30 min (ES+) rn/z (relative intensity) 613.16 ([M + , 100)). The THF was removed by evaporation in vacuo and the resulting residue dissolved in Et0Ac (100 mL), washed with H20 (100 mL), brine (30 mL), dried (Mg504) filtered and evaporated in vacuo to provide the crude N10-SEM-protected dilactam (2.23 g, 72%).
Product carried through to next step without purification. LC/MS (4.30 min (ES+) tniz (relative intensity) 613.16 ([M + , 100)). 1H NMR (400 MHz, CDCI3) 6 7.49 -7.28 (m, 6H), 7.24 (s, 1H), 5.55 - 5.49 (m, 1H), 5.18 (q, J= 11.9 Hz, 2H), 4.68 - 4.61 (m, 1H), 4.56 (p, J=
5.8 Hz, 1H), 4.22 (dd, J = 8.2, 3.8 Hz, 1H), 3.89 (s, 3H), 3.83 - 3.58 (m, 4H), 3.58 - 3.50 (m, 1H), 2.84 (ddd, J = 12.8, 5.5, 4.0 Hz, 1H), 2.05 - 1.96 (m, 1H), 1.04 - 0.89 (m, 6H), 0.89 -0.84 (m, 9H), 0.05 - 0.00 (m, 9H).
(v) (2R,11aS)-2-((tert-butyldimethylsily0oxy)-7-hydroxy-8-methoxy-104(2-(trimethylsilyl)ethoxy)methyl)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (128) Benzyl ether 127 (2.23g, 3.63 mmol) was hydrogenated in ethyl acetate (40 mL) at 40 PSI
overnight in Parr hydrogenator in the presence of 10% Pd/C (220 mg, 10% w/w) after which completion was observed by LC/MS. The solids were removed by filtration over celite and the resulting filtrate was concentrated under vacuum. The resulting residue was found to be of satisfactory purity and was carried through to the next steps without further purification.
(1.90 g, 100%). LC/MS (3.87 min (ES+) m/z (relative intensity) 522.81 ([M+
, 100)). 1H
NMR (400 MHz, CDCI3) 6 7.46 (s, 1H), 7.22 (s, 1H), 6.11 (s, 1H), 5.51 (d, J =
9.9 Hz, 1H), 4.66 (d, J = 8.1 Hz, 1H), 4.57 (p, J = 5.8 Hz, 1H), 4.23 (dd, J = 8.2, 3.8 Hz, 1H), 3.92 (s, 3H), 3.84 - 3.50 (m, 4H), 2.92 - 2.74 (m, 1H), 2.10- 1.90 (m, 1H), 1.06 - 0.89 (m, 2H), 0.89 -0.82 (m, 9H), 0.09 (d, J = 0.9 Hz, 6H), 0.03 (d, J = 3.2 Hz, 9H).
(vi) (2R,11aS)-2-((tert-butyldimethylsily0oxy)-8-methoxy-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (/29) Neat triisopropylsilylchloride (1.55 mL, 1.39 g, 7.24 mmol) was added to a mixture of imidazole (743 mg, 10.9 mmol) and the previously prepared phenol 128 (1.90 g, 3.64 mmol) (ground together). The mixture was heated until the phenol and imidazole melted and went into solution (100 C). The reaction mixture was allowed to stir for 5 mins and was then allowed to cool, whereupon a solid was observed to form at the bottom of the flask. The reaction mixture was diluted with 5% Et0Ac/ hexanes and loaded directly onto silica gel and the column was eluted with 5% Et0Ac/ hexanes, followed by 10% Et0Ac/hexanes.
Excess eluent was removed by rotary evaporation under reduced pressure, followed by drying under high vacuum to afford as an oil (2.5 g, 100 %). LC/MS (4.50 min (ES+) tniz (relative intensity) 679.49 ([M+ , 100)). 1H NMR (400 MHz, CDCI3) 6 7.36 (s, 1H), 7.18 (s, 1H), 5.51 (d, J= 9.9 Hz, 1H), 4.63 (d, J= 9.9 Hz, 1H), 4.55 (p, J= 5.6 Hz, 1H), 4.21 (dd, J= 8.1, 4.1 Hz, 1H), 3.83 (s, 3H), 3.72 - 3.51 (m, 4H), 2.91 -2.75 (m, 1H), 2.10- 1.94 (m, 1H), 1.33 - 1.21 (m, 3H), 1.09 (dd, J = 7.4, 2.0 Hz, 18H), 1.00 - 0.89 (m, 2H), 0.89 -0.81 (m, 9H), 0.08 (s, 6H), 0.03 (s, 9H).
(vii) (2R,11aS)-2-hydroxy-8-methoxy-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11(10H,11aH)-dione (130) The secondary TBS ether 129 (2.5 g, 3.68 mmol) was dissolved in a mixture of 1% v/v conc aq HCI in methanol (20 mL) and THF (5 mL). After stirring for 6h at 20 C, analysis of the reaction mixture by TLC (50:50 v/v Et0Ac/Hexane) revealed that the reaction was almost complete. The reaction mixture was dissolved in Et0Ac (100 mL) and washed with water (2 x 100 mL). The combined organic layers were washed with brine (60 mL), dried (MgSO4), filtered and evaporated under reduced pressure to provide the crude product which was taken directly to the next step as a crude. (2.08 g, 3.68 mmol, 100%). LC/MS
3.77 min (ES+) m/z (relative intensity) 565.29 ([M + , 100).
(viii) (S)-8-methoxy-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-1H-benzolelpyrrolo[1,2-a][1 ,4]diazepine-2,5,11(3H,10H,11aH)-trione (131) TCCA (600 mg, 2.58 mmol, 0.7 eq) was added to a stirred solution of 130 (2.08 g, 3.68 mmol, 1 eq) and TEMPO (57 mg, 0.36 mmol, 0.1 eq) in dry dichloromethane (50 mL) at -10 C (ice/acetone bath). The reaction mixture was vigorously stirred for 20 minutes, at which point TLC (25/75 ethyl acetate/hexane) revealed complete consumption of the starting material. The reaction mixture was filtered through celite and the filtrate washed with aqueous saturated sodium bicarbonate (50 mL), sodium thiosulphate (1.5 g in 50 mL), brine (100 mL) and dried over magnesium sulphate. Rotary evaporation under reduced pressure followed by flash column chromatography (gradient elution: 90:10 v/v Hexane/Et0Ac to 80:20 v/v Hexane/Et0Ac) afforded the desired product (1.40 g, 67%). LC/MS 3.87 min (ES+) m/z (relative intensity) 563.05 ([M+ , 100); 1H NMR (400 MHz, CDCI3) 6 7.35 (s, 1H), 7.22 (s, 1H), 5.55 (d, J = 9.9 Hz, 1H), 4.69 (d, J = 9.9 Hz, 1H), 4.63 (dd, J = 9.9, 3.1 Hz, 1H), 4.23 (d, J = 20.1 Hz, 1H), 3.91 - 3.83 (m, 4H), 3.79 (td, J = 9.7, 6.7 Hz, 1H), 3.68 (td, J
= 9.7, 6.7 Hz, 1H), 3.56 (dd, J= 19.2, 3.1 Hz, 1H), 2.78 (dd, J= 18.2, 9.9 Hz, 1H), 1.34 -1.21 (m, 3H), 1.10 (d, J= 7.3 Hz, 18H), 0.98 (ddd, J= 9.6, 6.5, 4.1 Hz, 2H), 0.05 - 0.01 (m, 9H).
(ix) (S)-8-methoxy-5,11-dioxo-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-5,10,11,11 a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-2-y1 trifluoromethanesulfonate (132) Triflic anhydride (1.24 mL, 2.08 g, 7.37 mmol, 3 eq) was injected (temperature controlled) to a vigorously stirred suspension of ketone 131 (1.40 g, 2.49 mmol, 1 eq) in dry dichloromethane (50 mL) in the presence of 2,6-lutidine (1.16 mL, 1.06 g, 9.96 mmol, 4 eq, dried over sieves) at -50 C (acetone/dry ice bath). The reaction mixture was allowed to stir for 1.5 hours when LC/MS, following a mini work-up (water/dichloromethane), revealed the reaction to be complete. Water was added to the still cold reaction mixture and the organic layer was separated and washed with saturated sodium bicarbonate, brine and magnesium sulphate. The organic phase was filtered and excess solvent was removed by rotary evaporation under reduced pressure. The residue was subjected to column flash chromatography (gradient elution: 95:5 v/v Hexane/Et0Ac to 80:20 v/v Hexane/Et0Ac) afforded the desired product (1.34 g, 77%). LC/MS (Method 2) 4.08 min (ES+) tniz (relative intensity) 716.82 ([M+ Na], 100). 1H NMR (400 MHz, CDCI3) 6 7.34 (s, 1H), 7.22 (s, 1H), 7.11 (t, J = 2.0 Hz, 1H), 5.55 (d, J = 9.9 Hz, 1H), 4.69 (d, J = 9.9 Hz, 1H), 4.63 (dd, J = 11.0, 3.7 Hz, 1H), 3.91 (ddd, J= 16.3, 3.7, 1.8 Hz, 1H), 3.86 (s, 3H), 3.80 (td, J=
9.5, 7.1 Hz, 1H), 3.69 (td, J= 9.5, 7.1 Hz, 1H), 3.16 (ddd, J= 16.3, 11.1, 2.4 Hz, 1H), 1.34-1.20 (m, 3H), 1.10 (d, J = 7.2 Hz, 18H), 1.02 - 0.94 (m, 2H), 0.05 - 0.01 (m, 9H).
(x) (S)-8-methoxy-2-(6-methoxynaphthalen-2-y1)-7-((triisopropylsily0oxy)-104(2-(trimethylsily0ethoxy)methyl)-1 H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11 (10H,11aH)-dione (/33) Pd(PPh3)4 (112 mg, 95.2 pmol, 0.05 eq) was added to a stirred mixture of enol triflate 132 (1.35 g, 1.94 mmol), 6-methoxy-2-naphthylboronic acid (1.02 g, 5.05 mmol, 2.6 eq), K3PO4 (1.07 g, 5.04 mmol), dioxane (15 mL). The reaction mixture was allowed to stir under a argon atmosphere for 2 hours at 35 C after which time the complete consumption of starting material was observed by TLC (Et0Ac/Hexane) and LC/MS (4.22 min (ES+) tniz (relative intensity) 702.88 ([M + , 100)). The reaction mixture was diluted with Et0Ac (100 mL) and washed with brine (200 mL), dried (Mg504), filtered and evaporated under reduced pressure to provide the crude product. Purification by flash chromatography (gradient elution: 90:10 v/v Hexane/Et0Ac to 70:30 v/v Hexane/Et0Ac) afforded the TIPS
protected C2-aryl which was immediately redissolved in wet DMF (50/1 DMF/water v/v).
Solid lithium acetate (198 mg, 1.94 mmol, 1 eq) was added and the reaction allowed to proceed for 3 hours at 40 C followed by three days at -20 C. The reaction mixture was diluted with ethyl acetate and washed with citric acid (pH - 3), water and brine. The organic layer was dried over magnesium sulphate filtered and excess ethyl acetate was removed by rotary evaporation under reduced pressure to provide the deprotected material (1.17g, Quantitative). : LC/MS (3.33 min (ES+) tniz (relative intensity) 546.77 ([M +
, 100)).
Example 1 SEM SEM
= 111 HO 0 o N
OMe 116 Nis-&
fiqr0 N 11" O HMe 0 11111;11 21µ1 0 /(:)\0./N3 Fff. 00 r" H
cfN,r (a) (S)-7-methoxy-2-methy1-84(5-(((S)-2-methyl-5,11-dioxo-7-(prop-2-yn-1-yloxy)-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,41diazepin-5 8-yl)oxy)pentyl)oxy)-104(2-(trimethylsilyl)ethoxy)methyl)-1 H-benzo[e]pyrrolo[1, 2-a][1,41diazepine-5,11 (10H,11aH)-dione (1) Tetrabutylammonium iodide (34 mg, 0.093 mmol, 0.2 eq), potassium carbonate (96 mg, 0.694 mmol, 1.5 eq) and propargyl bromide (0.1 mL, 0.973 mmol, 2.1 eq) were added to a solution of alcohol 118 (400 mg, 0.463 mmol) of dimethylformamide (10 mL). The reaction mixture was stirred for 1 hour at 70 C after when the reaction was observed to be complete by LC/MS. The reaction mixture was diluted with ethyl acetate and washed with water three times, brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to provide the desired product (448 mg, quantitative). LC/MS (Method 3) 2.04 min, no ionisation, 1H NMR (400 MHz, CDC13) 6 7.52 (s, 1H), 7.35 (s, 1H), 7.23 (s, 1H), 7.20 (s, 1H), 6.67 (s, 2H), 5.52 (dd, J=
10.0, 4.2 Hz, 2H), 4.78 (t, J = 2.5 Hz, 2H), 4.68 (dd, J = 10.0, 7.8 Hz, 2H), 4.46 (dt, J = 10.4, 3.4 Hz, 2H), 4.14 ¨ 4.00 (m, 4H), 3.90 (s, 3H), 3.84 ¨ 3.73 (m, 2H), 3.73 ¨ 3.62 (m, 2H), 3.44 (d, J = 16.6 Hz, 2H), 2.80 ¨ 2.72 (m, 2H), 2.52 (t, J = 2.4 Hz, 1H), 1.99 ¨ 1.92 (m, 4H), 1.83 (s, 3H), 1.83 (s, 3H), 1.75¨ 1.68 (m, 2H), 0.97 (ddd, J= 9.7, 6.7, 3.0 Hz, 4H), 0.01 (s, 18H).
(b) (S)-7-methoxy-2-methyl-84(5-(((S)-2-methyl-5-oxo-7-(prop-2-yn-1 -yloxy)-5,1 la-dihydro-1 H-benzo[e]pyrrolo[1,2-a][1 ,4]diazepin-8-y0oxy)pentyl)oxy)-1H-benzo[e]pyrrolo[1 ,2-41-1,41diazepin-5(11aH)-one (2) Compound 1 (500 mg, 0.55 mmol) was dissolved in dry THF (15 mL) and cooled to -78 C.
Lithium triethylborohydride (1.39 mL, 1.39 mmol, 2.5 eq) was then added dropwise. The reaction was stirred under argon at -78 C. After 30 minutes, the cold bath was removed and water added. The reaction mixture was extracted with ethyl acetate and washed with brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was dissolved with a mixture of dichloromethane / methanol / water (3 / 6 / 1, 6 mL / 12 mL / 2 mL). Silica gel was added until the solution gets thick and left stirring at ambient temperature for 5 days. The reaction mixture was filtered and washed with brine, dried over magnesium sulphate;
filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to column flash chromatography (silica gel; 5% methanol /
chloroform). Pure fractions were collected and combined, and excess eluent was removed by rotary evaporation under reduced pressure afforded the desired product (240 mg, 72 A).
LC/MS (Method 3) 1.88 min, (ES+) m/z (relative intensity) 608.68 [M + H], 1H
NMR (400 MHz, CDCI3) 6 7.80 (d, J = 4.1 Hz, 1H), 7.79 (d, J = 4.1 Hz, 1H), 7.63 (s, 1H), 7.48 (s, 1H), 6.78(s, 1H), 6.77(s, 1H), 6.72 (br, 2H), 4.81 ¨ 4.76 (m, 2H), 4.28 ¨ 4.18 (m, 2H), 4.12 ¨
4.01 (m, 4H), 3.91 (s, 3H), 3.24 ¨ 3.09 (m, 2H), 2.94 (dd, J = 16.8, 5.0 Hz, 2H), 2.52 (t, J =
2.3 Hz, 1H), 1.99 ¨ 1.85 (m, 4H), 1.81 (s, 6H), 1.71 ¨ 1.60 (m, 2H).
(c) 3-(2,5-dioxo-2,5-dihydro-1 H-pyrrol-1-y1)-N-(2-(2-(2-(2-(4-((((S)-84(5-(((S)-7-methoxy-2-methy1-5-oxo-5,1 1 a-dihydro-1 H-benzo[e]pyrrolo[1 ,2-a][1 , 4]diazepin-8-y0oxy)pentyl)oxy)-2-methy1-5-oxo-5,1 1 a-dihydro-1 H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-7-y0oxy)methyl)-1 H-1 ,2,3-triazol-1-yOethoxy)ethoxy)ethoxy)ethyl)propa na mide (5) Azide 4 (64 pL, 0.328 mmol, 1.2 eq) was added to a solution of succinimide 3 (100 mg, 0.375 mmol, 1.3 eq) in dry DMSO (2 mL) and the reaction mixture was stirred at ambient temperature for 12 hours. In another round bottom flask, compound 2 (170 mg, 0.279 mmol) was dissolved in tert-butanol (2 mL). Water (2 mL) was added followed by sodium ascorbate (11 mg, 0.056 mmol, 0.2 eq) and copper sulphate (4 mg, 0.014 mmol, 0.05 eq).
The reaction mixture (with reacted 4 and3) in DMSO was then added to the reaction mixture in water /
tert-butanol. The reaction mixture was degassed with argon and stirred at ambient temperature. The reaction was complete after 1 hour and then diluted with dichloromethane and washed with water two times, brine, dried over magnesium sulphate;
filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to column flash chromatography (silica gel; 2% to 10% methanol /
chloroform). Pure fractions were collected and combined, and excess eluent was removed by rotary evaporation under reduced pressure afforded the desired product (40 mg, 15 A).
LC/MS (Method 3) 1.29 min, (ES+) m/z (relative intensity)978.40 [M +
Example 2 SEM SEM
0 jEM SIEM o 0 0 \ 0 N 1110 '.-c) 6 H OMe 0 IS I\
0 0 0 7 y 0 H N
ALLOC
OMe 0 1111" N OMe 0 111)11 c.
ALLOC
OMe N
(a) allyl (3-(((S)-84(5-(((S)-7-methoxy-2-methy1-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-10 8-y0oxy)pentyl)oxy)-2-methyl-5,11-dioxo-10-((2-(trimethylsily0ethoxy)methyl)-5,10,11,11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-7-yl)oxy)propyl)carbamate (7) Tetrabutylammonium iodide (34 mg, 0.093 mmol, 0.2 eq), potassium carbonate (96 mg, 0.694 mmol, 1.5 eq) and 6 (154 mg, 0.695 mmol, 1.5 eq) were added to a solution of alcohol 118 (400 mg, 0.463 mmol) in dimethylformamide (5 mL). The reaction mixture was stirred for 1 hour at 70 C after when the reaction was observed to be complete by LC/MS.
The reaction mixture was diluted with ethyl acetate and washed with water three times, brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure to provide the desired product (420 mg, 90%).
LC/MS (Method 3) 2.05 min, (ES+) m/z (relative intensity)863.35 [M + H], 1H
NMR (400 MHz, CDC13) 6 7.33 (s, 1H), 7.31 (s, 1H), 7.18 (s, 1H), 7.17 (s, 1H), 6.64 (br, 2H), 5.87 (ddd, J = 22.7, 10.9, 5.7 Hz, 1H), 5.57 (br, 1H), 5.48 (dd, J = 10.0, 3.0 Hz, 2H), 5.22 (dd, J = 18.3, 1.4 Hz, 1H), 5.15 (dd, J= 10.4, 1.2 Hz, 1H), 4.67 (t, J= 9.9 Hz, 2H), 4.51 (d, J= 5.5 Hz, 2H), 4.44 (ddd, J = 10.4, 5.2, 3.3 Hz, 2H), 4.16 ¨ 3.99 (m, 6H), 3.87 (s, 3H), 3.79 ¨ 3.72 (tdd, 2H), 3.70 ¨ 3.59 (m, 2H), 3.43 (br, 1H), 3.42 ¨ 3.34 (m, 3H), 2.73 (dd, J= 16.6, 10.5 Hz, 2H), 2.04 - 1.88 (m, 6H), 1.80 (s, 6H), 1.66 (d, J = 7.0 Hz, 2H), 0.94 (ddt, J = 9.4, 6.6, 2.5 Hz, 4H), 0.01 (s, 18H).
(b) Allyl (3-(((S)-84(5-(((S)-7-methoxy-2-methy1-5-oxo-5,11a-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methyl-5-oxo-5,11a-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-7-y0oxy)propyl)carbamate (8) Compound 7 (580 mg, 0.55 mmol) was dissolved in dry THF (15 mL) and cooled to -78 C.
Lithium triethylborohydride (1.44 mL, 1.44 mmol, 2.5 eq) was then added dropwise. The reaction was stirred under argon at -78 C. After 30 minutes, the cold bath was removed and water added. The reaction mixture was extracted with ethyl acetate and washed with brine, dried over magnesium sulphate; filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was dissolved with a mixture of dichloromethane / methanol / water (3 / 6 / 1, 6 mL / 12 mL / 2 mL). Silica gel was added until the solution gets thick and left stirring at ambient temperature for 5 days. The reaction mixture was filtered and washed with brine, dried over magnesium sulphate;
filtered and excess solvent was removed by rotary evaporation under reduced pressure. The resulting residue was subjected to column flash chromatography (silica gel; 5% methanol /
chloroform). Pure fractions were collected and combined, and excess eluent was removed by rotary evaporation under reduced pressure afforded the desired product (220 mg, 54 A).
LC/MS (Method 3) 1.41 min, (ES+) m/z (relative intensity)712.40 [M + H], 1H
NMR (400 MHz, CDCI3) 6 7.80 (dd, J = 3.9, 1.0 Hz, 2H), 7.49 (s, 1H), 7.47 (s, 1H), 6.78 (s, 2H), 6.73 (d, J= 1.3 Hz, 2H), 5.96 - 5.83 (m, 1H), 5.68 (br, 1H), 5.27 (d, J= 17.2 Hz, 1H), 5.17 (dd, J=
10.4, 1.2 Hz, 1H), 4.54(d, J= 5.1 Hz, 2H), 4.28 - 4.16 (m, 2H), 4.16 - 4.00 (m, 6H), 3.91 (s, 3H), 3.48 (br, 1H), 3.50 - 3.38 (m, 2H), 3.36 - 3.34 (m, 1H), 3.24 - 3.11 (m, 2H), 2.95 (dd, J
= 16.8, 4.8 Hz, 2H), 2.05 - 2.00 (m, 2H), 1.99 - 1.89 (m, 4H), 1.83 (s, 6H).
