CA2271451A1 - Variant c-terminal fragment of plasmodium falciparum msp-1 - Google Patents
Variant c-terminal fragment of plasmodium falciparum msp-1 Download PDFInfo
- Publication number
- CA2271451A1 CA2271451A1 CA002271451A CA2271451A CA2271451A1 CA 2271451 A1 CA2271451 A1 CA 2271451A1 CA 002271451 A CA002271451 A CA 002271451A CA 2271451 A CA2271451 A CA 2271451A CA 2271451 A1 CA2271451 A1 CA 2271451A1
- Authority
- CA
- Canada
- Prior art keywords
- resid
- name
- assign
- msp
- sing
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
Abstract
A non-naturally occurring variant of a C-terminal fragment of a Plasmodium merozoite surface protein-1 (MSP-1) wherein said variant has (i) a reduced affinity, compared with a naturally occurring Plasmodium MSP-1 19, for at least one first antibody capable of blocking the binding of a second antibody, which second antibody inhibits the proteolytic cleavage of Plasmodium MSP-1 42 and (ii) substantially the same affinity for at least one third antibody compared with said naturally occurring Plasmodium MSP-1 19.
which third antibody inhibits the proteolytic cleavage of Plasmodium MSP-1 42 is provided for use in an anti-malarial vaccine.
which third antibody inhibits the proteolytic cleavage of Plasmodium MSP-1 42 is provided for use in an anti-malarial vaccine.
Description
VACCINE
Field of the Invention The present invention relates to modified Plasmodium MSP-1 protein variants and their use in producing a vaccine against malaria. It also relates to a method for the rational design of suitable variants.
Background to the Invention Malaria is a devastating disease that causes widespread morbidity and mortality in areas where it is transmitted by anopheline mosquitoes. In areas of high transmission young children and non-immune visitors are most at risk from this disease, which is caused by protozoa of the genus Plasmodium. In areas of lower or unstable transmission, epidemics of the disease can result and afflict individuals of all ages. The most dangerous form of malaria, responsible for much of the morbidity and most of the mortality, is caused by the species Plasmodium falciparum. It has been estimated that 2 billion people are at risk from malaria, with 200-300 million clinical cases and 1-2 million deaths each year.
2o The parasite has a complex life cycle in its human and mosquito hosts. In humans the stage of the life cycle which is responsible for the clinical symptoms of the disease occurs in the bloodstream. During this phase the parasite is largely hidden within host red blood cells. Here the parasite grows and multiplies. For example, within a red blood cell each P. falciparum parasite divides several times to produce approximately 20 new ones during a 48 hour cycle. At this point the red blood cell is burst open and the parasites (called merozoites at this stage) are released into the bloodstream. The merozoites must enter new red blood cells in order to survive and for the cycle of replication in the blood to continue.
If the parasites do not manage to enter red blood cells they cannot survive for very long and are rapidly destroyed. Symptoms of malaria such as fever are associated with this 3o cyclic merozoite release and re-invasion of red blood cells.
Field of the Invention The present invention relates to modified Plasmodium MSP-1 protein variants and their use in producing a vaccine against malaria. It also relates to a method for the rational design of suitable variants.
Background to the Invention Malaria is a devastating disease that causes widespread morbidity and mortality in areas where it is transmitted by anopheline mosquitoes. In areas of high transmission young children and non-immune visitors are most at risk from this disease, which is caused by protozoa of the genus Plasmodium. In areas of lower or unstable transmission, epidemics of the disease can result and afflict individuals of all ages. The most dangerous form of malaria, responsible for much of the morbidity and most of the mortality, is caused by the species Plasmodium falciparum. It has been estimated that 2 billion people are at risk from malaria, with 200-300 million clinical cases and 1-2 million deaths each year.
2o The parasite has a complex life cycle in its human and mosquito hosts. In humans the stage of the life cycle which is responsible for the clinical symptoms of the disease occurs in the bloodstream. During this phase the parasite is largely hidden within host red blood cells. Here the parasite grows and multiplies. For example, within a red blood cell each P. falciparum parasite divides several times to produce approximately 20 new ones during a 48 hour cycle. At this point the red blood cell is burst open and the parasites (called merozoites at this stage) are released into the bloodstream. The merozoites must enter new red blood cells in order to survive and for the cycle of replication in the blood to continue.
