CA2296840A1 - Dna sequence coding for a hydroxyphenylpyruvate dioxygenase and overproduction thereof in plants - Google Patents
Dna sequence coding for a hydroxyphenylpyruvate dioxygenase and overproduction thereof in plants Download PDFInfo
- Publication number
- CA2296840A1 CA2296840A1 CA002296840A CA2296840A CA2296840A1 CA 2296840 A1 CA2296840 A1 CA 2296840A1 CA 002296840 A CA002296840 A CA 002296840A CA 2296840 A CA2296840 A CA 2296840A CA 2296840 A1 CA2296840 A1 CA 2296840A1
- Authority
- CA
- Canada
- Prior art keywords
- hppd
- plant
- plants
- expression cassette
- ala
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N9/00—Enzymes; Proenzymes; Compositions thereof; Processes for preparing, activating, inhibiting, separating or purifying enzymes
- C12N9/0004—Oxidoreductases (1.)
- C12N9/0069—Oxidoreductases (1.) acting on single donors with incorporation of molecular oxygen, i.e. oxygenases (1.13)
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8242—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits
- C12N15/8243—Phenotypically and genetically modified plants via recombinant DNA technology with non-agronomic quality (output) traits, e.g. for industrial processing; Value added, non-agronomic traits involving biosynthetic or metabolic pathways, i.e. metabolic engineering, e.g. nicotine, caffeine
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N15/00—Mutation or genetic engineering; DNA or RNA concerning genetic engineering, vectors, e.g. plasmids, or their isolation, preparation or purification; Use of hosts therefor
- C12N15/09—Recombinant DNA-technology
- C12N15/63—Introduction of foreign genetic material using vectors; Vectors; Use of hosts therefor; Regulation of expression
- C12N15/79—Vectors or expression systems specially adapted for eukaryotic hosts
- C12N15/82—Vectors or expression systems specially adapted for eukaryotic hosts for plant cells, e.g. plant artificial chromosomes (PACs)
- C12N15/8241—Phenotypically and genetically modified plants via recombinant DNA technology
- C12N15/8261—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield
- C12N15/8271—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance
- C12N15/8274—Phenotypically and genetically modified plants via recombinant DNA technology with agronomic (input) traits, e.g. crop yield for stress resistance, e.g. heavy metal resistance for herbicide resistance
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Genetics & Genomics (AREA)
- Engineering & Computer Science (AREA)
- Chemical & Material Sciences (AREA)
- Zoology (AREA)
- Biotechnology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Wood Science & Technology (AREA)
- Organic Chemistry (AREA)
- General Engineering & Computer Science (AREA)
- Biomedical Technology (AREA)
- Molecular Biology (AREA)
- Microbiology (AREA)
- Biochemistry (AREA)
- General Health & Medical Sciences (AREA)
- Cell Biology (AREA)
- Physics & Mathematics (AREA)
- Biophysics (AREA)
- Plant Pathology (AREA)
- Medicinal Chemistry (AREA)
- Nutrition Science (AREA)
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
- Agricultural Chemicals And Associated Chemicals (AREA)
Abstract
The invention relates to a method for producing plants with an increased yield of vitamin E from biosynthesis by overexpression of a plant HPPD gene from barley.
Description
DNA SEQUENCE CODING FOR A HYDROXYPHENYLPYRUVATE DIOXYGENASE
AND OVERPRODUCTION THEREOF IN PLANTS
The present invention relates to a method of generating plants with an elevated vitamin E content by expressing an exogenous or endogenous HPPD gene in plants or plant organs. The invention furthermore relates to the use of the corresponding nucleic acids encoding an HPPD gene in transgenic plants to make the latter resistant to HPPD inhibitors, and to the use of the DNA sequence encoding an HPPD for generating a test system for identifying HPPD inhibitors.
An important aim in plant molecular genetics is the generation of plants with an elevated content of sugars, enzymes and amino acids. It would also be economically interesting to develop plants with an elevated vitamin content, eg. an elevated vitamin E content.
The eight naturally occurring compounds with vitamin E activity are derivatives of 6-chromanol (Ullmann's Encyclopedia of Industrial Chemistry, Vol. A 27 (1996), VCH Verlagsgesellschaft, Chapter 4., 478-488, Vitamin E). The first group (la - d) is derived from tocol, while the second group is composed of tocotrienol derivatives (2a - d):
HO
~5I 3 \ 1 R O 4, 8, la, a-tocopherol: R1 = Rz = R3 = CH3 lb, (i-tocopherol [148-03-8]: R1 = R3 = CH3, R2 = H
lc, y-tocopherol [ 54-2 8-4 ] : R1 = H, R2 = R3 = CH3 ld, b-tocopherol [119-13-lj: R1 = RZ = H, R3 = CH3 HO
\ ~ 0 _ _/ _ / /
R T 3' 7' 11, 0050/48141 CA 02296840 2000-oi-i3 ., , 2a, a-tocotrienol [ 1721-51-3 j : R1 = RZ = R3 = CH3 2b, (3-tocotrienol [ 490-23-3 j : Rl = R3 = CH3, R2 = H
2c, y-tocotrienol [ 14101-61-2 ] : R1 = H, R2 = R3 = CH3 2d, 8-tocotrienol [25612-59-3j: R1 = R2 = H, R3 = CH3 a-Tocopherol is of great economic importance.
The development of crop plants with an elevated vitamin E content by means of tissue culture or seed mutagenesis and natural selection has its limits. On the one hand, the vitamin E content must be detectable as early as at the tissue culture level and, on the other hand, only those plants can be manipulated via tissue culture techniques which can successfully be regenerated into entire plants, starting from cell cultures. Moreover, following mutagenesis and selection, crop plants may show undesirable characteristics which have to be eliminated by back-crossing, in some cases repeated back-crossing. Also, elevation of the vitamin E content by means of crossing would be limited to plants of the same species.
Those are the reasons why the genetic engineering approach, viz.
isolating an essential biosynthesis gene which encodes the vitamin E synthesis performance and transferring it specifically into crop plants, is superior to the traditional breeding method.
The conditions for this method are that the biosynthesis and its regulation are known and that genes which affect biosynthesis performance are identified.
Tocopherol biosynthesis in plants and algae proceeds in a known ! 30 manner and is as follows:
0050/48141 CA 02296840 2000-oi-i3 ., COOH
=0 HZ OH
HPPD ~ CH2- COOH
OH COZ OH
AND OVERPRODUCTION THEREOF IN PLANTS
The present invention relates to a method of generating plants with an elevated vitamin E content by expressing an exogenous or endogenous HPPD gene in plants or plant organs. The invention furthermore relates to the use of the corresponding nucleic acids encoding an HPPD gene in transgenic plants to make the latter resistant to HPPD inhibitors, and to the use of the DNA sequence encoding an HPPD for generating a test system for identifying HPPD inhibitors.
An important aim in plant molecular genetics is the generation of plants with an elevated content of sugars, enzymes and amino acids. It would also be economically interesting to develop plants with an elevated vitamin content, eg. an elevated vitamin E content.
The eight naturally occurring compounds with vitamin E activity are derivatives of 6-chromanol (Ullmann's Encyclopedia of Industrial Chemistry, Vol. A 27 (1996), VCH Verlagsgesellschaft, Chapter 4., 478-488, Vitamin E). The first group (la - d) is derived from tocol, while the second group is composed of tocotrienol derivatives (2a - d):
HO
~5I 3 \ 1 R O 4, 8, la, a-tocopherol: R1 = Rz = R3 = CH3 lb, (i-tocopherol [148-03-8]: R1 = R3 = CH3, R2 = H
lc, y-tocopherol [ 54-2 8-4 ] : R1 = H, R2 = R3 = CH3 ld, b-tocopherol [119-13-lj: R1 = RZ = H, R3 = CH3 HO
\ ~ 0 _ _/ _ / /
R T 3' 7' 11, 0050/48141 CA 02296840 2000-oi-i3 ., , 2a, a-tocotrienol [ 1721-51-3 j : R1 = RZ = R3 = CH3 2b, (3-tocotrienol [ 490-23-3 j : Rl = R3 = CH3, R2 = H
2c, y-tocotrienol [ 14101-61-2 ] : R1 = H, R2 = R3 = CH3 2d, 8-tocotrienol [25612-59-3j: R1 = R2 = H, R3 = CH3 a-Tocopherol is of great economic importance.
The development of crop plants with an elevated vitamin E content by means of tissue culture or seed mutagenesis and natural selection has its limits. On the one hand, the vitamin E content must be detectable as early as at the tissue culture level and, on the other hand, only those plants can be manipulated via tissue culture techniques which can successfully be regenerated into entire plants, starting from cell cultures. Moreover, following mutagenesis and selection, crop plants may show undesirable characteristics which have to be eliminated by back-crossing, in some cases repeated back-crossing. Also, elevation of the vitamin E content by means of crossing would be limited to plants of the same species.
Those are the reasons why the genetic engineering approach, viz.
isolating an essential biosynthesis gene which encodes the vitamin E synthesis performance and transferring it specifically into crop plants, is superior to the traditional breeding method.
The conditions for this method are that the biosynthesis and its regulation are known and that genes which affect biosynthesis performance are identified.
Tocopherol biosynthesis in plants and algae proceeds in a known ! 30 manner and is as follows:
0050/48141 CA 02296840 2000-oi-i3 ., COOH
=0 HZ OH
HPPD ~ CH2- COOH
OH COZ OH
4-hydroxyphenylpyruvate homogentisic acid (3) (4) i 15 OH
H H
H H
(5) (6) b -tocotrienol (2d) b -tocopherol (ld) ~ .
(~- or Y- tocotrienol ---~ ~- or Y-tocopherol (2b or 2c) (lb or lc) a -tocotrienol (2a) ~ a -tocopherol (la) ~ i The precursor of the aromatic ring of the tocopherols is p-hydroxyphenylpyruvate (3), which is converted enzymatically into homogentisic acid (4) with the aid of the enzyme hydroxyphenylpyruvate dioxygenase (HPPD), and the homogentisic acid reacts with phytyl pyrophosphate with elimination of C02 to give the precursor (6). The tocotrienol biosynthesis route starts with a condensation reaction between homogentisic acid (4) and geranylgeranyl pyrophosphate to give the precursor (5). Enzymatic cyclization of the precursors 5 or 6 gives 8 - tocotrienol or b -tocopherol, respectively. Some of these biosynthesis enzymes have been isolated.
While searching for Arabidopsis mutants with defects in the carotinoid biosynthesis, a white phenotype mutant was identified which is not capable of producing active HPPD. If this mutant, termed pds2, is raised in the presence of homogentisic acid, it produces carotinoids, like the wild type, and greens (Norris et al., Plant Cell (1995) 7: 2139 - 2149). This work shows that HPPD
activity is a prerequisite for the formation of photosynthetically active chloroplasts. Without this enzyme, no plastoquinones are formed, which are required as acceptors for liberated reduction equivalents during carotinoid biosynthesis (phytoene desaturation). The fact that HPPD has a key role in the plastid metabolism makes it an interesting target for herbicides.
Sulcotriones efficiently inhibit the activity of the enzyme (Schultz et al., FEBS Lett. (1993) 318: 162 - 166).
Sequences of HPPD-specific genes are already known from the organisms mentioned below:
Access number Organism Sequence database nee Humans HPPD HUMAN X72389 Pig HPPD PIG D13390 Rat HPPD RAT M18405 Mouse HPPD MOUSE D29987 Streptomyces SA11864 U11864 avermitilis Pseudomonas sp. strain HPPD PSESP P80064 P.J. 874 Arabidopsis HPPD_ARAB1 AF900228 Furthermore, the following sequences, which show a marked homology with HPPD sequences, can be found in the databases:
PEA3 MOUSE: Mus muscula (mouse) PEA3 polypeptide, AC X63190;
MELA SHECO: Shewanella colwelliana, melA protein, AC M59289.
WO 96/38567 describes the HPPD DNA sequence from Arabidopsis thaliana and Daucus carota.
A knowledge of the HPPD DNA sequences is an absolute prerequisite both for the use in crop protection for the generation of herbicide-resistant plants and for increasing the vitamin E
synthesis in plants, for example for producing animal feeds with elevated vitamin E content.
It is an object of the present invention to develop a transgenic plant with elevated vitamin E content.
20 It is a further object of the present invention to develop a transgenic plant which is resistant to HPPD inhibitors.
We have found that these objects are achieved, surprisingly, by overexpressing an HPPD gene in the plants.
It is an additional object of the present invention to develop a test system for identifying HPPD inhibitors.
We have found that this object is achieved by expressing a barley HPPD gene in a plant or in a microorganism and subsequently testing chemicals for inhibition of HPPD enzyme activity.
A first aspect of the present invention relates to the cloning of the complete barley HPPD gene via isolating the HPPD-gene-specific cDNA (HvSD36).
During leaf senescence, the vitamin E content in the leaves is markedly increased (Rise et al., Plant Physiol. (1989) 89:
1028 - 1030).'The monocotyledonous leaf of barley represents a gradient of cells of different ages since the leaf has a basal meristem, from which new cells are formed by successive division.
Thus, the oldest cells are located at the leaf tip and the youngest at the base. Fig. 1 shows a diagram of the primary leaf of barley on various days after sowing. The total leaf length measured can be seen from the scale on the left-hand side. Shown, and termed I - IV, are the leaf sections of the primary leaf which are differentiated to various degrees and which have been ~
(~- or Y- tocotrienol ---~ ~- or Y-tocopherol (2b or 2c) (lb or lc) a -tocotrienol (2a) ~ a -tocopherol (la) ~ i The precursor of the aromatic ring of the tocopherols is p-hydroxyphenylpyruvate (3), which is converted enzymatically into homogentisic acid (4) with the aid of the enzyme hydroxyphenylpyruvate dioxygenase (HPPD), and the homogentisic acid reacts with phytyl pyrophosphate with elimination of C02 to give the precursor (6). The tocotrienol biosynthesis route starts with a condensation reaction between homogentisic acid (4) and geranylgeranyl pyrophosphate to give the precursor (5). Enzymatic cyclization of the precursors 5 or 6 gives 8 - tocotrienol or b -tocopherol, respectively. Some of these biosynthesis enzymes have been isolated.
While searching for Arabidopsis mutants with defects in the carotinoid biosynthesis, a white phenotype mutant was identified which is not capable of producing active HPPD. If this mutant, termed pds2, is raised in the presence of homogentisic acid, it produces carotinoids, like the wild type, and greens (Norris et al., Plant Cell (1995) 7: 2139 - 2149). This work shows that HPPD
activity is a prerequisite for the formation of photosynthetically active chloroplasts. Without this enzyme, no plastoquinones are formed, which are required as acceptors for liberated reduction equivalents during carotinoid biosynthesis (phytoene desaturation). The fact that HPPD has a key role in the plastid metabolism makes it an interesting target for herbicides.
Sulcotriones efficiently inhibit the activity of the enzyme (Schultz et al., FEBS Lett. (1993) 318: 162 - 166).
Sequences of HPPD-specific genes are already known from the organisms mentioned below:
Access number Organism Sequence database nee Humans HPPD HUMAN X72389 Pig HPPD PIG D13390 Rat HPPD RAT M18405 Mouse HPPD MOUSE D29987 Streptomyces SA11864 U11864 avermitilis Pseudomonas sp. strain HPPD PSESP P80064 P.J. 874 Arabidopsis HPPD_ARAB1 AF900228 Furthermore, the following sequences, which show a marked homology with HPPD sequences, can be found in the databases:
PEA3 MOUSE: Mus muscula (mouse) PEA3 polypeptide, AC X63190;
MELA SHECO: Shewanella colwelliana, melA protein, AC M59289.
WO 96/38567 describes the HPPD DNA sequence from Arabidopsis thaliana and Daucus carota.
A knowledge of the HPPD DNA sequences is an absolute prerequisite both for the use in crop protection for the generation of herbicide-resistant plants and for increasing the vitamin E
synthesis in plants, for example for producing animal feeds with elevated vitamin E content.
It is an object of the present invention to develop a transgenic plant with elevated vitamin E content.
20 It is a further object of the present invention to develop a transgenic plant which is resistant to HPPD inhibitors.
We have found that these objects are achieved, surprisingly, by overexpressing an HPPD gene in the plants.
It is an additional object of the present invention to develop a test system for identifying HPPD inhibitors.
We have found that this object is achieved by expressing a barley HPPD gene in a plant or in a microorganism and subsequently testing chemicals for inhibition of HPPD enzyme activity.
A first aspect of the present invention relates to the cloning of the complete barley HPPD gene via isolating the HPPD-gene-specific cDNA (HvSD36).
During leaf senescence, the vitamin E content in the leaves is markedly increased (Rise et al., Plant Physiol. (1989) 89:
1028 - 1030).'The monocotyledonous leaf of barley represents a gradient of cells of different ages since the leaf has a basal meristem, from which new cells are formed by successive division.
Thus, the oldest cells are located at the leaf tip and the youngest at the base. Fig. 1 shows a diagram of the primary leaf of barley on various days after sowing. The total leaf length measured can be seen from the scale on the left-hand side. Shown, and termed I - IV, are the leaf sections of the primary leaf which are differentiated to various degrees and which have been ~
selected for gene expression analysis. The plants were raised in a daily light/dark photoperiod (L/D) and, for inducing senescence, were excised after 6 days and incubated for 2 days in the dark (2 nD). A "Northern blot" analysis of RNA from the barley primary leaf from sections which had differentiated to various degrees (see Fig. 2) suggest that HPPD expression in barley is controlled in a development-dependent manner. Thus, copious accumulation of the approx. 1600 nt long transcript takes place in the meristematic region on the primary leaf base (I). The content of this transcript decreases with increasing age of the tissue (IIa and IIb) and increases again in the fully differentiated cells with mature chloroplasts (III). Finally, the content of the 1600 nt long transcript is highest in the senescing sections of the primary leaf (IV). In addition, an approx. 3100 nt long transcript can be detected only in the meristematic cells on the base of the primary leaf. Again, this transcript can no longer be detected with increasing tissue maturation.
With the aid of the so-called "Differential Display" method, a 207 by cDNA fragment was first isolated whose corresponding transcript accumulates in the primary leaf of barley in the case of dark-induced senescence. This fragment (sequence protocol:
sequence ID NO:1: nucleotide position 1342 - 1549) was subsequently used as a probe to isolate a cDNA clone with a larger insert in a cDNA library (in ~,-ZAP-II) from senescing barley flag leaves:
Diagram of the cDNA subclone HvSD 36 from the ~,-ZAP-II library:
,! 3 0 T~ -~XhoI SaII HindIII EcoRI NcoI PstI EcoRI PstI BamHI XbaI ~- T3 3 5 14 by 759 by 14 by The cDNA fragment (sequence protocol: Sequence ID NO:1:
nucleotide position 771 - 1529) was cloned into the EcoRl 40 cleavage site of pBluescript(SK-). In addition, both ends of the cDNA are equipped with a 14 by adaptor sequence which was required for ligation into ~,-ZAP-II. Selected restriction sites of the vector and of the cDNA itself are shown.