(c) (S)-7-(3-aminopropoxy)-84(5-(((S)-7-methoxy-2-methy1-5-oxo-5,11a-dihydro-benzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methyl-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-5(11aH)-one (9) Tetrakis(triphenylphosphine)palladium(0) (7 mg, 0.006 mmol, 0.06 eq) was added to a solution of 8 (80 mg, 0.112 mmol) and pyrrolidine (23 pL, 0.28 mmol, 2.5 eq) in dry dichloromethane (2 mL). The reaction was flushed with argon three times and stirred 3 hours at room temperature. Then the reaction was diluted with dichloromethane and washed sequentially with saturated aqueous ammonium chloride and brine. The organic phase was dried over magnesium sulphate filtered and excess dichloromethane removed by rotary evaporation under reduced pressure. The resulting residue was used as a crude mixture for the next reaction. LC/MS (Method 3) 1.05 min, (ES+) m/z (relative intensity) 628.35 [M +
H].
(d) 1-(3-(2, 5-dioxo-2, 5-dihydro-1 H-pyrrol-1-yl)propa na mido)-N-(3-(((S)-84(5-(((S)-7-meth oxy-2-methyl-5-oxo-5,11 a-d ihydro-1 H-be nzo[e]pyrrolo[1,2-a][1,4]diazepin-8-y0oxy)pentyl)oxy)-2-methy1-5-oxo-5,11 a-dihyd ro-1 H-benzo[e]pyrrolo[1 ,2-a][1 ,4]diazepi n-7-yl)oxy)propyI)-3, 6,9,12,15,18, 21 ,24-octaoxaheptacosan-27-amide (10) 1-ethyl-3-(3'-dimethylaminopropyl)carbodiimide (EDCI, 11 mg, 0.060 mmol, 1.1 eq) was added to a solution of crude 9 (0.056 mmol) and Mal-(PEG)8-acid (35 mg, 0.060 mmol, 1.1 eq) in dry dichloromethane (2 mL). The reaction was degassed three times with Argon and stirred for 1 hours and the presence of starting material was no longer observed by LC/MS.
The reaction was diluted with dichloromethane and washed sequentially with water and brine. The organic phase was dried over magnesium sulphate filtered and excess dichloromethane removed by rotary evaporation under reduced pressure. The resulting residue was subjected to flash column chromatography (silica gel; 100%
chloroform to 10%
methanol in chloroform). Pure fractions were collected and combined and excess eluent was removed by rotary evaporation under reduced pressure to give the desired product (19 mg, 28% over 2 steps). LC/MS (Method 3) 1.30 min, (ES+) m/z (relative intensity) 1202.55 [M +
H]. 1H NMR (400 MHz, CDCI3) 6 7.79 (d, J = 4.0 Hz, 1H), 7.48(d, J= 5.1 Hz, 1H), 6.77(d, J
= 1.8 Hz, 1H), 6.72 (d, J = 3.5 Hz, 1H), 6.68 (s, 2H), 6.45 ¨ 6.34 (m, 1H), 4.59 ¨ 4.48 (m, 1H), 4.28 ¨ 4.20 (m, 1H), 4.18 ¨ 3.95 (m, 6H), 3.91 (s, 2H), 3.86 ¨ 3.75 (m, 4H), 3.75 ¨ 3.67 (m, 2H), 3.63 ¨ 3.58 (m, 28H), 3.54 ¨ 3.49 (m, 2H), 3.49 ¨ 3.36 (m, 6H), 3.35 ¨ 3.34 (m, 1H), 3.20 ¨ 3.13 (m, 2H), 2.94 (d, J= 16.8 Hz, 2H), 2.50 (t, J= 7.2 Hz, 2H), 2.46 ¨
2.37 (m, 2H), 2.07 ¨ 1.99 (m, 2H), 1.97 ¨ 1.91 (m, 4H), 1.82 (s, 3H), 1.77 (s, 3H), 1.69 ¨
1.63 (m, 2H), 0.90 ¨ 0.77 (m, 1H).
Example 3 SEM
k 0 HO 1-/Sla ao 0 +OS u + H 2 () (:)/ N3 (a) (S)-2-methylene-7-(prop-2-yn-1-yloxy)-104(2-(trimethylsily0ethoxy)methyl)-2,3-dihydro-1H-benzolelpyrrolo[1,2-4-1,41diazepine-5,11(10H,11aH)-dione (11) Propargyl bromide (149 pL, 158 mg, 1.33 mmol, 1.05 eq) was added to a suspension of phenol 122 (477 mg, 1.27 mmol, leg), TBAI (47 mg, 0.127 mmol, 0.1eq), and potassium carbonate (132 mg, 0.96 mmol, 0.75 eq) in dry DMF (10 mL), and stirred at 75 C
for 1 hour when completion was observed. The reaction mixture was partitioned between ethyl acetate (100 mL) and water (100mL). The organics were further washed with water (2 x 100 mL), brine (50 mL) and dried over magnesium sulphate. Yield = 420 mg (80%). LC/MS
(3.43 min (ES+) m/z (relative intensity) 413.07 ([M +
, 100)); 1H NMR (400 MHz, CDCI3) 6 7.63 (dd, J = 9.0, 1.7 Hz, 1H), 7.44 (d, J = 3.1 Hz, 1H), 7.17 - 7.11 (m, 1H), 5.48 (dd, J = 9.9, 1.5 Hz, 1H), 5.22 - 5.07 (m, 2H), 4.74 (d, J = 2.7 Hz, 2H), 4.68 (d, J = 9.2 Hz, 1H), 4.40 - 4.14 (m, 3H), 3.69 (dtd, J= 16.8, 9.6, 7.7 Hz, 2H), 3.43 (d, J= 15.9 Hz, 1H), 2.88 -2.71 (m, 1H), 2.60 - 2.47 (m, 1H), 1.04 - 0.88 (m, 2H), 0.08 - -0.06 (m, 9H).
(b) (S)-2-methylene-7-(prop-2-yn-1-yloxy)-2,3-dihydro-1H-benzo[e]pyrrolo[1,2-a][1,41diazepin-5(11aH)-one (12) 1M superhydride solution in THF (1.32 mL, 1.3 eq) was injected slowly to a solution of dilactam 11 (420 mg, 1.02 mmol, 1eq ) in THF at -78 C. The reaction was monitored for 1 hour after which time the complete conversion of starting material directly was observed by LC/MS (3.02 min (ES+) m/z (relative intensity) 267.10 ([M +
, 100)). The reaction mixture was carefully diluted with H20 (500 mL) and extracted with ethyl acetate (50 mL). The combined organic layers were washed with water (1 x 50 mL), brine (1 x 20 mL), dried over MgSO4, filtered and evaporated under reduced pressure at 35 C to provide the intermediate SEM-carbinolamine. The white solid were immediately dissolved in Et0H (40 mL), DCM
(15mL) and H20 (5 mL) and treated with flash silica gel (30 g). The thick suspension was allowed to stir at room temperature for 72 hours after which time the formation of a significant quantity of desired product was observed by TLC (95:5 v/v CHC13/Me0H). The reaction mixture was filtered through a very wide porosity 3 sinter funnel and the pad rinsed slowly and thoroughly with 90:10 v/v CHC13/Me0H until no further product eluted (checked by TLC). The filtrate was washed with brine (300 mL), dried (MgSO4), filtered and evaporated in vacuo, followed by high vacuum drying, to provide the crude product.
Purification by flash chromatography (gradient elution: 100% HPLC grade CHCI3 to 98:2 v/v CHC13/Me0H) gave the desired product as a mixture of carbinolamine ethers and imine (155 mg, 57%). In order to obtain an NMR sample, material (10 mg) was treated with HPLC
grade CHCI3 (50 mL) and allowed to stand overnight to promote the formation of the imine form. The solvent was removed by evaporation under reduced pressure, and the residue was again treated with HPLC grade CHCI3 (50 mL) and allowed to stand for 4 hours.
LC/MS (2.28 min (ES+) m/z (relative intensity) 267.10 ([M +
, 100)); 1H NMR (400 MHz, CDCI3) 6 7.71 (d, J = 4.4 Hz, 1H), 7.60 (d, J = 3.0 Hz, 1H), 7.29 (d, J = 8.8 Hz, 1H), 7.17 (dd, J = 8.8, 3.0 Hz, 1H), 5.23 - 5.19 (m, 1H), 5.18 (s, 1H), 4.79 - 4.75 (m, 2H), 4.32 - 4.26 (m, 1H), 3.89 (s, 1H), 3.78 - 3.69 (m, 1H), 3.49 (d, J= 5.5 Hz, 1H), 3.12 (dd, J=
16.1, 9.1 Hz, 1H), 2.96 (dd, J = 3.0, 1.4 Hz, 1H).
(c) (S)-3-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-y1)-N-(2-(2-(2-(2-(4-(((2-methylene-5-oxo-2,3,5, 11a-tetrahydro-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-7-y0oxy)methyl)-1H-1,2,3-triazol-1-yl)ethoxy)ethoxy)ethoxy)ethyl)propanamide (13) Amino-(Peg)3-azide 4 (86.1 mg, 78pL,0.39 mmol 1.05 eq) was added to a solution of maleimide succinimide 3 (100 mg, 0.38 mmol, 1 eq) in DMSO (0.5 mL) at 25 C and reacted for 45 minutes. This solution was added to a mixture of propargyl-PBD 12 (100 mg, 0.38 mmol, 1 eq), sodium ascorbate (15 mg, 0.076 mmol, 0.2 eq), and copper sulphate (4.69 mg, 0.018 mmol, 0.05 eq) in tert-butanol/water 1/1 v/v (1.2 mL). The reaction was degazed and allowed to proceed under argon. After 2 hours, the LC/MS profile of the reaction was judged encouraging with significant formation of product alongside the amino-(peg)3-PBD. When allowed to proceed overnight, the LC/MS profile became poorer. The reaction mixture was partitioned between chloroform/methanol (90/10, v/v) and water. The organics were washed with water, followed by brine and dried over magnesium sulphate. The volatiles were removed by rotoevaporation under vacuum. The residue was purified by flash column chromatography (gradient methanol/chloroform 1/99 to 20/80). The product (dark spot under UV) came as mixed fractions with the amino-(peg)3-PBD (blue glow under UV) and was further purified by preparative TLC (25 mg, 10%). LC/MS (2.28 min (ES+) tniz (relative intensity) 636.16 ([M + , 100)); 1H NMR (400 MHz, CDCI3) 6 7.90 (s, 1H), 7.71 (d, J = 4.4 Hz, 1H), 7.61 (d, J = 2.9 Hz, 1H), 7.29(d, J= 8.8 Hz, 1H), 7.18 (dd, J= 8.8, 3.0 Hz, 1H), 6.67 (s, 2H), 6.46 (s, 1H), 5.26 (d, J = 7.1 Hz, 1H), 5.23 - 5.16 (m, 2H), 4.61 - 4.53 (m, 2H), 4.32 - 4.25 (m, 1H), 3.94 - 3.87 (m, 2H), 3.82 (t, J = 7.2 Hz, 2H), 3.65 -3.53 (m, 10H), 3.52 -3.46 (m, 3H), 3.43 - 3.35 (m, 2H), 3.14 (dd, J= 16.0, 9.0 Hz, 1H), 2.95 (dd, J= 16.0, 1.5 Hz, 1H), 2.49 (t, J= 7.2 Hz, 2H).
Example 4 SEM SEM
HO 4111111fr 0 tilo&
OMe 0 OMe O S + cg N__ H
al OMe 0 H
OMe (a) (S)-8-methoxy-2-(6-methoxynaphthalen-2-y1)-7-(prop-2-yn-1-yloxy)-10-((2-15 (trimethylsily0ethoxy)methyl)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepine-5,11 (10H,11aH)-dione (14) Propargyl bromide (251pL, 2.24 mmol 1.05 eq) was added to a suspension of crude phenol 133 (1.17g, 2.14 mmol, 1 eq), TBAI (79mg, 0.21 mmol, 1 eq) and potassium carbonate (221mg, 1.60 mmol, 0.75 eq) in dry DMF (10 mL), and stirred at 75 C for 1 hour when completion was observed. The reaction mixture was partitioned between ethyl acetate (100 mL) and water (100mL). The organics were further washed with water (2 x 100 mL), brine (50 mL) and dried over magnesium sulphate. The residue was subjected to column flash chromatography (gradient elution: 35:65 v/v Hexane/Et20 to 0:100 v/v Hexane/Et20) afforded the desired product (594 mg, 47% from crude, 52% over three steps).
LC/MS (3.85 min (ES+) m/z (relative intensity) 584.92 ([M + , 100)); [a]21D = +345 (c = 0.229, Chloroform); 1H NMR (400 MHz, CDCI3) 6 7.75 - 7.64 (m, 3H), 7.64 - 7.55 (m, 2H), 7.52 (s, 1H), 7.32(s, 1H), 7.19 - 7.08 (m, 2H), 5.59 (d, J= 10.0 Hz, 1H), 4.92 - 4.77 (m, 2H), 4.71 (dd, J = 10.4, 3.8 Hz, 2H), 4.08 (ddd, J = 16.0, 3.3, 1.7 Hz, 1H), 3.97 - 3.89 (m, 6H), 3.83 (td, J= 9.4, 7.2 Hz, 1H), 3.72 (td, J= 9.4, 7.1 Hz, 1H), 3.27 (ddd, J= 15.9, 10.6, 2.1 Hz, 1H), 2.56 (t, J = 2.4 Hz, 1H), 1.05 - 0.95 (m, 2H), 0.07 - 0.02 (m, 9H).
(b) (S)-8-methoxy-2-(6-methoxynaphthalen-2-y1)-7-(prop-2-yn-1-yloxy)-1H-benzo[e]pyrrolo[1,2-a][1,4]diazepin-5(11aH)-one (15) 1M superhydride solution in THF (1.27 mL, 1.27 mmol, 1.3 eq) was injected slowly to a solution of dilactam 14 (573 mg, 0.98 mmol, 1 eq) in THF (10 mL) at -78 C. The reaction was monitored for 1 hour after which time the complete conversion of starting material directly was observed by LC/MS (3.03 min (ES+) m/z (relative intensity) 456.88 ([M + , 100)). The reaction mixture was carefully diluted with H20 (500 mL) and extracted with chlorofom (50 mL). The combined organic layers were washed with water (1 x 50 mL), brine (1 x 20 mL), dried over Mg504, filtered and evaporated under reduced pressure at 35 C to provide the intermediate SEM-carbinolamine. The white solid were immediately dissolved in Et0H (40 mL), DCM (15mL) and H20 (5 mL) and treated with flash silica gel (30 g). The thick suspension was allowed to stir at room temperature for 72 hours after which time the formation of a significant quantity of desired product was observed by TLC
(95:5 v/v CHC13/Me0H). The reaction mixture was filtered through a very wide porosity 3 sinter funnel and the pad rinsed slowly and thoroughly with 90:10 v/v CHC13/Me0H until no further product eluted (checked by TLC). The filtrate was washed with brine (100 mL), dried (Mg504), filtered and evaporated in vacuo, followed by high vacuum drying, to provide the crude product. Purification by flash chromatography (Ethyl acetate) gave the desired product (100 mg, 23%). In order to obtain an NMR sample, material (10 mg) was treated with HPLC grade CHCI3 (50 mL) and allowed to stand overnight to promote the formation of the imine form. The solvent was removed by evaporation under reduced pressure, and the residue was again treated with HPLC grade CHCI3 (50 mL) and allowed to stand for 4 hours.
LC/MS (3.03 min (ES+) m/z (relative intensity) 456.88 ([M + H2O], 100)); 1H
NMR (500 MHz, CDCI3) 6 7.96 (d, J = 4.0 Hz, 1H), 7.74 - 7.68 (m, 3H), 7.63 - 7.57 (m, 3H), 7.19 -7.09 (m, 2H), 6.87 (s, 1H), 4.87 (dd, J = 4.6, 2.4 Hz, 2H), 4.49 (ddd, J =
11.6, 5.1, 4.1 Hz, 1H), 3.99 - 3.91 (m, 6H), 3.72 (ddd, J= 16.1, 11.5, 2.0 Hz, 1H), 3.53 (ddd, J=
16.2, 5.1, 1.7 Hz, 1H), 2.56 (t, J = 2.4 Hz, 1H).
(c) (S)-3-(2,5-dioxo-2,5-dihydro-1H-pyrrol-1-y1)-N-(2-(2-(2-(2-(4-(((8-methoxy-2-(6-methoxyn ap hthale n-2-y1)-5-oxo-5, 11 a-dihyd ro-1 H-benzo[e]pyrrolo[1 , 2-4[1 ,4]diazepin-7-yl)oxy)methyl)-1H-1,2,3-triazol-1-y1)ethoxy)ethoxy)ethoxy)ethyl)propanamide (16) Amino-(Peg)3-azide 4 (34.2pL, 37.6 mg, 0.17 mmol, 0.9 eq) was added to a solution of maleimide succinimide 3 (56.1mg, 0.21 mmol, 1.1 eq) in DMSO (0.5 mL) at 25 C
and reacted for 45 minutes. This solution was added to a mixture of propargyl-PBD
15 (84 mg, 0.19 mmol, 1 eq), sodium ascorbate (7.6 mg, 0.038 mmol, 0.2 eq), and copper sulphate (2.4 mg, 0.010 mmol, 0.05 eq) in tert-butanol/water 1/1 v/v (1 mL). DMSO (2.5 mL) to improve solubility. The reaction was degazed and allowed to proceed under argon. After 5 hours, the LC/MS profile of the reaction showed significant formation of product. The reaction mixture was partitioned between chloroform and water. The organics were washed with water, followed by brine and dried over magnesium sulphate. The volatiles were removed by rotoevaporation under vacuum. The residue was purified by flash column chromatography (gradient methanol/chloroform 1/99 to 5/95) to give the desired product.
Yield: 64 mg (41%).
LC/MS (2.85 min (ES+) m/z (relative intensity) 808.61 ([M + , 100)); 1H NMR
(500 MHz, CDCI3) 6 7.96 (d, J = 4.0 Hz, 1H), 7.94 (s, 1H), 7.74 - 7.68 (m, 3H), 7.64 -7.56 (m, 3H), 7.19 - 7.10 (m, 2H), 6.86 (s, 1H), 6.65 (s, 2H), 6.44(s, 1H), 5.33 (q, J= 11.9 Hz, 2H), 4.60 -4.54 (m, 2H), 4.50 (dt, J = 9.1, 5.0 Hz, 1H), 3.95 - 3.88 (m, 8H), 3.82 (t, J
= 7.3 Hz, 2H), 3.77 - 3.65 (m, 2H), 3.65 - 3.58 (m, 5H), 3.58 - 3.51 (m, 3H), 3.52 - 3.47 (m, 2H), 3.39 (dd, J =
10.6, 5.3 Hz, 2H), 2.49 (td, J = 7.0, 0.8 Hz, 2H).
Example 5 General antibody conjugation procedure Antibodies are diluted to 1-5 mg/mL in a reduction buffer (examples: phosphate buffered saline PBS, histidine buffer, sodium borate buffer,TRIS buffer). A freshly prepared solution of TCEP (tris(2-carboxyethyl)phosphine hydrochloride) is added to selectively reduce cysteine disulfide bridges. The amount of TCEP is proportional to the target level of reduction, within 1 to 4 molar equivalents per antibody, generating 2 to 8 reactive thiols.
After reduction for several hours at 37 C, the mixture is cooled down to room temperature and excess drug-linker (5, 10, 13, 16) added as a diluted DMSO solution (final DMSO content of up to 10%
volume/volume of reaction mixture). The mixture was gently shaken at either 4 C or room temperature for the appropriate time, generally 1-3 hours. Excess reactive thiols can be reacted with a `thiol capping reagent' like N-ethyl maleimide (NEM) at the end of the conjugation. Antibody-drug conjugates are concentrated using centrifugal spin-filters with a molecular weight cut-off of 10 kDa or higher, then purified by tangential flow filtration (TFF) or Fast Protein Liquid Chromatography (FPLC). Corresponding antibody-drug conjugates can be determined by analysis by High-Performance Liquid Chromatography (HPLC) or Ultra-High-Performance Liquid Chromatography (UHPLC) to assess drug-per-antibody ratio (DAR) using reverse-phase chromatography (RP) or Hydrophobic-Interaction Chromatography (HIC), coupled with UV-Visible, Fluorescence or Mass-Spectrometer detection; aggregate level and monomer purity can be analysed by HPLC or UHPLC
using size-exclusion chromatography coupled with UV-Visible, Fluorescence or Mass-Spectrometer detection. Final conjugate concentration is determined by a combination of spectroscopic (absorbance at 280, 214 and 330 nm) and biochemical assay (bicinchonic acid assay BCA; Smith, P.K., et al. (1985) Anal. Biochem. 150 (1): 76-85;
using a known-concentration IgG antibody as reference). Antibody-drug conjugates are generally sterile filtered using 0.2 urn filters under aseptic conditions, and stored at +4 C, -20 C or -80 C.
Examples of particular conjugations are described below.
Conjugate Al (Herceptin-10, ConjA) HerceptinTM (2.0 mg, 13.3 nanomoles) was diluted into 1.8 mL of a reduction buffer containing 10 mM sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 10 mM solution of TCEP was added (2 molar equivalent/antibody, 26.6 nanomoles, 2.66 4) and the reduction mixture was heated at +37 C for 2.5 hours in a heating block. After cooling down to room temperature, compound 10 was added as a DMSO solution (3.5 molar equivalent/antibody, 45 nanomoles, in 0.2 mL DMSO).
The solution was mixed for 2 hour at room temperature, then the conjugation was quenched by addition of N-ethyl maleimide (1 micromole, 104 at 100 mM) followed 15 minutes later by N-acetyl cystein ( 1.5 micromoles, 154 at 100 mM), then injected into a AKTATmFPLC using a GE Healthcare XK16/70 column packed with Superdex 200 PG, eluting with 1.5 mL/min of sterile-filtered Phosphate-buffered saline (PBS). Fractions corresponding to ConjA1 monomer peak were pooled, concentrated using a 15mL Amicon Ultracell 50KDa MWCO
spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjA at 1.49 mg/mL in 1.2 mL, obtained mass of ConjA1 is 1.79 mg (90% yield).