If the parasites do not manage to enter red blood cells they cannot survive for very long and are rapidly destroyed. Symptoms of malaria such as fever are associated with this 3o cyclic merozoite release and re-invasion of red blood cells.
-2-There is an urgent need for a vaccine against malaria. There is no effective vaccine currently available. In addition, mosquito control by the spraying of residual insecticides is either becoming ineffective or considered to be unacceptable, and there is a very worrying spread of drug resistance within parasites. The rapid spread of drug resistance is worrying because compounds such as the cheap and once-effective chloroquine are no longer useful in many parts of the world, and there are few if any new drugs available that are both cheap and effective. Vaccines against microorganisms can be very cost effective and efficient ways to protect populations against infectious diseases.
to Because of the complexity of the parasite's life cycle there are a number of points in its development within humans that could be the target of a protective immune response. It is known that with increasing age and exposure individuals do become immune to malaria, suggesting that protective responses do develop with time. Broadly speaking there are three types of vaccine strategy: to target the pre-erythrocytic stages, the asexual blood stage and the sexual stage. The pre-erythrocytic stages are the sporozoites that are injected by an infected mosquito when it takes a blood meal and the initial development of the parasite in the liver. The asexual blood stage is the infection and release of merozoites from red blood cells that occurs in a cyclic manner, and the stage responsible for the manifestation of the clinical symptoms. The sexual stage takes place in the mosquito's 2o gut after it has ingested gametocytes in a blood meal and this initiates the infection of the insect to complete the cycle; a vaccine against the sexual stages would not protect the individual but could reduce transmission and therefore the incidence of malaria in a given human population.
During the asexual cycle in the blood the parasite is directly exposed to the host's immune system, and in particular to antibodies circulating within the bloodstream, only transiently:
when merozoites are released by rupture of one cell and before they penetrate another. If there are specific antibodies that can bind to the surface of the parasite then it is possible that these antibodies will interfere with the ability of the parasite to invade a new red 3o blood cell. In fact it has been shown that several monoclonal antibodies that recognise single epitopes on parasite surface proteins, are capable of neutralising the parasite and preventing the cycle of reproduction within red blood cells.
One of the best characterised proteins on the surface of the merozoite is called merozoite surface protein 1 (MSP-1). MSP-1 is a large protein that varies in size and amino acid sequence in different parasite lines. It is synthesised as a precursor molecule of 200 kDa by the intracellular parasite and located on the parasite's surface. During release of merozoites from red blood cells and the re-invasion of new erythrocytes the protein undergoes at least two proteolytic modifications. In the first modification as a result of a process called primary processing, the precursor is cleaved to four fragments of ~83, 30, 38 and 42 kDa that remain together as a complex on the merozoite surface. This complex 1o also contains two other proteins of 22 kDa and 36 kDa derived from different genes. The complex is maintained by non-covalent interactions between the different subunits and is held on the merozoite surface by a glycosyl phosphatidyl inositol anchor, attached to the C-terminus of the 42 kDa fragment and inserted into the plasma membrane of the merozoite. At the time of merozoite invasion of an erythrocyte the C-terminal 42 kDa fragment is cleaved by a second proteolytic cleavage in a process called secondary processing. The result of secondary processing is that the entire complex is shed from the surface of the merozoite except for a C-terminal sub-fragment that consists of just under one hundred amino acids and which is carried into the newly invaded erythrocyte on the surface of the merozoite.
Based on sequence similarities, the structure of this small C-terminal fragment (called MSP-1,~) was suggested to consist of two epidermal growth factor (EGF)-like domains (see sequence in Figure 1) (Blackman et al., 1991). An EGF-like motif consists of a 45-50 amino acid sequence with a characteristic disulphide bonding pattern and such domains occur frequently in extracellular modular proteins of animals. In the MSP-1 C-terminal fragment each of the motifs contains six Cys residues proposed to form three disulphide bonds and each motif has a partial match to the EGF consensus (see Figure 1 ).