45 The 759 by long cDNA fragment was used as probe in a further experiment to obtain a complete sequence of HvSD 36. To this end, a cDNA library from RNA of the meristematic section of 5-day-old . ~ 0050/48141 barley seedlings was available. The lambda phage ExCeli Eco RICIP
from Pharmacia (Freiburg) (product number: 27-5011, 45.5kb) was used for this cDNA library.
A 1565 by long cDNA clone was isolated, see sequence protocol:
sequence ID NO:1: and 2.
Amongst the sequences in the databases, the 434 amino acids long protein sequence has a homology of 58%, which is the highest homology with the HPPD sequence from Arabidopsis tha3iana.
To find a genomic clone which contains the complete HPPD gene sequence, a lambda FIXII library of barley was obtained from Stratagene (Heidelberg, product number 946104). The library was prepared using DNA from etiolated leaves of winter barley cv.
Igri. The DNA was subjected to partial digestion with Sau3AI.
Prior to cloning into the Xhol cleavage site of the vector, the fragment ends and the phage arms were filled up with nucleotides.
Screening of the library with 200,000 pfu in the first round gave only one clone which hybridized with cDNA HvSD36. After subjecting this recombinant phage to restriction digestion with PstI and SacI, fragments of a size of 5400, 3800 and 1800 bp, respectively, were isolated which can be detected in a "Southern"
blot hybridization with the HvSD36 probe. These sub-fragments exist in cloned form in the Bluescript vector. Figure 3 shows the construction of the barley HPPD gene in the form of a diagram.
The invention relates in particular to expression cassettes whose sequence encodes an HPPD or a functional equivalent thereof, and ," 30 to the use of these expression cassettes for generating a plant with an elevated vitamin E content. The nucleic acid sequence may be, for example, a DNA or a cDNA sequence. Encoding sequences which are suitable for insertion into an expression cassette according to the invention are, for example, those which encode an HPPD and which impart, to the host, the ability to overproduce vitamin E.
In addition, the expression cassettes according to the invention comprise regulatory nucleic acid sequences which govern expression of the encoding sequence in the host cell. In accordance with a preferred embodiment, an expression cassette according to the invention comprises upstream, ie. on the 5' end of the encoding sequence, a promoter and downstream, ie. on the 3' end, a polyadenylation signal and, if appropriate, other regulatory elements which are operatively linked with the encoding sequence for the HPPD gene which is located in-between.
Operative linkage is to be understood as meaning the sequential arrangement of promoter, encoding sequence, terminator and, if appropriate, other regulatory elements in such a way that each of the regulatory elements can fulfill its function as intended when the encoding sequence is expressed. The sequences preferred for operative linkage, but not limited thereto, are targeting sequences for guaranteeing subcellular localization in the apoplast, in the vacuole, in plastids, in the mitochondrium, in the endoplasmatic reticulum (ER), in the nucleus, in liposomes or in other compartments and translation enhancers such as the 5' leader sequence from the tobacco mosaic virus (Gallie et al., Nucl. Acids Res. 15 (1987) 8693 - 8711).
For example, the plant expression cassette can be incorporated into the tobacco transformation vector pBinAR-Hyg. Fig. 4 shows the tobacco transformation vectors pBinAR-Hyg with 35S
promoter (A) and pBinAR-Hyg with seed-specific promoter phaseolin 796 (B):
- HPT: hygromycin phosphotransferase - OCS: octopine synthase terminator - PNOS: nopaline synthase promoter - those restriction sites which cleave the vector only once are also shown.
Suitable as promoters of the expression cassette according to the invention are, in principle, all promoters which can control the expression of foreign genes in plants. In particular a plant promoter or a promoter derived from a plant virus is preferably used. Particularly preferred is the CaMV 35S promoter from ;- 30 cauliflower mosaic viruss (Franck et al., Cell 21 (1980) 285 - 294). It is known that this promoter contains various recognition sequences for transcriptional effectors which in their entirety lead to permanent and constitutive expression of the gene introduced (Benfey et al., EMBO J. 8 (1989) 2195 - 2202).
The expression cassette according to the invention may additionally comprise a chemically inducible promoter by means of which expression of the exogenous HPPD gene in the plant can be controlled at a specific point in time. Such promoters which can be used are, inter alia, for example the PRP1 promoter (Ward et al., Plant. Mol. Biol. 22 (1993), 36I-366), a promoter which can be induced by salicylic acid (WO 95/19443), a promoter which can be induced by benzenesulfonamide (EP-A 388186), a promoter which can be induced by tetracyclin (Gatz et al., (1992) Plant J. 2, 397-404), a promoter which can be induced by abscisic acid ~
. , 0050/48141 (EP-A 335528) or a promoter which can be induced by ethanol or cyclohexanone (WO 93/21334).
Furthermore, particularly preferred promoters are those which ensure expression in tissues or plant organs in which the biosynthesis of vitamin E, or its precursors, takes place.
Promoters which must be mentioned in particular are those which guarantee leaf-specific expression. Promoters which may be mentioned are the potato cytosolic FBPase or the potato ST-LSI
promoter (Stockhaus et al., EMBO J. 8 (1989) 2445 - 245).
With the aid of a seed-specific promoter, it was possible stably to express a foreign protein in the seeds of transgenic tobacco plants in an amount of up to 0.67% of the total soluble seed protein (Fiedler and Conrad, Bio/Technology 10 (1995), 1090-1094). The expression cassette according to the invention can therefore contain, for example, a seed-specific promoter (preferably the phaseolin promoter (US 5504200), the USP
(Baumlein, H. et al. Mol. Gen. Genet. (1991) 225 (3), 459 - 467) or LEB4 promoter (Fiedler and Conrad, 1995)), the LEB4 signal peptide, the gene to be expressed and an ER retention signal. The construction of such a cassette is shown in the form of a diagram in Figure 4 by way of example.
An expression cassette according to the invention is prepared by fusing a suitable promoter with a suitable HPPD DNA sequence and preferably a DNA which is inserted between promoter and HPPD DNA
sequence and which encodes a chloroplast-specific transit peptide, and a polyadenylation signal, using customary ;-- 30 recombination and cloning techniques as they are described, for example, in T. Maniatis, E.F. Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989) and in T.J. Silhavy, M.L. Berman and L.W. Enquist, Experiments with Gene Fusions, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1984) and in Ausubel, F.M. et al., Current Protocols in Molecular Biology, Greene Publishing Assoc. and Wiley-Interscience (1987).
Particularly preferred sequences are those which guarantee targeting into the apoplast, into plastids, into the vacuole, the mitochondrium, the endoplasmatic reticulum (ER), or, by means of the absence of suitable operative sequences, the remaining in the compartment of formation, the cytosol (Kermode, Crit. Rev. Plant Sci. 15, 4 (1996), 285 - 423). Localization in the ER has proved to be especially advantageous for the amount of protein accumulation in transgenic plants (Schouten et al. , Plant Mol.
Biol. 30 (1996), 781 - 792).
The invention also relates to expression cassettes whose DNA
5 sequence encodes an HPPD fusion protein, a moiety of the fusion protein being a transit peptide which governs translocation of the polypeptide. Especially preferred are chloroplast-specific transit peptides which are cleaved enzymatically from the HPPD
moiety after the HPPD gene product has been translocated into the 10 chloroplasts. Particularly preferred is the transit peptide which is derived from plastid transketolase (TK) or a functional equivalent of this transit peptide (eg. the transit peptide of the small subunit of rubisco or of Ferredoxin NADP
oxidoreductase).
t 15 The HPPD-encoding nucleotide sequence inserted can be prepared synthetically or obtained naturally or comprise a mixture of synthetic and natural DNA components. In general, there are prepared synthetic nucleotide sequences with codons which are preferred by plants. These codons which are preferred by plants can be determined from amongst codons with the highest protein frequency which are expressed in most interesting plant species.
When preparing an expression cassette, various DNA fragments may be manipulated in order to obtain a nucleotide sequence which expediently reads in the correct direction and which is provided with a correct reading frame. To connect the DNA fragments to each other, adaptors or linkers may be joined onto the fragments.
The promoter and terminator regions according to the invention may advantageously be provided, in the direction of transcription, with a linker or polylinker which comprises one or more restriction sites for insertion of this sequence. As a rule, the linker has 1 to 10, in most cases 1 to 8, preferably 2 to 6, restriction sites. In general, the linker within the regulatory regions has a size of less than 100 bp, frequently less than 60 bp, but at least 5 bp. The promoter according to the invention may be both native, or homologous, but also foreign, or heterologous, to the host plant. The expression cassette according to the invention comprises, in the 5'-3' transcription direction, the promoter according to the invention, any desired DNA sequence and a region for transcriptional termination.
Various termination regions can be exchanged for each other as desired.
It is furthermore possible to employ manipulations which provide suitable restriction sites or which remove excess DNA or restriction sites. Where insertions, deletions or substitutions, . ~ 0050/48141 eg. transitions and transversions, are suitable, it is possible to use in vitro mutagenesis, primer repair, restriction or ligation. In the case of suitable manipulations, eg. restriction, chewing back or filling up overlaps for blunt ends, complementary ends of the fragments may be provided for ligation.
What may be of importance for the success according to the invention is, inter alia, attaching the specific ER retention signal SEKDEL (Schouten, A. et al. Plant Mol. Biol. 30 (1996), 781 - 792), which results in a three to four times higher than , average expression level. Other retention signals which occur naturally in plant and animal proteins which are localized in the ER may also be used for constructing the cassette.
Preferred polyadenylation signals are plant polyadenylation signals, preferably those which correspond essentially to T-DNA
polyadenylation signals from Agrobacterium tumefaciens, in particular of gene 3 of the T-DNA (octopine synthase) of the Ti plasmid pTiACH5 (Gielen et al., EMBO J. 3 (1984) 835 et seq.), or functional equivalents.
An expression cassette according to the invention may comprise, for example, a constitutive promoter (preferably the CaMV 35S
promoter), the LeB4 signal peptide, the gene to be expressed and the ER retention signal. The preferred ER retention signal used is the amino acid sequence KDEL (lysine, aspartic acid, glutamic acid, leucine).
The fused expression cassette which encodes an HPPD gene is preferably cloned into a vector, for example pBinl9, which is suitable for transforming Agrobacterium tumefaciens. Agrobacteria which are transformed with such a vector can then be used in the known manner for transforming plants, in particular crop plants, eg. tobacco plants, for example by immersing scarified leaves or leaf sections in an agrobacteria solution and subsequently growing them in suitable media. The transformation of plants by means of agrobacteria is known, inter alia, from F.F. White, Vectors for Gene Transfer in Higher Plants; in Transgenic Plants, Vol. 1, Engineering and Utilization, Eds. S.D. Kung and R. Wu, Academic Press, 1993, pp. 15 - 38. The transformed cells of the scarified leaves or leaf sections can be used for regenerating, in the known manner, transgenic plants which contain a gene for expression of an HPPD gene integrated into the expression cassette according to the invention.
With the aid of the so-called "Differential Display" method, a 207 by cDNA fragment was first isolated whose corresponding transcript accumulates in the primary leaf of barley in the case of dark-induced senescence. This fragment (sequence protocol:
sequence ID NO:1: nucleotide position 1342 - 1549) was subsequently used as a probe to isolate a cDNA clone with a larger insert in a cDNA library (in ~,-ZAP-II) from senescing barley flag leaves:
Diagram of the cDNA subclone HvSD 36 from the ~,-ZAP-II library:
,! 3 0 T~ -~XhoI SaII HindIII EcoRI NcoI PstI EcoRI PstI BamHI XbaI ~- T3 3 5 14 by 759 by 14 by The cDNA fragment (sequence protocol: Sequence ID NO:1:
nucleotide position 771 - 1529) was cloned into the EcoRl 40 cleavage site of pBluescript(SK-). In addition, both ends of the cDNA are equipped with a 14 by adaptor sequence which was required for ligation into ~,-ZAP-II. Selected restriction sites of the vector and of the cDNA itself are shown.
45 The 759 by long cDNA fragment was used as probe in a further experiment to obtain a complete sequence of HvSD 36. To this end, a cDNA library from RNA of the meristematic section of 5-day-old . ~ 0050/48141 barley seedlings was available. The lambda phage ExCeli Eco RICIP
from Pharmacia (Freiburg) (product number: 27-5011, 45.5kb) was used for this cDNA library.
A 1565 by long cDNA clone was isolated, see sequence protocol:
sequence ID NO:1: and 2.
Amongst the sequences in the databases, the 434 amino acids long protein sequence has a homology of 58%, which is the highest homology with the HPPD sequence from Arabidopsis tha3iana.
To find a genomic clone which contains the complete HPPD gene sequence, a lambda FIXII library of barley was obtained from Stratagene (Heidelberg, product number 946104). The library was prepared using DNA from etiolated leaves of winter barley cv.
Igri. The DNA was subjected to partial digestion with Sau3AI.
Prior to cloning into the Xhol cleavage site of the vector, the fragment ends and the phage arms were filled up with nucleotides.
Screening of the library with 200,000 pfu in the first round gave only one clone which hybridized with cDNA HvSD36. After subjecting this recombinant phage to restriction digestion with PstI and SacI, fragments of a size of 5400, 3800 and 1800 bp, respectively, were isolated which can be detected in a "Southern"
blot hybridization with the HvSD36 probe. These sub-fragments exist in cloned form in the Bluescript vector. Figure 3 shows the construction of the barley HPPD gene in the form of a diagram.
The invention relates in particular to expression cassettes whose sequence encodes an HPPD or a functional equivalent thereof, and ," 30 to the use of these expression cassettes for generating a plant with an elevated vitamin E content. The nucleic acid sequence may be, for example, a DNA or a cDNA sequence. Encoding sequences which are suitable for insertion into an expression cassette according to the invention are, for example, those which encode an HPPD and which impart, to the host, the ability to overproduce vitamin E.
In addition, the expression cassettes according to the invention comprise regulatory nucleic acid sequences which govern expression of the encoding sequence in the host cell. In accordance with a preferred embodiment, an expression cassette according to the invention comprises upstream, ie. on the 5' end of the encoding sequence, a promoter and downstream, ie. on the 3' end, a polyadenylation signal and, if appropriate, other regulatory elements which are operatively linked with the encoding sequence for the HPPD gene which is located in-between.
Operative linkage is to be understood as meaning the sequential arrangement of promoter, encoding sequence, terminator and, if appropriate, other regulatory elements in such a way that each of the regulatory elements can fulfill its function as intended when the encoding sequence is expressed. The sequences preferred for operative linkage, but not limited thereto, are targeting sequences for guaranteeing subcellular localization in the apoplast, in the vacuole, in plastids, in the mitochondrium, in the endoplasmatic reticulum (ER), in the nucleus, in liposomes or in other compartments and translation enhancers such as the 5' leader sequence from the tobacco mosaic virus (Gallie et al., Nucl. Acids Res. 15 (1987) 8693 - 8711).
For example, the plant expression cassette can be incorporated into the tobacco transformation vector pBinAR-Hyg. Fig. 4 shows the tobacco transformation vectors pBinAR-Hyg with 35S
promoter (A) and pBinAR-Hyg with seed-specific promoter phaseolin 796 (B):
- HPT: hygromycin phosphotransferase - OCS: octopine synthase terminator - PNOS: nopaline synthase promoter - those restriction sites which cleave the vector only once are also shown.
Suitable as promoters of the expression cassette according to the invention are, in principle, all promoters which can control the expression of foreign genes in plants. In particular a plant promoter or a promoter derived from a plant virus is preferably used. Particularly preferred is the CaMV 35S promoter from ;- 30 cauliflower mosaic viruss (Franck et al., Cell 21 (1980) 285 - 294). It is known that this promoter contains various recognition sequences for transcriptional effectors which in their entirety lead to permanent and constitutive expression of the gene introduced (Benfey et al., EMBO J. 8 (1989) 2195 - 2202).
The expression cassette according to the invention may additionally comprise a chemically inducible promoter by means of which expression of the exogenous HPPD gene in the plant can be controlled at a specific point in time. Such promoters which can be used are, inter alia, for example the PRP1 promoter (Ward et al., Plant. Mol. Biol. 22 (1993), 36I-366), a promoter which can be induced by salicylic acid (WO 95/19443), a promoter which can be induced by benzenesulfonamide (EP-A 388186), a promoter which can be induced by tetracyclin (Gatz et al., (1992) Plant J. 2, 397-404), a promoter which can be induced by abscisic acid ~
. , 0050/48141 (EP-A 335528) or a promoter which can be induced by ethanol or cyclohexanone (WO 93/21334).
Furthermore, particularly preferred promoters are those which ensure expression in tissues or plant organs in which the biosynthesis of vitamin E, or its precursors, takes place.
Promoters which must be mentioned in particular are those which guarantee leaf-specific expression. Promoters which may be mentioned are the potato cytosolic FBPase or the potato ST-LSI
promoter (Stockhaus et al., EMBO J. 8 (1989) 2445 - 245).
With the aid of a seed-specific promoter, it was possible stably to express a foreign protein in the seeds of transgenic tobacco plants in an amount of up to 0.67% of the total soluble seed protein (Fiedler and Conrad, Bio/Technology 10 (1995), 1090-1094). The expression cassette according to the invention can therefore contain, for example, a seed-specific promoter (preferably the phaseolin promoter (US 5504200), the USP
(Baumlein, H. et al. Mol. Gen. Genet. (1991) 225 (3), 459 - 467) or LEB4 promoter (Fiedler and Conrad, 1995)), the LEB4 signal peptide, the gene to be expressed and an ER retention signal. The construction of such a cassette is shown in the form of a diagram in Figure 4 by way of example.
An expression cassette according to the invention is prepared by fusing a suitable promoter with a suitable HPPD DNA sequence and preferably a DNA which is inserted between promoter and HPPD DNA
sequence and which encodes a chloroplast-specific transit peptide, and a polyadenylation signal, using customary ;-- 30 recombination and cloning techniques as they are described, for example, in T. Maniatis, E.F. Fritsch and J. Sambrook, Molecular Cloning: A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1989) and in T.J. Silhavy, M.L. Berman and L.W. Enquist, Experiments with Gene Fusions, Cold Spring Harbor Laboratory, Cold Spring Harbor, NY (1984) and in Ausubel, F.M. et al., Current Protocols in Molecular Biology, Greene Publishing Assoc. and Wiley-Interscience (1987).