UHPLC analysis on a Shimadzu Prominence system using a Phenomenex Aeris 3.6u XB-C18 150 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjA1 at 280 nm and 330 nm (Compound 10 specific) shows a mixture of light and heavy chains attached to several molecules of compound 10, consistent with a drug-per-antibody ratio (DAR) of 2.7 molecules of compound 10 per antibody.
UHPLC analysis on a Shimadzu Prominence system using a Waters Acquity UPLC
SEC 1.7 um 4.6 x 150 mm column eluting with sterile-filtered Phosphate-buffered saline (PBS) containing 5% isopropanol ( v/v) on a sample of ConjA at 280 nm shows a monomer purity of over 99% with no impurity detected.
Conjugate A2 (Herceptin-10, ConjA2) HerceptinTM (2.0 mg, 13.3 nanomoles) was diluted into 1.8 mL of a reduction buffer containing 10 mM sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 10 mM solution of TCEP was added (2 molar equivalent/antibody, 26.6 nanomoles, 2.66 L) and the reduction mixture was heated at +37 C for 2.5 hours in a heating block. After cooling down to room temperature, compound 10 was added as a DMSO solution (3.5 molar equivalent/antibody, 45 nanomoles, in 0.2 mL DMSO).
The solution was mixed for 2 hours at room temperature, then the conjugation was quenched by addition of N-ethyl maleimide (1 micromole, 10 I_ at 100 mM) followed 15 minutes later by N-acetyl cysteine (1.5 micromoles, 15 I_ at 100 mM), then injected into an AKTATm FPLC
using a GE Healthcare XK16/70 column packed with SuperdexTM 200 PG, eluting with 1.5 mL/min of sterile-filtered phosphate-buffered saline (PBS). Fractions corresponding to ConjA2 monomer peak were pooled, concentrated using a 15mL Amicon Ultracell 50KDa MWCO spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjA2 at 1.49 mg/mL in 1.2 mL, obtained mass of ConjA2 is 1.79 mg (90%
yield).
UHPLC analysis on a Shimadzu Prominence system using a Phenomenex Aeris 3.6u XB-C18 150 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjA2 at 280 nm and 330 nm (compound 10 specific) shows a mixture of light and heavy chains attached to several molecules of compound 10, consistent with a drug-per-antibody ratio (DAR) of 2.7 molecules of compound 10 per antibody.
UHPLC analysis on a Shimadzu Prominence system using a Waters Acquity UPLC
SEC 1.7 um 4.6 x 150 mm column eluting with sterile-filtered phosphate-buffered saline (PBS) containing 5% isopropanol (v/v) on a sample of ConjA2 at 280 nm shows a monomer purity of over 99% with no impurity detected.
Conjugate B (Herceptin-5, ConjB) HerceptinTM (2.0 mg, 13.3 nanomoles) was diluted into 1.8 mL of a reduction buffer containing 10 mM sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 10 mM solution of TCEP was added (2 molar equivalent/antibody, 26.6 nanomoles, 2.66 L) and the reduction mixture was heated at +37 C for 2.0 hours in a heating block. After cooling down to room temperature, compound 5 was added as a DMSO
solution (10 molar equivalent/antibody, 133 nanomoles, in 0.2 mL DMSO). The solution was mixed for 1 hours at room temperature, then the conjugation was injected into an AKTATm FPLC using a GE Healthcare XK16/70 column packed with Superdex 200 PG, eluting with 1.5 mL/min of sterile-filtered phosphate-buffered saline (PBS). Fractions corresponding to ConjB monomer peak were pooled, concentrated using a 15mL Amicon Ultracell 50KDa MWCO spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjB at 3.13 mg/mL in 0.65 mL, obtained mass of ConjB is 1.61 mg (80% yield).
UHPLC analysis on a Shimadzu Prominence system using a Phenomenex Aeris 3.6u XB-C18 150 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjB at 280 nm and 330 nm (compound 5 specific) shows a mixture of light and heavy chains attached to several molecules of compound 5, consistent with a drug-per-antibody ratio (DAR) of 4 molecules of compound 5 per antibody.
UHPLC analysis on a Shimadzu Prominence system using a Waters Acquity UPLC
SEC 1.7 um 4.6 x 150 mm column eluting with sterile-filtered Phosphate-buffered saline (PBS) containing 5% isopropanol (v/v) on a sample of ConjB at 280 nm shows a monomer purity of over 98.6%.
Conjugate C (Herceptin-13, ConjC) HerceptinTm(1.0 mg, 6.7 nanomoles) was diluted into 0.9 mL of a reduction buffer containing 10 mM sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 1 mM solution of TCEP was added (3 molar equivalent/antibody, 20 nanomoles, 20 L) and the reduction mixture was heated at +37 C for 1.5 hours in a heating block. After cooling down to room temperature, compound 13 was added as a DMSO solution (10 molar equivalent/antibody, 67 nanomoles, in 0.1 mL DMSO). The solution was mixed for 1 hour at room temperature, the conjugation mixture was analysed by HPLC and then injected into an AKTATm FPLC using a GE Healthcare XK16/70 column packed with SuperdexTM 200 PG, eluting with 1.5 mL/min of sterile-filtered phosphate-buffered saline (PBS).
Fractions corresponding to ConjC monomer peak were pooled, concentrated using a 15mL
Amicon Ultracell 50KDa MWCO spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjC at 0.70 mg/mL in 1.0 mL, obtained mass of ConjC
is 0.70 mg (70% yield).
UHPLC analysis on a Shimadzu Prominence system using an Agilent Technologies PLRP-S
1000A 5 pm 50 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjC at 280 nm and 330 nm (compound 13 specific) shows a mixture of light and heavy chains attached to several molecules of compound 13, consistent with a drug-per-antibody ratio (DAR) of >2.7 molecules of compound 13 per antibody.
Conjugate D (Herceptin-16, ConjD) HerceptinTM was diluted into 0.9 mL of a reduction buffer containing 10 mM
sodium borate pH 8.4, 2.5 mM EDTA and a final antibody concentration of 1.11 mg/mL. A 1 mM
solution of TCEP was added (3 molar equivalent/antibody, 20 nanomoles, 20 L) and the reduction mixture was heated at +37 C for 1.5 hours in a heating block. After cooling down to room temperature, compound 16 was added as a DMSO solution (10 molar equivalent/antibody, 67 nanomoles, in 0.1 mL DMSO). The solution was mixed for 1 hour at room temperature, the conjugation mixture was analysed by HPLC and then injected into an AKTATm FPLC
using a GE Healthcare XK16/70 column packed with SuperdexTM 200 PG, eluting with 1.5 mL/min of sterile-filtered phosphate-buffered saline (PBS). Fractions corresponding to ConjD
monomer peak were pooled, concentrated using a 15mL Amicon Ultracell 50KDa MWCO
spin filter, analysed and sterile-filtered. BCA assay gives a concentration of final ConjD at 0.55 mg/mL in 1.0 mL, obtained mass of ConjD is 0.55 mg (55% yield).
UHPLC analysis on a Shimadzu Prominence system using an Agilent Technologies PLRP-S
1000A 5 pm 50 x 2.1 mm column eluting with a gradient of water and acetonitrile on a reduced sample of ConjD at 280 nm and 330 nm (compound 16 specific) shows a mixture of light and heavy chains attached to several molecules of compound 16, consistent with a drug-per-antibody ratio (DAR) of 3.56 molecules of compound 16 per antibody.
Example 6: In vivo ADC efficacy studies CB.17 SCID mice, aged 8-12 weeks, may be injected with 1 mm3 tumour fragments sub cutaneously in the flank. When tumours reach an average size of 100 - 150 mg, treatment may be begun. Mice may be weighed twice a week. Tumour size may be measured twice a week. Animals may be monitored individually. The endpoint of the experiment is a tumour volume of 1000 mm3 or 60 days, whichever comes first. Responders can be followed longer.
Groups of 10 xenografted mice can be injected i.v. with 0.2m1 of antibody drug conjugate (ADC), or naked antibody, in phosphate buffered saline (vehicle) or with 0.2m1 of vehicle alone. The concentration of ADC can be adjusted to give, for example, 0.3 or 1.0 mg ADC/
kg body weight in a single dose. Three identical doses may be given to each mouse at intervals of, for example, 1 week.
Example 7: In vitro ADC efficacy studies Medium from subconfluent (about 80-90% confluency) SK-BR-3 cells in a T75 flask was aspirated and PBS (about 20m1) was added to rinse away the culture medium. The PBS was aspirated and Trypsin-EDTA (5m1) added. The flask was returned to the 37 C
gassed incubator for up to about 5 minutes. The flask was rapped sharply to dislodge and dissociate cells from the plastic. The cell suspension was transferred to a sterile 50m1 screw-top centrifuge tube. Medium (McCoy's + 10% FCS) was added to a final volume of 15m1, then the tube was centrifuged (400g for 5 min). The supernatant was aspirated and the pellet re-suspended in 10m1 culture medium. Repeated aspiration (up and down a 10m1 pipette) may be necessary to break up cell clumps and produce monodisperse cell suspensions suitable for counting. Cell suspension (10p1) was mixed with Trypan blue (10p1) and live/dead cells counted with a haemocytometer to determine cell concentration and viability. The cell suspension was diluted to 20x104/m1 and 50plwas dispensed into clear 96 well flat bottomed plates. The cells were incubated overnight to allow recovery before use.
A stock solution (1m1) of antibody drug conjugate (ADC) (20pg/m1) was made by dilution of filter-sterilised ADC into cell culture medium. A set of 8x 10-fold dilutions of stock ADC was made in a 24 well plate by serial transfer of 100p1 onto 900p1 of cell culture medium.
50p1 of each ADC dilution is dispensed into 4 replicate wells of the 96 well plate, containing 50p1 cell suspension seeded the previous day. Control wells receive 50p1 cell culture medium. The 96-well plate containing cells and ADCs was incubated at 37 C in a CO2-gassed incubator for 4 days. At the end of the incubation period, viable cells were measured by MTS assay. MTS (Promega) was dispensed (20p1 per well) into each well and incubated for 4 hours at 37 C in the CO2-gassed incubator. Well absorbance was measured at 490nm. Percentage cell survival is calculated from the mean absorbance in the 4 ADC-treated wells compared to the mean absorbance in the 4 control wells (100%).
ADC EC50 (pg/ml) ConjA 0.06187 Abbreviations Ac acetyl Acm acetamidomethyl Alloc allyloxycarbonyl Boc di-tert-butyl dicarbonate t-Bu tert-butyl Bz1 benzyl, where Bz1-0Me is methoxybenzyl and Bzl-Me is methylbenzene Cbz or Z benzyloxy-carbonyl, where Z-C1 and Z-Br are chloro- and bromobenzyloxy carbonyl respectively DMF N,N-dimethylformamide Dnp dinitrophenyl DTT dithiothreitol Fmoc 9H-fluoren-9-ylmethoxycarbonyl imp N-10 imine protecting group: 3-(2-methoxyethoxy)propanoate-Val-Ala-PAB
MC-0Su maleimidocaproyl-O-N-succinimide Moc methoxycarbonyl MP maleimidopropanamide Mtr 4-methoxy-2,3,6-trimethtylbenzenesulfonyl PAB para-aminobenzyloxycarbonyl PEG ethyleneoxy PNZ p-nitrobenzyl carbamate Psec 2-(phenylsulfonyl)ethoxycarbonyl TBDMS tert-butyldimethylsilyl TBDPS tert-butyldiphenylsilyl Teoc 2-(trimethylsilyl)ethoxycarbonyl Tos tosyl Troc 2,2,2-trichlorethoxycarbonyl chloride Trt trityl Xan xanthyl References The following references are incorporated by reference in their entirety:
62 WO 2002/61087;
63 Am. J. Hum. Genet. 49 (3):555-565 (1991) Amiel J., et al Hum. Mol. Genet. 5, 355-357, 1996 Amir et al (2003) Angew. Chem. Int. Ed. 42:4494-4499 Amsberry, et al (1990) J. Org. Chem. 55:5867 Angew Chem. Intl. Ed. Engl. (1994) 33:183-186 Annu. Rev. Neurosci. 21:309-345 (1998) Arai H., et al J. Biol. Chem. 268, 3463-3470, 1993 Arai H., et al Jpn. Circ. J. 56, 1303-1307, 1992 Arima, et al., J. Antibiotics, 25, 437-444 (1972) Attie T., et al, Hum. Mol. Genet. 4, 2407-2409, 1995 Auricchio A., et al Hum. Mol. Genet. 5:351-354, 1996 Barel M., et al Mol. lmmunol. 35, 1025-1031, 1998 Barella et al (1995) Biochem. J. 309:773-779 Barnett T., et al Genomics 3, 59-66, 1988 Beck et al (1992) J. Mol. Biol. 228:433-441 Beck et al (1996) J. Mol. Biol. 255:1-13 Berge, et al., J. Pharm. Sci., 66, 1-19 (1977) Biochem. Biophys. Res. Commun. (2000) 275(3):783-788 Biochem. Biophys. Res. Commun. 255 (2), 283-288 (1999) Blood (2002) 100 (9):3068-3076 Blood 99 (8):2662-2669 (2002) Blumberg H., et al Cell 104, 9-19, 2001 Bose, et al., Tetrahedron, 48, 751-758 (1992) Bourgeois C., et al J. Clin. Endocrinol. Metab. 82, 3116-3123, 1997 Brinster et al (1988) Proc. Natl. Acad. Sci. USA 85:836 Buchman and Berg (1988) Mol. Cell. Biol. 8:4395 Cancer Res. 61 (15), 5857-5860 (2001) Carl et al (1981) J. Med. Chem. 24:479-480 Carlsson et al (1978) Biochem. J. 173:723-737 Carter, P. (2006) Nature Reviews Immunology 6:343-357 Cell 109 (3):397-407 (2002) CellTiter Glo Luminescent Cell Viability Assay, Promega Corp. Technical Bulletin Chakravarty et al (1983) J. Med. Chem. 26:638-644 Chan,J. and Watt, V.M., Oncogene 6 (6), 1057-1061 (1991) Child et al (1999) J. Biol. Chem. 274: 24335-24341 Cho H.-S., et al Nature 421, 756-760, 2003 Ciccodicola, A., et al EMBO J. 8(7):1987-1991 (1989) Clackson et al (1991) Nature, 352:624-628 Clark H.F., et al Genome Res. 13, 2265-2270, 2003 Corey E, Quinn JE, Buhler KR, et al. LuCap35: a new model of prostate cancer progression to androgen independence. The Prostate 2003;55:239-46 Coussens L., et al Science (1985) 230(4730):1132-1139 Cree et al (1995) AntiCancer Drugs 6:398-404 Crouch et al (1993) J. lmmunol. Meth. 160:81-88 Davis et al (2001) Proc. Natl. Acad. Sci USA 98(17):9772-9777 de Groot et al (2001) J. Org. Chem. 66:8815-8830 de Groot et al (2003) Angew. Chem. Int. Ed. 42:4490-4494 Dennis et al. (2002) "Albumin Binding As A General Strategy For Improving The Pharmacokinetics Of Proteins" J Biol Chem. 277:35035-35043 Dobner et al (1992) Eur. J. lmmunol. 22:2795-2799 Dornan et al (2009) Blood 114(13):2721-2729 Doronina et al (2006) Bioconj. Chem. 17:114-124 Dubowchik et al. Bioconjugate Chemistry, 2002, 13,855-869 Dubowchik, et al. (1997) Tetrahedron Letters, 38:5257-60 Dumoutier L., et al J. lmmunol. 167, 3545-3549, 2001 E. Schroder and K. Lubke, The Peptides, volume 1, pp 76-136 (1965) Academic Press Ehsani A., et al (1993) Genomics 15, 426-429 Eliel, E. and Wilen, S., "Stereochemistry of Organic Compounds", John Wiley &
Sons, Inc., New York, 1994 Elshourbagy N.A., et al J. Biol. Chem. 268, 3873-3879, 1993 Erickson et al (2006) Cancer Res. 66(8):1-8 Feild, J.A., et al (1999) Biochem. Biophys. Res. Commun. 258 (3):578-582 Fields, G. and Noble, R. (1990) "Solid phase peptide synthesis utilizing 9-fluoroenylmethoxycarbonyl amino acids", Int. J. Peptide Protein Res. 35:161-Fuchs S., et al Mol. Med. 7, 115-124, 2001 Fujisaku et al (1989) J. Biol. Chem. 264 (4):2118-2125) Gary S.C., et al Gene 256, 139-147, 2000 Gaugitsch, H.W., et al (1992) J. Biol. Chem. 267 (16):11267-11273) Geiser et al "Automation of solid-phase peptide synthesis" in Macromolecular Sequencing and Synthesis, Alan R. Liss, Inc., 1988, pp. 199-218 Genome Res. 13 (10):2265-2270 (2003) Genomics 62 (2):281-284 (1999) Geoghegan & Stroh, (1992) Bioconjugate Chem. 3:138-146 Getz et al (1999) Anal. Biochem. Vol 273:73-80 Glynne-Jones et al (2001) Int J Cancer. Oct 15; 94(2):178-84 Gregson et al., Chem. Commun. 1999, 797-798 Gregson et al., J. Med. Chem. 2001, 44, 1161-1174 Gu Z., et al Oncogene 19, 1288-1296, 2000 Ha et al (1992) J. lmmunol. 148(5):1526-1531 Haendler B., et al J. Cardiovasc. Pharmacol. 20, s1-S4, 1992 Hamann P. (2005) Expert Opin. Ther. Patents 15(9):1087-1103 Hamblett et al (2004) Clin. Cancer Res. 10:7063-7070 Handbook of Pharmaceutical Additives, 2nd Edition (eds. M. Ash and I. Ash), (Synapse Information Resources, Inc., Endicott, New York, USA) Handbook of Pharmaceutical Excipients, 2nd edition, 1994 Hara, et al., J. Antibiotics, 41, 702-704 (1988) Hashimoto et al (1994) lmmunogenetics 40(4):287-295 Hay et al. (1999) Bioorg. Med. Chem. Lett. 9:2237 Herdwijn, P. et al., Canadian Journal of Chemistry. 1982, 60, 2903-7 Hermanson, G.T. (1996) Bioconjugate Techniques; Academic Press: New York, p Hochlowski, et al., J. Antibiotics, 40, 145-148 (1987) Hofstra R.M.W., et al Eur. J. Hum. Genet. 5, 180-185, 1997 Hofstra R.M.W., et al Nat. Genet. 12, 445-447, 1996 Horie et al (2000) Genomics 67:146-152 Hubert, R.S., et al (1999) Proc. Natl. Acad. Sci. U.S.A. 96 (25):14523-14528) Hurley and Needham-VanDevanter, Acc. Chem. Res., 19, 230-237 (1986) lmmunogenetics 54 (2):87-95 (2002) Int. Rev. Cytol. 196:177-244 (2000) ltoh, et al., J. Antibiotics, 41, 1281-1284 (1988) J. Biol. Chem. 270 (37):21984-21990 (1995) J. Biol. Chem. 276 (29):27371-27375 (2001) J. Biol. Chem. 277 (22):19665-19672 (2002) J. Biol. Chem. 278 (33):30813-30820 (2003) Janeway, C., Travers, P., Walport, M., Shlomchik (2001) lmmuno Biology, 5th Ed., Garland Publishing, New York Jeffrey et al (2005) J. Med. Chem. 48:1344-1358 Jonsson et al (1989) lmmunogenetics 29(6):411-413 Junutula, et al., 2008b Nature Biotech., 26(8):925-932 Kang, G-D., et al., Chem. Commun., 2003, 1680-1689 Kasahara et al (1989) lmmunogenetics 30(1):66-68 King et al (2002) Tetrahedron Letters 43:1987-1990 Kingsbury et al (1984) J. Med. Chem. 27:1447 Kohler et al (1975) Nature 256:495 Kohn, in Antibiotics III. Springer-Verlag, New York, pp. 3-11 (1975).
Konishi, et al., J. Antibiotics, 37, 200-206 (1984) Kovtun et al (2006) Cancer Res. 66(6):3214-3121 Kuhns J.J., et al J. Biol. Chem. 274, 36422-36427, 1999 Kuminoto, et al., J. Antibiotics, 33, 665-667 (1980) Kurebayashi et al (1999) Brit. Jour. Cancer 79(5-6):707-717 Lab. Invest. 82 (11):1573-1582 (2002) Lambert J. (2005) Current Opin. in Pharmacol. 5:543-549 Langley and Thurston, J. Org. Chem., 52, 91-97 (1987) Larhammar et al (1985) J. Biol. Chem. 260(26):14111-14119 Law et al (2006) Cancer Res. 66(4):2328-2337 Le et al (1997) FEBS Lett. 418(1-2):195-199 Leber, et al., J. Am. Chem. Soc., 110, 2992-2993 (1988) Leimgruber, et al., J. Am. Chem. Soc., 87, 5791-5793 (1965) Leimgruber, et al., J. Am. Chem. Soc., 87, 5793-5795 (1965) Levenson et al (1997) Cancer Res. 57(15):3071-3078 Liang et al (2000) Cancer Res. 60:4907-12 Manfre, F. et al., J. Org. Chem. 1992, 57, 2060-2065 Marks et al (1991) J. Mol. Biol., 222:581-597 McDonagh (2006) Protein Eng. Design & Sel., 19(7): 299-307 Mendoza et al (2002) Cancer Res. 62:5485-5488 Miller et al (2003) Jour. of Immunology 170:4854-4861 Miura et al (1996) Genomics 38(3):299-304 Miura et al (1998) Blood 92:2815-2822 Moore M., et al Proc. Natl. Acad. Sci. U.S.A. 84, 9194-9198, 1987 Morrison et al (1984) Proc. Natl. Acad. Sci. USA, 81:6851-6855 Muller et al (1992) Eur. J. lmmunol. 22 (6):1621-1625 Mungall A.J., et al Nature 425, 805-811, 2003 Nagase T., et al (2000) DNA Res. 7 (2):143-150) Nakamuta M., et al Biochem. Biophys. Res. Commun. 177, 34-39, 1991 Nakayama et al (2000) Biochem. Biophys. Res. Commun. 277(1):124-127 Naruse et al (2002) Tissue Antigens 59:512-519 Nature 395 (6699):288-291 (1998) Neuberger and Williams (1988) Nucleic Acids Res. 16:6713 Novabiochem Catalog 2006/2007 Ogawa Y., et al Biochem. Biophys. Res. Commun. 178, 248-255, 1991 Okamoto Y., et al Biol. Chem. 272, 21589-21596, 1997 Oncogene 10 (5):897-905 (1995) Oncogene 14(11):1377-1382 (1997)) Parrish-Novak J., et al J. Biol. Chem. 277, 47517-47523, 2002 Payne, G. (2003) Cancer Cell 3:207-212 Phillips et al (2008) Cancer Res. 68(22):9280-9290 Pingault V., et al (2002) Hum. Genet. 111, 198-206 Pletnev S., et al (2003) Biochemistry 42:12617-12624 Preud'homme et al (1992) Clin. Exp. lmmunol. 90(1):141-146 Proc. Natl. Acad. Sci. U.S.A. (2003) 100 (7):4126-4131 Proc. Natl. Acad. Sci. U.S.A. 93 (1):136-140 (1996) Proc. Natl. Acad. Sci. U.S.A. 98 (17):9772-9777 (2001) Proc. Natl. Acad. Sci. U.S.A. 99 (26):16899-16903 (2002) Proc.Natl. Acad. Sci. U.S.A. 96 (20):11531-11536 (1999) Protective Groups in Organic Synthesis, Greene and Wuts, 3rd Edition, 1999, John Wiley & Sons Inc.