However, because the degree of similarity is limited and since the pattern of its disulphide bonding is not known, the designation of the MSP-1 C-terminal fragment as comprised of EGF-3o like structures has been regarded as tentative. Other relatively divergent potential EGF-like sequences occur in Plasmodium, but previous structure determinations have been confined to those from metazoan organisms (Campbell et al., 1998).
A number of studies have implicated MSP-1 as the target of a protective immune response. Although the goal of this work is to develop a malaria vaccine for use in humans, out of necessity most of this experimental work has been done either in model animal systems or in vitro. These include studies of the effect of specific antibodies on parasite invasion of erythrocytes in vitro, passive immunisation studies in rodent malaria models in laboratory mice and direct immunisation in both rodent and primate malaria models using either native protein (derived from the parasite) or recombinant protein expressed from parts of the MSP-1 gene in heterologous organisms. Sero-epidemiological 1o studies have also showed a correlation between human antibody responses to parts of the MSP-1 molecule and protection against clinical disease. Much, but not all, of the work has focused on the immune response to the C-terminal MSP-1,~. For example some monoclonal antibodies that recognise MSP-l,~ prevent red blood cell invasion in in vitro cultures (Blackman et al., 1990). Interestingly, these antibodies that inhibit invasion also inhibit the secondary processing of the 42 kDa fragment, suggesting the mechanism by which they work is by steric hinderance of the protease responsible for secondary processing (Blackman et al., 1994). Since secondary processing goes to completion during successful invasion, if it cannot occur then invasion is interrupted.
2o All of the work described above would suggest that MSP-1 and in particular polypeptides based on the C-terminal sequence that forms the 42 kDa or the MSP-l,~ region, should be very good candidates for malaria vaccine development. However, several studies have shown that the epitopes or binding sites for antibodies on MSP-1,~ require a correct polypeptide tertiary structure, and that this is destroyed by treatments that reduce the disulphide bonds that are postulated to be present between the cysteine residues present in MSP-1,9. This limitation appears to have been overcome by the expression of recombinant protein in ways that allow antibodies that recognise the native parasite MSP-1 to bind. Other investigators have suggested that other parts of MSP-1 also have potential for inclusion in a vaccine, however the MSP-1 C-terminal fragment is currently 3o the lead candidate for development of a vaccine against the blood stages of the malaria parasite (Diggs et al., 1993; Stoute et al.,1998).
As stated above, every ~48 hours P. falcipara~m merozoites are released from the infected erythrocyte to re-invade new red blood cells and during this time they are exposed to the host's immune system. Therefore, the question arises as to how the has parasite evolved to avoid the potentially lethal effects of, for example, neutralising antibodies.
In other infectious micro-organisms it is clear that there is a constant battle between the immune system and the micro-organism, and that sophisticated mechanisms have been evolved by micro-organisms to evade the immune response. For example antigenic variation and antigenic diversity are two mechanisms that involve presenting the immune system with "a moving target" such that even though an immune response to one variant of the micro-organism may kill that variant, new variants are produced that are at least partially or fully resistant to the immune response. In the case of malaria merozoites and in particular MSP-1 an alternative mechanism has been proposed whereby the binding of some antibodies ("blocking antibodies") can prevent the binding of neutralising antibodies and thereby allow the parasite to successfully invade a red blood cell even in the presence of I S neutralising antibodies (Guevara Patino et al., 1997). These blocking antibodies may be of two types, those against epitopes that are formed from amino acids that are distant in the linear primary sequence from the epitopes that are the target of neutralising antibodies, and those that are against epitopes that overlap with the epitopes of the neutralising antibodies. This represents a novel mechanism by which a parasite can evade an effective 2o immune response, and unlike mechanisms based on antigenic polymorphism or diversity, it is not dependent upon amino acid sequence diversity.