Particularly preferred sequences are those which guarantee targeting into the apoplast, into plastids, into the vacuole, the mitochondrium, the endoplasmatic reticulum (ER), or, by means of the absence of suitable operative sequences, the remaining in the compartment of formation, the cytosol (Kermode, Crit. Rev. Plant Sci. 15, 4 (1996), 285 - 423). Localization in the ER has proved to be especially advantageous for the amount of protein accumulation in transgenic plants (Schouten et al. , Plant Mol.
Biol. 30 (1996), 781 - 792).
The invention also relates to expression cassettes whose DNA
5 sequence encodes an HPPD fusion protein, a moiety of the fusion protein being a transit peptide which governs translocation of the polypeptide. Especially preferred are chloroplast-specific transit peptides which are cleaved enzymatically from the HPPD
moiety after the HPPD gene product has been translocated into the 10 chloroplasts. Particularly preferred is the transit peptide which is derived from plastid transketolase (TK) or a functional equivalent of this transit peptide (eg. the transit peptide of the small subunit of rubisco or of Ferredoxin NADP
oxidoreductase).
t 15 The HPPD-encoding nucleotide sequence inserted can be prepared synthetically or obtained naturally or comprise a mixture of synthetic and natural DNA components. In general, there are prepared synthetic nucleotide sequences with codons which are preferred by plants. These codons which are preferred by plants can be determined from amongst codons with the highest protein frequency which are expressed in most interesting plant species.
When preparing an expression cassette, various DNA fragments may be manipulated in order to obtain a nucleotide sequence which expediently reads in the correct direction and which is provided with a correct reading frame. To connect the DNA fragments to each other, adaptors or linkers may be joined onto the fragments.
The promoter and terminator regions according to the invention may advantageously be provided, in the direction of transcription, with a linker or polylinker which comprises one or more restriction sites for insertion of this sequence. As a rule, the linker has 1 to 10, in most cases 1 to 8, preferably 2 to 6, restriction sites. In general, the linker within the regulatory regions has a size of less than 100 bp, frequently less than 60 bp, but at least 5 bp. The promoter according to the invention may be both native, or homologous, but also foreign, or heterologous, to the host plant. The expression cassette according to the invention comprises, in the 5'-3' transcription direction, the promoter according to the invention, any desired DNA sequence and a region for transcriptional termination.
Various termination regions can be exchanged for each other as desired.
It is furthermore possible to employ manipulations which provide suitable restriction sites or which remove excess DNA or restriction sites. Where insertions, deletions or substitutions, . ~ 0050/48141 eg. transitions and transversions, are suitable, it is possible to use in vitro mutagenesis, primer repair, restriction or ligation. In the case of suitable manipulations, eg. restriction, chewing back or filling up overlaps for blunt ends, complementary ends of the fragments may be provided for ligation.
What may be of importance for the success according to the invention is, inter alia, attaching the specific ER retention signal SEKDEL (Schouten, A. et al. Plant Mol. Biol. 30 (1996), 781 - 792), which results in a three to four times higher than , average expression level. Other retention signals which occur naturally in plant and animal proteins which are localized in the ER may also be used for constructing the cassette.
Preferred polyadenylation signals are plant polyadenylation signals, preferably those which correspond essentially to T-DNA
polyadenylation signals from Agrobacterium tumefaciens, in particular of gene 3 of the T-DNA (octopine synthase) of the Ti plasmid pTiACH5 (Gielen et al., EMBO J. 3 (1984) 835 et seq.), or functional equivalents.
An expression cassette according to the invention may comprise, for example, a constitutive promoter (preferably the CaMV 35S
promoter), the LeB4 signal peptide, the gene to be expressed and the ER retention signal. The preferred ER retention signal used is the amino acid sequence KDEL (lysine, aspartic acid, glutamic acid, leucine).
The fused expression cassette which encodes an HPPD gene is preferably cloned into a vector, for example pBinl9, which is suitable for transforming Agrobacterium tumefaciens. Agrobacteria which are transformed with such a vector can then be used in the known manner for transforming plants, in particular crop plants, eg. tobacco plants, for example by immersing scarified leaves or leaf sections in an agrobacteria solution and subsequently growing them in suitable media. The transformation of plants by means of agrobacteria is known, inter alia, from F.F. White, Vectors for Gene Transfer in Higher Plants; in Transgenic Plants, Vol. 1, Engineering and Utilization, Eds. S.D. Kung and R. Wu, Academic Press, 1993, pp. 15 - 38. The transformed cells of the scarified leaves or leaf sections can be used for regenerating, in the known manner, transgenic plants which contain a gene for expression of an HPPD gene integrated into the expression cassette according to the invention.
To transform a host plant with an HPPD-encoding DNA, an expression cassette according to the invention is incorporated into a recombinant vector in the form of an insertion, and the vector DNA of this recombinant vector additionally comprises functional regulation signals, for example sequences for replication or integration. Suitable vectors are described, inter alia, in "Methods in Plant Molecular Biology and Biotechnology"
(CRC Press), Chapter. 6/7, pp. 71 - 119 (1993).
Using the above-cited recombination and cloning techniques, the expression cassettes according to the invention can be cloned into suitable vectors which allow their multiplication, for example in E. coli. Suitable cloning vectors are, inter alia, pBR332, pUC series, Ml3mp series and pACYC184. Especially suitable are binary vectors which are capable of replicating not only in E. coli, but also in agrobacteria.
The invention furthermore relates to the use of an expression cassette according to the invention for transforming plants, plant cells, plant tissues or plant organs. The preferred purpose of the use is to raise the vitamin E content of the plant.
Depending on the choice of the promoter, expression may take place specifically in the leaves, in the seeds or in other plant organs. The present invention also relates to such transgenic plants, their propagation material and their plant cells, plant tissues or plant organs.
In addition, the expression cassette according to the invention may also be employed for transforming bacteria, cyanobacteria, yeasts, filarnentous fungi and algae with the purpose of raising the vitamin E production.
The transfer of foreign genes into the genome of a plant is termed transformation. This process exploits the previously described methods of transforming and regenerating plants from plant tissues or plant cells to obtain transient or stable transformation. Suitable methods are protoplast transformation by polyethylene-glycol induced DNA uptake, the ballistic method with the gene gun - the so-called particle bombardment method, electroporation, incubation of dry embryos in DNA-containing solution, microinjection and Agrobacterium-mediated gene transfer. The abovementioned methods are described, for example, in B. Jenes et al., Techniques for Gene Transfer, in: Transgenic Plants, Vol. 1, Engineering and Utilization, Eds. S.D. Kung and R.
Wu, Academic Press (1993) 128 - 143, and in Potrykus Annu. Rev.
Plant Physiol. Plant Molec. Biol. 42 (1991) 205 - 225). The construct to be expressed is preferably cloned into a vector which is suitable for transforming Agrobacterium tumefaciens, for example pBinl9 (Bevan et al., Nucl. Acids Res. 12 (1984) 8711).
Agrobacteria transformed with an expression cassette according to the invention can also be used, in a known manner, for transforming of plants, in particular crop plants such as cereals, maize, oats, soya, rice, cotton, sugar beet, canola, sunflowers, flax, hemp, potatoes, tobacco, tomatoes, oilseed .
rape, alfalfa, lettuce and the various tree, nut and grapevine species, for example by immersing scarified leaves or leaf sections in an agrobacteria solution and subsequently growing them in suitable media.
Functionally equivalent sequences which encode an HPPD gene are, in accordance with the invention, those sequences which still have the desired functions despite a different nucleotide sequence. Thus, functional equivalents embrace naturally occurring variants of the sequences described herein and also artificial nucleotide sequences, eg. artificial nucleotide sequences which have been obtained by chemical synthesis and which are adapted to the codon usage of a plant.
A functional equivalent is also to be understood as meaning, in particular, natural or artificial mutations of an originally isolated HPPD-encoding sequence which continues to show the desired function. Mutations encompass substitutions, additions, deletions, inversions or insertions of one or more nucleotide residues. Thus, the present invention also encompasses those nucleotide sequences which are obtained by modifying the present nucleotide sequence. The purpose of such a modification may be, for example, a further limitation of the encoding sequence contained therein, or else, for example, the insertion of further cleavage sites for restriction enzymes.
Functional equivalents are also those variants whose function is less or more pronounced in comparison with the starting gene or gene fragment.
Also suitable are artificial DNA sequences as long as they, as described above, mediate the desired characteristic of raising the vitamin E content in the plant by overexpressing the HPPD
gene in crop plants. Such artificial DNA sequences can be determined for example by back-translation of proteins constructed with the aid of molecular modeling and which have HPPD activity, or by in vitro selection. Especially suitable are encoding DNA sequences which were obtained by back-translating a - ~ 005048141 CA 02296840 2000-O1-13 polypeptide sequence in accordance with the codon usage specific to the host plant. The specific codon usage can be determined readily by an expert familiar with plant genetic methods using computer evaluations of other, known genes of the plant to be transformed.
Further suitable equivalent nucleic acid sequences according to the invention which must be mentioned are sequences which encode fusion proteins, a component of the fusion protein being a plant HPPD polypeptide or a functionally equivalent moiety thereof. The second moiety of the fusion protein can be, for example, a further polypeptide with enzymatic activity or an antigenic polypeptide sequence with the aid of which the detection of HPPD
expression is possible (eg. myc-tag or his-tag). However, this is preferably a regulatory protein sequence, eg. a signal or transit peptide, which leads the HPPD protein to the desired site of action.
However, the invention also relates to the expression products and fusion products, of a transit peptide and a polypeptide with HPPD activity, which have been produced in accordance with the invention.
Raising the vitamin E content means, for the purposes of the present invention, the artificially acquired ability of an elevated vitamin E biosynthesis performance by means of functional overexpression of the HPPD gene in the plant in contrast to the non-genetically-engineered plant for the duration of at least one plant generation.
The vitamin E biosynthesis site is generally the leaf tissue, so that leaf-specific expression of the HPPD gene is expedient.
However, it will be understood readily that vitamin E
biosynthesis is not necessarily restricted to the leaf tissue, but may also take place tissue-specifically in all other organs of the plant, for example in fatty seeds.
In addition, constitutive expression of the exogenous HPPD gene is advantageous. On the other hand, inducible expression may also appear desirable.
The efficacy of expression of the transgenically expressed HPPD
gene can be determined for example in vitro by shoot meristem propagation. In addition, changes in the nature and level of HPPD
gene expression, and its effect on the vitamin E biosynthesis ' 0050/48141 performance on test plants, can be tested in greenhouse experiments.
The invention furthermore relates to transgenic plants 5 transformed with an expression cassette according to the invention, and to transgenic cells, tissues, organs and propagation material of such plants. Especially preferred in this context are transgenic crop plants, eg. barley, wheat, rye, maize, oats, soya, rice, cotton, sugar beet, canola, sunflowers, 10 flax, hemp, potatoes, tobacco, tomatoes, oilseed rape, alfalfa, lettuce and the various tree, nut and grapevine species.
Plants for the purposes of the invention are mono- and dicotyledonous plants or algae.
As already mentioned, HPPD is a suitable target for sulcotrione-type herbicides. To allow even more efficient HPPD
inhibitors, it is necessary to provide suitable test systems with which inhibitor/enzyme binding studies can be carried out. To this end, for example, the complete barley HPPD cDNA sequence is cloned into an expression vector (pQE, Qiagen) and overexpressed in E. coli.
The HPPD protein expressed with the aid of the expression cassette according to the invention is particularly suitable for finding HPPD-specific inhibitors.
To this end, the HPPD can be employed, for example, in an enzyme assay in which the HPPD activity is determined in the presence and absence of the active substance to be tested. A comparison of the two activity determinations allows qualitative and quantitative findings on the inhibitory behavior of the active substance to be tested to be obtained.
The test system according to the invention allows a large number of chemical compounds to be screened rapidly and simply for herbicidal properties. The method allows the targeted and reproducible selection, amongst a large number of substances, of those with great potency in order to subject these substances subsequently to further in-depth tests with which the expert is familiar.
The invention furthermore relates to herbicides which can be identified with the above-described test system.
Overexpression in a plant of the gene sequence Seq ID NO: l, which encodes an HPPD, results in an elevated resistance to HPPD
inhibitors. The invention also relates to the transgenic plants thus generated.
The invention furthermore relates to:
- A method of transforming a plant, which comprises introducing an expression cassette according to the invention into a plant cell, into callus tissue, into an entire plant or into plant protoplasts.
- The use of a plant for generating plant HPPD.
;;;;v 15 - The use of the expression cassette according to the invention for generating plants with elevated resistance to HPPD
inhibitors by means of higher expression of a DNA sequence according to the invention.
- The use of the expression cassette according to the invention for generating plants with an elevated vitamin E content by means of expressing, in plants, a DNA sequence according to the invention.
- The use of the expression cassette according to the invention for generating a test system for identifying HPPD inhibitors.
The invention is illustrated by the examples which follow, but not limited thereto:
General cloning methods The cloning steps carried out within the scope of the present invention, eg. restriction cleavages, agarose gel electrophoresis, purification of DNA fragments, transfer of nucleic acids onto nitrocellulose and nylon membranes, linking DNA fragments, transformation of E. coli cells, growing bacteria, multiplying phages and sequence analysis of recombinant DNA, were carried out as described by Sambrook et al. (1989) Cold Spring Harbor Laboratory Press; ISBN 0-87969-309-6).
The bacterial strains used hereinbelow (E. coli, XL-I Blue) were obtained from Stratagene and, in the case of NP66, Pharmacia. The i. 15 agrobacterial strain used for the transformation of plants (Agrobacterium tumefaciens, C58C1 with plasmid pGV2260 or pGV3850kann) was described by Deblaere et al. in (Nucl. Acids Res. 13 (1985) 4777). Alternatively, the agrobacterial strain LBA4404 (Clontech) or other suitable strains may also be employed. Vectors which can be used for cloning are the vectors pUCl9 (Vanish-Perron, Gene 33 (1985), 103 - 119) pBluescript SK-(Stratagene), pGEM-T (Promega), pZerO (Invitrogen), pBinl9 (Bevan et al., Nucl. Acids Res. 12 (1984), 8711 - 8720) and pBinAR
(Hofgen and Willmitzer, Plant Science 66 (1990) 221 - 230).
Sequence analysis of recombinant DNA
Recombinant DNA molecules were sequenced using a laser fluorescence DNA sequencer by Licor (available from MWG Biotech, Ebersbach) following the method of Sanger (Sanger et al., Proc.
Natl. Acad. Sci. USA 74 (1977), 5463 - 5467).
Generation of plant expression cassettes Into plasmid pBinl9 (Bevan et al., Nucl. Acids Res. (1984) 12, 8711) there was inserted a 35S CaMV promoter in the form of an EcoRI-KpnI.fragment corresponding to nucleotides 6909 - 7437 of cauliflower mosaic virus (Franck et a1. Cell 21 (1980) 285). The polyadenylation signal of gene 3 of the T-DNA of the Ti plasmid pTiACHS (Gielen et al., EMBO J. 3 (1984) 835), nucleotides 11749 - 11939, was isolated as a PvuII-HindIII fragment and, after addition of SphI linkers, cloned into the PvuII cleavage site between the SpHI-HindIII cleavage site of the vector pBmAR-Hyg.
This gave the plasmid pBinAR (Hofgen and Willmitzer, Plant Science 66 (1990) 221 - 230).
Use Examples Example 1 Isolation of HPPD-specific cDNA sequences The composition of the mRNA population from primary leaves of nine-day-old barley plants which had been grown in an L/D
photoperiod (16 hours light/8 hours dark) was compared with that of primary leaves of 11-day-old barley plants in which, after a raising period of nine days, senescence was subsequently induced by a two-day dark treatment (Humbeck and Krupinska, J. Photochem.
Photobiol. 36 (1996), 321 - 326) with the aid of the DDRT-PCR
method published by Liang and Pardee (Science (1992) 257, 967 -972). In each case 0.2 p,g of the total RNA was converted into cDNA
using the enzyme "Superskript RT" (Gibco BRL, Eggenstein). In addition to the RNA, the reaction batches (20 ~1) also contained ~tM dNTPs, 10 ~M DTT, lxRT buffer and in each case 1 ~M
(dT)12VN primer. The anchor "primers" required for these 20 reactions were synthesized on the basis of the data of Liang and Pardee:
1. 5'-TTTTTTTTTTTTAG-3' 2. 5'-TTTTTTTTTTTTCA-3' 3, 5'-TTTTTTTTTTTTAC-3' 4. 5'-TTTTTTTTTTTTGT-3' After the cDNAs were synthesized, amplification of the relevant sequences was effected in each case in ten batches, which differ by the use of the random "primers" given hereinbelow:
1. 5 '-TACAACGAGG-3' 2. 5'-GGAACCAATC-3' 3. 5 '-AAACTCCGTC-3' 4. 5'-TGGTAAAGGG-3' 5. 5 '-CTGCTTGATG-3' 6. 5'-GTTTTCGCAG-3' 5 '-GATCTCAGAC-3' 8. 5'-GATCTAACCG-3' 7.
9. 5 '-GATCATGGTC-3' 10. 5'-GATCTAAGGC-3' In a volume of in each case 20 ~,1, the PCR reaction batches contained lxPCR buffer, 2 ~M dNTPs, 2.5 ~.Ci (a 33P)-dATP, 1 [~M
(dT)12VN-..primer", 1/10 vol. RT mix (Sambrook et al. Molecular Cloning - A Laboratory Manual, 1989), 1 U Taq DNA polymerase (Boehringer, Mannheim) and 1 p,M 10-mer random "primers". The PCR-reactions proceeded in a Uno block (Biometra) following the program below:
1. 94°C 2 min 2. 94°C 30 s v 19 3. 40°C 2 min 4. 72°C 30 s 5. 72°C 5 min 6. 4°C storage until further processing Steps 2, 3 and 4 were carried out 40 times in succession. This gave approximately 100 cDNA bands per reaction and "primer"
combination.
In contrast to the protocol of Liang and Pardee, the amplified cDNA fragments were separated in non-denaturing polyacrylamide gels of the following composition: 6% (w/v) acrylamide (Long Ranger, AT Biochem), 1.2 x TBE buffer, 0.005% (v/v) TEMED and 0.005% (w/v) APS (Bauer et al, Nucl. Ac. Res. (1993) 21, 4272 - 4280 ) .