Puffenberger E.G., et al Cell 79, 1257-1266, 1994 Rao et al (1997) Breast Cancer Res. and Treatment 45:149-158 Reiter R.E., et al Proc. Natl. Acad. Sci. U.S.A. 95, 1735-1740, 1998 Remington's Pharmaceutical Sciences, 20th edition, pub. Lippincott, Williams &
Wilkins, 2000 Rodrigues et al (1995) Chemistry Biology 2:223 Ross et al (2002) Cancer Res. 62:2546-2553 S. P. Parker, Ed., McGraw-Hill Dictionary of Chemical Terms (1984) McGraw-Hill Book Company, New York Sakaguchi et al (1988) EMBO J. 7(11):3457-3464 Sakamoto A., Yanagisawa M., et al Biochem. Biophys. Res. Commun. 178, 656-663, Sanderson et al (2005) Clin. Cancer Res. 11:843-852 Semba K., et al Proc. Natl. Acad. Sci. U.S.A. 82, 6497-6501, 1985 Servenius et al (1987) J. Biol. Chem. 262:8759-8766 Shamis et al (2004) J. Am. Chem. Soc. 126:1726-1731 Sheikh F., et al (2004) J. lmmunol. 172, 2006-2010 Shimizu, et al, J. Antibiotics, 29, 2492-2503 (1982) Sinha S.K., et al (1993) J. lmmunol. 150, 5311-5320 Storm et al (1972) J. Amer. Chem. Soc. 94:5815 Strausberg et al (2002) Proc. Natl. Acad. Sci USA 99:16899-16903 Sun et al (2002) Bioorganic & Medicinal Chemistry Letters 12:2213-2215 Sun et al (2003) Bioorganic & Medicinal Chemistry 11:1761-1768 Svensson P.J., et al Hum. Genet. 103, 145-148, 1998 Swiercz J.M., et al J. Cell Biol. 165, 869-880, 2004 Syrigos and Epenetos (1999) Anticancer Research 19:605-614 Takeuchi, et al., J. Antibiotics, 29, 93-96 (1976) Tawaragi Y., et al Biochem. Biophys. Res. Commun. 150, 89-96, 1988 ten Dijke,P., et al Science 264 (5155):101-104 (1994) Thompson, J.S., et al Science 293 (5537), 2108-2111 (2001) WO 2004/058309 Thurston, et al., Chem. Brit., 26, 767-772 (1990) Thurston, et al., Chem. Rev. 1994, 433-465 (1994) Toki et al (2002) J. Org. Chem. 67:1866-1872 Tonnelle et al (1985) EMBO J. 4(11):2839-2847 Touchman et al (2000) Genome Res. 10:165-173 Trail et al (2003) Cancer lmmunol. lmmunother. 52:328-337 Tsunakawa, et al., J. Antibiotics, 41, 1366-1373 (1988) Tsutsumi M., et al Gene 228, 43-49, 1999 Uchida et al (1999) Biochem. Biophys. Res. Commun. 266:593-602 Verheij J.B., et al Am. J. Med. Genet. 108, 223-225, 2002 Von Hoegen et al (1990) J. lmmunol. 144(12):4870-4877 Webster et al (1994) Semin. Cancer Biol. 5:69-76 Weis J.J., et al J. Exp. Med. 167, 1047-1066, 1988 Weis J.J., et al Proc. Natl. Acad. Sci. U.S.A. 83, 5639-5643, 1986 Wilson et al (1991) J. Exp. Med. 173:137-146 Wu et al (2005) Nature Biotech. 23(9):1137-1145 Xie et al (2006) Expert. Opin. Biol. Ther. 6(3):281-291 Xu, M.J., et al (2001) Biochem. Biophys. Res. Commun. 280 (3):768-775 WO
Xu, X.Z., et al Proc. Natl. Acad. Sci. U.S.A. 98 (19):10692-10697 (2001) Yamaguchi, N., et al Biol. Chem. 269 (2), 805-808 (1994) Yamamoto T., et al Nature 319, 230-234, 1986 Yu et al (1992) J. lmmunol. 148(2) 633-637
Sons, Inc., New York, 1994 Elshourbagy N.A., et al J. Biol. Chem. 268, 3873-3879, 1993 Erickson et al (2006) Cancer Res. 66(8):1-8 Feild, J.A., et al (1999) Biochem. Biophys. Res. Commun. 258 (3):578-582 Fields, G. and Noble, R. (1990) "Solid phase peptide synthesis utilizing 9-fluoroenylmethoxycarbonyl amino acids", Int. J. Peptide Protein Res. 35:161-Fuchs S., et al Mol. Med. 7, 115-124, 2001 Fujisaku et al (1989) J. Biol. Chem. 264 (4):2118-2125) Gary S.C., et al Gene 256, 139-147, 2000 Gaugitsch, H.W., et al (1992) J. Biol. Chem. 267 (16):11267-11273) Geiser et al "Automation of solid-phase peptide synthesis" in Macromolecular Sequencing and Synthesis, Alan R. Liss, Inc., 1988, pp. 199-218 Genome Res. 13 (10):2265-2270 (2003) Genomics 62 (2):281-284 (1999) Geoghegan & Stroh, (1992) Bioconjugate Chem. 3:138-146 Getz et al (1999) Anal. Biochem. Vol 273:73-80 Glynne-Jones et al (2001) Int J Cancer. Oct 15; 94(2):178-84 Gregson et al., Chem. Commun. 1999, 797-798 Gregson et al., J. Med. Chem. 2001, 44, 1161-1174 Gu Z., et al Oncogene 19, 1288-1296, 2000 Ha et al (1992) J. lmmunol. 148(5):1526-1531 Haendler B., et al J. Cardiovasc. Pharmacol. 20, s1-S4, 1992 Hamann P. (2005) Expert Opin. Ther. Patents 15(9):1087-1103 Hamblett et al (2004) Clin. Cancer Res. 10:7063-7070 Handbook of Pharmaceutical Additives, 2nd Edition (eds. M. Ash and I. Ash), (Synapse Information Resources, Inc., Endicott, New York, USA) Handbook of Pharmaceutical Excipients, 2nd edition, 1994 Hara, et al., J. Antibiotics, 41, 702-704 (1988) Hashimoto et al (1994) lmmunogenetics 40(4):287-295 Hay et al. (1999) Bioorg. Med. Chem. Lett. 9:2237 Herdwijn, P. et al., Canadian Journal of Chemistry. 1982, 60, 2903-7 Hermanson, G.T. (1996) Bioconjugate Techniques; Academic Press: New York, p Hochlowski, et al., J. Antibiotics, 40, 145-148 (1987) Hofstra R.M.W., et al Eur. J. Hum. Genet. 5, 180-185, 1997 Hofstra R.M.W., et al Nat. Genet. 12, 445-447, 1996 Horie et al (2000) Genomics 67:146-152 Hubert, R.S., et al (1999) Proc. Natl. Acad. Sci. U.S.A. 96 (25):14523-14528) Hurley and Needham-VanDevanter, Acc. Chem. Res., 19, 230-237 (1986) lmmunogenetics 54 (2):87-95 (2002) Int. Rev. Cytol. 196:177-244 (2000) ltoh, et al., J. Antibiotics, 41, 1281-1284 (1988) J. Biol. Chem. 270 (37):21984-21990 (1995) J. Biol. Chem. 276 (29):27371-27375 (2001) J. Biol. Chem. 277 (22):19665-19672 (2002) J. Biol. Chem. 278 (33):30813-30820 (2003) Janeway, C., Travers, P., Walport, M., Shlomchik (2001) lmmuno Biology, 5th Ed., Garland Publishing, New York Jeffrey et al (2005) J. Med. Chem. 48:1344-1358 Jonsson et al (1989) lmmunogenetics 29(6):411-413 Junutula, et al., 2008b Nature Biotech., 26(8):925-932 Kang, G-D., et al., Chem. Commun., 2003, 1680-1689 Kasahara et al (1989) lmmunogenetics 30(1):66-68 King et al (2002) Tetrahedron Letters 43:1987-1990 Kingsbury et al (1984) J. Med. Chem. 27:1447 Kohler et al (1975) Nature 256:495 Kohn, in Antibiotics III. Springer-Verlag, New York, pp. 3-11 (1975).
Konishi, et al., J. Antibiotics, 37, 200-206 (1984) Kovtun et al (2006) Cancer Res. 66(6):3214-3121 Kuhns J.J., et al J. Biol. Chem. 274, 36422-36427, 1999 Kuminoto, et al., J. Antibiotics, 33, 665-667 (1980) Kurebayashi et al (1999) Brit. Jour. Cancer 79(5-6):707-717 Lab. Invest. 82 (11):1573-1582 (2002) Lambert J. (2005) Current Opin. in Pharmacol. 5:543-549 Langley and Thurston, J. Org. Chem., 52, 91-97 (1987) Larhammar et al (1985) J. Biol. Chem. 260(26):14111-14119 Law et al (2006) Cancer Res. 66(4):2328-2337 Le et al (1997) FEBS Lett. 418(1-2):195-199 Leber, et al., J. Am. Chem. Soc., 110, 2992-2993 (1988) Leimgruber, et al., J. Am. Chem. Soc., 87, 5791-5793 (1965) Leimgruber, et al., J. Am. Chem. Soc., 87, 5793-5795 (1965) Levenson et al (1997) Cancer Res. 57(15):3071-3078 Liang et al (2000) Cancer Res. 60:4907-12 Manfre, F. et al., J. Org. Chem. 1992, 57, 2060-2065 Marks et al (1991) J. Mol. Biol., 222:581-597 McDonagh (2006) Protein Eng. Design & Sel., 19(7): 299-307 Mendoza et al (2002) Cancer Res. 62:5485-5488 Miller et al (2003) Jour. of Immunology 170:4854-4861 Miura et al (1996) Genomics 38(3):299-304 Miura et al (1998) Blood 92:2815-2822 Moore M., et al Proc. Natl. Acad. Sci. U.S.A. 84, 9194-9198, 1987 Morrison et al (1984) Proc. Natl. Acad. Sci. USA, 81:6851-6855 Muller et al (1992) Eur. J. lmmunol. 22 (6):1621-1625 Mungall A.J., et al Nature 425, 805-811, 2003 Nagase T., et al (2000) DNA Res. 7 (2):143-150) Nakamuta M., et al Biochem. Biophys. Res. Commun. 177, 34-39, 1991 Nakayama et al (2000) Biochem. Biophys. Res. Commun. 277(1):124-127 Naruse et al (2002) Tissue Antigens 59:512-519 Nature 395 (6699):288-291 (1998) Neuberger and Williams (1988) Nucleic Acids Res. 16:6713 Novabiochem Catalog 2006/2007 Ogawa Y., et al Biochem. Biophys. Res. Commun. 178, 248-255, 1991 Okamoto Y., et al Biol. Chem. 272, 21589-21596, 1997 Oncogene 10 (5):897-905 (1995) Oncogene 14(11):1377-1382 (1997)) Parrish-Novak J., et al J. Biol. Chem. 277, 47517-47523, 2002 Payne, G. (2003) Cancer Cell 3:207-212 Phillips et al (2008) Cancer Res. 68(22):9280-9290 Pingault V., et al (2002) Hum. Genet. 111, 198-206 Pletnev S., et al (2003) Biochemistry 42:12617-12624 Preud'homme et al (1992) Clin. Exp. lmmunol. 90(1):141-146 Proc. Natl. Acad. Sci. U.S.A. (2003) 100 (7):4126-4131 Proc. Natl. Acad. Sci. U.S.A. 93 (1):136-140 (1996) Proc. Natl. Acad. Sci. U.S.A. 98 (17):9772-9777 (2001) Proc. Natl. Acad. Sci. U.S.A. 99 (26):16899-16903 (2002) Proc.Natl. Acad. Sci. U.S.A. 96 (20):11531-11536 (1999) Protective Groups in Organic Synthesis, Greene and Wuts, 3rd Edition, 1999, John Wiley & Sons Inc.
Puffenberger E.G., et al Cell 79, 1257-1266, 1994 Rao et al (1997) Breast Cancer Res. and Treatment 45:149-158 Reiter R.E., et al Proc. Natl. Acad. Sci. U.S.A. 95, 1735-1740, 1998 Remington's Pharmaceutical Sciences, 20th edition, pub. Lippincott, Williams &
Wilkins, 2000 Rodrigues et al (1995) Chemistry Biology 2:223 Ross et al (2002) Cancer Res. 62:2546-2553 S. P. Parker, Ed., McGraw-Hill Dictionary of Chemical Terms (1984) McGraw-Hill Book Company, New York Sakaguchi et al (1988) EMBO J. 7(11):3457-3464 Sakamoto A., Yanagisawa M., et al Biochem. Biophys. Res. Commun. 178, 656-663, Sanderson et al (2005) Clin. Cancer Res. 11:843-852 Semba K., et al Proc. Natl. Acad. Sci. U.S.A. 82, 6497-6501, 1985 Servenius et al (1987) J. Biol. Chem. 262:8759-8766 Shamis et al (2004) J. Am. Chem. Soc. 126:1726-1731 Sheikh F., et al (2004) J. lmmunol. 172, 2006-2010 Shimizu, et al, J. Antibiotics, 29, 2492-2503 (1982) Sinha S.K., et al (1993) J. lmmunol. 150, 5311-5320 Storm et al (1972) J. Amer. Chem. Soc. 94:5815 Strausberg et al (2002) Proc. Natl. Acad. Sci USA 99:16899-16903 Sun et al (2002) Bioorganic & Medicinal Chemistry Letters 12:2213-2215 Sun et al (2003) Bioorganic & Medicinal Chemistry 11:1761-1768 Svensson P.J., et al Hum. Genet. 103, 145-148, 1998 Swiercz J.M., et al J. Cell Biol. 165, 869-880, 2004 Syrigos and Epenetos (1999) Anticancer Research 19:605-614 Takeuchi, et al., J. Antibiotics, 29, 93-96 (1976) Tawaragi Y., et al Biochem. Biophys. Res. Commun. 150, 89-96, 1988 ten Dijke,P., et al Science 264 (5155):101-104 (1994) Thompson, J.S., et al Science 293 (5537), 2108-2111 (2001) WO 2004/058309 Thurston, et al., Chem. Brit., 26, 767-772 (1990) Thurston, et al., Chem. Rev. 1994, 433-465 (1994) Toki et al (2002) J. Org. Chem. 67:1866-1872 Tonnelle et al (1985) EMBO J. 4(11):2839-2847 Touchman et al (2000) Genome Res. 10:165-173 Trail et al (2003) Cancer lmmunol. lmmunother. 52:328-337 Tsunakawa, et al., J. Antibiotics, 41, 1366-1373 (1988) Tsutsumi M., et al Gene 228, 43-49, 1999 Uchida et al (1999) Biochem. Biophys. Res. Commun. 266:593-602 Verheij J.B., et al Am. J. Med. Genet. 108, 223-225, 2002 Von Hoegen et al (1990) J. lmmunol. 144(12):4870-4877 Webster et al (1994) Semin. Cancer Biol. 5:69-76 Weis J.J., et al J. Exp. Med. 167, 1047-1066, 1988 Weis J.J., et al Proc. Natl. Acad. Sci. U.S.A. 83, 5639-5643, 1986 Wilson et al (1991) J. Exp. Med. 173:137-146 Wu et al (2005) Nature Biotech. 23(9):1137-1145 Xie et al (2006) Expert. Opin. Biol. Ther. 6(3):281-291 Xu, M.J., et al (2001) Biochem. Biophys. Res. Commun. 280 (3):768-775 WO
Xu, X.Z., et al Proc. Natl. Acad. Sci. U.S.A. 98 (19):10692-10697 (2001) Yamaguchi, N., et al Biol. Chem. 269 (2), 805-808 (1994) Yamamoto T., et al Nature 319, 230-234, 1986 Yu et al (1992) J. lmmunol. 148(2) 633-637
Claims (73)
1. A conjugate of formula (A):
and salts and solvates thereof, wherein:
D represents either group D1 or D2:
the dotted line indicates the optional presence of a double bond between C2 and C3;
when there is a double bond present between C2 and C3, R2 is selected from the group consisting of:
(ia) C5-10 aryl group, optionally substituted by one or more substituents selected from the group comprising: halo, nitro, cyano, ether, carboxy, ester, C1-7 alkyl, C3-7 heterocyclyl and bis-oxy-C1-3 alkylene;
(ib) C1-5 saturated aliphatic alkyl;
(ic) C3-6 saturated cycloalkyl;
(id) wherein each of R31, R32 and R33 are independently selected from H, C1-3 saturated alkyl, C2-3 alkenyl, C2-3 alkynyl and cyclopropyl, where the total number of carbon atoms in the R2 group is no more than 5;
(ie) wherein one of R35a and R35b is H and the other is selected from:
phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl; and (if) where R34 is selected from: H; C1-3 saturated alkyl; C2-3 alkenyl; C2-3 alkynyl; cyclopropyl; phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl;
(ig) halo;
when there is a single bond present between C2 and C3, R2 is where R36a and R36b are independently selected from H, F, C1-4 saturated alkyl, C2-3 alkenyl, which alkyl and alkenyl groups are optionally substituted by a group selected from C1-4 alkyl amido and C1-4 alkyl ester; or, when one of R16a and R16b is H, the other is selected from nitrile and a C1-4 alkyl ester;
R6 and R9 are independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo;
either (a) R10 is H, and R11 is OH or OR A, where R A is C1-4 alkyl; or (b) R10 and R11 form a nitrogen-carbon double bond between the nitrogen and carbon atoms to which they are bound; or (c) R10 is H and R11 is OSO z M, where z is 2 or 3 and M is a monovalent pharmaceutically acceptable cation; or (d) R11 is OH or OR A, where R A is C1-4 alkyl and R10 is selected from:
(d-iii) where R Z is selected from:
(z-i) (z-ii) OC(=O)CH3;
(z-iii) NO2;
(z-iv) OMe;
(z-v) glucoronide;
(z-vi) -C(=O)-X1-NHC(=O)X2-NH-R ZC, where -C(=O)-X1-NH- and -C(=O)-X2-NH- represent natural amino acid residues and R ZC is selected from Me, OMe, OCH2CH2OMe;
Y is selected from formulae A1, A2 and A3:
Z1 is a C1-3 alkylene group;
Z2 is a C1-3 alkylene group;
Z3 is a C1-3 alkylene group;
L is a linker connected to a cell binding agent;
CBA is the cell binding agent;
n is an integer between 0 and 48;
R and R' are each independently selected from optionally substituted C1-12 alkyl, C3-20 heterocyclyl and C5-20 aryl groups, and optionally in relation to the group NRR', R and R' together with the nitrogen atom to which they are attached form an optionally substituted 4-, 5-, 6- or 7-membered heterocyclic ring;
R8 is either:
(a) independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo; or (b) of formula A*:
wherein:
D' represents either group D'1 or D2:
wherein the dotted line indicates the optional presence of a double bond between C2' and C3';
R17 is independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo;
R" is a C3-12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. O, S, N(H), NMe and/or aromatic rings, e.g. benzene or pyridine, which rings are optionally substituted; and X and X' are independently selected from O, S and N(H); and R22, R16, R19, R20 and R21 are as defined for R2, R6, R9, R10 and R11 respectively.
and salts and solvates thereof, wherein:
D represents either group D1 or D2:
the dotted line indicates the optional presence of a double bond between C2 and C3;
when there is a double bond present between C2 and C3, R2 is selected from the group consisting of:
(ia) C5-10 aryl group, optionally substituted by one or more substituents selected from the group comprising: halo, nitro, cyano, ether, carboxy, ester, C1-7 alkyl, C3-7 heterocyclyl and bis-oxy-C1-3 alkylene;
(ib) C1-5 saturated aliphatic alkyl;
(ic) C3-6 saturated cycloalkyl;
(id) wherein each of R31, R32 and R33 are independently selected from H, C1-3 saturated alkyl, C2-3 alkenyl, C2-3 alkynyl and cyclopropyl, where the total number of carbon atoms in the R2 group is no more than 5;
(ie) wherein one of R35a and R35b is H and the other is selected from:
phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl; and (if) where R34 is selected from: H; C1-3 saturated alkyl; C2-3 alkenyl; C2-3 alkynyl; cyclopropyl; phenyl, which phenyl is optionally substituted by a group selected from halo, methyl, methoxy; pyridyl; and thiophenyl;
(ig) halo;
when there is a single bond present between C2 and C3, R2 is where R36a and R36b are independently selected from H, F, C1-4 saturated alkyl, C2-3 alkenyl, which alkyl and alkenyl groups are optionally substituted by a group selected from C1-4 alkyl amido and C1-4 alkyl ester; or, when one of R16a and R16b is H, the other is selected from nitrile and a C1-4 alkyl ester;
R6 and R9 are independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo;
either (a) R10 is H, and R11 is OH or OR A, where R A is C1-4 alkyl; or (b) R10 and R11 form a nitrogen-carbon double bond between the nitrogen and carbon atoms to which they are bound; or (c) R10 is H and R11 is OSO z M, where z is 2 or 3 and M is a monovalent pharmaceutically acceptable cation; or (d) R11 is OH or OR A, where R A is C1-4 alkyl and R10 is selected from:
(d-iii) where R Z is selected from:
(z-i) (z-ii) OC(=O)CH3;
(z-iii) NO2;
(z-iv) OMe;
(z-v) glucoronide;
(z-vi) -C(=O)-X1-NHC(=O)X2-NH-R ZC, where -C(=O)-X1-NH- and -C(=O)-X2-NH- represent natural amino acid residues and R ZC is selected from Me, OMe, OCH2CH2OMe;
Y is selected from formulae A1, A2 and A3:
Z1 is a C1-3 alkylene group;
Z2 is a C1-3 alkylene group;
Z3 is a C1-3 alkylene group;
L is a linker connected to a cell binding agent;
CBA is the cell binding agent;
n is an integer between 0 and 48;
R and R' are each independently selected from optionally substituted C1-12 alkyl, C3-20 heterocyclyl and C5-20 aryl groups, and optionally in relation to the group NRR', R and R' together with the nitrogen atom to which they are attached form an optionally substituted 4-, 5-, 6- or 7-membered heterocyclic ring;
R8 is either:
(a) independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo; or (b) of formula A*:
wherein:
D' represents either group D'1 or D2:
wherein the dotted line indicates the optional presence of a double bond between C2' and C3';
R17 is independently selected from H, R, OH, OR, SH, SR, NH2, NHR, NRR', NO2, SnMe3 and halo;
R" is a C3-12 alkylene group, which chain may be interrupted by one or more heteroatoms, e.g. O, S, N(H), NMe and/or aromatic rings, e.g. benzene or pyridine, which rings are optionally substituted; and X and X' are independently selected from O, S and N(H); and R22, R16, R19, R20 and R21 are as defined for R2, R6, R9, R10 and R11 respectively.