Some monoclonal antibodies (mAbs) that bind to MSP-l,~ inhibit the proteolytic cleavage and erythrocyte invasion, suggesting that cleavage is a prerequisite for invasion 25 (Blackman et al., 1994). Other mAbs that bind to the MSP-1 C-terminal fragment do not inhibit processing or invasion but block the binding of the inhibitory neutralizing antibodies. Other antibodies that bind to MSP-1,9 neither inhibit nor block the binding of inhibitory antibodies. In the presence of blocking antibodies, inhibitory antibodies are ineffective and invasion proceeds. The balance between inhibitory and blocking 3o antibodies induced by immunisation may be a critical factor in determining whether or not the immune response is effective in preventing invasion (Guevara Patino et al., 1997).
Summary of the Invention An object of the present invention is therefore to provide an effective vaccine against the malaria parasite based on variants of the Plasmodium MSP-1 protein. In designing such a vaccine, the following criteria should be met:
1. The amino acid sequence of the polypeptide to be used in the vaccine should contain epitopes that are the targets of, and can induce, neutralising antibodies.
t o 2. The polypeptide should ideally not include amino acid sequences that only form epitopes for blocking antibodies.
to Because of the complexity of the parasite's life cycle there are a number of points in its development within humans that could be the target of a protective immune response. It is known that with increasing age and exposure individuals do become immune to malaria, suggesting that protective responses do develop with time. Broadly speaking there are three types of vaccine strategy: to target the pre-erythrocytic stages, the asexual blood stage and the sexual stage. The pre-erythrocytic stages are the sporozoites that are injected by an infected mosquito when it takes a blood meal and the initial development of the parasite in the liver. The asexual blood stage is the infection and release of merozoites from red blood cells that occurs in a cyclic manner, and the stage responsible for the manifestation of the clinical symptoms. The sexual stage takes place in the mosquito's 2o gut after it has ingested gametocytes in a blood meal and this initiates the infection of the insect to complete the cycle; a vaccine against the sexual stages would not protect the individual but could reduce transmission and therefore the incidence of malaria in a given human population.
During the asexual cycle in the blood the parasite is directly exposed to the host's immune system, and in particular to antibodies circulating within the bloodstream, only transiently:
when merozoites are released by rupture of one cell and before they penetrate another. If there are specific antibodies that can bind to the surface of the parasite then it is possible that these antibodies will interfere with the ability of the parasite to invade a new red 3o blood cell. In fact it has been shown that several monoclonal antibodies that recognise single epitopes on parasite surface proteins, are capable of neutralising the parasite and preventing the cycle of reproduction within red blood cells.
One of the best characterised proteins on the surface of the merozoite is called merozoite surface protein 1 (MSP-1). MSP-1 is a large protein that varies in size and amino acid sequence in different parasite lines. It is synthesised as a precursor molecule of 200 kDa by the intracellular parasite and located on the parasite's surface. During release of merozoites from red blood cells and the re-invasion of new erythrocytes the protein undergoes at least two proteolytic modifications. In the first modification as a result of a process called primary processing, the precursor is cleaved to four fragments of ~83, 30, 38 and 42 kDa that remain together as a complex on the merozoite surface. This complex 1o also contains two other proteins of 22 kDa and 36 kDa derived from different genes. The complex is maintained by non-covalent interactions between the different subunits and is held on the merozoite surface by a glycosyl phosphatidyl inositol anchor, attached to the C-terminus of the 42 kDa fragment and inserted into the plasma membrane of the merozoite. At the time of merozoite invasion of an erythrocyte the C-terminal 42 kDa fragment is cleaved by a second proteolytic cleavage in a process called secondary processing. The result of secondary processing is that the entire complex is shed from the surface of the merozoite except for a C-terminal sub-fragment that consists of just under one hundred amino acids and which is carried into the newly invaded erythrocyte on the surface of the merozoite.
Based on sequence similarities, the structure of this small C-terminal fragment (called MSP-1,~) was suggested to consist of two epidermal growth factor (EGF)-like domains (see sequence in Figure 1) (Blackman et al., 1991). An EGF-like motif consists of a 45-50 amino acid sequence with a characteristic disulphide bonding pattern and such domains occur frequently in extracellular modular proteins of animals. In the MSP-1 C-terminal fragment each of the motifs contains six Cys residues proposed to form three disulphide bonds and each motif has a partial match to the EGF consensus (see Figure 1 ).