In each case 3.5 [~1 of each PCR batch were treated with 2 ~.1 of loading buffer (dye II, Sambrook et al., 1989) and then loaded onto the gel. To determine the reproducibility of the cDNA
band patterns (Fig. 5), in each case two independent RNA preparations (9 and 9', 11 and 11') were prepared from the barley primary leaves harvested on days 9 and 11 and used in parallel in the analysis below. What is shown is the result of two different primer combinations (A and B); by way of example, two differences in the band pattern between the sample of days 9 and 11 were emphasized by arrows. Only those bands which occurred equally in the two samples from senescing plants and which did not occur in the two comparison samples were taken into consideration when analyzing the gels at a later point in time. Electrophoresis was carried out over a period of 2.5 hours at 40 watt (0.8 w/cm3) in 1 x TBE buffer. After separation of the cDNA fragments had occurred, the gel was transferred onto filter paper (Schleicher &
Schiill, Dassel). After the gel had been dried at 50C, an X-ray film was placed on top of it. cDNA bands which were only found in the case of samples 11 and 11' in the autoradiograph were excised from the dry gel using a surgical blade, and the DNA was eluted by boiling in 100 ~1 1 x TE buffer. The ethanol-precipitated DNA
was resuspended in 10 ~.1 of water for further tests. After reamplification with the "primers" previously used for this batch, the DNA was cloned and sequenced and also employed as a probe for Northern blot hybridizations.
To test if the relevant cDNA fragment actually represents a senescence-specifically occurring transcript, hybridizations were carried out with RNA from leaves of various developmental stages:
' 0050/48141 A. 1. RNA from primary leaves from plants raised for 9 days in an L/D photoperiod A. 3. RNA from primary leaves from 10-day-old plants raised 5 without a light phase on day 10 A. 4 RNA from primary leaves from 11-day-old plants which lacked a light phase on days 10 and 11 10 A. 5 RNA from primary leaves from 12-day-old plants which underwent a further light phase after 2 days in the dark The samples for RNA analysis were harvested in each case in the middle of the original night phase.
B. RNA from flag leaves which had been collected in the field at seven different points in time (Fig. 6). The leaves were fully grown on 29 May and showed less than 10~ of the original chlorophyll content on 21 June. The beginning of the senescence processes is shown in Figure 6 by an arrow (ie. 17 days after reaching the full length on 15 June). The beginning of senescence was defined as the day on which photosystem II efficacy dropped (Humbeck et al., Plant Cell Environment (1996) 19 : 337 - 344 ) .
To hybridize a filter with the above-described RNA samples, a specific probe for the rbcS gene, which encodes the small sub-unit of ribulose-1,5-bisphosphate carboxylase, was also employed in addition to the HPPD probe, for comparison reasons.
Figure 6 shows hybridization of the "Northern blots" A and B with cDNA HvSD36 and with a probe which is specific for the rbcS gene.
Filter A carries RNA from barley primary leaves after a raising period of 9 days in an L/D photoperiod (9), after subsequent incubation in the dark for one and two days, respectively (10, 11) and after subsequent return to light conditions for one day (12). Filter B contains RNA from flag leaves which had been harvested in the field in the period from 29.05. to 21.06.1992.
The arrow indicates the beginning of senescence on 15.06. As can been seen from Figure 6, the amount of rbcS-specific mRNA is high when the amount of HPPD-specific mRNA is relatively low. In primary leaves of nine-day-old plants, the HPPD-specific mRNA is not detectable prior to transfer into the dark and accumulates markedly during the dark phase. When the plants are returned to light conditions, the amount of this mRNA drops markedly. In the case of the flag leaves, small amounts of the HPPD-specific mRNA
can already be detected in fully-grown, non-senescent leaves. As ' 0050/48141 early as 4 days prior to the actual beginning of senescence, expression levels are higher. The highest amount of this mRNA can be found in senescent leaves. A size comparison with known RNA
species showed that the transcript detected with the cDNA probe HvSD36 (s: senescence; d: dark, fragment number 36 in the DDRT
gel) has a length of approx. 1.6 kb.
By means of DDRT PCR, three cDNA fragments were obtained independently of each other which showed this expression pattern and which, on the basis of sequence analysis, actually represent the same transcript. The longest fragment had a size of 230 bp.
The 230 by long PCR product was finally cloned into the SmaI
cleavage site of vector pUCl8 using the "Sure CloneTM ligation kit" (Pharmacia, Freiburg) following the manufacturer's t 15 instructions. The recombinant plasmid was transformed into competent cells of E. coli strain DH5 a. Since, for methodology reasons, the fragment represents the 3' end of the relevant transcript, the sequence information was first insufficient to identify an unambiguous homology with a sequence in the databases. To isolate a longer corresponding cDNA, a lambda ZAPII
library (Stratagene, Heidelberg) of RNA of senescent flag leaves was screened using the 230 by long fragment as the probe. For this step, the probe was labeled with Dig-dUTP following the instructions of the "DNA Labeling and Detection Kit" (Boehringer, Mannheim). The library was examined following the protocol of the "ZAP-cDNA Synthesis Kit" (Stratagene, Heidelberg).
In the case of the probe described herein, 150,000 pfu were examined. Of these, 39 phage plaques gave a positive signal. Of these, further work was carried out on 12 phage populations.
Following phage preparation, the fragments inserted were enriched via PCR and separated by electrophoresis. Southern blot hybridization with the HvSD36 probe allowed those phage populations which had the largest "inserts" with positive signal to be selected amongst the 12 phage populations thus treated.
After replating, the phages were subjected to a further hybridization step. Single phage plaques were excised and, after elution, subjected to an in vivo excision using a helper phage and following the protocol from Stratagene (ExassistTM
Interference-Resistant Helper Phage with SOLR TM Strain). The so-called "phagemids" obtained from this treatment contain the cDNA cloned in pBLueskript (SK-).
Following a subsequent plasmid preparation, the relevant "insert~
was excised from the Bluescript plasmid using EcoRI. The cDNA
clone obtained in the case of HvSD36 contains an "insert" with a length of approx. 800 bp. Complete sequencing of the cDNA was carried out using the "SequiTherm Excel Long-Read DNA-Sequenzierungs-Rit" (Epicentre Technologies, Biozym Diagnostic, Oldendorf) using IRD41-labeled universal "primers"
which bind to sequence regions in the Bluescript vector.
Detection of the DNA fragments was effected via the infrared laser of the automatic sequencer 4000L by Licor. After sequencing, an exactly 759 by long sequence was present whose sides are flanked by an in each case 14 by long adaptor sequence.
These adaptor sequences were used for ligating the cDNA fragments with the arms of phage lambda ZAPII (Stratagene, Heidelberg) when generating the c-DNA library.
Amongst the sequences in the databases, the protein sequence HvSD36, which has a total of over 180 amino acids, has a homology of 41% with the sequence of human HPPD which is the highest.
Taking into consideration the length of the transcript detected in the "Northern blot" (approx. 1600 nt), it can be assumed that 850-900 by are still missing from the cDNA.
To complete the cDNA, a further cDNA library was investigated.
mRNA was isolated from the basal meristematic zone of 5-day-old barley seedlings with the aid of "Dynabeads" (Dynal, Hamburg) and transcribed into cDNA using the "Time Saver cDNA SyntheseRit"
(Pharmacia, Freiburg). This was followed by ligation of EcoRI/NotI adaptors (Pharmacia, Freiburg) to the cDNA with subsequent ligation into the lambda ExCell vector (Pharmacia, Freiburg). Finally, the recombinant phage DNA was packaged into phage proteins with the aid of "Gigapack II Gold Set" (Stratagene, Heidelberg). Using the 759 by long probe HvSD36, 400,000 pfu were screened, and 5 phages were detected by the probe. Excision of the "phagemids" from the phage was effected in vivo with the aid of bacterial strain NP66 following the instructions of Pharmacia (Freiburg). The recombinant pExCell plasmids were isolated from the individual bacterial colonies and transferred into bacterial strain D115 a for propagation.
The longest cDNA clone HvSD36 isolated in this manner has a length of 1565 by and was sequenced completely (see sequence protocol).
Example 2 Characterization of the genomic sequence To identify a genomic clone which contains the gene sequence of HPPD, a lambda FIXII library of barley was obtained from Stratagene (Heidelberg). The library was prepared using DNA from etiolated leaves of winter barley cv. Igri. The DNA was partially digested with Sau3AI. Prior to cloning into the XhoI cleavage site of the vector, the fragment ends and the phage arms were filled up with nucleotides. Screening of the library with 200,000 pfu in the first round only gave one clone which hybridized with cDNA HvSD36. After subjecting this recombinant phage to restriction digestion with PstI and SacI, fragments 5400, 3800 and 1800 by in length were subsequently isolated which can be detected with the HvSD36 probe when carrying out a "Southern" blot hybridization. These sub-fragments exist in cloned form in the Bluescript vector.
The library was screened following the protocol given for the HybondN membrane. Labeling of the probe for screening the library (;~ 15 and for the "Southern" blot hybridizations was effected via "random priming" with 32P-dATP using the Klenow enzyme (Sambrook et al., (1989) Molecular cloning. A laboratory manual. Cold Spring Harbor Laboratory, New York).
A genomic "Southern blot" was carried out with total DNA from barley (farina) (Fig. 7). In each case 15 ~tg of DNA were digested with BamHI (B), EcoRI (E), HindIII (H) or XBAI (X) and separated in a 0.75 agarose gel. After transfer to a Hybond N+ membrane (Amersham, Braunschweig), hybridization was effected with the incomplete, 759 by long cDNA probe from HvSD36 following instructions of the membrane manufacturer. The following fragments were detected:
BamHI: 6.0, 3.9 and 3.0 kbp ~' 30 EcoRI: >10 kbp ~HindIII: 8.3, 2.6, 1.1 and 1.0 kbp XbaI: 9.0, 5.2 and 4.2 kbp The fragment lengths were estimated by comparison with a DNA size standard (Kb-Leiter, GibcoBRL, Eggenstein).
Example 3 Homology comparison of the HvSD36 protein sequence A comparison of the HvSD36 protein sequence with protein sequences in the database revealed homologies to the following protein sequences known to date:
~
~ 0050/48141 CA 02296840 2000-O1-13 5 HPPD Hv .......... .......... .......... ........MP PTPTTPAATG
HPPD_Ath .......... .........~ ..~~~~~~~~ ~-.MGHQNAA VSENQNHDDG
HPPD_HUMAN .......... .......... .......... .......... ..........
HPPD_RAT .......... .......... .......... .......... ..........
HPPD_PIG .......... .......... .......... .......... ..........
HPPD_MOUSE .......... ........~. .......... .......... ..........
HPPD_PSESP .......... .......... .......... .......... ..........
10 MELA_SHECO .......... .......... .......... .......... ..........
HPPDHv AAAAVTPEHA RPHRMVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFA
_ Ath AASSPGFKLV GFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWG
HPPD
t;',' 15 HPPDHUMAN _ M TTYSDKGAKPERGRFLH--FHSVTFWVGNAKQAASFYCSK
_ RAT YWDKGPKP ERGRFLH--FHSVTFWVGNAKQAASFYCNK
HPPD
_ PIG M TSYSDKGEKPERGRFLH--FHSVTFWGNARQAASYYCSK
HPPD
_ MOUSE M TTYNNKGPKPERGRFLH--FHSVTFWVGNAKQAASFYCNK
HPPD
_ PSESP ADLYENP MGLMGFEFIELASPTPNTLE
HPPD
_ SHECO MASEQNP LGLLGIEFTEFATPDLDFMH
MELA
_ MOUSE PAQTPGPQVS ASARGPGPVAGGSGRMERRMKGGYL---DQRVPYTFCSKS
HPPDHv LGAPLAARSD LSTGNSAHASQLLRSGSLAFLFT--APYANG-CDAA----_ Ath LGMRFSAKSD LSTGNMVHASYLLTSGDLRFLFT--APYSPS-LSAGEIKP
HPPD
_ HUMAN MGFEPLAYRG LETGSREWSHVIKQGKIVFVLS--SA----------LNP
HPPD
_ RAT MGFEPLAYKG LETGSREWSHVIKQGKIVFVLC--SA----------LNP
HppD
HPPDPIG IGFEPLAYKG LETGSREWSHVVKQDKIVFVFS--SA----------LNP
_ MOUSE MGFEPLAYRG LETGSREWSHVIKRGKIVFVLC--SA----------LNP
HPPD
_ PSESP PIFEIMGFTK VATHRSKDV-HLYRQGAINLILN--NE-------------HPPD
_ SHECO KVFIDFGFSK LKKHKQKDI-WYKQNDINF LLN--NE-------------MELA
_ MOUSE PGNGSLGEAL MVPQGKLMDPGSLPPSDSEDLFQDLSHFQETWLAEAQVPD
PEA3_ y- 30 HPPDHv --TASLPSFS ADAARRFSADHGIAVRSVALRVADAAEAFRASRRRGARPA
_ Ath TTTASIPSFD HGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPS
HPPD
_ HUMAN --------WN KEMGDHL-VKHGDGVKDIAFEVEDCDYIVQKARERGAKIM
HPPD
_ RAT --------WN KEMGDHL-VKHGDGVKDIAFEVEDCEHIVQKARERGAKIV
HPPD
_ PIG --------WN KEMGDHL-VKHGDGVKDIAFEVEDCDYIVQKARERGAIIV
HppD
HPPDMOUSE --------WN KEMGDHL-VKHGDGVKDIAFEVEDCDHIVQKARERGAKIV
_ PSESP ---------P HSVASYFAAEHGPSVCGMAFRVKDSQKAYKRALELGAQPI
HPPD
_ SHECO ---------K QGFSAQFAKTHGPAISSMGWRVEDANFAFEGAVARGAKPA
MELA
_ MOUSE SDEQFVPDFH ---SENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYH
HPPDHv FAPV------ -----DLGRGFAFAEVELYG--DWLRFVSHP--DG--TD
_ Ath SPPI------ -----VLNEAVTIAEV'KLYG--DVVLRYVSYKAEDT--EK
HPPD
HPPD_ REP------- -WVEQDKFGKVKFAVLQTYG--DTTHTLVEKMN-----YI
HUMAN
HPPD_ REP------- -WVEEDKFGKVKFAVLQTYG--DTTHTLVEKIN-----YT
RAT
HPPD_ REEVC-CAAD VRGHHTPLDRAR----QVWE--GT---LVEKMT-----FC
PIG
HppD_ REP------- -WVEQDKFGKVKFAVLQTYG--DTTHTLVEKIN-----YT
MOUSE
HPPDPSESP HI-------- ----ETGPMELNLPAIKGIG--GAPLYLIDRFGEGSSIYD
MELA_ AD-------- ----EV--KDLPYPAIYGIG--DSLIYFIDTFGDDNNIYT
SHECO
PEA3_ HGEQCLYSRQ IAIKSPAPGAPGQSPLQPFSRAEQQQSLLRASSSSQSHPG
MOUSE
' 0050/48141 HPPDHv VPFLPGFEGV TNPDA-----VDYGLTRFDH -APAAAYIAG
WGNVP--EL
_ Ath SEFLPGFERV EDASSF---PLDYGIRRLDH -GPALTYVAG
HPPD AVGNVP--EL
_ HUMAN GQFLPGYEAP AFMDPLLPKLPKCSLEMIDHIVGNQPDQEM-VSASEW---HPPD
_ RAT GRFLPGFEAP TYKDTLLPKLPSCNLEIIDHIVGNQPDQEM-ESASEW---HPPD
5 _ PIG LDSRPQPSQT LLHRLLLSKLPKCGLEIIDHIVGNQPDQEM-ESASQW---HPPD
HPPDMOUSE GRFLPGFEAP TYKDTLLPKLPRCNLEIIDHIVGNQPDQEM-QSASEW---_ PSESP IDFV--FLEG VDRHPVGA-----GLKIIDHLTHNWRGRM-A---YWANF
HPPD
_ SHECO SDF-----EA LDEPIITQ---EKGFIEVDHLTNNVHKGTM-E---YWSNF
MELA
_ MOUSE HGYLGEHSSV FQQPVDMCHSFTSPQGGGREPLPAPYQHQLSEPCPPYPQQ
HPPDHv FT---GFHEF AEFTAEDVGTTESGLNSWL ANNSEGVLLPLNEPVHGTKR
_ Ath FT---GFHQF AEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKR
HPPD
_ HUMAN YLKNLQFHRF WSVDDTQVHTEYSSLRSIW ANYEESIKMPINEPAPG-KR
HPPD
_ RAT YLKNLQFHRF WSVDDTQVHTEYSSLRSIW ANYEESIKMPINEPAPG-RR
HPPD
_ PIG YMRNLQFHRF WSVDDTQIHTEYSALRSWM ANYEESIKMPINEPAPG-KR
HPPD
_ MOUSE YLKNLQFHRF WSVDDTQVHTEYSSLRSIW TNYEESIKMPINEPAPG-RK
HPPD
;: 15 HPPDPSESP YEKLFNFREI RYF---DIKGEYTGLTSKAMTAPDGMIRIPLNE--ESSKG
'-_ SHECO YKDIFGFTEV RYF---DIKGSQTALISYAI.RSPDGSFCIPINE--GKGDD
MELA
_ MOUSE NFKQ-EYHDP LYEQAGQPASSQGGVSGHRYPGAGWIKQERTDFAYDSDV
20 HPPDHv RSQIQTFLEH HGGPGVQH-IAVASSDVLRTLRKMRARSAMGGFDFLPPPL
_ Ath KSQIQTYLEH NEGAGLQH-LALMSEDIFRTLREMRKRSSIGGFDFMPSPP
HPPD
_ HUMAN KSQIQEYVDY NGGAGVQH-IALKTEDIITAIRHLRER----GLEFLSVP-HPPD
_ RAT KSQIQEYVDY NGGAGVQH-IALRTEDIITTIRHLRER----GMEFLAVP-HPPD
_ PIG KSQIQEYVDY NGGAGVQH-IALKTEDIITAIRSLRER----GVEFLAVP-HPPD
HPPD_ KSQIQEYVDY NGGAGVQH-IALKTEDIITAIRHLRER----GTEFLAAP-MOUSE
HPPD_ AGQIEEFLMQ FNGEGIQH-VAFLSDDLIKTWDHLKSI--=-GMRFMTAPP
PSESP
PEAS_ PGCASMYLHP EGFSGPSPGDGVMGYGYEKSLRPFPDDVCIVPRKFEGDIK
MOUSE
HPPDHv PKYYEGVRRL AGD--VLSEAQIKECQELGVLVDRDDQG----VLL-----HPPD_ PTYYQNLKKR VGD--VLSDDQIKECEELGILVDRDDQG----TLL-----Ath HPPD_ STYYKQLREK LKTAKIKVKENIDALEELKILVDYDEKG----YLL-----HUMAN
HPPD_ SSYYRLLREN LKTSKIQVKENMDVLEELKILVDYDEKG----YLL-----RAT
HPPD_ FTYYRQLQEK LKSAKIRVKESIDVLEELKILVDYDEKG----YLL-----PIG
HPPD_ SSYYKLLREN LKSAKIQVKESMDVLEELHILVDYDEKG----YLL-----MOUSE
HPPD_ DTYYEMLEGR LPN----HGEPVGELQARGILLDGSSESGDKRLLL-----PSESP
MELA_ E-YYDTIFEK LPQ----VTEDRDRIKHHQILVDGDEDG----YLL-----SHECO
HPPDHv QIFTKPVGDR PTLFLEMIQRIGCMEKDERGEE----YQKGGCGGFGKGNF
HPPD_ QIFTKPLGDR PTIFIEIIQRVGCMMKDEEGKA----YQSGGCGGFGKGNF
Ath HPPD_ QIFTKPVQDR PTLFLEVIQRHNHQ-------------- -GFGAGNF
HUMAN
HPPD_ QIFTKPMQDR PTLFLEVIQRHNHQ-------------------GFGAGNF
RAT
HPPD_ QIFTKPMQDR PTVFLEVIQRNNHQ-------------- ---GFGAGNF
PIG
HPPD_ QIFTKPMQDR PTLFLEVIQRHNHQ-------------------GFGAGNF
MOUSE
HPPD_ QIFSETLMGP --VFFEFIQR-----KGDD------------GFGEGNF
PSESP
MELA_ QIFTKNLFGP --IFIEIIQR-----KNNL--------------GFGEGNF
SHECO
PEAS_ MEFKLIEPEE VARLWGIQKNRPAMNYDKLSRSLRYYYEKG
MOUSE IMQKVAGERY
HPPDHv --------SE LFK-SIE-DY--EKS--LEA
KQSAAV-QGS
- ~ 0050/48141 HPPD Ath --------SE LFK-SIE-EY--EKT--LEAKQLVG
_ HUMAN --------NS LFK-AFEEEQ--NLRGNLTNMETNGVVPGM
HPPD
_ RAT --------NS LFK-AFEEEQ--ALRG
HPPD
_ PIG --------NS LFK-AFEEEQ--ELRGNLTDTDPNGVPFRL
HPPD
_ MOUSE --------NS LFK-AFEEEQ--ALRGNLTDLEPNGVRSGM
HPPD
_ PSESP --------KA LFE-SIERDQ--VRRGVLST-D
HPPD_ MELA SHECO --------KA LFE-SIERDQ--VRRGVL
_ MOUSE VYKFVCEPEA LFSLAFPDNQRPALKAEFDRPVSEEDTVPL SHLDESPAYL
HPPD_Hv HPPD_Ath HPPD_HUMAN
HPPD_RAT
HPPD_PIG
HPPD_MOUSE
HPPD PSESP
MELA SHECO
,:.