2. The conjugate according to claim 1, wherein R9 is H.
3. The conjugate according to either claim 1 or claim 2, wherein R6 is H.
4. The conjugate according to any one of claims 1 to 3, wherein D is D2.
5. The conjugate according to any one of claims 1 to 3, wherein D is D1, there is a double bond between C2 and C3, and R2 is a C5-7 aryl group.
6. The conjugate according to claim 5, wherein R12 is phenyl.
7. The conjugate according to any one of claims 1 to 3, wherein D is D1, there is a double bond between C2 and C3, and R2 is a C8-10 aryl group.
8. The conjugate according to any one of claims 5 to 7, wherein R12 bears one to three substituent groups.
9. The conjugate according to any one of claims 5 to 8, wherein the substituents are selected from methoxy, ethoxy, fluoro, chloro, cyano, bis-oxy-methylene, methyl-piperazinyl, morpholino and methyl-thiophenyl.
10. The conjugate according to any one of claims 1 to 3, wherein D is D1, there is a double bond between C2 and C3, and R2 is a C1-5 saturated aliphatic alkyl group.
11. The conjugate according to claim 10, wherein R2 is methyl, ethyl or propyl.
12. The conjugate according to any one of claims 1 to 3, wherein D is D1, there is a double bond between C2 and C3, and R2 is a C3-6 saturated cycloalkyl group.
13. The conjugate according to claim 12, wherein R2 is cyclopropyl.
14. The conjugate according to any one of claims 1 to 3, wherein D is D1, there is a double bond between C2 and C3, and R2 is a group of formula:
15. The conjugate according to claim 14, wherein the total number of carbon atoms in the R2 group is no more than 4.
16. The conjugate according to claim 15, wherein the total number of carbon atoms in the R2 group is no more than 3.
17. The conjugate according to any one of claims 14 to 16, wherein one of R31, R32 and R33 is H, with the other two groups being selected from H, C1-3 saturated alkyl, C2-3 alkenyl, C2-3 alkynyl and cyclopropyl.
18. The conjugate according to any one of claims 14 to 16, wherein two of R31, R32 and R33 are H, with the other group being selected from H, C1-3 saturated alkyl, C2-3 alkenyl, C2-3 alkynyl and cyclopropyl.
19. The conjugate according to any one of claims 1 to 3, wherein D is D1, there is a double bond between C2 and C3, and R2 is a group of formula:
20. The conjugate according to claim 19, wherein R12 is the group:
21. The conjugate according to any one of claims 1 to 3, wherein D is D1, there is a double bond between C2 and C3, and R2 is a group of formula:
22. The conjugate according to claim 21, wherein R34 is selected from H, methyl, ethyl, ethenyl and ethynyl.
23. The conjugate according to claim 22, wherein R34 is selected from H and methyl.
24. The conjugate according to any one of claims 1 to 3, wherein D is D1, there is a double bond between C2 and C3, and R2 is .
25. The conjugate according to claim 24, wherein R36a and R36b are both H.
26. The conjugate according to claim 24, wherein R36a and R36b are both methyl.
27. The conjugate according to claim 24, wherein one of R36a and R36b is H, and the other is selected from C1-4 saturated alkyl, C2-3 alkenyl, which alkyl and alkenyl groups are optionally substituted.
28. The conjugate according to claim 24, wherein the group of R36a and R36b which is not H is selected from methyl and ethyl.
29. The conjugate according to any one of claims 1 to 28, wherein R10 is H, and R11 is OH.
30. The conjugate according to any one of claims 1 to 28, wherein R10 and R11 form a nitrogen-carbon double bond between the nitrogen and carbon atoms to which they are bound.
31. The conjugate according to any one of claims 1 to 28, wherein R11 is OH
or OR A and R10 is selected from:
or OR A and R10 is selected from:
32. The conjugate according to any one of claims 1 to 31, wherein -C(=O)-X1-NHC(=O)X2-NH-, is selected from: -Phe-Lys-, -Val-Ala-, -Val-Lys-, -Ala-Lys-, and -Val-Cit-.
33. The conjugate according to claim 32, wherein -C(=O)-X1-NHC(=O)X2-NH-, is selected from: -Phe-Lys-, and -Val-Ala-.
34. The conjugate according to any one of claims 31 to 33, wherein R11 is OMe.
35. The conjugate according to any one of claims 1 to 34, wherein R8 is OR8A, where R8A
is optionally substituted C1-4 alkyl.
is optionally substituted C1-4 alkyl.
36. The conjugate of claim 35, wherein R8A is Me.
37. The conjugate according to any one of claims 1 to 34, wherein R8 is of formula A*.
38. The conjugate according to claim 37, wherein X and X' are O.
39. The conjugate according to either claim 37 or claim 38, wherein R11 is C3-7 alkylene.
40. The conjugate according to claim 39, wherein R11 is C3 alkylene or C5 alkylene.
41. The conjugate according to any one of claims 37 to 40, wherein R17 is OR17A, where R17A is optionally substituted C1-4 alkyl.
42. The conjugate of claim 41, wherein R17A is Me.
43. The conjugate according to any one of claims 37 to 42, wherein R16, R19, R20, R21 and D' are the same as R6, R9, R10, R11 and D respectively.
44. The conjugate according to any one of claims 1 to 43, wherein the group L contains a moiety derived from an electrophilic functional group selected from (i) maleimide groups (ii) activated disulfides, (iii) active esters such as NHS (N-hydroxysuccinimide) esters, HOBt (N-hydroxybenzotriazole) esters, haloformates, and acid halides; (iv) alkyl and benzyl halides such as haloacetamides; and (v) aldehydes, ketones, carboxyl.
45. The conjugate according to any one of claims 1 to 43, wherein L is of formula:
-LA-(CH2)m-ehere m is from 0 to 6; and L A is selected from:
where Ar represents a C5-6 arylene group.
-LA-(CH2)m-ehere m is from 0 to 6; and L A is selected from:
where Ar represents a C5-6 arylene group.
46. The conjugate of claim 45, wherein L A is L A1-1.
47. The conjugate according to either claim 45 or claim 46, wherein m is 2, 3 or 5.
48. The conjugate according to any one of claims 1 to 47, wherein n is an integer between 0 and 16.
49. The conjugate according to any one of claims 1 to 48, wherein n is an integer between 0 and 8.
50. The conjugate according to any one of claims 1 to 49, wherein n is 3 or 4.
51. The conjugate according to any one of claims 1 to 50, wherein the cell binding agent is an antibody or an active fragment thereof.
52. The conjugate according to claim 51, wherein the antibody or antibody fragment is an antibody or antibody fragment for a tumour-associated antigen.
53. The conjugate of claim 52 wherein the antibody or antibody fragment is an antibody which binds to one or more tumor-associated antigens or cell-surface receptors selected from (1)-(88):
(1) BMPR1B;
(2) E16;
(3) STEAP1;
(4) 0772P;
(5) MPF;
(6) Napi3b;
(7) Sema 5b;
(8) PSCA hlg;
(9) ETBR;
(10) MSG783;
(11) STEAP2;
(12) TrpM4;
(13) CRIPTO;
(14) CD21;
(15) CD79b;
(16) FcRH2;
(17) HER2;
(18) NCA;
(19) MDP;
(20) IL20R-alpha;
(21) Brevican;
(22) EphB2R;
(23) ASLG659;
(24) PSCA;
(25) GEDA;
(26) BAFF-R;
(27) CD22;
(28) CD79a;
(29) CXCR5;
(30) HLA-DOB;
(31) P2X5;
(32) CD72;
(33) LY64;
(34) FcRH1;
(35) IRTA2;
(36) TENB2;
(37) PSMA - FOLH1;
(38) SST;
(38.1) SSTR2;
(38.2) SSTR5;
(38.3) SSTR1;
(38.4)SSTR3;
(38.5) SSTR4;
(39) ITGAV;
(40) ITGB6;
(41) CEACAM5;
(42) MET;
(43) MUC1;
(44) CA9;
(45) EGFRvIII;
(46) CD33;
(47) CD19;
(48) IL2RA;
(49) AXL;
(50) CD30 - TNFRSF8;
(51) BCMA - TNFRSF17;
(52) CT Ags - CTA;
(53) CD174 (Lewis Y) - FUT3;
(54) CLEC14A;
(55) GRP78 - HSPA5;
(56) CD70;
(57) Stem Cell specific antigens;
(58) ASG-5;
(59) ENPP3;
(60) PRR4;
(61) GCC - GUCY2C;
(62) Liv-1 - SLC39A6;
(63) 5T4;
(64) CD56 - NCMA1;
(65) CanAg;
(66) FOLR1;
(67) GPNMB;
(68) TIM-1 - HAVCR1;
(69) RG-1/Prostate tumor target Mindin - Mindin/RG-1;
(70) B7-H4 - VTCN1;
(71) PTK7;
(72) CD37;
(73) CD138 - SDC1;
(74) CD74;
(75) Claudins - CLs;
(76) EGFR;
(77) Her3;
(78) RON - MST1R;
(79) EPHA2;
(80) CD20 - MS4A1;
(81) Tenascin C - TNC;
(82) FAP;
(83) DKK-1;
(84) CD52;
(85) CS1 - SLAMF7;
(86) Endoglin - ENG;
(87) Annexin A1 - ANXA1;
(88) V-CAM (CD106) - VCAM1.
(1) BMPR1B;
(2) E16;
(3) STEAP1;
(4) 0772P;
(5) MPF;
(6) Napi3b;
(7) Sema 5b;
(8) PSCA hlg;
(9) ETBR;
(10) MSG783;
(11) STEAP2;
(12) TrpM4;
(13) CRIPTO;
(14) CD21;
(15) CD79b;
(16) FcRH2;
(17) HER2;
(18) NCA;
(19) MDP;
(20) IL20R-alpha;
(21) Brevican;
(22) EphB2R;
(23) ASLG659;
(24) PSCA;
(25) GEDA;
(26) BAFF-R;
(27) CD22;
(28) CD79a;
(29) CXCR5;
(30) HLA-DOB;
(31) P2X5;
(32) CD72;
(33) LY64;
(34) FcRH1;
(35) IRTA2;
(36) TENB2;
(37) PSMA - FOLH1;
(38) SST;
(38.1) SSTR2;
(38.2) SSTR5;
(38.3) SSTR1;
(38.4)SSTR3;
(38.5) SSTR4;
(39) ITGAV;
(40) ITGB6;
(41) CEACAM5;
(42) MET;
(43) MUC1;
(44) CA9;
(45) EGFRvIII;
(46) CD33;
(47) CD19;
(48) IL2RA;
(49) AXL;
(50) CD30 - TNFRSF8;
(51) BCMA - TNFRSF17;
(52) CT Ags - CTA;
(53) CD174 (Lewis Y) - FUT3;
(54) CLEC14A;
(55) GRP78 - HSPA5;
(56) CD70;
(57) Stem Cell specific antigens;
(58) ASG-5;
(59) ENPP3;
(60) PRR4;
(61) GCC - GUCY2C;
(62) Liv-1 - SLC39A6;
(63) 5T4;
(64) CD56 - NCMA1;
(65) CanAg;
(66) FOLR1;
(67) GPNMB;
(68) TIM-1 - HAVCR1;
(69) RG-1/Prostate tumor target Mindin - Mindin/RG-1;
(70) B7-H4 - VTCN1;
(71) PTK7;
(72) CD37;
(73) CD138 - SDC1;
(74) CD74;
(75) Claudins - CLs;
(76) EGFR;
(77) Her3;
(78) RON - MST1R;
(79) EPHA2;
(80) CD20 - MS4A1;
(81) Tenascin C - TNC;
(82) FAP;
(83) DKK-1;
(84) CD52;
(85) CS1 - SLAMF7;
(86) Endoglin - ENG;
(87) Annexin A1 - ANXA1;
(88) V-CAM (CD106) - VCAM1.
54. The conjugate of claim 51 wherein the antibody or antibody fragment is a cysteine-engineered antibody.
55. The conjugate according to any one of claims 51 to 54 wherein the drug loading (p) of drugs (D) to antibody (Ab) is an integer from 1 to about 8.
56. The conjugate according to claim 55, wherein p is 1, 2, 3, or 4.
57. The conjugate according to claim 56 comprising a mixture of the antibody-drug conjugate compounds, wherein the average drug loading per antibody in the mixture of antibody-drug conjugate compounds is about 2 to about 5.
58. The conjugate according to any one of claims 1 to 57, for use in therapy.
59. A pharmaceutical composition comprising the conjugate of any one of claims 1 to 57 a pharmaceutically acceptable diluent, carrier or excipient.
60. The conjugate according to any one of claims 1 to 57 or the pharmaceutical composition according to claim 59, for use in the treatment of a proliferative disease in a subject.
61. The conjugate according to claim 60, wherein the disease is cancer.
62. Use of a conjugate according to any one of claims 1 to 57 or a pharmaceutical composition according to claim 59 in a method of medical treatment.
63. A method of medical treatment comprising administering to a patient the pharmaceutical composition of claim 59.
64. The method of claim 63 wherein the method of medical treatment is for treating cancer.
65. The method of claim 64, wherein the patient is administered a chemotherapeutic agent, in combination with the conjugate.
66. Use of a compound according to any one of claims 1 to 57 in a method of manufacture of a medicament for the treatment of a proliferative disease.
67. A method of treating a mammal having a proliferative disease, comprising administering an effective amount of a compound according to any one of claims 1 to 57 or a pharmaceutical composition according to claim 60 or claim 61.
68. A compound of formula (B):
wherein:
Y L is selected from formulae B1, B2 and B3:
G is a linker for connecting to a cell binding agent; and D, R6, R8, R9, R10, R11, Z1, Z,2, Z3 and n are as defined in any one of claims 1 to 50.
wherein:
Y L is selected from formulae B1, B2 and B3:
G is a linker for connecting to a cell binding agent; and D, R6, R8, R9, R10, R11, Z1, Z,2, Z3 and n are as defined in any one of claims 1 to 50.
69. The compound according to claim 68, wherein the group G contains an electrophilic group selected from (i) maleimide groups (ii) activated disulfides, (iii) active esters such as NHS (N-hydroxysuccinimide) esters, HOBt (N-hydroxybenzotriazole) esters, haloformates, and acid halides; (iv) alkyl and benzyl halides such as haloacetamides; and (v) aldehydes, ketones, carboxyl.
70. The compound according to claim 69, wherein G is of formula:
G A-(CH2)m-where m is from 0 to 6; and G A is selected from:
where Ar represents a C5-6 arylene group.
G A-(CH2)m-where m is from 0 to 6; and G A is selected from:
where Ar represents a C5-6 arylene group.
71. The compound of claim 70, wherein G A is G A1-1.
72. A compound of formula (C):
wherein Y C is selected from from formulae C1, C2 and C3:
and D, R6, R8, R9, R10, R11, Z1, Z2 and Z3 are as defined in any one of claims 1 to 50.
wherein Y C is selected from from formulae C1, C2 and C3:
and D, R6, R8, R9, R10, R11, Z1, Z2 and Z3 are as defined in any one of claims 1 to 50.