However, because the degree of similarity is limited and since the pattern of its disulphide bonding is not known, the designation of the MSP-1 C-terminal fragment as comprised of EGF-3o like structures has been regarded as tentative. Other relatively divergent potential EGF-like sequences occur in Plasmodium, but previous structure determinations have been confined to those from metazoan organisms (Campbell et al., 1998).
A number of studies have implicated MSP-1 as the target of a protective immune response. Although the goal of this work is to develop a malaria vaccine for use in humans, out of necessity most of this experimental work has been done either in model animal systems or in vitro. These include studies of the effect of specific antibodies on parasite invasion of erythrocytes in vitro, passive immunisation studies in rodent malaria models in laboratory mice and direct immunisation in both rodent and primate malaria models using either native protein (derived from the parasite) or recombinant protein expressed from parts of the MSP-1 gene in heterologous organisms. Sero-epidemiological 1o studies have also showed a correlation between human antibody responses to parts of the MSP-1 molecule and protection against clinical disease. Much, but not all, of the work has focused on the immune response to the C-terminal MSP-1,~. For example some monoclonal antibodies that recognise MSP-l,~ prevent red blood cell invasion in in vitro cultures (Blackman et al., 1990). Interestingly, these antibodies that inhibit invasion also inhibit the secondary processing of the 42 kDa fragment, suggesting the mechanism by which they work is by steric hinderance of the protease responsible for secondary processing (Blackman et al., 1994). Since secondary processing goes to completion during successful invasion, if it cannot occur then invasion is interrupted.
2o All of the work described above would suggest that MSP-1 and in particular polypeptides based on the C-terminal sequence that forms the 42 kDa or the MSP-l,~ region, should be very good candidates for malaria vaccine development. However, several studies have shown that the epitopes or binding sites for antibodies on MSP-1,~ require a correct polypeptide tertiary structure, and that this is destroyed by treatments that reduce the disulphide bonds that are postulated to be present between the cysteine residues present in MSP-1,9. This limitation appears to have been overcome by the expression of recombinant protein in ways that allow antibodies that recognise the native parasite MSP-1 to bind. Other investigators have suggested that other parts of MSP-1 also have potential for inclusion in a vaccine, however the MSP-1 C-terminal fragment is currently 3o the lead candidate for development of a vaccine against the blood stages of the malaria parasite (Diggs et al., 1993; Stoute et al.,1998).
As stated above, every ~48 hours P. falcipara~m merozoites are released from the infected erythrocyte to re-invade new red blood cells and during this time they are exposed to the host's immune system. Therefore, the question arises as to how the has parasite evolved to avoid the potentially lethal effects of, for example, neutralising antibodies.
In other infectious micro-organisms it is clear that there is a constant battle between the immune system and the micro-organism, and that sophisticated mechanisms have been evolved by micro-organisms to evade the immune response. For example antigenic variation and antigenic diversity are two mechanisms that involve presenting the immune system with "a moving target" such that even though an immune response to one variant of the micro-organism may kill that variant, new variants are produced that are at least partially or fully resistant to the immune response. In the case of malaria merozoites and in particular MSP-1 an alternative mechanism has been proposed whereby the binding of some antibodies ("blocking antibodies") can prevent the binding of neutralising antibodies and thereby allow the parasite to successfully invade a red blood cell even in the presence of I S neutralising antibodies (Guevara Patino et al., 1997). These blocking antibodies may be of two types, those against epitopes that are formed from amino acids that are distant in the linear primary sequence from the epitopes that are the target of neutralising antibodies, and those that are against epitopes that overlap with the epitopes of the neutralising antibodies. This represents a novel mechanism by which a parasite can evade an effective 2o immune response, and unlike mechanisms based on antigenic polymorphism or diversity, it is not dependent upon amino acid sequence diversity.