Key: HPPD Hv: Hordeum vulgate 4-hydroxyphenylpyruvate dioxygenase (HvSD36) HPPD_Ath: Arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase HPPD HUMAN: H.sapiens 4-hydroxyphenylpyruvate dioxygenase HPPD_PIG: pig 4-hydroxyphenylpyruvate dioxygenase HPPD_RAT: rat F alloantigen HPPD MOUSE: mouse 4-hydroxyphenylpyruvate dioxygenase MELA_SHECO: S. colwelliana melA protein HPPD_PSESP: Pseudomonas sp. (strain P.J.874) 4-hydroxyphenylpyruvate dioxygenase PEA3 MOUSE: Mus musculus (mouse) PEA3 polypeptide The greatest homology was with the Arabidopsis sequence, viz. 58% over the entire sequence (62% over 412 amino acids), followed by HPPD_RAT with 35% (over 365 amino acids), HPPD HUMAN 34% (over 365 amino acids), HPPD MOUSE
34% (over 371 amino acids).
Example 4 Raising barley (Hordeum vulgate) Barley seedlings (Hordeum vulgate L. cv. Carina, Ackermann Saatzucht, Irbach, Germany) were raised over a period of 15 days under controlled conditions in a controlled-environment cabinet in so-called Mitscherlich pots in soil containing 4 g of Osmocote 5M (Urania, Hamburg, Germany) per liter. To ensure uniform growth, the seeds were germinated on moist filter paper in the dark for 2 days at 4~C and 1 day at 21~C, and only those seedlings - ~ 0050/48141 CA 02296840 2000-O1-13 were planted which showed the same longitudinal growth of the primary root. After these seedlings had been transferred onto soil, they were covered with screened soil to a depth of 1.5 cm.
Thereafter, the plants were incubated for 9 days at 16 hours light (120 Eumm-2~s'1) and 8 hours darkness in conjunction with a temperature shift (21~C during the day, 16~C during the night).
After 9 days, the plants were kept for 2 days (days 10 and 11) in the dark at the abovementioned temperature in order to induce senescence.
Example 5 Raising tobacco The tobacco plants were raised following the known method. The tobacco cultivar used is Nicotiana tabacum cv. Xanthi.
Example 6 Transformation of tobacco The expression cassette according to the invention comprising the HPPD gene with Sequence 1 was cloned into vector pBinAR-Hyg (Fig. 4). Tobacco plants as described in Example 5 were subsequently transformed with this vector following the known method.
Example 7 Increasing the tocopherol biosynthesis in tobacco The HPPD cDNA was provided with a CaMV 35S promoter and ,'- 30 overexpressed in tobacco using the 35S promoter. In parallel, the seed-specific phaseolin gene promoter was used to increase the tocopherol content specifically in the tobacco seed. Tobacco plants which had been transformed with the relevant constructs were raised in the greenhouse. The a-tocopherol content of the total plant and of the seeds of the plant was subsequently determined. In all cases, the a-tocopherol concentration was increased in comparison with the untransformed plant.
~
~ 0050/48141 CA 02296840 2000-O1-13 SEQUENCE PROTOCOL
(1) GENERAL
INFORMATION
(i) APPLICANT
(A) NAME: BASF AG
(B) STREET: Carl Bosch (C) TOWN: Ludwigshafen (D) FEDERAL COUNTRY: Germany (F) POSTCODE: 67056 (G) TELEPHONE: 0621-60-52698 (ii) TITLE OF APPLICATION: HPPD sequence from barley (iii) NUMBER OF SEQUENCES: 2 (iv) COMPUTER-READABLE FORM:
(A) RECORDING MEDIUM: floppy disk (B) COMPUTER: IBM PC compatible _ (C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: PatentIn release #1.0, Version #1.25 (EPA) (2) INFORMATION
ON SEQ
ID NO:
1:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 1565 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: double (D) TOPOLOGY: linear (ii) MOLECULE TYPE: cDNA
(iii) HYPOTHETIC: NO
(iii) ANTISENSE: NO
(vi) ORIGINAL SOURCE:
(A) ORGANISM: hppd from barley (D) DEVELOPMENTAL STAGE: senescence (vi1) IMMEDIATE SOURCE:
(A) LIBRARY: lambda FIXII library of barley (B) CLONE: pHvSD36.seq (ix) FEATURES:
(A) NAME/KEY: CDS
(B) POSITION: 9..1313 (x) PUBLICATION DETAILS:
(A) AUTHORS: Krupinska, Karin (B) TITLE: Overexpression of HPPD
(C) JOURNAL: overexpression of HPPD
(G) DATE: 1998 (K) RELEVANT RESIDUES IN SEQ ID NO: 1 FROM 1 (xi) SEQUENCE DESCRIPTION: SEQ ID NO: 1:
Met Pro Pro Thr Pro Thr Thr Pro Ala Ala Thr Gly Ala Ala ..' 2 9 Ala Ala Val Thr Pro Glu His Ala Arg Pro His Arg Met Val Arg Phe Asn Pro Arg Ser Asp Arg Phe His Thr Leu Ser Phe His His Val Glu Phe Trp Cys Ala Asp Ala Ala Ser Ala Ala Gly Arg Phe Ala Phe Ala Leu Gly Ala Pro Leu Ala Ala Arg Ser Asp Leu Ser Thr Gly Asn Ser GCG CAC GCC TCC CAG.CTG CTC CGC TCG GGC TCC CTC GCC TTC CTC TTC 290 Ala His Ala Ser Gln Leu Leu Arg Ser Gly Ser Leu Ala Phe Leu Phe Thr Ala Pro Tyr Ala Asn Gly Cys Asp Ala Ala Thr Ala Ser Leu Pro Ser Phe Ser Ala Asp Ala Ala Arg Arg Phe Ser Ala Asp His Gly Ile Ala Val Arg Ser Val Ala Leu Arg Val Ala Asp Ala Ala Glu Ala Phe t,: Arg Ala Ser Arg Arg Arg Gly Ala Arg Pro Ala Phe Ala Pro Val Asp Leu Gly Arg Gly Phe Ala Phe Ala Glu Val Glu Leu Tyr Gly Asp Val Val Leu Arg Phe Val Ser His Pro Asp Gly Thr Asp Val Pro Phe Leu Pro Gly Phe Glu Gly Val Thr Asn Pro Asp Ala Val Asp Tyr Gly Leu Thr Arg Phe Asp His Val Val Gly Asn Val Pro Glu Leu Ala Pro Ala Ala Ala TyrIle Ala GlyPhe Thr GlyPhe His GluPhe Ala Glu Phe ACG GCG GAGGAC GTG GGCACG ACC GAGAGC GGG CTCAAC TCG GTG GTG ?70 Thr Ala GluAsp Val GlyThr Thr GluSer Gly LeuAsn Ser Val Val Leu Ala AsnAsn Ser GluGly Val LeuLeu Pro LeuAsn Glu Pro Val His Gly ThrLys Arg ArgSer Gln IleGln Thr PheLeu Glu His His GGC GGC CCGGGC GTG .CAGCAC ATC GCGGTG GCC AGCAGT GAC GTG CTC 914 Gly Gly ProGly Val GlnHis Ile AlaVal Ala SerSer Asp Val Leu Arg Thr LeuArg Lys MetArg Ala ArgSer Ala MetGly Gly Phe Asp Phe Leu ProPro Pro LeuPro Lys TyrTyr Glu GlyVal Arg Arg Leu Ala Gly AspVal Leu SerGlu Ala GlnIle Lys GluCys Gln Glu Leu Gly Val LeuVal Asp ArgAsp Asp GlnGly Val LeuLeu Gln Ile Phe Thr Lys ProVal Gly AspArg Pro ThrLeu Phe LeuGlu Met Ile Gln Arg Ile GlyCys Met GluLys Asp GluArg Gly GluGlu Tyr Gln Lys Gly Gly CysGly Gly PheGly Lys GlyAsn Phe SerGlu Leu Phe Lys Ser Ile GluAsp Tyr GluLys Ser LeuGlu Ala LysGln Ser Ala Ala Val Gln Gly Ser ACAGATTTTG AGTTCTGCAA AAAA.A 1565 (2) INFORMATION ON SEQ ID N0: 2:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 434 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) TYPE OF MOLECULE: protein (xi) SEQUENCE DESCRIPTION: SEQ ID NO: 2:
Met Pro Pro Thr Pro Thr Thr Pro Ala Ala Thr Gly Ala Ala Ala Ala Val Thr Pro Glu His Ala Arg Pro His Arg Met Val Arg Phe Asn Pro Arg Ser Asp Arg Phe His Thr Leu Ser Phe His His Val Glu Phe Trp Cys Ala Asp Ala Ala Ser Ala Ala Gly Arg Phe Ala Phe Ala Leu Gly Ala Pro Leu Ala Ala Arg Ser Asp Leu Ser Thr Gly Asn Ser Ala His Ala Ser Gln Leu Leu Arg Ser Gly Ser Leu Ala Phe Leu Phe Thr Ala Pro Tyr Ala Asn Gly Cys Asp Ala Ala Thr Ala Ser Leu Pro Ser Phe Ser Ala Asp Ala Ala Arg Arg Phe Ser Ala Asp His Gly Ile Ala Val Arg Ser Val Ala Leu Arg Val Ala Asp Ala Ala Glu Ala Phe Arg Ala Ser Arg Arg Arg Gly Ala Arg Pro Ala Phe Ala Pro Val Asp Leu Gly -' 32 Arg Gly Phe Ala Phe Ala Glu Val Glu Leu Tyr Gly Asp Val Val Leu Arg Phe Val Ser His Pro Asp Gly Thr Asp Val Pro Phe Leu Pro Gly Phe Glu Gly Val Thr Asn Pro Asp Ala Val Asp Tyr Gly Leu Thr Arg Phe Asp His Val Val Gly Asn Val Pro Glu Leu Ala Pro Ala Ala Ala Tyr Ile Ala Gly Phe Thr Gly Phe His Glu Phe Ala Glu Phe Thr Ala Glu Asp Val Gly Thr Thr Glu Ser Gly Leu Asn Ser Val Val Leu Ala l, 245 250 255 Asn Asn Ser Glu Gly Val Leu Leu Pro Leu Asn Glu Pro Val His Gly Thr Lys Arg Arg Ser Gln Ile Gln Thr Phe Leu Glu His His Gly Gly Pro Gly Val Gln His Ile Ala Val Ala Ser Ser Asp Val Leu Arg Thr 29p 295 300 Leu Arg Lys Met Arg Ala Arg Ser Ala Met Gly Gly Phe Asp Phe Leu Pro Pro Pro Leu Pro Lys Tyr Tyr Glu Gly Val Arg Arg Leu Ala Gly f,- Asp Val Leu Ser Glu Ala Gln Ile Lys Glu Cys Gln Glu Leu Gly Val Leu Val Asp Arg Asp Asp Gln Gly Val Leu Leu Gln Ile Phe Thr Lys Pro Val Gly Asp Arg Pro Thr Leu Phe Leu Glu Met Ile Gln Arg Ile Gly Cys Met Glu Lys Asp Glu Arg Gly Glu Glu Tyr Gln Lys Gly Gly 385 390 395 ~ 400 Cys Gly Gly Phe Gly Lys Gly Asn Phe Ser Glu Leu Phe Lys Ser Ile Glu Asp Tyr Glu Lys Ser Leu Glu Ala Lys Gln Ser Ala Ala Val Gln Gly Ser
(CRC Press), Chapter. 6/7, pp. 71 - 119 (1993).
Using the above-cited recombination and cloning techniques, the expression cassettes according to the invention can be cloned into suitable vectors which allow their multiplication, for example in E. coli. Suitable cloning vectors are, inter alia, pBR332, pUC series, Ml3mp series and pACYC184. Especially suitable are binary vectors which are capable of replicating not only in E. coli, but also in agrobacteria.
The invention furthermore relates to the use of an expression cassette according to the invention for transforming plants, plant cells, plant tissues or plant organs. The preferred purpose of the use is to raise the vitamin E content of the plant.
Depending on the choice of the promoter, expression may take place specifically in the leaves, in the seeds or in other plant organs. The present invention also relates to such transgenic plants, their propagation material and their plant cells, plant tissues or plant organs.
In addition, the expression cassette according to the invention may also be employed for transforming bacteria, cyanobacteria, yeasts, filarnentous fungi and algae with the purpose of raising the vitamin E production.
The transfer of foreign genes into the genome of a plant is termed transformation. This process exploits the previously described methods of transforming and regenerating plants from plant tissues or plant cells to obtain transient or stable transformation. Suitable methods are protoplast transformation by polyethylene-glycol induced DNA uptake, the ballistic method with the gene gun - the so-called particle bombardment method, electroporation, incubation of dry embryos in DNA-containing solution, microinjection and Agrobacterium-mediated gene transfer. The abovementioned methods are described, for example, in B. Jenes et al., Techniques for Gene Transfer, in: Transgenic Plants, Vol. 1, Engineering and Utilization, Eds. S.D. Kung and R.
Wu, Academic Press (1993) 128 - 143, and in Potrykus Annu. Rev.
Plant Physiol. Plant Molec. Biol. 42 (1991) 205 - 225). The construct to be expressed is preferably cloned into a vector which is suitable for transforming Agrobacterium tumefaciens, for example pBinl9 (Bevan et al., Nucl. Acids Res. 12 (1984) 8711).
Agrobacteria transformed with an expression cassette according to the invention can also be used, in a known manner, for transforming of plants, in particular crop plants such as cereals, maize, oats, soya, rice, cotton, sugar beet, canola, sunflowers, flax, hemp, potatoes, tobacco, tomatoes, oilseed .
rape, alfalfa, lettuce and the various tree, nut and grapevine species, for example by immersing scarified leaves or leaf sections in an agrobacteria solution and subsequently growing them in suitable media.
Functionally equivalent sequences which encode an HPPD gene are, in accordance with the invention, those sequences which still have the desired functions despite a different nucleotide sequence. Thus, functional equivalents embrace naturally occurring variants of the sequences described herein and also artificial nucleotide sequences, eg. artificial nucleotide sequences which have been obtained by chemical synthesis and which are adapted to the codon usage of a plant.
A functional equivalent is also to be understood as meaning, in particular, natural or artificial mutations of an originally isolated HPPD-encoding sequence which continues to show the desired function. Mutations encompass substitutions, additions, deletions, inversions or insertions of one or more nucleotide residues. Thus, the present invention also encompasses those nucleotide sequences which are obtained by modifying the present nucleotide sequence. The purpose of such a modification may be, for example, a further limitation of the encoding sequence contained therein, or else, for example, the insertion of further cleavage sites for restriction enzymes.
Functional equivalents are also those variants whose function is less or more pronounced in comparison with the starting gene or gene fragment.
Also suitable are artificial DNA sequences as long as they, as described above, mediate the desired characteristic of raising the vitamin E content in the plant by overexpressing the HPPD
gene in crop plants. Such artificial DNA sequences can be determined for example by back-translation of proteins constructed with the aid of molecular modeling and which have HPPD activity, or by in vitro selection. Especially suitable are encoding DNA sequences which were obtained by back-translating a - ~ 005048141 CA 02296840 2000-O1-13 polypeptide sequence in accordance with the codon usage specific to the host plant. The specific codon usage can be determined readily by an expert familiar with plant genetic methods using computer evaluations of other, known genes of the plant to be transformed.
Further suitable equivalent nucleic acid sequences according to the invention which must be mentioned are sequences which encode fusion proteins, a component of the fusion protein being a plant HPPD polypeptide or a functionally equivalent moiety thereof. The second moiety of the fusion protein can be, for example, a further polypeptide with enzymatic activity or an antigenic polypeptide sequence with the aid of which the detection of HPPD
expression is possible (eg. myc-tag or his-tag). However, this is preferably a regulatory protein sequence, eg. a signal or transit peptide, which leads the HPPD protein to the desired site of action.
However, the invention also relates to the expression products and fusion products, of a transit peptide and a polypeptide with HPPD activity, which have been produced in accordance with the invention.
Raising the vitamin E content means, for the purposes of the present invention, the artificially acquired ability of an elevated vitamin E biosynthesis performance by means of functional overexpression of the HPPD gene in the plant in contrast to the non-genetically-engineered plant for the duration of at least one plant generation.
The vitamin E biosynthesis site is generally the leaf tissue, so that leaf-specific expression of the HPPD gene is expedient.
However, it will be understood readily that vitamin E
biosynthesis is not necessarily restricted to the leaf tissue, but may also take place tissue-specifically in all other organs of the plant, for example in fatty seeds.