73. A method of synthesis of a compound according to any one of claims 1 to 57, comprising the step of conjugating a drug-linker according to any one of claims 68 to 71 with a cell-binding agent.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201361778752P | 2013-03-13 | 2013-03-13 | |
US61/778,752 | 2013-03-13 | ||
PCT/EP2014/054958 WO2014140174A1 (en) | 2013-03-13 | 2014-03-13 | Pyrrolobenzodiazepines and conjugates thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
CA2905181A1 true CA2905181A1 (en) | 2014-09-18 |
CA2905181C CA2905181C (en) | 2020-06-02 |
Family
ID=50345993
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA2905181A Expired - Fee Related CA2905181C (en) | 2013-03-13 | 2014-03-13 | Pyrrolobenzodiazepines and conjugates thereof for providing targeted therapy |
Country Status (14)
Country | Link |
---|---|
US (1) | US20160031887A1 (en) |
EP (1) | EP2968585B1 (en) |
JP (1) | JP6444902B2 (en) |
KR (1) | KR102066319B1 (en) |
CN (1) | CN105209077B (en) |
AU (1) | AU2014230735B2 (en) |
BR (1) | BR112015023333A8 (en) |
CA (1) | CA2905181C (en) |
ES (1) | ES2687439T3 (en) |
HK (1) | HK1219651A1 (en) |
MX (1) | MX362970B (en) |
NZ (1) | NZ712035A (en) |
WO (1) | WO2014140174A1 (en) |
ZA (1) | ZA201506668B (en) |
Families Citing this family (45)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
GB0819095D0 (en) | 2008-10-17 | 2008-11-26 | Spirogen Ltd | Pyrrolobenzodiazepines |
US8697688B2 (en) | 2010-04-15 | 2014-04-15 | Seattle Genetics Inc. | Pyrrolobenzodiazepines used to treat proliferative diseases |
WO2011130613A1 (en) | 2010-04-15 | 2011-10-20 | Seattle Genetics, Inc. | Targeted pyrrolobenzodiazapine conjugates |
AU2012311505B2 (en) | 2011-09-20 | 2016-09-29 | Medimmune Limited | Pyrrolobenzodiazepines as unsymmetrical dimeric PBD compounds for inclusion in targeted conjugates |
AU2012322613B2 (en) | 2011-10-14 | 2016-04-21 | Medimmune Limited | Pyrrolobenzodiazepines and targeted conjugates |
CN108164551A (en) | 2011-10-14 | 2018-06-15 | 西雅图基因公司 | Pyrrolobenzodiazepines Zhuo and targeting conjugate |
US9388187B2 (en) | 2011-10-14 | 2016-07-12 | Medimmune Limited | Pyrrolobenzodiazepines |
AU2012322934B2 (en) | 2011-10-14 | 2016-09-08 | Medimmune Limited | Pyrrolobenzodiazepines |
CA2885305C (en) | 2012-10-12 | 2019-11-12 | Spirogen Sarl | Synthesis and intermediates of pyrrolobenzodiazepine derivatives for conjugation |
ES2530968T3 (en) | 2012-10-12 | 2015-03-09 | Spirogen Sarl | Pyrrolobenzodiazepines and conjugates thereof |
CN110256469B (en) | 2012-10-12 | 2022-05-17 | 麦迪穆有限责任公司 | Pyrrolobenzodiazepines and conjugates thereof |
CA2894961C (en) | 2012-12-21 | 2020-09-15 | Spirogen Sarl | Pyrrolobenzodiazepines and conjugates thereof |
US9567340B2 (en) | 2012-12-21 | 2017-02-14 | Medimmune Limited | Unsymmetrical pyrrolobenzodiazepines-dimers for use in the treatment of proliferative and autoimmune diseases |
AU2014229529B2 (en) | 2013-03-13 | 2018-02-15 | Medimmune Limited | Pyrrolobenzodiazepines and conjugates thereof |
CA2901941C (en) | 2013-03-13 | 2020-04-07 | Spirogen Sarl | Pyrrolobenzodiazepines and conjugates thereof |
GB201317981D0 (en) | 2013-10-11 | 2013-11-27 | Spirogen Sarl | Pyrrolobenzodiazepines and conjugates thereof |
GB201317982D0 (en) | 2013-10-11 | 2013-11-27 | Spirogen Sarl | Pyrrolobenzodiazepines and conjugates thereof |
CN106687141A (en) * | 2014-09-10 | 2017-05-17 | 麦迪穆有限责任公司 | Pyrrolobenzodiazepines and conjugates thereof |
GB201416112D0 (en) | 2014-09-12 | 2014-10-29 | Medimmune Ltd | Pyrrolobenzodiazepines and conjugates thereof |
CA2968447A1 (en) | 2014-11-25 | 2016-06-02 | Adc Therapeutics Sa | Pyrrolobenzodiazepine-antibody conjugates and their use to treat neoplasms |
EA201791550A1 (en) | 2015-01-14 | 2017-11-30 | Бристол-Маерс Сквибб Компани | DYMERAS OF BENZODIAZEPINS, THEIR CONJUGATES AND METHODS OF THEIR RECEPTION AND APPLICATION |
SG11201705645YA (en) | 2015-01-14 | 2017-08-30 | Bristol Myers Squibb Co | Heteroarylene-bridged benzodiazepine dimers, conjugates thereof, and methods of making and using |
JP2018518506A (en) | 2015-06-23 | 2018-07-12 | ブリストル−マイヤーズ スクイブ カンパニーBristol−Myers Squibb Company | Production and use of macrocyclic benzodiazepine dimers and conjugates thereof |
GB201601431D0 (en) | 2016-01-26 | 2016-03-09 | Medimmune Ltd | Pyrrolobenzodiazepines |
GB201602359D0 (en) | 2016-02-10 | 2016-03-23 | Medimmune Ltd | Pyrrolobenzodiazepine Conjugates |
GB201602356D0 (en) | 2016-02-10 | 2016-03-23 | Medimmune Ltd | Pyrrolobenzodiazepine Conjugates |
GB201607478D0 (en) | 2016-04-29 | 2016-06-15 | Medimmune Ltd | Pyrrolobenzodiazepine Conjugates |
WO2017201132A2 (en) | 2016-05-18 | 2017-11-23 | Mersana Therapeutics, Inc. | Pyrrolobenzodiazepines and conjugates thereof |
CN109641910A (en) | 2016-06-24 | 2019-04-16 | 梅尔莎纳医疗公司 | Pyrroles acene phenodiazine * and its conjugate |
GB201617466D0 (en) | 2016-10-14 | 2016-11-30 | Medimmune Ltd | Pyrrolobenzodiazepine conjugates |
AU2018217926B2 (en) | 2017-02-08 | 2019-10-03 | Adc Therapeutics Sa | Pyrrolobenzodiazepine-antibody conjugates |
GB201702031D0 (en) | 2017-02-08 | 2017-03-22 | Medlmmune Ltd | Pyrrolobenzodiazepine-antibody conjugates |
JP2020517609A (en) | 2017-04-18 | 2020-06-18 | メディミューン リミテッド | Pyrrolobenzodiazepine complex |
SI3668874T1 (en) | 2017-08-18 | 2022-04-29 | Medimmune Limited | Pyrrolobenzodiazepine conjugates |
US11628223B2 (en) | 2017-09-29 | 2023-04-18 | Daiichi Sankyo Company, Limited | Antibody-drug conjugates comprising substituted benzo[e]pyrrolo[1,2-α][1,4]diazepines |
WO2019104289A1 (en) | 2017-11-27 | 2019-05-31 | Mersana Therapeutics, Inc. | Pyrrolobenzodiazepine antibody conjugates |
TW201929908A (en) | 2017-12-21 | 2019-08-01 | 美商梅爾莎納醫療公司 | Pyrrolobenzodiazepine antibody conjugates |
GB201803342D0 (en) | 2018-03-01 | 2018-04-18 | Medimmune Ltd | Methods |
GB201806022D0 (en) | 2018-04-12 | 2018-05-30 | Medimmune Ltd | Pyrrolobenzodiazepines and conjugates thereof |
GB2581394A (en) * | 2019-02-18 | 2020-08-19 | Medimmune Ltd | Pyrrolobenzodiazepines and conjugates thereof |
EP4013494A1 (en) | 2019-08-12 | 2022-06-22 | Regeneron Pharmaceuticals, Inc. | Macrophage stimulating 1 receptor (mst1r) variants and uses thereof |
US20240123081A1 (en) | 2019-10-25 | 2024-04-18 | Medimmune, Llc | Branched moiety for use in conjugates |
EP4211171A2 (en) | 2020-09-10 | 2023-07-19 | Precirix N.V. | Antibody fragment against fap |
WO2023203135A1 (en) | 2022-04-22 | 2023-10-26 | Precirix N.V. | Improved radiolabelled antibody |
WO2023213801A1 (en) | 2022-05-02 | 2023-11-09 | Precirix N.V. | Pre-targeting |
Family Cites Families (370)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CU22545A1 (en) | 1994-11-18 | 1999-03-31 | Centro Inmunologia Molecular | OBTAINING A CHEMICAL AND HUMANIZED ANTIBODY AGAINST THE RECEPTOR OF THE EPIDERMAL GROWTH FACTOR FOR DIAGNOSTIC AND THERAPEUTIC USE |
JPS58180487A (en) | 1982-04-16 | 1983-10-21 | Kyowa Hakko Kogyo Co Ltd | Antibiotic dc-81 and its preparation |
US4816567A (en) | 1983-04-08 | 1989-03-28 | Genentech, Inc. | Recombinant immunoglobin preparations |
JPS6098584A (en) | 1983-11-02 | 1985-06-01 | Canon Inc | United vtr provided with power saving mechanism |
US5583024A (en) | 1985-12-02 | 1996-12-10 | The Regents Of The University Of California | Recombinant expression of Coleoptera luciferase |
US6013772A (en) | 1986-08-13 | 2000-01-11 | Bayer Corporation | Antibody preparations specifically binding to unique determinants of CEA antigens or fragments thereof and use of the antibody preparations in immunoassays |
GB8800078D0 (en) | 1988-01-05 | 1988-02-10 | Ciba Geigy Ag | Novel antibodies |
US5162504A (en) | 1988-06-03 | 1992-11-10 | Cytogen Corporation | Monoclonal antibodies to a new antigenic marker in epithelial prostatic cells and serum of prostatic cancer patients |
AU4128089A (en) | 1988-09-15 | 1990-03-22 | Rorer International (Overseas) Inc. | Monoclonal antibodies specific to human epidermal growth factor receptor and therapeutic methods employing same |
CA2023779A1 (en) | 1989-08-23 | 1991-02-24 | Margaret D. Moore | Compositions and methods for detection and treatment of epstein-barr virus infection and immune disorders |
HUT60768A (en) | 1990-03-16 | 1992-10-28 | Sandoz Ag | Process for producing cd25 fixing molecules |
US5256643A (en) | 1990-05-29 | 1993-10-26 | The Government Of The United States | Human cripto protein |
GB9014932D0 (en) | 1990-07-05 | 1990-08-22 | Celltech Ltd | Recombinant dna product and method |
AU9016591A (en) | 1990-10-25 | 1992-05-26 | Tanox Biosystems, Inc. | Glycoproteins associated with membrane-bound immunoglobulins as antibody targets on B cells |
JP4156662B2 (en) | 1991-03-29 | 2008-09-24 | ジェネンテック・インコーポレーテッド | Human PF4A receptor and use thereof |
US5543503A (en) | 1991-03-29 | 1996-08-06 | Genentech Inc. | Antibodies to human IL-8 type A receptor |
US5440021A (en) | 1991-03-29 | 1995-08-08 | Chuntharapai; Anan | Antibodies to human IL-8 type B receptor |
WO1994004679A1 (en) | 1991-06-14 | 1994-03-03 | Genentech, Inc. | Method for making humanized antibodies |
JP3050424B2 (en) | 1991-07-12 | 2000-06-12 | 塩野義製薬株式会社 | Human endothelin receptor |
US5264557A (en) | 1991-08-23 | 1993-11-23 | The United States Of America As Represented By The Department Of Health And Human Services | Polypeptide of a human cripto-related gene, CR-3 |
US5362852A (en) | 1991-09-27 | 1994-11-08 | Pfizer Inc. | Modified peptide derivatives conjugated at 2-hydroxyethylamine moieties |
US5976551A (en) | 1991-11-15 | 1999-11-02 | Institut Pasteur And Institut Nationale De La Sante Et De La Recherche Medicale | Altered major histocompatibility complex (MHC) determinant and method of using the determinant |
US6153408A (en) | 1991-11-15 | 2000-11-28 | Institut Pasteur And Institut National De La Sante Et De La Recherche Medicale | Altered major histocompatibility complex (MHC) determinant and methods of using the determinant |
US5955075A (en) | 1992-03-11 | 1999-09-21 | Institute Of Virology, Slovak Academy Of Sciences | Method of inhibiting tumor growth using antibodies to MN protein |
IL107366A (en) | 1992-10-23 | 2003-03-12 | Chugai Pharmaceutical Co Ltd | Genes coding for megakaryocyte potentiator |
US5736137A (en) | 1992-11-13 | 1998-04-07 | Idec Pharmaceuticals Corporation | Therapeutic application of chimeric and radiolabeled antibodies to human B lymphocyte restricted differentiation antigen for treatment of B cell lymphoma |
US5644033A (en) | 1992-12-22 | 1997-07-01 | Health Research, Inc. | Monoclonal antibodies that define a unique antigen of human B cell antigen receptor complex and methods of using same for diagnosis and treatment |
US5472693A (en) | 1993-02-16 | 1995-12-05 | The Dow Chemical Company | Family of anti-carcinoembryonic antigen chimeric antibodies |
US5869445A (en) | 1993-03-17 | 1999-02-09 | University Of Washington | Methods for eliciting or enhancing reactivity to HER-2/neu protein |
US5801005A (en) | 1993-03-17 | 1998-09-01 | University Of Washington | Immune reactivity to HER-2/neu protein for diagnosis of malignancies in which the HER-2/neu oncogene is associated |
US6214345B1 (en) | 1993-05-14 | 2001-04-10 | Bristol-Myers Squibb Co. | Lysosomal enzyme-cleavable antitumor drug conjugates |
US5773223A (en) | 1993-09-02 | 1998-06-30 | Chiron Corporation | Endothelin B1, (ETB1) receptor polypeptide and its encoding nucleic acid methods, and uses thereof |
EP0647450A1 (en) | 1993-09-09 | 1995-04-12 | BEHRINGWERKE Aktiengesellschaft | Improved prodrugs for enzyme mediated activation |
US5750370A (en) | 1995-06-06 | 1998-05-12 | Human Genome Sciences, Inc. | Nucleic acid encoding human endothlein-bombesin receptor and method of producing the receptor |
JPH08336393A (en) | 1995-04-13 | 1996-12-24 | Mitsubishi Chem Corp | Production of optically active gamma-substituted-beta-hydroxybutyric ester |
US5686292A (en) | 1995-06-02 | 1997-11-11 | Genentech, Inc. | Hepatocyte growth factor receptor antagonist antibodies and uses thereof |
US6824993B2 (en) | 1995-06-06 | 2004-11-30 | Human Genome Sciences, Inc. | Antibodies that bind human prostate specific G-protein receptor HPRAJ70 |
US5707829A (en) | 1995-08-11 | 1998-01-13 | Genetics Institute, Inc. | DNA sequences and secreted proteins encoded thereby |
US20020193567A1 (en) | 1995-08-11 | 2002-12-19 | Genetics Institute, Inc. | Secreted proteins and polynucleotides encoding them |
JP3646191B2 (en) | 1996-03-19 | 2005-05-11 | 大塚製薬株式会社 | Human gene |
JP2000511403A (en) | 1996-03-20 | 2000-09-05 | イムノメディクス,インコーポレイテッド | Humanization of anti-carcinoembryonic antigen anti-idiotype antibodies and their use as tumor vaccines and for targeting applications |
US6150508A (en) | 1996-03-25 | 2000-11-21 | Northwest Biotherapeutics, Inc. | Monoclonal antibodies specific for the extracellular domain of prostate-specific membrane antigen |
US6218519B1 (en) | 1996-04-12 | 2001-04-17 | Pro-Neuron, Inc. | Compounds and methods for the selective treatment of cancer and bacterial infections |
US7011812B1 (en) | 1996-05-03 | 2006-03-14 | Immunomedics, Inc. | Targeted combination immunotherapy of cancer and infectious diseases |
HUP9901562A3 (en) | 1996-05-04 | 2000-06-28 | Astrazeneca Ab | Monoclonal antibody to cea, conjugates comprising said antibody, and their therapeutic use in an adept system |
US6107090A (en) | 1996-05-06 | 2000-08-22 | Cornell Research Foundation, Inc. | Treatment and diagnosis of prostate cancer with antibodies to extracellur PSMA domains |
CA2254843A1 (en) | 1996-05-17 | 1997-11-27 | Schering Corporation | Human b-cell antigens, related reagents |
US6590088B1 (en) | 1996-07-19 | 2003-07-08 | Human Genome Sciences, Inc. | CD33-like protein |
CA2264227A1 (en) | 1996-09-27 | 1998-04-02 | Raymond A. Firestone | Hydrolyzable prodrugs for delivery of anticancer drugs to metastatic cells |
US6653104B2 (en) | 1996-10-17 | 2003-11-25 | Immunomedics, Inc. | Immunotoxins, comprising an internalizing antibody, directed against malignant and normal cells |
US6417337B1 (en) | 1996-10-31 | 2002-07-09 | The Dow Chemical Company | High affinity humanized anti-CEA monoclonal antibodies |
US6759509B1 (en) | 1996-11-05 | 2004-07-06 | Bristol-Myers Squibb Company | Branched peptide linkers |
US5989604A (en) | 1996-12-19 | 1999-11-23 | Adore-A-Pet, Ltd. | Xylitol-containing non-human foodstuff and method |
US5942602A (en) | 1997-02-13 | 1999-08-24 | Schering Aktiengessellschaft | Growth factor receptor antibodies |
US5945511A (en) | 1997-02-20 | 1999-08-31 | Zymogenetics, Inc. | Class II cytokine receptor |
US7033827B2 (en) | 1997-02-25 | 2006-04-25 | Corixa Corporation | Prostate-specific polynucleotide compositions |
US20030185830A1 (en) | 1997-02-25 | 2003-10-02 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of prostate cancer |
US6541212B2 (en) | 1997-03-10 | 2003-04-01 | The Regents Of The University Of California | Methods for detecting prostate stem cell antigen protein |
CA2281877C (en) | 1997-03-10 | 2010-01-05 | The Regents Of The University Of California | Psca: prostate stem cell antigen |
US6261791B1 (en) | 1997-03-10 | 2001-07-17 | The Regents Of The University Of California | Method for diagnosing cancer using specific PSCA antibodies |
US6555339B1 (en) | 1997-04-14 | 2003-04-29 | Arena Pharmaceuticals, Inc. | Non-endogenous, constitutively activated human protein-coupled receptors |
US6319688B1 (en) | 1997-04-28 | 2001-11-20 | Smithkline Beecham Corporation | Polynucleotide encoding human sodium dependent phosphate transporter (IPT-1) |
US6235883B1 (en) | 1997-05-05 | 2001-05-22 | Abgenix, Inc. | Human monoclonal antibodies to epidermal growth factor receptor |
WO1998051805A1 (en) | 1997-05-15 | 1998-11-19 | Abbott Laboratories | Reagents and methods useful for detecting diseases of the prostate |
WO1998051824A1 (en) | 1997-05-15 | 1998-11-19 | Abbott Laboratories | Reagents and methods useful for detecting disease of the urinary tract |
US6602677B1 (en) | 1997-09-19 | 2003-08-05 | Promega Corporation | Thermostable luciferases and methods of production |
US20030060612A1 (en) | 1997-10-28 | 2003-03-27 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
US20020034749A1 (en) | 1997-11-18 | 2002-03-21 | Billing-Medel Patricia A. | Reagents and methods useful for detecting diseases of the breast |
US6110695A (en) | 1997-12-02 | 2000-08-29 | The Regents Of The University Of California | Modulating the interaction of the chemokine, B Lymphocyte Hemoattractant, and its Receptor, BLR1 |
ATE407943T1 (en) | 1998-03-13 | 2008-09-15 | Burnham Inst | TARGETING CONNECTIONS FOR VARIOUS ORGANS AND TISSUES |
WO1999058658A2 (en) | 1998-05-13 | 1999-11-18 | Epimmune, Inc. | Expression vectors for stimulating an immune response and methods of using the same |
EP1079862B1 (en) | 1998-05-20 | 2010-07-07 | Immunomedics, Inc. | Therapeutics using a bispecific anti-hla class ii invariant chain x anti-pathogen antibody |
US20030064397A1 (en) | 1998-05-22 | 2003-04-03 | Incyte Genomics, Inc. | Transmembrane protein differentially expressed in prostate and lung tumors |
CN1250293C (en) | 1998-05-22 | 2006-04-12 | 第一制药株式会社 | Drug composites |
US20020187472A1 (en) | 2001-03-09 | 2002-12-12 | Preeti Lal | Steap-related protein |
WO2000012130A1 (en) | 1998-08-27 | 2000-03-09 | Smithkline Beecham Corporation | Rp105 agonists and antagonists |
GB9818731D0 (en) | 1998-08-27 | 1998-10-21 | Univ Portsmouth | Compounds |
ATE294803T1 (en) | 1998-08-27 | 2005-05-15 | Spirogen Ltd | PYRROLOBENZODIAZEPINES |
JP4689781B2 (en) | 1998-09-03 | 2011-05-25 | 独立行政法人科学技術振興機構 | Amino acid transport protein and its gene |
WO2000020579A1 (en) | 1998-10-02 | 2000-04-13 | Mcmaster University | Spliced form of erbb-2/neu oncogene |
WO2001057188A2 (en) | 2000-02-03 | 2001-08-09 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
US20020119158A1 (en) | 1998-12-17 | 2002-08-29 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US6858710B2 (en) | 1998-12-17 | 2005-02-22 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20030091580A1 (en) | 2001-06-18 | 2003-05-15 | Mitcham Jennifer L. | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US6962980B2 (en) | 1999-09-24 | 2005-11-08 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US6468546B1 (en) | 1998-12-17 | 2002-10-22 | Corixa Corporation | Compositions and methods for therapy and diagnosis of ovarian cancer |
CA2360396A1 (en) | 1998-12-30 | 2000-07-13 | Andrew M. Scharenberg | Characterization of a calcium channel family |
ES2348708T3 (en) | 1999-01-29 | 2010-12-13 | Corixa Corporation | FUSION PROTEINS OF HER-2 / NEU. |
GB9905124D0 (en) | 1999-03-05 | 1999-04-28 | Smithkline Beecham Biolog | Novel compounds |
US7109292B2 (en) | 1999-03-08 | 2006-09-19 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
AU3395900A (en) | 1999-03-12 | 2000-10-04 | Human Genome Sciences, Inc. | Human lung cancer associated gene sequences and polypeptides |
US7312303B2 (en) | 1999-05-11 | 2007-12-25 | Genentech, Inc. | Anti-PRO4980 antibodies |
US6268488B1 (en) | 1999-05-25 | 2001-07-31 | Barbas, Iii Carlos F. | Prodrug activation using catalytic antibodies |
WO2000075655A1 (en) | 1999-06-03 | 2000-12-14 | Takeda Chemical Industries, Ltd. | Screening method with the use of cd100 |
HU230586B1 (en) | 1999-06-25 | 2017-02-28 | Genentech, Inc. | Use of an anti-erbb antibody-maytansinoid conjugates in the manufacture of a medicament for treating tumorous diseases |
US20030119113A1 (en) | 1999-07-20 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
ES2277846T3 (en) | 1999-07-29 | 2007-08-01 | Medarex, Inc. | HUMAN MONOCLONAL ANTIBODIES FOR SPECIFIC PROSTATIC ANTIGEN. |