In addition, constitutive expression of the exogenous HPPD gene is advantageous. On the other hand, inducible expression may also appear desirable.
The efficacy of expression of the transgenically expressed HPPD
gene can be determined for example in vitro by shoot meristem propagation. In addition, changes in the nature and level of HPPD
gene expression, and its effect on the vitamin E biosynthesis ' 0050/48141 performance on test plants, can be tested in greenhouse experiments.
The invention furthermore relates to transgenic plants 5 transformed with an expression cassette according to the invention, and to transgenic cells, tissues, organs and propagation material of such plants. Especially preferred in this context are transgenic crop plants, eg. barley, wheat, rye, maize, oats, soya, rice, cotton, sugar beet, canola, sunflowers, 10 flax, hemp, potatoes, tobacco, tomatoes, oilseed rape, alfalfa, lettuce and the various tree, nut and grapevine species.
Plants for the purposes of the invention are mono- and dicotyledonous plants or algae.
As already mentioned, HPPD is a suitable target for sulcotrione-type herbicides. To allow even more efficient HPPD
inhibitors, it is necessary to provide suitable test systems with which inhibitor/enzyme binding studies can be carried out. To this end, for example, the complete barley HPPD cDNA sequence is cloned into an expression vector (pQE, Qiagen) and overexpressed in E. coli.
The HPPD protein expressed with the aid of the expression cassette according to the invention is particularly suitable for finding HPPD-specific inhibitors.
To this end, the HPPD can be employed, for example, in an enzyme assay in which the HPPD activity is determined in the presence and absence of the active substance to be tested. A comparison of the two activity determinations allows qualitative and quantitative findings on the inhibitory behavior of the active substance to be tested to be obtained.
The test system according to the invention allows a large number of chemical compounds to be screened rapidly and simply for herbicidal properties. The method allows the targeted and reproducible selection, amongst a large number of substances, of those with great potency in order to subject these substances subsequently to further in-depth tests with which the expert is familiar.
The invention furthermore relates to herbicides which can be identified with the above-described test system.
Overexpression in a plant of the gene sequence Seq ID NO: l, which encodes an HPPD, results in an elevated resistance to HPPD
inhibitors. The invention also relates to the transgenic plants thus generated.
The invention furthermore relates to:
- A method of transforming a plant, which comprises introducing an expression cassette according to the invention into a plant cell, into callus tissue, into an entire plant or into plant protoplasts.
- The use of a plant for generating plant HPPD.
;;;;v 15 - The use of the expression cassette according to the invention for generating plants with elevated resistance to HPPD
inhibitors by means of higher expression of a DNA sequence according to the invention.
- The use of the expression cassette according to the invention for generating plants with an elevated vitamin E content by means of expressing, in plants, a DNA sequence according to the invention.
- The use of the expression cassette according to the invention for generating a test system for identifying HPPD inhibitors.
The invention is illustrated by the examples which follow, but not limited thereto:
General cloning methods The cloning steps carried out within the scope of the present invention, eg. restriction cleavages, agarose gel electrophoresis, purification of DNA fragments, transfer of nucleic acids onto nitrocellulose and nylon membranes, linking DNA fragments, transformation of E. coli cells, growing bacteria, multiplying phages and sequence analysis of recombinant DNA, were carried out as described by Sambrook et al. (1989) Cold Spring Harbor Laboratory Press; ISBN 0-87969-309-6).
The bacterial strains used hereinbelow (E. coli, XL-I Blue) were obtained from Stratagene and, in the case of NP66, Pharmacia. The i. 15 agrobacterial strain used for the transformation of plants (Agrobacterium tumefaciens, C58C1 with plasmid pGV2260 or pGV3850kann) was described by Deblaere et al. in (Nucl. Acids Res. 13 (1985) 4777). Alternatively, the agrobacterial strain LBA4404 (Clontech) or other suitable strains may also be employed. Vectors which can be used for cloning are the vectors pUCl9 (Vanish-Perron, Gene 33 (1985), 103 - 119) pBluescript SK-(Stratagene), pGEM-T (Promega), pZerO (Invitrogen), pBinl9 (Bevan et al., Nucl. Acids Res. 12 (1984), 8711 - 8720) and pBinAR
(Hofgen and Willmitzer, Plant Science 66 (1990) 221 - 230).
Sequence analysis of recombinant DNA
Recombinant DNA molecules were sequenced using a laser fluorescence DNA sequencer by Licor (available from MWG Biotech, Ebersbach) following the method of Sanger (Sanger et al., Proc.
Natl. Acad. Sci. USA 74 (1977), 5463 - 5467).
Generation of plant expression cassettes Into plasmid pBinl9 (Bevan et al., Nucl. Acids Res. (1984) 12, 8711) there was inserted a 35S CaMV promoter in the form of an EcoRI-KpnI.fragment corresponding to nucleotides 6909 - 7437 of cauliflower mosaic virus (Franck et a1. Cell 21 (1980) 285). The polyadenylation signal of gene 3 of the T-DNA of the Ti plasmid pTiACHS (Gielen et al., EMBO J. 3 (1984) 835), nucleotides 11749 - 11939, was isolated as a PvuII-HindIII fragment and, after addition of SphI linkers, cloned into the PvuII cleavage site between the SpHI-HindIII cleavage site of the vector pBmAR-Hyg.
This gave the plasmid pBinAR (Hofgen and Willmitzer, Plant Science 66 (1990) 221 - 230).
Use Examples Example 1 Isolation of HPPD-specific cDNA sequences The composition of the mRNA population from primary leaves of nine-day-old barley plants which had been grown in an L/D
photoperiod (16 hours light/8 hours dark) was compared with that of primary leaves of 11-day-old barley plants in which, after a raising period of nine days, senescence was subsequently induced by a two-day dark treatment (Humbeck and Krupinska, J. Photochem.
Photobiol. 36 (1996), 321 - 326) with the aid of the DDRT-PCR
method published by Liang and Pardee (Science (1992) 257, 967 -972). In each case 0.2 p,g of the total RNA was converted into cDNA
using the enzyme "Superskript RT" (Gibco BRL, Eggenstein). In addition to the RNA, the reaction batches (20 ~1) also contained ~tM dNTPs, 10 ~M DTT, lxRT buffer and in each case 1 ~M
(dT)12VN primer. The anchor "primers" required for these 20 reactions were synthesized on the basis of the data of Liang and Pardee:
1. 5'-TTTTTTTTTTTTAG-3' 2. 5'-TTTTTTTTTTTTCA-3' 3, 5'-TTTTTTTTTTTTAC-3' 4. 5'-TTTTTTTTTTTTGT-3' After the cDNAs were synthesized, amplification of the relevant sequences was effected in each case in ten batches, which differ by the use of the random "primers" given hereinbelow:
1. 5 '-TACAACGAGG-3' 2. 5'-GGAACCAATC-3' 3. 5 '-AAACTCCGTC-3' 4. 5'-TGGTAAAGGG-3' 5. 5 '-CTGCTTGATG-3' 6. 5'-GTTTTCGCAG-3' 5 '-GATCTCAGAC-3' 8. 5'-GATCTAACCG-3' 7.
9. 5 '-GATCATGGTC-3' 10. 5'-GATCTAAGGC-3' In a volume of in each case 20 ~,1, the PCR reaction batches contained lxPCR buffer, 2 ~M dNTPs, 2.5 ~.Ci (a 33P)-dATP, 1 [~M
(dT)12VN-..primer", 1/10 vol. RT mix (Sambrook et al. Molecular Cloning - A Laboratory Manual, 1989), 1 U Taq DNA polymerase (Boehringer, Mannheim) and 1 p,M 10-mer random "primers". The PCR-reactions proceeded in a Uno block (Biometra) following the program below:
1. 94°C 2 min 2. 94°C 30 s v 19 3. 40°C 2 min 4. 72°C 30 s 5. 72°C 5 min 6. 4°C storage until further processing Steps 2, 3 and 4 were carried out 40 times in succession. This gave approximately 100 cDNA bands per reaction and "primer"
combination.
In contrast to the protocol of Liang and Pardee, the amplified cDNA fragments were separated in non-denaturing polyacrylamide gels of the following composition: 6% (w/v) acrylamide (Long Ranger, AT Biochem), 1.2 x TBE buffer, 0.005% (v/v) TEMED and 0.005% (w/v) APS (Bauer et al, Nucl. Ac. Res. (1993) 21, 4272 - 4280 ) .
In each case 3.5 [~1 of each PCR batch were treated with 2 ~.1 of loading buffer (dye II, Sambrook et al., 1989) and then loaded onto the gel. To determine the reproducibility of the cDNA
band patterns (Fig. 5), in each case two independent RNA preparations (9 and 9', 11 and 11') were prepared from the barley primary leaves harvested on days 9 and 11 and used in parallel in the analysis below. What is shown is the result of two different primer combinations (A and B); by way of example, two differences in the band pattern between the sample of days 9 and 11 were emphasized by arrows. Only those bands which occurred equally in the two samples from senescing plants and which did not occur in the two comparison samples were taken into consideration when analyzing the gels at a later point in time. Electrophoresis was carried out over a period of 2.5 hours at 40 watt (0.8 w/cm3) in 1 x TBE buffer. After separation of the cDNA fragments had occurred, the gel was transferred onto filter paper (Schleicher &
Schiill, Dassel). After the gel had been dried at 50C, an X-ray film was placed on top of it. cDNA bands which were only found in the case of samples 11 and 11' in the autoradiograph were excised from the dry gel using a surgical blade, and the DNA was eluted by boiling in 100 ~1 1 x TE buffer. The ethanol-precipitated DNA
was resuspended in 10 ~.1 of water for further tests. After reamplification with the "primers" previously used for this batch, the DNA was cloned and sequenced and also employed as a probe for Northern blot hybridizations.
To test if the relevant cDNA fragment actually represents a senescence-specifically occurring transcript, hybridizations were carried out with RNA from leaves of various developmental stages:
' 0050/48141 A. 1. RNA from primary leaves from plants raised for 9 days in an L/D photoperiod A. 3. RNA from primary leaves from 10-day-old plants raised 5 without a light phase on day 10 A. 4 RNA from primary leaves from 11-day-old plants which lacked a light phase on days 10 and 11 10 A. 5 RNA from primary leaves from 12-day-old plants which underwent a further light phase after 2 days in the dark The samples for RNA analysis were harvested in each case in the middle of the original night phase.
B. RNA from flag leaves which had been collected in the field at seven different points in time (Fig. 6). The leaves were fully grown on 29 May and showed less than 10~ of the original chlorophyll content on 21 June. The beginning of the senescence processes is shown in Figure 6 by an arrow (ie. 17 days after reaching the full length on 15 June). The beginning of senescence was defined as the day on which photosystem II efficacy dropped (Humbeck et al., Plant Cell Environment (1996) 19 : 337 - 344 ) .
To hybridize a filter with the above-described RNA samples, a specific probe for the rbcS gene, which encodes the small sub-unit of ribulose-1,5-bisphosphate carboxylase, was also employed in addition to the HPPD probe, for comparison reasons.
Figure 6 shows hybridization of the "Northern blots" A and B with cDNA HvSD36 and with a probe which is specific for the rbcS gene.
Filter A carries RNA from barley primary leaves after a raising period of 9 days in an L/D photoperiod (9), after subsequent incubation in the dark for one and two days, respectively (10, 11) and after subsequent return to light conditions for one day (12). Filter B contains RNA from flag leaves which had been harvested in the field in the period from 29.05. to 21.06.1992.
The arrow indicates the beginning of senescence on 15.06. As can been seen from Figure 6, the amount of rbcS-specific mRNA is high when the amount of HPPD-specific mRNA is relatively low. In primary leaves of nine-day-old plants, the HPPD-specific mRNA is not detectable prior to transfer into the dark and accumulates markedly during the dark phase. When the plants are returned to light conditions, the amount of this mRNA drops markedly. In the case of the flag leaves, small amounts of the HPPD-specific mRNA
can already be detected in fully-grown, non-senescent leaves. As ' 0050/48141 early as 4 days prior to the actual beginning of senescence, expression levels are higher. The highest amount of this mRNA can be found in senescent leaves. A size comparison with known RNA
species showed that the transcript detected with the cDNA probe HvSD36 (s: senescence; d: dark, fragment number 36 in the DDRT
gel) has a length of approx. 1.6 kb.
By means of DDRT PCR, three cDNA fragments were obtained independently of each other which showed this expression pattern and which, on the basis of sequence analysis, actually represent the same transcript. The longest fragment had a size of 230 bp.
The 230 by long PCR product was finally cloned into the SmaI
cleavage site of vector pUCl8 using the "Sure CloneTM ligation kit" (Pharmacia, Freiburg) following the manufacturer's t 15 instructions. The recombinant plasmid was transformed into competent cells of E. coli strain DH5 a. Since, for methodology reasons, the fragment represents the 3' end of the relevant transcript, the sequence information was first insufficient to identify an unambiguous homology with a sequence in the databases. To isolate a longer corresponding cDNA, a lambda ZAPII
library (Stratagene, Heidelberg) of RNA of senescent flag leaves was screened using the 230 by long fragment as the probe. For this step, the probe was labeled with Dig-dUTP following the instructions of the "DNA Labeling and Detection Kit" (Boehringer, Mannheim). The library was examined following the protocol of the "ZAP-cDNA Synthesis Kit" (Stratagene, Heidelberg).
In the case of the probe described herein, 150,000 pfu were examined. Of these, 39 phage plaques gave a positive signal. Of these, further work was carried out on 12 phage populations.
Following phage preparation, the fragments inserted were enriched via PCR and separated by electrophoresis. Southern blot hybridization with the HvSD36 probe allowed those phage populations which had the largest "inserts" with positive signal to be selected amongst the 12 phage populations thus treated.
After replating, the phages were subjected to a further hybridization step. Single phage plaques were excised and, after elution, subjected to an in vivo excision using a helper phage and following the protocol from Stratagene (ExassistTM
Interference-Resistant Helper Phage with SOLR TM Strain). The so-called "phagemids" obtained from this treatment contain the cDNA cloned in pBLueskript (SK-).
Following a subsequent plasmid preparation, the relevant "insert~
was excised from the Bluescript plasmid using EcoRI. The cDNA
clone obtained in the case of HvSD36 contains an "insert" with a length of approx. 800 bp. Complete sequencing of the cDNA was carried out using the "SequiTherm Excel Long-Read DNA-Sequenzierungs-Rit" (Epicentre Technologies, Biozym Diagnostic, Oldendorf) using IRD41-labeled universal "primers"
which bind to sequence regions in the Bluescript vector.
Detection of the DNA fragments was effected via the infrared laser of the automatic sequencer 4000L by Licor. After sequencing, an exactly 759 by long sequence was present whose sides are flanked by an in each case 14 by long adaptor sequence.
These adaptor sequences were used for ligating the cDNA fragments with the arms of phage lambda ZAPII (Stratagene, Heidelberg) when generating the c-DNA library.
Amongst the sequences in the databases, the protein sequence HvSD36, which has a total of over 180 amino acids, has a homology of 41% with the sequence of human HPPD which is the highest.
Taking into consideration the length of the transcript detected in the "Northern blot" (approx. 1600 nt), it can be assumed that 850-900 by are still missing from the cDNA.
To complete the cDNA, a further cDNA library was investigated.
mRNA was isolated from the basal meristematic zone of 5-day-old barley seedlings with the aid of "Dynabeads" (Dynal, Hamburg) and transcribed into cDNA using the "Time Saver cDNA SyntheseRit"
(Pharmacia, Freiburg). This was followed by ligation of EcoRI/NotI adaptors (Pharmacia, Freiburg) to the cDNA with subsequent ligation into the lambda ExCell vector (Pharmacia, Freiburg). Finally, the recombinant phage DNA was packaged into phage proteins with the aid of "Gigapack II Gold Set" (Stratagene, Heidelberg). Using the 759 by long probe HvSD36, 400,000 pfu were screened, and 5 phages were detected by the probe. Excision of the "phagemids" from the phage was effected in vivo with the aid of bacterial strain NP66 following the instructions of Pharmacia (Freiburg). The recombinant pExCell plasmids were isolated from the individual bacterial colonies and transferred into bacterial strain D115 a for propagation.
The longest cDNA clone HvSD36 isolated in this manner has a length of 1565 by and was sequenced completely (see sequence protocol).
Example 2 Characterization of the genomic sequence To identify a genomic clone which contains the gene sequence of HPPD, a lambda FIXII library of barley was obtained from Stratagene (Heidelberg). The library was prepared using DNA from etiolated leaves of winter barley cv. Igri. The DNA was partially digested with Sau3AI. Prior to cloning into the XhoI cleavage site of the vector, the fragment ends and the phage arms were filled up with nucleotides. Screening of the library with 200,000 pfu in the first round only gave one clone which hybridized with cDNA HvSD36. After subjecting this recombinant phage to restriction digestion with PstI and SacI, fragments 5400, 3800 and 1800 by in length were subsequently isolated which can be detected with the HvSD36 probe when carrying out a "Southern" blot hybridization. These sub-fragments exist in cloned form in the Bluescript vector.
The library was screened following the protocol given for the HybondN membrane. Labeling of the probe for screening the library (;~ 15 and for the "Southern" blot hybridizations was effected via "random priming" with 32P-dATP using the Klenow enzyme (Sambrook et al., (1989) Molecular cloning. A laboratory manual. Cold Spring Harbor Laboratory, New York).
A genomic "Southern blot" was carried out with total DNA from barley (farina) (Fig. 7). In each case 15 ~tg of DNA were digested with BamHI (B), EcoRI (E), HindIII (H) or XBAI (X) and separated in a 0.75 agarose gel. After transfer to a Hybond N+ membrane (Amersham, Braunschweig), hybridization was effected with the incomplete, 759 by long cDNA probe from HvSD36 following instructions of the membrane manufacturer. The following fragments were detected:
BamHI: 6.0, 3.9 and 3.0 kbp ~' 30 EcoRI: >10 kbp ~HindIII: 8.3, 2.6, 1.1 and 1.0 kbp XbaI: 9.0, 5.2 and 4.2 kbp The fragment lengths were estimated by comparison with a DNA size standard (Kb-Leiter, GibcoBRL, Eggenstein).
Example 3 Homology comparison of the HvSD36 protein sequence A comparison of the HvSD36 protein sequence with protein sequences in the database revealed homologies to the following protein sequences known to date:
~
~ 0050/48141 CA 02296840 2000-O1-13 5 HPPD Hv .......... .......... .......... ........MP PTPTTPAATG
HPPD_Ath .......... .........~ ..~~~~~~~~ ~-.MGHQNAA VSENQNHDDG
HPPD_HUMAN .......... .......... .......... .......... ..........