US7297770B2 (en) | 1999-08-10 | 2007-11-20 | Genentech, Inc. | PRO6496 polypeptides |
US7294696B2 (en) | 1999-08-17 | 2007-11-13 | Genentech Inc. | PRO7168 polypeptides |
US6716966B1 (en) | 1999-08-18 | 2004-04-06 | Altarex Corp. | Therapeutic binding agents against MUC-1 antigen and methods for their use |
US7147850B2 (en) | 1999-08-18 | 2006-12-12 | Altarex Medical Corp. | Therapeutic binding agents against MUC-1 antigen and methods for their use |
EP1208202A2 (en) | 1999-09-01 | 2002-05-29 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030232056A1 (en) | 1999-09-10 | 2003-12-18 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20030129192A1 (en) | 1999-09-10 | 2003-07-10 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
US20030206918A1 (en) | 1999-09-10 | 2003-11-06 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of ovarian cancer |
KR100490077B1 (en) | 1999-10-29 | 2005-05-17 | 제넨테크, 인크. | Anti-Prostate Stem Cell Antigen (PSCA) Antibody Compositions and Methods of Use |
CA2393126C (en) | 1999-11-29 | 2016-05-24 | The Trustees Of Columbia University In The City Of New York | Isolation of five novel genes coding for new fc receptors-type melanoma involved in the pathogenesis of lymphoma/melanoma |
AU1807401A (en) | 1999-11-30 | 2001-06-12 | Corixa Corporation | Compositions and methods for therapy and diagnosis of breast cancer |
CA2393738A1 (en) | 1999-12-10 | 2001-06-14 | Epimmune Inc. | Inducing cellular immune responses to her2/neu using peptide and nucleic acid compositions |
US6610286B2 (en) | 1999-12-23 | 2003-08-26 | Zymogenetics, Inc. | Method for treating inflammation using soluble receptors to interleukin-20 |
WO2001046232A2 (en) | 1999-12-23 | 2001-06-28 | Zymogenetics, Inc. | Soluble interleukin-20 receptor |
NZ502058A (en) | 1999-12-23 | 2003-11-28 | Ovita Ltd | Isolated mutated nucleic acid molecule for regulation of ovulation rate |
EP2295078A3 (en) | 1999-12-23 | 2011-03-23 | ZymoGenetics, L.L.C. | Method for treating inflammation |
DE60030323T2 (en) | 1999-12-24 | 2007-10-11 | Genentech, Inc., South San Francisco | METHOD AND CONNECTIONS FOR EXTENDING THE HALF-TIME PERIODS FOR THE DISPOSAL OF BIOWIRESAMIC COMPOUNDS |
US20040001827A1 (en) | 2002-06-28 | 2004-01-01 | Dennis Mark S. | Serum albumin binding peptides for tumor targeting |
US7297333B2 (en) | 2000-01-20 | 2007-11-20 | Genentech, Inc. | Anti-PRO10268 antibodies |
US20030224379A1 (en) | 2000-01-21 | 2003-12-04 | Tang Y. Tom | Novel nucleic acids and polypeptides |
AU2001234493A1 (en) | 2000-01-21 | 2001-07-31 | Corixa Corporation | Compounds and methods for prevention and treatment of her-2/neu associated malignancies |
US20030104562A1 (en) | 2000-02-11 | 2003-06-05 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030219806A1 (en) | 2000-02-22 | 2003-11-27 | Millennium Pharmaceuticals, Inc. | Novel 18607, 15603, 69318, 12303, 48000, 52920, 5433, 38554, 57301, 58324, 55063, 52991, 59914, 59921 and 33751 molecules and uses therefor |
WO2001062794A2 (en) | 2000-02-22 | 2001-08-30 | Millennium Pharmaceuticals, Inc. | 18607, a human calcium channel |
US20040052793A1 (en) | 2001-02-22 | 2004-03-18 | Carter Paul J. | Caspase activivated prodrugs therapy |
AU3985701A (en) | 2000-02-25 | 2001-09-03 | Us Health | Anti-EGFRviii SCFVS with improved cytotoxicity and yield, immunotoxins based thereon, and methods of use thereof |
US20040005561A1 (en) | 2000-03-01 | 2004-01-08 | Corixa Corporation | Compositions and methods for the detection, diagnosis and therapy of hematological malignancies |
US20040002068A1 (en) | 2000-03-01 | 2004-01-01 | Corixa Corporation | Compositions and methods for the detection, diagnosis and therapy of hematological malignancies |
WO2001066689A2 (en) | 2000-03-07 | 2001-09-13 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
WO2001072962A2 (en) | 2000-03-24 | 2001-10-04 | Fahri Saatcioglu | Novel prostate-specific or testis-specific nucleic acid molecules, polypeptides, and diagnostic and therapeutic methods |
US20030186889A1 (en) | 2000-03-31 | 2003-10-02 | Wolf-Georg Forssmann | Diagnostic and medicament for analysing the cell surface proteome of tumour and inflammatory cells and for treating tumorous and inflammatory diseases, preferably using a specific chemokine receptor analysis and the chemokine receptor-ligand interaction |
WO2004043361A2 (en) | 2002-11-08 | 2004-05-27 | Genentech, Inc. | Compositions and methods for the treatment of natural killer cell related diseases |
WO2001075177A2 (en) | 2000-04-03 | 2001-10-11 | The Government Of The United States Of America, As Represented By The Secretary, Department Of Health And Human Services | Tumor markers in ovarian cancer |
IL152136A0 (en) | 2000-04-07 | 2003-05-29 | Arena Pharm Inc | Non-endogenous, constitutively activated known g protein-coupled receptors |
AU2001263105A1 (en) | 2000-05-18 | 2001-11-26 | Lexicon Genetics Incorporated | Human semaphorin homologs and polynucleotides encoding the same |
WO2001090304A2 (en) | 2000-05-19 | 2001-11-29 | Human Genome Sciences, Inc. | Nucleic acids, proteins, and antibodies |
WO2001094641A2 (en) | 2000-06-09 | 2001-12-13 | Idec Pharmaceuticals Corporation | Gene targets and ligands that bind thereto for treatment and diagnosis of ovarian carcinomas |
CA2409776A1 (en) | 2000-06-16 | 2001-12-27 | Incyte Genomics, Inc. | G-protein coupled receptors |
WO2002002587A1 (en) | 2000-06-30 | 2002-01-10 | Human Genome Sciences, Inc. | B7-like polynucleotides, polypeptides, and antibodies |
AU2001273194A1 (en) | 2000-06-30 | 2002-01-14 | Amgen Inc. | B7-Like Molecules and Uses Thereof |
JP2004528003A (en) | 2000-06-30 | 2004-09-16 | インサイト・ゲノミックス・インコーポレイテッド | Extracellular matrix and cell adhesion molecules |
WO2002006339A2 (en) | 2000-07-03 | 2002-01-24 | Curagen Corporation | Proteins and nucleic acids encoding same |
US20040044179A1 (en) | 2000-07-25 | 2004-03-04 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
WO2002010187A1 (en) | 2000-07-27 | 2002-02-07 | Mayo Foundation For Medical Education And Research | B7-h3 and b7-h4, novel immunoregulatory molecules |
JP2004505617A (en) | 2000-07-28 | 2004-02-26 | ヴィッセンバッハ,ウルリヒ | Trp8, Trp9 and Trp10, novel markers for cancer |
US7229623B1 (en) | 2000-08-03 | 2007-06-12 | Corixa Corporation | Her-2/neu fusion proteins |
US7163681B2 (en) | 2000-08-07 | 2007-01-16 | Centocor, Inc. | Anti-integrin antibodies, compositions, methods and uses |
CN1468259A (en) | 2000-08-08 | 2004-01-14 | ͨ��ҽ�ƹ�˾ | Immunotherapy for chronic myelocytic leukemia |
JP2004522412A (en) | 2000-08-14 | 2004-07-29 | コリクサ コーポレイション | Compositions and methods for the treatment and diagnosis of HER-2 / NEU-related malignancies |
WO2002013847A2 (en) | 2000-08-14 | 2002-02-21 | Corixa Corporation | Methods for diagnosis and therapy of hematological and virus-associated malignancies |
JP2004520806A (en) | 2000-08-24 | 2004-07-15 | ジェネンテック・インコーポレーテッド | Compositions and methods for tumor diagnosis and treatment |
GB0020953D0 (en) | 2000-08-24 | 2000-10-11 | Smithkline Beecham Biolog | Vaccine |
CA2421949A1 (en) | 2000-09-11 | 2002-03-21 | Hyseq, Inc. | Novel nucleic acids and polypeptides |
DE60141546D1 (en) | 2000-09-15 | 2010-04-22 | Zymogenetics Inc | Polypeptides containing the extracellular domain of IL-20RA and / or IL-20RB |
US6613567B1 (en) | 2000-09-15 | 2003-09-02 | Isis Pharmaceuticals, Inc. | Antisense inhibition of Her-2 expression |
US20060073551A1 (en) | 2000-09-15 | 2006-04-06 | Genentech, Inc. | Pro4487 polypeptides |
UA83458C2 (en) | 2000-09-18 | 2008-07-25 | Байоджен Айдек Ма Інк. | The isolated polypeptide baff-r (the receptor of the factor of activation of b-cells of the family tnf) |
WO2002022808A2 (en) | 2000-09-18 | 2002-03-21 | Biogen, Inc. | Cripto mutant and uses thereof |
WO2002030268A2 (en) | 2000-10-13 | 2002-04-18 | Eos Biotechnology, Inc. | Methods of diagnosis of prostate cancer, compositions and methods of screening for modulators of prostate cancer |
EP1407017B1 (en) | 2000-11-07 | 2009-06-03 | ZymoGenetics, Inc. | Human tumor necrosis factor receptor |
US20020150573A1 (en) | 2000-11-10 | 2002-10-17 | The Rockefeller University | Anti-Igalpha-Igbeta antibody for lymphoma therapy |
US20040018194A1 (en) | 2000-11-28 | 2004-01-29 | Francisco Joseph A. | Recombinant anti-CD30 antibodies and uses thereof |
WO2002061087A2 (en) | 2000-12-19 | 2002-08-08 | Lifespan Biosciences, Inc. | Antigenic peptides, such as for g protein-coupled receptors (gpcrs), antibodies thereto, and systems for identifying such antigenic peptides |
US20020159986A1 (en) | 2001-01-12 | 2002-10-31 | John Langenfeld | Bone morphogenetic protein-2 in the treatment and diagnosis of cancer |
US20030119125A1 (en) | 2001-01-16 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US20030119133A1 (en) | 2001-01-16 | 2003-06-26 | Genentech, Inc. | Secreted and transmembrane polypeptides and nucleic acids encoding the same |
US7754208B2 (en) | 2001-01-17 | 2010-07-13 | Trubion Pharmaceuticals, Inc. | Binding domain-immunoglobulin fusion proteins |
MXPA03006617A (en) | 2001-01-24 | 2004-12-02 | Protein Design Labs Inc | Methods of diagnosis of breast cancer, compositions and methods of screening for modulators of breast cancer. |
AU2002251841A1 (en) | 2001-01-30 | 2002-08-12 | Corixa Corporation | Compositions and methods for the therapy and diagnosis of pancreatic cancer |
WO2002064780A1 (en) | 2001-02-12 | 2002-08-22 | Bionomics Limited | Dna sequences for human tumour suppressor genes |
US20030087250A1 (en) | 2001-03-14 | 2003-05-08 | Millennium Pharmaceuticals, Inc. | Nucleic acid molecules and proteins for the identification, assessment, prevention, and therapy of ovarian cancer |
EP1243276A1 (en) | 2001-03-23 | 2002-09-25 | Franciscus Marinus Hendrikus De Groot | Elongated and multiple spacers containing activatible prodrugs |
AU2002311787A1 (en) | 2001-03-28 | 2002-10-15 | Zycos Inc. | Translational profiling |
EP1578345A2 (en) | 2001-03-29 | 2005-09-28 | RAMOT UNIVERSITY AUTHORITY FOR APPLIED RESEARCH & INDUSTRIAL DEVELOPMENT LTD. | Peptides and antibodies to muc 1 proteins |
EP1383802A4 (en) | 2001-03-30 | 2005-08-03 | Univ California | Anti-muc-1 single chain antibodies for tumor targeting |
US7183388B2 (en) | 2001-03-30 | 2007-02-27 | The Regents Of The University Of California | Anti-MUC-1 single chain antibodies for tumor targeting |
WO2003008537A2 (en) | 2001-04-06 | 2003-01-30 | Mannkind Corporation | Epitope sequences |
US6820011B2 (en) | 2001-04-11 | 2004-11-16 | The Regents Of The University Of Colorado | Three-dimensional structure of complement receptor type 2 and uses thereof |
WO2002083866A2 (en) | 2001-04-17 | 2002-10-24 | The Board Of Trustees Of The University Of Arkansas | Repeat sequences of the ca125 gene and their use for diagnostic and therapeutic interventions |
WO2002086443A2 (en) | 2001-04-18 | 2002-10-31 | Protein Design Labs, Inc | Methods of diagnosis of lung cancer, compositions and methods of screening for modulators of lung cancer |
AU2002334799B2 (en) | 2001-04-26 | 2009-05-07 | Biogen Ma Inc. | Cripto-specific antibodies |
RS51635B (en) | 2001-04-26 | 2011-08-31 | Biogen Idec Ma Inc. | Cripto blocking antibodies and uses thereof |
US6884869B2 (en) | 2001-04-30 | 2005-04-26 | Seattle Genetics, Inc. | Pentapeptide compounds and uses related thereto |
JP2005504513A (en) | 2001-05-09 | 2005-02-17 | コリクサ コーポレイション | Compositions and methods for treatment and diagnosis of prostate cancer |
AU2002344326A1 (en) | 2001-05-11 | 2002-11-25 | Sloan-Kettering Institute For Cancer Research | Nucleic acid sequence encoding ovarian antigen, ca125, and uses thereof |
DK1436003T3 (en) | 2001-05-24 | 2010-03-15 | Zymogenetics Inc | TACI-immunoglobulin fusion proteins |
US7157558B2 (en) | 2001-06-01 | 2007-01-02 | Genentech, Inc. | Polypeptide encoded by a polynucleotide overexpresses in tumors |
JP4619651B2 (en) | 2001-06-01 | 2011-01-26 | コーネル・リサーチ・ファンデーション・インコーポレイテッド | Modified antibodies against prostate-specific membrane antigen and uses thereof |
WO2002098358A2 (en) | 2001-06-04 | 2002-12-12 | Eos Biotechnology, Inc. | Methods of diagnosis and treatment of androgen-dependent prostate cancer, prostate cancer undergoing androgen-withdrawal, and androgen-independent prostate cancer |
JP2005518185A (en) | 2001-06-04 | 2005-06-23 | キュラジェン コーポレイション | Novel protein and nucleic acid encoding it |
DE60237917D1 (en) | 2001-06-05 | 2010-11-18 | Exelixis Inc | GFATS AS MODULATORS OF THE P53 PATH AND METHOD OF USE |
US20050112568A1 (en) | 2001-06-05 | 2005-05-26 | Lori Friedman | Dgks as modifiers of the p53 pathwha and methods of use |
US7235358B2 (en) | 2001-06-08 | 2007-06-26 | Expression Diagnostics, Inc. | Methods and compositions for diagnosing and monitoring transplant rejection |
US7125663B2 (en) | 2001-06-13 | 2006-10-24 | Millenium Pharmaceuticals, Inc. | Genes, compositions, kits and methods for identification, assessment, prevention, and therapy of cervical cancer |
EP1517998A2 (en) | 2001-06-18 | 2005-03-30 | EOS Biotechnology, Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
US7189507B2 (en) | 2001-06-18 | 2007-03-13 | Pdl Biopharma, Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
US7705120B2 (en) | 2001-06-21 | 2010-04-27 | Millennium Pharmaceuticals, Inc. | Compositions, kits, and methods for identification, assessment, prevention, and therapy of breast cancer |
DE60232244D1 (en) | 2001-06-21 | 2009-06-18 | Glycomimetics Inc | PROOF AND TREATMENT OF PROSTATE CANCER |
WO2003002717A2 (en) | 2001-06-28 | 2003-01-09 | Schering Corporation | Biological activity of ak155 |
WO2003004529A2 (en) | 2001-07-02 | 2003-01-16 | Licentia Ltd. | Ephrin-tie receptor materials and methods |
US20040076955A1 (en) | 2001-07-03 | 2004-04-22 | Eos Biotechnology, Inc. | Methods of diagnosis of bladder cancer, compositions and methods of screening for modulators of bladder cancer |
WO2003003984A2 (en) | 2001-07-05 | 2003-01-16 | Curagen Corporation | Novel proteins and nucleic acids encoding same |
WO2003055439A2 (en) | 2001-07-18 | 2003-07-10 | The Regents Of The University Of California | Her2/neu target antigen and use of same to stimulate an immune response |
WO2003009814A2 (en) | 2001-07-25 | 2003-02-06 | Millennium Pharmaceuticals, Inc. | Novel genes, compositions, kits, and methods for identification, assessment, prevention, and therapy of prostate cancer |
HUP0500992A3 (en) | 2001-08-03 | 2007-11-28 | Genentech Inc | Tacis and br3 polypeptides and uses thereof |
EP1423510A4 (en) | 2001-08-03 | 2005-06-01 | Glycart Biotechnology Ag | Antibody glycosylation variants having increased antibody-dependent cellular cytotoxicity |
WO2003016475A2 (en) | 2001-08-14 | 2003-02-27 | The General Hospital Corporation | Nucleic acid and amino acid sequences involved in pain |
US20030092013A1 (en) | 2001-08-16 | 2003-05-15 | Vitivity, Inc. | Diagnosis and treatment of vascular disease |
WO2003018621A2 (en) | 2001-08-23 | 2003-03-06 | Oxford Biomedica (Uk) Limited | Genes |
WO2003029262A2 (en) | 2001-08-29 | 2003-04-10 | Vanderbilt University | The human mob-5 (il-24) receptors and uses thereof |
US20030124579A1 (en) | 2001-09-05 | 2003-07-03 | Eos Biotechnology, Inc. | Methods of diagnosis of ovarian cancer, compositions and methods of screening for modulators of ovarian cancer |
ES2532757T3 (en) | 2001-09-06 | 2015-03-31 | Agensys, Inc. | Nucleic acid and corresponding protein called STEAP-1 useful in the treatment and detection of cancer |
EP1434881A4 (en) | 2001-09-17 | 2005-10-26 | Protein Design Labs Inc | Methods of diagnosis of cancer compositions and methods of screening for modulators of cancer |
US20050004017A1 (en) | 2001-09-18 | 2005-01-06 | Yuval Reiss | Methods and compositions for treating hcap associated diseases |
EP2153843B1 (en) | 2001-09-18 | 2012-08-15 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
CA2460621A1 (en) | 2001-09-19 | 2003-03-27 | Nuvelo, Inc. | Novel nucleic acids and polypeptides |
WO2003026577A2 (en) | 2001-09-24 | 2003-04-03 | Seattle Genetics, Inc. | P-amidobenzylethers in drug delivery agents |
US7091186B2 (en) | 2001-09-24 | 2006-08-15 | Seattle Genetics, Inc. | p-Amidobenzylethers in drug delivery agents |
WO2003026493A2 (en) | 2001-09-28 | 2003-04-03 | Bing Yang | Diagnosis and treatment of diseases caused by mutations in cd72 |
WO2003029421A2 (en) | 2001-10-03 | 2003-04-10 | Origene Technologies, Inc. | Regulated breast cancer genes |
WO2003029277A2 (en) | 2001-10-03 | 2003-04-10 | Rigel Pharmaceuticals, Inc. | Modulators of lymphocyte activation and migration |
AR036833A1 (en) | 2001-10-18 | 2004-10-06 | Bayer Corp | HUMAN ANTIBODIES THAT JOIN MN AND HAVE NEUTRALIZING ACTIVITY OF CELLULAR ADHESION. |
US20050123925A1 (en) | 2002-11-15 | 2005-06-09 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
CA2842429A1 (en) | 2001-10-19 | 2003-05-01 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of inflammatory bowel disorders |
EP3184539A3 (en) | 2001-10-23 | 2017-09-13 | PSMA Development Company L.L.C. | Psma antibodies |
CA2465268A1 (en) | 2001-10-24 | 2003-05-01 | National Jewish Medical And Research Center | Three-dimensional structures of tall-1 and its cognate receptors and modified proteins and methods related thereto |
KR20110032003A (en) | 2001-10-31 | 2011-03-29 | 알콘, 인코퍼레이티드 | Bone morphogenic proteins (bmp), bmp receptors and bmp binding proteins and their use in the diagnosis and treatment of glaucoma |
US20030232350A1 (en) | 2001-11-13 | 2003-12-18 | Eos Biotechnology, Inc. | Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer |
WO2003042661A2 (en) | 2001-11-13 | 2003-05-22 | Protein Design Labs, Inc. | Methods of diagnosis of cancer, compositions and methods of screening for modulators of cancer |
US20050123536A1 (en) | 2001-11-20 | 2005-06-09 | Che-Leung Law | Treatment of immunological disorders using anti-dc30 antibodies |
AU2002339691A1 (en) | 2001-11-29 | 2003-06-10 | Genset | Agonists and antagonists of prolixin for the treatment of metabolic disorders |
CA2467738A1 (en) | 2001-12-03 | 2003-06-12 | Abgenix, Inc. | Antibodies against carboxic anhydrase ix (ca ix) tumor antigen |
AU2002349784A1 (en) | 2001-12-03 | 2003-06-17 | Asahi Kasei Pharma Corporation | Nf-kappab activating genes |
EP1504099A4 (en) | 2001-12-10 | 2006-05-10 | Nuvelo Inc | Novel nucleic acids and polypeptides |
US20030134790A1 (en) | 2002-01-11 | 2003-07-17 | University Of Medicine And Dentistry Of New Jersey | Bone Morphogenetic Protein-2 And Bone Morphogenetic Protein-4 In The Treatment And Diagnosis Of Cancer |
US7452675B2 (en) | 2002-01-25 | 2008-11-18 | The Queen's Medical Center | Methods of screening for TRPM4b modulators |
CN1652821A (en) | 2002-01-28 | 2005-08-10 | 米德列斯公司 | Human monoclonal antibodies to prostate specific membrane antigen (PSMA) |
US20030202975A1 (en) | 2002-02-21 | 2003-10-30 | Tedder Thomas F. | Reagents and treatment methods for autoimmune diseases |
CA2477163C (en) | 2002-02-21 | 2010-07-27 | Institute Of Virology | Soluble form of carbonic anhydrase ix (s-ca-ix), assays to detect s-ca ix, and ca ix's coexpression with her-2/neu/c-erbb-2, and ca ix-specific monoclonal antibodies to non-immunodominant epitopes |
EP2388265A1 (en) | 2002-02-22 | 2011-11-23 | Genentech, Inc. | Compositions and methods for the treatment of immune related diseases |
KR101017732B1 (en) | 2002-03-01 | 2011-02-28 | 이뮤노메딕스, 인코오포레이티드 | Internalizing anti-CD74 antibodies and methods of use |
WO2003074662A2 (en) | 2002-03-01 | 2003-09-12 | Exelixis, Inc. | SCDs AS MODIFIERS OF THE p53 PATHWAY AND METHODS OF USE |
US20090162382A1 (en) | 2002-03-01 | 2009-06-25 | Bernett Matthew J | Optimized ca9 antibodies and methods of using the same |