HPPD_RAT .......... .......... .......... .......... ..........
HPPD_PIG .......... .......... .......... .......... ..........
HPPD_MOUSE .......... ........~. .......... .......... ..........
HPPD_PSESP .......... .......... .......... .......... ..........
10 MELA_SHECO .......... .......... .......... .......... ..........
HPPDHv AAAAVTPEHA RPHRMVRFNPRSDRFHTLSFHHVEFWCADAASAAGRFAFA
_ Ath AASSPGFKLV GFSKFVRKNPKSDKFKVKRFHHIEFWCGDATNVARRFSWG
HPPD
t;',' 15 HPPDHUMAN _ M TTYSDKGAKPERGRFLH--FHSVTFWVGNAKQAASFYCSK
_ RAT YWDKGPKP ERGRFLH--FHSVTFWVGNAKQAASFYCNK
HPPD
_ PIG M TSYSDKGEKPERGRFLH--FHSVTFWGNARQAASYYCSK
HPPD
_ MOUSE M TTYNNKGPKPERGRFLH--FHSVTFWVGNAKQAASFYCNK
HPPD
_ PSESP ADLYENP MGLMGFEFIELASPTPNTLE
HPPD
_ SHECO MASEQNP LGLLGIEFTEFATPDLDFMH
MELA
_ MOUSE PAQTPGPQVS ASARGPGPVAGGSGRMERRMKGGYL---DQRVPYTFCSKS
HPPDHv LGAPLAARSD LSTGNSAHASQLLRSGSLAFLFT--APYANG-CDAA----_ Ath LGMRFSAKSD LSTGNMVHASYLLTSGDLRFLFT--APYSPS-LSAGEIKP
HPPD
_ HUMAN MGFEPLAYRG LETGSREWSHVIKQGKIVFVLS--SA----------LNP
HPPD
_ RAT MGFEPLAYKG LETGSREWSHVIKQGKIVFVLC--SA----------LNP
HppD
HPPDPIG IGFEPLAYKG LETGSREWSHVVKQDKIVFVFS--SA----------LNP
_ MOUSE MGFEPLAYRG LETGSREWSHVIKRGKIVFVLC--SA----------LNP
HPPD
_ PSESP PIFEIMGFTK VATHRSKDV-HLYRQGAINLILN--NE-------------HPPD
_ SHECO KVFIDFGFSK LKKHKQKDI-WYKQNDINF LLN--NE-------------MELA
_ MOUSE PGNGSLGEAL MVPQGKLMDPGSLPPSDSEDLFQDLSHFQETWLAEAQVPD
PEA3_ y- 30 HPPDHv --TASLPSFS ADAARRFSADHGIAVRSVALRVADAAEAFRASRRRGARPA
_ Ath TTTASIPSFD HGSCRSFFSSHGLGVRAVAIEVEDAESAFSISVANGAIPS
HPPD
_ HUMAN --------WN KEMGDHL-VKHGDGVKDIAFEVEDCDYIVQKARERGAKIM
HPPD
_ RAT --------WN KEMGDHL-VKHGDGVKDIAFEVEDCEHIVQKARERGAKIV
HPPD
_ PIG --------WN KEMGDHL-VKHGDGVKDIAFEVEDCDYIVQKARERGAIIV
HppD
HPPDMOUSE --------WN KEMGDHL-VKHGDGVKDIAFEVEDCDHIVQKARERGAKIV
_ PSESP ---------P HSVASYFAAEHGPSVCGMAFRVKDSQKAYKRALELGAQPI
HPPD
_ SHECO ---------K QGFSAQFAKTHGPAISSMGWRVEDANFAFEGAVARGAKPA
MELA
_ MOUSE SDEQFVPDFH ---SENLAFHSPTTRIKKEPQSPRTDPALSCSRKPPLPYH
HPPDHv FAPV------ -----DLGRGFAFAEVELYG--DWLRFVSHP--DG--TD
_ Ath SPPI------ -----VLNEAVTIAEV'KLYG--DVVLRYVSYKAEDT--EK
HPPD
HPPD_ REP------- -WVEQDKFGKVKFAVLQTYG--DTTHTLVEKMN-----YI
HUMAN
HPPD_ REP------- -WVEEDKFGKVKFAVLQTYG--DTTHTLVEKIN-----YT
RAT
HPPD_ REEVC-CAAD VRGHHTPLDRAR----QVWE--GT---LVEKMT-----FC
PIG
HppD_ REP------- -WVEQDKFGKVKFAVLQTYG--DTTHTLVEKIN-----YT
MOUSE
HPPDPSESP HI-------- ----ETGPMELNLPAIKGIG--GAPLYLIDRFGEGSSIYD
MELA_ AD-------- ----EV--KDLPYPAIYGIG--DSLIYFIDTFGDDNNIYT
SHECO
PEA3_ HGEQCLYSRQ IAIKSPAPGAPGQSPLQPFSRAEQQQSLLRASSSSQSHPG
MOUSE
' 0050/48141 HPPDHv VPFLPGFEGV TNPDA-----VDYGLTRFDH -APAAAYIAG
WGNVP--EL
_ Ath SEFLPGFERV EDASSF---PLDYGIRRLDH -GPALTYVAG
HPPD AVGNVP--EL
_ HUMAN GQFLPGYEAP AFMDPLLPKLPKCSLEMIDHIVGNQPDQEM-VSASEW---HPPD
_ RAT GRFLPGFEAP TYKDTLLPKLPSCNLEIIDHIVGNQPDQEM-ESASEW---HPPD
5 _ PIG LDSRPQPSQT LLHRLLLSKLPKCGLEIIDHIVGNQPDQEM-ESASQW---HPPD
HPPDMOUSE GRFLPGFEAP TYKDTLLPKLPRCNLEIIDHIVGNQPDQEM-QSASEW---_ PSESP IDFV--FLEG VDRHPVGA-----GLKIIDHLTHNWRGRM-A---YWANF
HPPD
_ SHECO SDF-----EA LDEPIITQ---EKGFIEVDHLTNNVHKGTM-E---YWSNF
MELA
_ MOUSE HGYLGEHSSV FQQPVDMCHSFTSPQGGGREPLPAPYQHQLSEPCPPYPQQ
HPPDHv FT---GFHEF AEFTAEDVGTTESGLNSWL ANNSEGVLLPLNEPVHGTKR
_ Ath FT---GFHQF AEFTADDVGTAESGLNSAVLASNDEMVLLPINEPVHGTKR
HPPD
_ HUMAN YLKNLQFHRF WSVDDTQVHTEYSSLRSIW ANYEESIKMPINEPAPG-KR
HPPD
_ RAT YLKNLQFHRF WSVDDTQVHTEYSSLRSIW ANYEESIKMPINEPAPG-RR
HPPD
_ PIG YMRNLQFHRF WSVDDTQIHTEYSALRSWM ANYEESIKMPINEPAPG-KR
HPPD
_ MOUSE YLKNLQFHRF WSVDDTQVHTEYSSLRSIW TNYEESIKMPINEPAPG-RK
HPPD
;: 15 HPPDPSESP YEKLFNFREI RYF---DIKGEYTGLTSKAMTAPDGMIRIPLNE--ESSKG
'-_ SHECO YKDIFGFTEV RYF---DIKGSQTALISYAI.RSPDGSFCIPINE--GKGDD
MELA
_ MOUSE NFKQ-EYHDP LYEQAGQPASSQGGVSGHRYPGAGWIKQERTDFAYDSDV
20 HPPDHv RSQIQTFLEH HGGPGVQH-IAVASSDVLRTLRKMRARSAMGGFDFLPPPL
_ Ath KSQIQTYLEH NEGAGLQH-LALMSEDIFRTLREMRKRSSIGGFDFMPSPP
HPPD
_ HUMAN KSQIQEYVDY NGGAGVQH-IALKTEDIITAIRHLRER----GLEFLSVP-HPPD
_ RAT KSQIQEYVDY NGGAGVQH-IALRTEDIITTIRHLRER----GMEFLAVP-HPPD
_ PIG KSQIQEYVDY NGGAGVQH-IALKTEDIITAIRSLRER----GVEFLAVP-HPPD
HPPD_ KSQIQEYVDY NGGAGVQH-IALKTEDIITAIRHLRER----GTEFLAAP-MOUSE
HPPD_ AGQIEEFLMQ FNGEGIQH-VAFLSDDLIKTWDHLKSI--=-GMRFMTAPP
PSESP
PEAS_ PGCASMYLHP EGFSGPSPGDGVMGYGYEKSLRPFPDDVCIVPRKFEGDIK
MOUSE
HPPDHv PKYYEGVRRL AGD--VLSEAQIKECQELGVLVDRDDQG----VLL-----HPPD_ PTYYQNLKKR VGD--VLSDDQIKECEELGILVDRDDQG----TLL-----Ath HPPD_ STYYKQLREK LKTAKIKVKENIDALEELKILVDYDEKG----YLL-----HUMAN
HPPD_ SSYYRLLREN LKTSKIQVKENMDVLEELKILVDYDEKG----YLL-----RAT
HPPD_ FTYYRQLQEK LKSAKIRVKESIDVLEELKILVDYDEKG----YLL-----PIG
HPPD_ SSYYKLLREN LKSAKIQVKESMDVLEELHILVDYDEKG----YLL-----MOUSE
HPPD_ DTYYEMLEGR LPN----HGEPVGELQARGILLDGSSESGDKRLLL-----PSESP
MELA_ E-YYDTIFEK LPQ----VTEDRDRIKHHQILVDGDEDG----YLL-----SHECO
HPPDHv QIFTKPVGDR PTLFLEMIQRIGCMEKDERGEE----YQKGGCGGFGKGNF
HPPD_ QIFTKPLGDR PTIFIEIIQRVGCMMKDEEGKA----YQSGGCGGFGKGNF
Ath HPPD_ QIFTKPVQDR PTLFLEVIQRHNHQ-------------- -GFGAGNF
HUMAN
HPPD_ QIFTKPMQDR PTLFLEVIQRHNHQ-------------------GFGAGNF
RAT
HPPD_ QIFTKPMQDR PTVFLEVIQRNNHQ-------------- ---GFGAGNF
PIG
HPPD_ QIFTKPMQDR PTLFLEVIQRHNHQ-------------------GFGAGNF
MOUSE
HPPD_ QIFSETLMGP --VFFEFIQR-----KGDD------------GFGEGNF
PSESP
MELA_ QIFTKNLFGP --IFIEIIQR-----KNNL--------------GFGEGNF
SHECO
PEAS_ MEFKLIEPEE VARLWGIQKNRPAMNYDKLSRSLRYYYEKG
MOUSE IMQKVAGERY
HPPDHv --------SE LFK-SIE-DY--EKS--LEA
KQSAAV-QGS
- ~ 0050/48141 HPPD Ath --------SE LFK-SIE-EY--EKT--LEAKQLVG
_ HUMAN --------NS LFK-AFEEEQ--NLRGNLTNMETNGVVPGM
HPPD
_ RAT --------NS LFK-AFEEEQ--ALRG
HPPD
_ PIG --------NS LFK-AFEEEQ--ELRGNLTDTDPNGVPFRL
HPPD
_ MOUSE --------NS LFK-AFEEEQ--ALRGNLTDLEPNGVRSGM
HPPD
_ PSESP --------KA LFE-SIERDQ--VRRGVLST-D
HPPD_ MELA SHECO --------KA LFE-SIERDQ--VRRGVL
_ MOUSE VYKFVCEPEA LFSLAFPDNQRPALKAEFDRPVSEEDTVPL SHLDESPAYL
HPPD_Hv HPPD_Ath HPPD_HUMAN
HPPD_RAT
HPPD_PIG
HPPD_MOUSE
HPPD PSESP
MELA SHECO
,:.
Key: HPPD Hv: Hordeum vulgate 4-hydroxyphenylpyruvate dioxygenase (HvSD36) HPPD_Ath: Arabidopsis thaliana 4-hydroxyphenylpyruvate dioxygenase HPPD HUMAN: H.sapiens 4-hydroxyphenylpyruvate dioxygenase HPPD_PIG: pig 4-hydroxyphenylpyruvate dioxygenase HPPD_RAT: rat F alloantigen HPPD MOUSE: mouse 4-hydroxyphenylpyruvate dioxygenase MELA_SHECO: S. colwelliana melA protein HPPD_PSESP: Pseudomonas sp. (strain P.J.874) 4-hydroxyphenylpyruvate dioxygenase PEA3 MOUSE: Mus musculus (mouse) PEA3 polypeptide The greatest homology was with the Arabidopsis sequence, viz. 58% over the entire sequence (62% over 412 amino acids), followed by HPPD_RAT with 35% (over 365 amino acids), HPPD HUMAN 34% (over 365 amino acids), HPPD MOUSE
34% (over 371 amino acids).
Example 4 Raising barley (Hordeum vulgate) Barley seedlings (Hordeum vulgate L. cv. Carina, Ackermann Saatzucht, Irbach, Germany) were raised over a period of 15 days under controlled conditions in a controlled-environment cabinet in so-called Mitscherlich pots in soil containing 4 g of Osmocote 5M (Urania, Hamburg, Germany) per liter. To ensure uniform growth, the seeds were germinated on moist filter paper in the dark for 2 days at 4~C and 1 day at 21~C, and only those seedlings - ~ 0050/48141 CA 02296840 2000-O1-13 were planted which showed the same longitudinal growth of the primary root. After these seedlings had been transferred onto soil, they were covered with screened soil to a depth of 1.5 cm.
Thereafter, the plants were incubated for 9 days at 16 hours light (120 Eumm-2~s'1) and 8 hours darkness in conjunction with a temperature shift (21~C during the day, 16~C during the night).
After 9 days, the plants were kept for 2 days (days 10 and 11) in the dark at the abovementioned temperature in order to induce senescence.
Example 5 Raising tobacco The tobacco plants were raised following the known method. The tobacco cultivar used is Nicotiana tabacum cv. Xanthi.
Example 6 Transformation of tobacco The expression cassette according to the invention comprising the HPPD gene with Sequence 1 was cloned into vector pBinAR-Hyg (Fig. 4). Tobacco plants as described in Example 5 were subsequently transformed with this vector following the known method.
Example 7 Increasing the tocopherol biosynthesis in tobacco The HPPD cDNA was provided with a CaMV 35S promoter and ,'- 30 overexpressed in tobacco using the 35S promoter. In parallel, the seed-specific phaseolin gene promoter was used to increase the tocopherol content specifically in the tobacco seed. Tobacco plants which had been transformed with the relevant constructs were raised in the greenhouse. The a-tocopherol content of the total plant and of the seeds of the plant was subsequently determined. In all cases, the a-tocopherol concentration was increased in comparison with the untransformed plant.