WO2003104399A2 (en) | 2002-06-07 | 2003-12-18 | Avalon Pharmaceuticals, Inc | Cancer-linked gene as target for chemotherapy |
EP2287198A3 (en) | 2002-03-13 | 2011-05-25 | Biogen Idec MA Inc. | Anti-alpha V beta 6 antibodies |
EP2258712A3 (en) | 2002-03-15 | 2011-05-04 | Multicell Immunotherapeutics, Inc. | Compositions and Methods to Initiate or Enhance Antibody and Major-histocompatibility Class I or Class II-restricted T Cell Responses by Using Immunomodulatory, Non-coding RNA Motifs |
WO2004000997A2 (en) | 2002-03-19 | 2003-12-31 | Curagen Corporation | Therapeutic polypeptides, nucleic acids encoding same, and methods of use |
WO2003081210A2 (en) | 2002-03-21 | 2003-10-02 | Sunesis Pharmaceuticals, Inc. | Identification of kinase inhibitors |
US7193069B2 (en) | 2002-03-22 | 2007-03-20 | Research Association For Biotechnology | Full-length cDNA |
EP1490085A2 (en) | 2002-03-25 | 2004-12-29 | Uab Research Foundation | Fc receptor homolog, reagents, and uses thereof |
AU2003222103A1 (en) | 2002-03-28 | 2003-10-13 | Idec Pharmaceuticals Corporation | Novel gene targets and ligands that bind thereto for treatment and diagnosis of colon carcinomas |
US20030194704A1 (en) | 2002-04-03 | 2003-10-16 | Penn Sharron Gaynor | Human genome-derived single exon nucleic acid probes useful for gene expression analysis two |
CA2481503A1 (en) | 2002-04-05 | 2003-10-23 | Agensys, Inc. | Nucleic acid and corresponding protein entitled 98p4b6 useful in treatment and detection of cancer |
US7435797B2 (en) | 2002-04-10 | 2008-10-14 | Genentech, Inc. | Anti-HER2 antibody variants |
WO2003087768A2 (en) | 2002-04-12 | 2003-10-23 | Mitokor | Targets for therapeutic intervention identified in the mitochondrial proteome |
EP1571968A4 (en) | 2002-04-16 | 2007-10-17 | Genentech Inc | Compositions and methods for the diagnosis and treatment of tumor |
US20030224467A1 (en) | 2002-04-17 | 2003-12-04 | Osborne C. Kent | AIB1 as a prognostic marker and predictor of resistance to endocrine therapy |
WO2003093444A2 (en) | 2002-05-03 | 2003-11-13 | Incyte Corporation | Transporters and ion channels |
EP1572925A4 (en) | 2002-05-15 | 2007-08-15 | Avalon Pharmaceuticals | Cancer-linked gene as target for chemotherapy |
WO2003101388A2 (en) | 2002-05-30 | 2003-12-11 | Bristol-Myers Squibb Company | Human solute carrier family 7 member 11 (hslc7a11) |
WO2003101283A2 (en) | 2002-06-04 | 2003-12-11 | Incyte Corporation | Diagnostics markers for lung cancer |
CA2488284A1 (en) | 2002-06-04 | 2003-12-11 | Avalon Pharmaceuticals, Inc. | Cancer-linked gene as target for chemotherapy |
WO2003104270A2 (en) | 2002-06-06 | 2003-12-18 | Ingenium Pharmaceuticals Ag | Dudulin 2 genes, expression products, non-human animal model: uses in human hematological disease |
CA2488404C (en) | 2002-06-06 | 2012-11-27 | Oncotherapy Science, Inc. | Genes and polypeptides relating to human colon cancers |
AU2003245441A1 (en) | 2002-06-12 | 2003-12-31 | Avalon Pharmaceuticals, Inc. | Cancer-linked gene as target for chemotherapy |
CA2487809A1 (en) | 2002-06-18 | 2003-12-24 | Archemix Corp. | Aptamer-toxin molecules and methods for using same |
US20040249130A1 (en) | 2002-06-18 | 2004-12-09 | Martin Stanton | Aptamer-toxin molecules and methods for using same |
US7304149B2 (en) | 2002-06-20 | 2007-12-04 | Washington University In St. Louis | BTLA nucleic acids |
US20060275287A1 (en) | 2002-06-21 | 2006-12-07 | Brad St Croix | Scroll compressor |
AU2003247762B2 (en) | 2002-07-03 | 2008-05-01 | Immunogen, Inc. | Antibodies to non-shed MUC1 and MUC16, and uses thereof |
WO2004009622A2 (en) | 2002-07-19 | 2004-01-29 | Cellzome Ag | Protein complexes of cellular networks underlying the development of cancer and other diseases |
JP2005533863A (en) | 2002-07-25 | 2005-11-10 | ジェネンテック・インコーポレーテッド | TACI antibodies and their uses |
EP1575514A2 (en) | 2002-07-31 | 2005-09-21 | Seattle Genetics, Inc. | Anti-cd20 antibody-drug conjugates for the treatment of cancer and immune disorders |
JP2004121218A (en) | 2002-08-06 | 2004-04-22 | Jenokkusu Soyaku Kenkyusho:Kk | Method for testing bronchial asthma or chronic obstructive pulmonary disease |
AU2003251471A1 (en) | 2002-08-06 | 2004-02-25 | Bayer Healthcare Ag | Diagnostics and therapeutics for diseases associated with human cxc chemokine receptor 5(cxcr5) |
AU2003259913A1 (en) | 2002-08-19 | 2004-03-03 | Genentech, Inc. | Compositions and methods for the diagnosis and treatment of tumor |
US20090252738A1 (en) | 2002-08-23 | 2009-10-08 | Novartis Vaccines And Diagnostics, Inc. | Compositions and methods of therapy for cancers characterized by expression of the tumor-associated antigen mn/ca ix |
EP1572957A4 (en) | 2002-08-27 | 2007-10-10 | Bristol Myers Squibb Pharma Co | Identification of polynucleotides for predicting activity of compounds that interact with and/or modulate protein tyrosine kinases and/or protein tyrosine kinase pathways in breast cells |
WO2004020595A2 (en) | 2002-08-29 | 2004-03-11 | Five Prime Therapeutics, Inc. | Novel human polypeptides encoded by polynucleotides |
WO2004019993A1 (en) | 2002-08-30 | 2004-03-11 | Ramot At Tel Aviv University Ltd. | Self-immolative dendrimers releasing many active moieties upon a single activating event |
AU2002951346A0 (en) | 2002-09-05 | 2002-09-26 | Garvan Institute Of Medical Research | Diagnosis of ovarian cancer |
CN1691964A (en) | 2002-09-06 | 2005-11-02 | 曼康公司 | Epitope sequences |
CA2498264A1 (en) | 2002-09-09 | 2004-05-13 | Nura, Inc. | G protein coupled receptors and uses thereof |
JP2004113151A (en) | 2002-09-27 | 2004-04-15 | Sankyo Co Ltd | Oncogene and its application |
US7541440B2 (en) | 2002-09-30 | 2009-06-02 | Immunomedics, Inc. | Chimeric, human and humanized anti-granulocyte antibodies and methods of use |
CA2500978A1 (en) | 2002-10-03 | 2004-04-15 | Mcgill University | Antibodies and cyclic peptides which bind cea (carcinoembryonic antigen) and their use as cancer therapeutics |
CA2501131A1 (en) | 2002-10-04 | 2004-04-22 | Van Andel Research Institute | Molecular sub-classification of kidney tumors and the discovery of new diagnostic markers |
US7803372B2 (en) | 2002-10-08 | 2010-09-28 | Immunomedics, Inc. | Antibody therapy |
JP5354835B2 (en) | 2002-11-07 | 2013-11-27 | イミュノジェン・インコーポレーテッド | Anti-CD33 antibody and method for treating acute myeloid leukemia using the same |
WO2004044178A2 (en) | 2002-11-13 | 2004-05-27 | Genentech, Inc. | Methods and compositions for diagnosing dysplasia |
US7705045B2 (en) | 2002-11-14 | 2010-04-27 | Syntarga, B.V. | Prodrugs built as multiple self-elimination-release spacers |
GB0226593D0 (en) | 2002-11-14 | 2002-12-24 | Consultants Ltd | Compounds |
AU2003298650B2 (en) | 2002-11-15 | 2010-03-11 | Musc Foundation For Research Development | Complement receptor 2 targeted complement modulators |
WO2004045553A2 (en) | 2002-11-15 | 2004-06-03 | The Board Of Trustees Of The University Of Arkansas | Ca125 gene and its use for diagnostic and therapeutic interventions |
AU2003297300A1 (en) | 2002-11-20 | 2004-06-15 | Biogen Idec Inc. | Novel gene targets and ligands that bind thereto for treatment and diagnosis of carcinomas |
CA2507044A1 (en) | 2002-11-21 | 2004-06-10 | Mary Lucero | Purinergic modulation of smell |
WO2004048938A2 (en) | 2002-11-26 | 2004-06-10 | Protein Design Labs, Inc. | Methods of detecting soft tissue sarcoma, compositions and methods of screening for soft tissue sarcoma modulators |
AU2003302774A1 (en) | 2002-12-06 | 2004-06-30 | Diadexus, Inc. | Compositions, splice variants and methods relating to ovarian specific genes and proteins |
JP2004198419A (en) | 2002-12-13 | 2004-07-15 | Bayer Healthcare Llc | Detection method using timp1 |
CA2510315C (en) | 2002-12-20 | 2014-01-28 | Protein Design Labs, Inc. | Antibodies against gpr64 and uses thereof |
AU2003299819A1 (en) | 2002-12-23 | 2004-07-22 | Human Genome Sciences, Inc. | Neutrokine-alpha conjugate, neutrokine-alpha complex, and uses thereof |
EP1597558A2 (en) | 2003-01-08 | 2005-11-23 | Bristol-Myers Squibb Company | Biomarkers and methods for determining sensitivity to epidermal growth factor receptor modulators |
US20050181375A1 (en) | 2003-01-10 | 2005-08-18 | Natasha Aziz | Novel methods of diagnosis of metastatic cancer, compositions and methods of screening for modulators of metastatic cancer |
US20050227301A1 (en) | 2003-01-10 | 2005-10-13 | Polgen | Cell cycle progression proteins |
EP1583820A4 (en) | 2003-01-14 | 2007-07-18 | Bristol Myers Squibb Co | Polynucleotides and polypeptides associated with the nf-kb pathway |
WO2004065576A2 (en) | 2003-01-15 | 2004-08-05 | Millennium Pharmaceuticals, Inc. | Methods and compositions for the treatment of urological disorder using differential expressed polypeptides |
EP2336189A1 (en) | 2003-01-28 | 2011-06-22 | Proscan RX Pharma | Prostate cancer diagnosis and treatment |
CN1767860A (en) | 2003-01-31 | 2006-05-03 | 免疫医疗公司 | Methods and compositions for administering therapeutic and diagnostic agents |
EP1592713A2 (en) | 2003-02-13 | 2005-11-09 | Pharmacia Corporation | Antibodies to c-met for the treatment of cancers |
EP1594893A2 (en) | 2003-02-14 | 2005-11-16 | Sagres Discovery, Inc. | Therapeutic targets in cancer |
US20030224411A1 (en) | 2003-03-13 | 2003-12-04 | Stanton Lawrence W. | Genes that are up- or down-regulated during differentiation of human embryonic stem cells |
DK1636593T5 (en) | 2003-06-06 | 2009-07-27 | Genentech Inc | Modulating the interaction between HGF-beta chain and c-met |
KR20140142311A (en) | 2003-06-27 | 2014-12-11 | 암젠 프레몬트 인코포레이티드 | Antibodies directed to the deletion mutants of epidermal growth factor receptor and uses thereof |
US7902338B2 (en) | 2003-07-31 | 2011-03-08 | Immunomedics, Inc. | Anti-CD19 antibodies |
EP1648512A4 (en) | 2003-07-31 | 2009-01-21 | Immunomedics Inc | Anti-cd19 antibodies |
HN2004000285A (en) | 2003-08-04 | 2006-04-27 | Pfizer Prod Inc | ANTIBODIES DIRECTED TO c-MET |
GB0321295D0 (en) | 2003-09-11 | 2003-10-15 | Spirogen Ltd | Synthesis of protected pyrrolobenzodiazepines |
CA2548282A1 (en) | 2003-12-11 | 2005-06-30 | Genentech, Inc. | Methods and compositions for inhibiting c-met dimerization and activation |
WO2005079479A2 (en) | 2004-02-17 | 2005-09-01 | Absalus, Inc. | Super-humanized antibodies against respiratory syncytial virus |
EP1718667B1 (en) | 2004-02-23 | 2013-01-09 | Genentech, Inc. | Heterocyclic self-immolative linkers and conjugates |
US20060035907A1 (en) | 2004-02-23 | 2006-02-16 | Christensen James G | Methods of treating abnormal cell growth using c-MET and m-TOR inhibitors |
DK2270010T3 (en) | 2004-03-01 | 2012-05-14 | Spirogen Ltd | 11-Hydroxy-5h-pyrrolo [2,1-c] [1,4] benzodiazepin-5-one derivatives as important intermediates in the preparation of c2-substituted pyrrolobenzodiazepines |
GB0404577D0 (en) | 2004-03-01 | 2004-04-07 | Spirogen Ltd | Pyrrolobenzodiazepines |
EP2497497B1 (en) | 2004-07-02 | 2017-06-21 | Wilex AG | Improved adjuvant therapy of G250-expressing tumors |
MX2007000723A (en) | 2004-07-22 | 2007-03-12 | Genentch Inc | Her2 antibody composition. |
PL1773885T3 (en) | 2004-08-05 | 2010-09-30 | Genentech Inc | Humanized anti-cmet antagonists |
ES2579805T3 (en) | 2004-09-23 | 2016-08-16 | Genentech, Inc. | Antibodies and conjugates engineered with cysteine |
EP1799262A4 (en) | 2004-10-15 | 2009-10-21 | Seattle Genetics Inc | Anti-cd70 antibody and its use for the treatment and prevention of cancer and immune disorders |
JO3000B1 (en) | 2004-10-20 | 2016-09-05 | Genentech Inc | Antibody Formulations. |
ATE432293T1 (en) | 2004-11-09 | 2009-06-15 | Philogen Spa | ANTIBODIES TO TENASCIN-C |
CA2589374C (en) | 2004-11-30 | 2016-05-03 | Curagen Corporation | Antibodies directed to gpnmb and uses thereof |
KR101385886B1 (en) | 2005-02-03 | 2014-04-24 | 안티토페 리미티드 | Human antibodies and proteins |
JP5249587B2 (en) | 2005-02-18 | 2013-07-31 | メダレックス, インク. | Monoclonal antibody against prostate specific membrane antigen (PSMA) lacking fucosyl residues |
ES2539790T3 (en) | 2005-03-25 | 2015-07-06 | Genentech, Inc. | Methods and compositions to modulate hyperstabilized c-met |
PL1879901T3 (en) | 2005-04-21 | 2010-06-30 | Medimmune Ltd | Pyrrolobenzodiazepines |
CN104072614B (en) | 2005-07-08 | 2017-04-26 | 生物基因Ma公司 | Anti-alpha[v]beta[6] antibodies and uses thereof |
JP2009506790A (en) | 2005-09-07 | 2009-02-19 | メディミューン,エルエルシー | EPH receptor antibody conjugated to toxin |
EP1934174B1 (en) | 2005-10-07 | 2011-04-06 | Exelixis, Inc. | Azetidines as mek inhibitors for the treatment of proliferative diseases |
SI1813614T1 (en) | 2006-01-25 | 2012-01-31 | Sanofi 174 | Cytotoxic agents comprising new tomaymycin derivatives |
RU2008142833A (en) | 2006-03-30 | 2010-05-10 | Новартис АГ (CH) | COMPOSITIONS AND METHODS OF APPLICATION OF ANTIBODIES TO c-Met |
JP2009532358A (en) | 2006-03-31 | 2009-09-10 | マサチューセッツ・インスティテュート・オブ・テクノロジー | Treatment of tumors expressing mutant EGF receptors |
BRPI0712850A8 (en) | 2006-06-07 | 2018-05-02 | Bioalliance Cv | antibodies that recognize a cd-43 and cea carbohydrate-containing epitope expressed in cancer cells and methods of using them |
AU2007348941B2 (en) | 2006-08-03 | 2011-08-04 | Medimmune Limited | Antibodies directed to alphaVbeta6 and uses thereof |
AU2007285976B2 (en) | 2006-08-14 | 2011-08-18 | Xencor, Inc | Optimized antibodies that target CD19 |
US20080138898A1 (en) | 2006-10-31 | 2008-06-12 | Immunogen, Inc. | Methods for improving antibody production |
CA2683568A1 (en) | 2007-05-08 | 2008-11-20 | Genentech, Inc. | Cysteine engineered anti-muc16 antibodies and antibody drug conjugates |
EP2014681A1 (en) | 2007-07-12 | 2009-01-14 | Pierre Fabre Medicament | Novel antibodies inhibiting c-met dimerization, and uses thereof |
PT2211904T (en) | 2007-10-19 | 2016-11-02 | Seattle Genetics Inc | Cd19 binding agents and uses thereof |
NZ584514A (en) | 2007-10-19 | 2012-07-27 | Genentech Inc | Cysteine engineered anti-tenb2 antibodies and antibody drug conjugates |
WO2009056342A1 (en) | 2007-11-02 | 2009-05-07 | Wilex Ag | Binding epitopes for g250 antibody |
RU2528738C2 (en) | 2007-12-18 | 2014-09-20 | Биоэллаенс К.В. | Antibodies recognising epitope on cd43 and cea expressed on malignant cells and methods for using them |
CN101945667A (en) | 2007-12-21 | 2011-01-12 | 健泰科生物技术公司 | Therapy of rituximab-refractory rheumatoid arthritis patients |
RU2547939C2 (en) | 2007-12-26 | 2015-04-10 | Биотест Аг | Anti-cd138 immunoconjugates and using them |
WO2009080829A1 (en) | 2007-12-26 | 2009-07-02 | Biotest Ag | Agents targeting cd138 and uses thereof |
TWI472339B (en) | 2008-01-30 | 2015-02-11 | Genentech Inc | Composition comprising antibody that binds to domain ii of her2 and acidic variants thereof |
DK2132228T3 (en) | 2008-04-11 | 2011-10-10 | Emergent Product Dev Seattle | CD37 immunotherapeutic agent and combination with its bifunctional chemotherapeutic agent |
KR20110033233A (en) | 2008-07-21 | 2011-03-30 | 이뮤노메딕스, 인코오포레이티드 | Structural variants of antibodies for improved therapeutic characteristics |
JP2012507555A (en) | 2008-10-31 | 2012-03-29 | アボット バイオセラピューティクス コーポレイション | Use of anti-CS1 antibodies in the treatment of rare diseases |
PA8849001A1 (en) | 2008-11-21 | 2010-06-28 | Lilly Co Eli | C-MET ANTIBODIES |
US8545839B2 (en) | 2008-12-02 | 2013-10-01 | Pierre Fabre Medicament | Anti-c-Met antibody |
AR074439A1 (en) | 2008-12-02 | 2011-01-19 | Pf Medicament | ANTI-CMET ANTIBODY (C-MET RECEIVER) |
CN105175434A (en) | 2009-02-05 | 2015-12-23 | 伊缪诺金公司 | Novel benzodiazepine derivatives |
WO2010128087A2 (en) | 2009-05-06 | 2010-11-11 | Biotest Ag | Uses of immunoconjugates targeting cd138 |
US20120052070A1 (en) | 2009-05-07 | 2012-03-01 | Novartis Ag | Compositions and methods of use for binding molecules to dickkopf-1 or dickkopf-4 or both |
US8287865B2 (en) | 2009-09-16 | 2012-10-16 | Immunomedics, Inc. | Class I anti-CEA antibodies and uses thereof |
US20110028129A1 (en) | 2009-10-13 | 2011-02-03 | Hutchison James W | Proximity Triggered Profile-Based Wireless Matching |
KR101671378B1 (en) | 2009-10-30 | 2016-11-01 | 삼성전자 주식회사 | c-Met specific antibodies and uses thereof |
KR101748707B1 (en) | 2009-11-27 | 2017-06-20 | 삼성전자주식회사 | c-Met specific antibodies and diagnosis kit for cancer using thereof |
ES2594893T3 (en) | 2009-12-16 | 2016-12-23 | Abbvie Biotherapeutics Inc. | Anti HER2 antibodies and their uses |
US8609095B2 (en) | 2010-03-04 | 2013-12-17 | Symphogen A/S | Anti-HER2 antibodies and compositions |
WO2011130613A1 (en) * | 2010-04-15 | 2011-10-20 | Seattle Genetics, Inc. | Targeted pyrrolobenzodiazapine conjugates |
ES2430567T3 (en) * | 2010-04-15 | 2013-11-21 | Spirogen Sàrl | Pyrrolobenzodiazepines and conjugates thereof |
US8697688B2 (en) | 2010-04-15 | 2014-04-15 | Seattle Genetics Inc. | Pyrrolobenzodiazepines used to treat proliferative diseases |
-
2014
- 2014-03-13 CN CN201480026705.9A patent/CN105209077B/en not_active Expired - Fee Related
- 2014-03-13 WO PCT/EP2014/054958 patent/WO2014140174A1/en active Application Filing
- 2014-03-13 JP JP2015562150A patent/JP6444902B2/en not_active Expired - Fee Related
- 2014-03-13 KR KR1020157028767A patent/KR102066319B1/en active IP Right Grant
- 2014-03-13 US US14/774,531 patent/US20160031887A1/en not_active Abandoned
- 2014-03-13 EP EP14711942.4A patent/EP2968585B1/en not_active Not-in-force
- 2014-03-13 AU AU2014230735A patent/AU2014230735B2/en not_active Ceased
- 2014-03-13 NZ NZ712035A patent/NZ712035A/en not_active IP Right Cessation
- 2014-03-13 BR BR112015023333A patent/BR112015023333A8/en not_active Application Discontinuation
- 2014-03-13 MX MX2015012278A patent/MX362970B/en active IP Right Grant
- 2014-03-13 CA CA2905181A patent/CA2905181C/en not_active Expired - Fee Related
- 2014-03-13 ES ES14711942.4T patent/ES2687439T3/en active Active
-
2015
- 2015-09-09 ZA ZA2015/06668A patent/ZA201506668B/en unknown
-
2016
- 2016-06-30 HK HK16107640.1A patent/HK1219651A1/en not_active IP Right Cessation
Also Published As
Publication number | Publication date |
---|---|
WO2014140174A1 (en) | 2014-09-18 |
NZ712035A (en) | 2019-06-28 |
KR102066319B1 (en) | 2020-01-14 |
EP2968585A1 (en) | 2016-01-20 |
JP2016512211A (en) | 2016-04-25 |
US20160031887A1 (en) | 2016-02-04 |
BR112015023333A2 (en) | 2017-12-26 |
CN105209077B (en) | 2019-06-11 |
CA2905181C (en) | 2020-06-02 |
KR20150131210A (en) | 2015-11-24 |
ES2687439T3 (en) | 2018-10-25 |
AU2014230735A1 (en) | 2015-10-01 |
HK1219651A1 (en) | 2017-04-13 |
EP2968585B1 (en) | 2018-07-18 |
ZA201506668B (en) | 2017-01-25 |
MX2015012278A (en) | 2016-04-15 |
MX362970B (en) | 2019-02-28 |
CN105209077A (en) | 2015-12-30 |
BR112015023333A8 (en) | 2018-04-17 |
AU2014230735B2 (en) | 2018-03-15 |
JP6444902B2 (en) | 2018-12-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CA2905181C (en) | Pyrrolobenzodiazepines and conjugates thereof for providing targeted therapy | |
US10420777B2 (en) | Pyrrolobenzodiazepines and conjugates thereof | |
AU2013366493B2 (en) | Pyrrolobenzodiazepines and conjugates thereof | |
US10188746B2 (en) | Pyrrolobenzodiazepines and conjugates thereof | |
AU2013366490B9 (en) | Unsymmetrical pyrrolobenzodiazepines-dimers for use in the treatment of proliferative and autoimmune diseases | |
US9649390B2 (en) | Pyrrolobenzodiazepines and conjugates thereof | |
CA2850371C (en) | Pyrrolobenzodiazepines and conjugates thereof | |
CA2901941C (en) | Pyrrolobenzodiazepines and conjugates thereof | |
EP2528625A1 (en) | Pyrrolobenzodiazepines and conjugates thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request |
Effective date: 20190308 |
|
MKLA | Lapsed |
Effective date: 20210315 |