~
~ 0050/48141 CA 02296840 2000-O1-13 SEQUENCE PROTOCOL
(1) GENERAL
INFORMATION
(i) APPLICANT
(A) NAME: BASF AG
(B) STREET: Carl Bosch (C) TOWN: Ludwigshafen (D) FEDERAL COUNTRY: Germany (F) POSTCODE: 67056 (G) TELEPHONE: 0621-60-52698 (ii) TITLE OF APPLICATION: HPPD sequence from barley (iii) NUMBER OF SEQUENCES: 2 (iv) COMPUTER-READABLE FORM:
(A) RECORDING MEDIUM: floppy disk (B) COMPUTER: IBM PC compatible _ (C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: PatentIn release #1.0, Version #1.25 (EPA) (2) INFORMATION
ON SEQ
ID NO:
1:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 1565 base pairs (B) TYPE: nucleic acid (C) STRANDEDNESS: double (D) TOPOLOGY: linear (ii) MOLECULE TYPE: cDNA
(iii) HYPOTHETIC: NO
(iii) ANTISENSE: NO
(vi) ORIGINAL SOURCE:
(A) ORGANISM: hppd from barley (D) DEVELOPMENTAL STAGE: senescence (vi1) IMMEDIATE SOURCE:
(A) LIBRARY: lambda FIXII library of barley (B) CLONE: pHvSD36.seq (ix) FEATURES:
(A) NAME/KEY: CDS
(B) POSITION: 9..1313 (x) PUBLICATION DETAILS:
(A) AUTHORS: Krupinska, Karin (B) TITLE: Overexpression of HPPD
(C) JOURNAL: overexpression of HPPD
(G) DATE: 1998 (K) RELEVANT RESIDUES IN SEQ ID NO: 1 FROM 1 (xi) SEQUENCE DESCRIPTION: SEQ ID NO: 1:
Met Pro Pro Thr Pro Thr Thr Pro Ala Ala Thr Gly Ala Ala ..' 2 9 Ala Ala Val Thr Pro Glu His Ala Arg Pro His Arg Met Val Arg Phe Asn Pro Arg Ser Asp Arg Phe His Thr Leu Ser Phe His His Val Glu Phe Trp Cys Ala Asp Ala Ala Ser Ala Ala Gly Arg Phe Ala Phe Ala Leu Gly Ala Pro Leu Ala Ala Arg Ser Asp Leu Ser Thr Gly Asn Ser GCG CAC GCC TCC CAG.CTG CTC CGC TCG GGC TCC CTC GCC TTC CTC TTC 290 Ala His Ala Ser Gln Leu Leu Arg Ser Gly Ser Leu Ala Phe Leu Phe Thr Ala Pro Tyr Ala Asn Gly Cys Asp Ala Ala Thr Ala Ser Leu Pro Ser Phe Ser Ala Asp Ala Ala Arg Arg Phe Ser Ala Asp His Gly Ile Ala Val Arg Ser Val Ala Leu Arg Val Ala Asp Ala Ala Glu Ala Phe t,: Arg Ala Ser Arg Arg Arg Gly Ala Arg Pro Ala Phe Ala Pro Val Asp Leu Gly Arg Gly Phe Ala Phe Ala Glu Val Glu Leu Tyr Gly Asp Val Val Leu Arg Phe Val Ser His Pro Asp Gly Thr Asp Val Pro Phe Leu Pro Gly Phe Glu Gly Val Thr Asn Pro Asp Ala Val Asp Tyr Gly Leu Thr Arg Phe Asp His Val Val Gly Asn Val Pro Glu Leu Ala Pro Ala Ala Ala TyrIle Ala GlyPhe Thr GlyPhe His GluPhe Ala Glu Phe ACG GCG GAGGAC GTG GGCACG ACC GAGAGC GGG CTCAAC TCG GTG GTG ?70 Thr Ala GluAsp Val GlyThr Thr GluSer Gly LeuAsn Ser Val Val Leu Ala AsnAsn Ser GluGly Val LeuLeu Pro LeuAsn Glu Pro Val His Gly ThrLys Arg ArgSer Gln IleGln Thr PheLeu Glu His His GGC GGC CCGGGC GTG .CAGCAC ATC GCGGTG GCC AGCAGT GAC GTG CTC 914 Gly Gly ProGly Val GlnHis Ile AlaVal Ala SerSer Asp Val Leu Arg Thr LeuArg Lys MetArg Ala ArgSer Ala MetGly Gly Phe Asp Phe Leu ProPro Pro LeuPro Lys TyrTyr Glu GlyVal Arg Arg Leu Ala Gly AspVal Leu SerGlu Ala GlnIle Lys GluCys Gln Glu Leu Gly Val LeuVal Asp ArgAsp Asp GlnGly Val LeuLeu Gln Ile Phe Thr Lys ProVal Gly AspArg Pro ThrLeu Phe LeuGlu Met Ile Gln Arg Ile GlyCys Met GluLys Asp GluArg Gly GluGlu Tyr Gln Lys Gly Gly CysGly Gly PheGly Lys GlyAsn Phe SerGlu Leu Phe Lys Ser Ile GluAsp Tyr GluLys Ser LeuGlu Ala LysGln Ser Ala Ala Val Gln Gly Ser ACAGATTTTG AGTTCTGCAA AAAA.A 1565 (2) INFORMATION ON SEQ ID N0: 2:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 434 amino acids (B) TYPE: amino acid (D) TOPOLOGY: linear (ii) TYPE OF MOLECULE: protein (xi) SEQUENCE DESCRIPTION: SEQ ID NO: 2:
Met Pro Pro Thr Pro Thr Thr Pro Ala Ala Thr Gly Ala Ala Ala Ala Val Thr Pro Glu His Ala Arg Pro His Arg Met Val Arg Phe Asn Pro Arg Ser Asp Arg Phe His Thr Leu Ser Phe His His Val Glu Phe Trp Cys Ala Asp Ala Ala Ser Ala Ala Gly Arg Phe Ala Phe Ala Leu Gly Ala Pro Leu Ala Ala Arg Ser Asp Leu Ser Thr Gly Asn Ser Ala His Ala Ser Gln Leu Leu Arg Ser Gly Ser Leu Ala Phe Leu Phe Thr Ala Pro Tyr Ala Asn Gly Cys Asp Ala Ala Thr Ala Ser Leu Pro Ser Phe Ser Ala Asp Ala Ala Arg Arg Phe Ser Ala Asp His Gly Ile Ala Val Arg Ser Val Ala Leu Arg Val Ala Asp Ala Ala Glu Ala Phe Arg Ala Ser Arg Arg Arg Gly Ala Arg Pro Ala Phe Ala Pro Val Asp Leu Gly -' 32 Arg Gly Phe Ala Phe Ala Glu Val Glu Leu Tyr Gly Asp Val Val Leu Arg Phe Val Ser His Pro Asp Gly Thr Asp Val Pro Phe Leu Pro Gly Phe Glu Gly Val Thr Asn Pro Asp Ala Val Asp Tyr Gly Leu Thr Arg Phe Asp His Val Val Gly Asn Val Pro Glu Leu Ala Pro Ala Ala Ala Tyr Ile Ala Gly Phe Thr Gly Phe His Glu Phe Ala Glu Phe Thr Ala Glu Asp Val Gly Thr Thr Glu Ser Gly Leu Asn Ser Val Val Leu Ala l, 245 250 255 Asn Asn Ser Glu Gly Val Leu Leu Pro Leu Asn Glu Pro Val His Gly Thr Lys Arg Arg Ser Gln Ile Gln Thr Phe Leu Glu His His Gly Gly Pro Gly Val Gln His Ile Ala Val Ala Ser Ser Asp Val Leu Arg Thr 29p 295 300 Leu Arg Lys Met Arg Ala Arg Ser Ala Met Gly Gly Phe Asp Phe Leu Pro Pro Pro Leu Pro Lys Tyr Tyr Glu Gly Val Arg Arg Leu Ala Gly f,- Asp Val Leu Ser Glu Ala Gln Ile Lys Glu Cys Gln Glu Leu Gly Val Leu Val Asp Arg Asp Asp Gln Gly Val Leu Leu Gln Ile Phe Thr Lys Pro Val Gly Asp Arg Pro Thr Leu Phe Leu Glu Met Ile Gln Arg Ile Gly Cys Met Glu Lys Asp Glu Arg Gly Glu Glu Tyr Gln Lys Gly Gly 385 390 395 ~ 400 Cys Gly Gly Phe Gly Lys Gly Asn Phe Ser Glu Leu Phe Lys Ser Ile Glu Asp Tyr Glu Lys Ser Leu Glu Ala Lys Gln Ser Ala Ala Val Gln Gly Ser
Claims (24)
1. The DNA sequence SEQ ID NO:1 and DNA sequences hybridizing therewith, encoding an HPPD.
2. An expression cassette comprising a promoter and a DNA
sequence as claimed in claim 1.
sequence as claimed in claim 1.
3. An expression cassette as claimed in claim 2, comprising the CaMV 35S promoter.
4. An expression cassette as claimed in claim 2, comprising the seed-specific phaseolin promoter.
5. An expression cassette as claimed in claim 2, the DNA
sequence as claimed in claim 1 being functionally linked to another protein in such a way that a joint translation product is formed.
sequence as claimed in claim 1 being functionally linked to another protein in such a way that a joint translation product is formed.
6. The use of the expression cassette as claimed in claim 2 for transforming plants.
7. A method of transforming a plant, which comprises introducing an expression cassette as claimed in claim 2 into a plant cell, into callus tissue, into an entire plant or into plant cell protoplasts.
8. A method of transforming plants, which comprises 1) transferring the expression cassette as claimed in claim 2 into an agrobacterial strain, 2) isolating the recombinant clones formed, and 3) using the latter for transforming plants.
9. A method as claimed in claim 8, the transformation being accomplished with the aid of the strain Agrobacterium tumefaciens.
10. A method of transforming plants as claimed in claim 7, wherein the transformation is accomplished with the aid of electroporation.
11. A method of transforming plants as claimed in claim 7, wherein the transformation is accomplished with the aid of the particle bombardment method.
12. A plant with an elevated vitamin E content, comprising an expression cassette as claimed in any one of claims 2 to 5.
13. A plant as claimed in claim 12, selected from the group consisting of soya, barley, oats, wheat, oilseed rape, maize or sunflowers.
14. A method of generating plants with an elevated vitamin E
content, which comprises expressing, in plants, a DNA
sequence as claimed in claim 1.
content, which comprises expressing, in plants, a DNA
sequence as claimed in claim 1.
15. A method as claimed in claim 14, wherein the DNA sequence is expressed in a tobacco plant.
16. A method as claimed in any of claims 14 and 15, wherein expression takes place in the leaves or the seeds of the plant.
17. The use of an expression cassette as claimed in any of claims 2 to 5 for generating plants with an elevated vitamin E
content by means of expressing, in plants, a DNA sequence as claimed in claim 1.
content by means of expressing, in plants, a DNA sequence as claimed in claim 1.
18. The use of the expression cassette as claimed in claim 2 for generating a test system for identifying HPPD inhibitors.
19. A test system based on the expression of an expression cassette as claimed in claim 2 for identifying HPPD
inhibitors.
inhibitors.
20. A herbicidally active substance which can be identified by means of a test system as claimed in claim 19.
21. The use of a plant as claimed in claim 12 for generating plant HPPD.
22. The use of the expression cassette as claimed in claim 2 for generating plants with elevated resistance to HPPD inhibitors by means of higher expression of a DNA sequence as claimed in claim 1.
23. A method of generating plants with elevated resistance to HPPD inhibitors by means of higher expression of a DNA
sequence as claimed in claim 1.
sequence as claimed in claim 1.
24. A plant with elevated resistance to HPPD inhibitors, comprising an expression cassette as claimed in any of claims 2 to 5.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
DE19730066.9 | 1997-07-14 | ||
DE19730066A DE19730066A1 (en) | 1997-07-14 | 1997-07-14 | DNA sequence coding for a hydroxyphenylpyruvate dioxygenase and its overproduction in plants |
PCT/EP1998/003832 WO1999004021A1 (en) | 1997-07-14 | 1998-06-23 | Dna sequence coding for a hydroxyphenylpyruvate dioxygenase and overproduction thereof in plants |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2296840A1 true CA2296840A1 (en) | 1999-01-28 |
Family
ID=7835618
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002296840A Abandoned CA2296840A1 (en) | 1997-07-14 | 1998-06-23 | Dna sequence coding for a hydroxyphenylpyruvate dioxygenase and overproduction thereof in plants |
Country Status (9)
Country | Link |
---|---|
EP (1) | EP1009841A1 (en) |
CN (1) | CN1270636A (en) |
AR (1) | AR014893A1 (en) |
AU (1) | AU8216998A (en) |
BR (1) | BR9811006A (en) |
CA (1) | CA2296840A1 (en) |
DE (1) | DE19730066A1 (en) |
WO (1) | WO1999004021A1 (en) |
ZA (1) | ZA986188B (en) |
Families Citing this family (29)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
FR2778527A1 (en) * | 1998-05-18 | 1999-11-19 | Rhone Poulenc Agrochimie | Producing tomato, cereal or oilseed plants, especially maize, oilseed rape, soya or sunflower plants, from which tocopherols can be extracted and purified |
DE19903493A1 (en) * | 1999-01-29 | 2000-08-03 | Basf Ag | Overexpression of a DNA sequence coding for a transketolase in plants |
PT1190068E (en) | 1999-04-15 | 2006-06-30 | Calgene Llc | SEQUENCES OF NUCLEIC ACIDS FOR PROTEINS INVOLVED IN TOCOFEROL SYNTHESIS |
FR2796954B1 (en) * | 1999-07-30 | 2003-10-31 | Aventis Cropscience Sa | HYDROXY-PHENYL PYRUVATE DIOXYGENASE FUSED TO A SIGNAL PEPTIDE, DNA SEQUENCE AND THE PRODUCTION OF PLANTS CONTAINING SUCH A GENE, HERBICIDE TOLERANT |
DE19937957A1 (en) * | 1999-08-11 | 2001-02-15 | Sungene Gmbh & Co Kgaa | Homogenate dioxygenase |
CN1301841A (en) * | 1999-12-27 | 2001-07-04 | 上海博德基因开发有限公司 | New polypeptide-human dioxygenase 13 and polynucleotide codign such polypeptide |
US6872815B1 (en) | 2000-10-14 | 2005-03-29 | Calgene Llc | Nucleic acid sequences to proteins involved in tocopherol synthesis |
AU2001290522B2 (en) | 2000-08-07 | 2006-11-30 | Monsanto Technology Llc | Methyl-D-erythritol phosphate pathway genes |
DE10046462A1 (en) * | 2000-09-19 | 2002-05-29 | Sungene Gmbh & Co Kgaa | Improved procedures for vitamin E biosynthesis |
CA2427787C (en) * | 2000-12-07 | 2012-07-17 | Syngenta Limited | Herbicide resistant plants |
US7161061B2 (en) | 2001-05-09 | 2007-01-09 | Monsanto Technology Llc | Metabolite transporters |
BR0209483A (en) | 2001-05-09 | 2004-07-06 | Monsanto Technology Llc | Tyra genes and their uses |
EP1427832A4 (en) | 2001-08-17 | 2006-09-06 | Monsanto Technology Llc | Methyltransferase genes and uses thereof |
WO2003034812A2 (en) | 2001-10-25 | 2003-05-01 | Monsanto Technology Llc | Aromatic methyltransferases and uses thereof |
US7112717B2 (en) | 2002-03-19 | 2006-09-26 | Monsanto Technology Llc | Homogentisate prenyl transferase gene (HPT2) from arabidopsis and uses thereof |
BR0313270A (en) | 2002-08-05 | 2005-08-02 | Monsanto Technology Llc | Genes related to tocopherol biosynthesis and uses |
FR2844142B1 (en) * | 2002-09-11 | 2007-08-17 | Bayer Cropscience Sa | TRANSFORMED PLANTS WITH ENHANCED PRENYLQUINON BIOSYNTHESIS |
CN1317388C (en) * | 2003-11-28 | 2007-05-23 | 中国科学院微生物研究所 | 2-amino phenol 1,6-dioxygenase, its gene and use thereof |
CN104056261B (en) * | 2008-04-17 | 2017-01-11 | 海莱乌医院 | Indoleamine 2, 3-dioxygenase based immunotherapy |
ES2619279T3 (en) | 2009-01-22 | 2017-06-26 | Syngenta Participations Ag. | Hydroxyphenylpyruvate Dioxygenase mutant polypeptides and methods of use |
WO2011068567A1 (en) | 2009-07-10 | 2011-06-09 | Syngenta Participations Ag | Novel hydroxyphenylpyruvate dioxygenase polypeptides and methods of use |
US9175305B2 (en) | 2009-01-22 | 2015-11-03 | Syngenta Participations Ag | Mutant hydroxyphenylpyruvate dioxygenase polypeptides and methods of use |
EP2992090A4 (en) * | 2013-04-30 | 2017-01-11 | Basf Se | Plants having increased tolerance to herbicides |
CA2910604A1 (en) * | 2013-04-30 | 2014-11-06 | Basf Se | Plants having increased tolerance to n-heterocyclyl-arylcarboxamide herbicides |
CN105567706A (en) * | 2015-12-28 | 2016-05-11 | 北京未名凯拓作物设计中心有限公司 | HPPD inhibitor-resistant gene derived from pseudomonas putida and application thereof |
CN105567707A (en) * | 2015-12-28 | 2016-05-11 | 北京未名凯拓作物设计中心有限公司 | HPPD inhibitor-resistant gene and application thereof |
CN105543245A (en) * | 2015-12-28 | 2016-05-04 | 北京未名凯拓作物设计中心有限公司 | HPPD (hydroxyphenylpyruvate dioxygenase) inhibitor-resistant gene derived from pseudomonas aeruginosa, as well as application thereof |
CN105567705A (en) * | 2015-12-28 | 2016-05-11 | 北京未名凯拓作物设计中心有限公司 | HPPD inhibitor-resistant gene derived from ochrobactrum anthropi and application thereof |
CN116064430B (en) * | 2021-09-14 | 2023-08-11 | 山东舜丰生物科技有限公司 | Mutant HPPD polypeptides and uses thereof |
Family Cites Families (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
FR2734842B1 (en) * | 1995-06-02 | 1998-02-27 | Rhone Poulenc Agrochimie | DNA SEQUENCE OF A HYDROXY-PHENYL PYRUVATE DIOXYGENASE GENE AND OBTAINING PLANTS CONTAINING A HYDROXY-PHENYL PYRUVATE DIOXYGENASE GENE, TOLERANT TO CERTAIN HERBICIDES |
US6087563A (en) * | 1996-01-29 | 2000-07-11 | Arizona Board Of Regents On Behalf Of The University Of Arizona | Cloned arabidopsis p-hydroxyphenyl pyruvic acid dioxygenase DNA |
HUP9904093A2 (en) * | 1996-06-27 | 2000-04-28 | E.I.Dupont De Nemours And Co. | Plant gene for p-hydroxyphenylpyruvate dioxygenase |
-
1997
- 1997-07-14 DE DE19730066A patent/DE19730066A1/en not_active Withdrawn
-
1998
- 1998-06-23 BR BR9811006-3A patent/BR9811006A/en not_active IP Right Cessation
- 1998-06-23 WO PCT/EP1998/003832 patent/WO1999004021A1/en not_active Application Discontinuation
- 1998-06-23 CA CA002296840A patent/CA2296840A1/en not_active Abandoned
- 1998-06-23 CN CN98809105A patent/CN1270636A/en active Pending
- 1998-06-23 AU AU82169/98A patent/AU8216998A/en not_active Abandoned
- 1998-06-23 EP EP98932179A patent/EP1009841A1/en not_active Withdrawn
- 1998-07-13 ZA ZA9806188A patent/ZA986188B/en unknown
- 1998-07-14 AR ARP980103428A patent/AR014893A1/en not_active Application Discontinuation
Also Published As
Publication number | Publication date |
---|---|
BR9811006A (en) | 2000-08-22 |
WO1999004021A1 (en) | 1999-01-28 |
ZA986188B (en) | 2000-01-13 |
CN1270636A (en) | 2000-10-18 |
DE19730066A1 (en) | 1999-01-21 |
AU8216998A (en) | 1999-02-10 |
AR014893A1 (en) | 2001-04-11 |
EP1009841A1 (en) | 2000-06-21 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CA2296840A1 (en) | Dna sequence coding for a hydroxyphenylpyruvate dioxygenase and overproduction thereof in plants | |
JP4683923B2 (en) | Transformed plant with high prenylquinone biosynthesis ability | |
US6118047A (en) | Anthranilate synthase gene and method of use thereof for conferring tryptophan overproduction | |
US7109392B1 (en) | Methods for increasing oleic acid content in seeds from transgenic plants containing a mutant delta 12 desaturase | |
US20090205079A1 (en) | ACETYL CoA CARBOXYLASE (ACCase) GENE FROM JATROPHA CURAS | |
EP0820513A2 (en) | TRANSGENIC PLANTS EXPRESSING ACETYL CoA CARBOXYLASE GENE | |
WO1997026366A9 (en) | Anthranilate synthase gene and use thereof | |
AU757440B2 (en) | DNA sequence coding for a 1-deoxy-d-xylulose-5-phosphate synthase and the overproduction thereof in plants | |
Wagner et al. | Transformation of tobacco with a mutated cyanobacterial phytoene desaturase gene confers resistance to bleaching herbicides | |
US6624342B1 (en) | Manipulation of tocopherol content in transgenic plants | |
CA2372332A1 (en) | Overexpression of a dna sequence coding for a 1-desoxy-d-xylulose-5-phosphate reductoisomerase in plants | |
JP2001526041A (en) | Methods for creating transgenic plants with modified 5-aminolevulinic acid biosynthesis and methods for identifying 5-aminolevulinic acid synthesis effectors | |
US7273966B2 (en) | Elevation of fatty acid synthase levels in plants | |
AU2004223634B2 (en) | Enhanced accumulation of carotenoids in plants | |
US20060021085A1 (en) | Method for producing transgenic plants having an elevated vitamin E content by modifying the serine-acetyltransferase content | |
AU784958B2 (en) | Triacylglycerol lipases | |
CA2325054A1 (en) | Amp deaminase | |
WO2002000890A1 (en) | Nucleic acids coding for a plant phosphatase of the mipp type with phytase activity and uses | |
CZ20001069A3 (en) | Nucleic acid sequence, alleles and derivatives, nucleic acid molecule, protein, microorganism, transgenic plants, dicotyledonous plants, monocotyledonous plants, transgenic plant cells, method of creating plants, use of plants and use of the nucleic acid sequence | |
Napier et al. | Method For The Production Of Gamma-linolenic Acid And/or Stearidonic Acid In Transgenic Brassicaceae And Linaceae (Patent US 2008/0229454 A1) |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Dead |