Some monoclonal antibodies (mAbs) that bind to MSP-l,~ inhibit the proteolytic cleavage and erythrocyte invasion, suggesting that cleavage is a prerequisite for invasion 25 (Blackman et al., 1994). Other mAbs that bind to the MSP-1 C-terminal fragment do not inhibit processing or invasion but block the binding of the inhibitory neutralizing antibodies. Other antibodies that bind to MSP-1,9 neither inhibit nor block the binding of inhibitory antibodies. In the presence of blocking antibodies, inhibitory antibodies are ineffective and invasion proceeds. The balance between inhibitory and blocking 3o antibodies induced by immunisation may be a critical factor in determining whether or not the immune response is effective in preventing invasion (Guevara Patino et al., 1997).
Summary of the Invention An object of the present invention is therefore to provide an effective vaccine against the malaria parasite based on variants of the Plasmodium MSP-1 protein. In designing such a vaccine, the following criteria should be met:
1. The amino acid sequence of the polypeptide to be used in the vaccine should contain epitopes that are the targets of, and can induce, neutralising antibodies.
t o 2. The polypeptide should ideally not include amino acid sequences that only form epitopes for blocking antibodies.
3. If the polypeptide contains epitopes for both neutralising and blocking antibodies then it should be modified to remove the blocking antibody epitopes without affecting the neutralising epitopes.
To assist in the design of candidate vaccine polypeptides fulfilling these three criteria, it is important to determine the three-dimensional structure of the MSP-1 C-terminal fragment since this will help in mapping sites of antibody interactions with this fragment. We have therefore determined the solution structure of the MSP-1 C-terminal, including the pattern of disulphide bonding, using NMR techniques.
We have made amino acid substitutions in the sequence of MSP-l,~ that prevent the binding of individual blocking monoclonal antibodies, without affecting the binding of neutralising antibodies. By determining the 3-dimensional structure of MSP-1,9 we have identified where these antibody binding sites are located in the tertiary structure and this has allowed other amino acid substitutions to be made that have similar properties. We have shown that several substitutions, each affecting the binding of one or more blocking antibodies can be combined into a single molecule, and that these modified molecules 3o continue to bind the neutralising antibodies but fail to bind any of the blocking antibodies.
Such modified molecules are expected to be much more effective than the natural or wild-type protein structure at inducing a protective neutralising antibody response when used to immunise individuals as a malaria vaccine. In addition we have made other modifications in the primary structure of the molecule which do not affect the binding of the neutralising antibodies but which may contribute to increased immunogenicity of the molecule. The modified MSP-l,~ structures, either alone or coupled to other carriers, which may or may not contain other parts of MSP-1 to enhance the immunogenicity (for example a combination of the remainder of the MSP-l~z kDa fragment with the modified MSP-1,9) and provide additional T cell epitopes, would be more effective vaccines than equivalent structures that have not been modified in this way.
1 o Accordingly, the present invention provides a non-naturally occurring variant of a C-terminal fragment of a Plasmodium merozoite surface protein-1 (MSP-1) wherein said variant has (i) a reduced affinity, compared with a naturally occurring Plasmodium MSP-1,9, for at least one first antibody capable of blocking the binding of a second antibody, which second antibody inhibits the proteolytic cleavage of Plasmodium MSP-14z and (ii) substantially the same affinity for said second antibody compared with said naturally occurring Plasmodium MSP-1,9.
Preferably, the Plasmodium MSP-1,9 and MSP-14z are Plasmodium falciparum MSP-1,~
and MSP-14z.
The first antibody is preferably selected from mAbs 2.2, 7.5 and 111.4. The second antibody is preferably selected from mAbs 12.8, 12.10 and SB 1.
The present invention further provides a non-naturally occurring variant of a C-terminal fragment of a Plasmodium merozoite surface protein-1 (MSP-1) comprising an amino acid modification at any one of amino acid residues 15, 27, 31, 34 and 43 of the Plasmodium falciparum MSP-1,9 amino acid sequence shown as SEQ LD. No. 1 or their equivalent positions in other Plasmodium MSP-1,9 polypeptides.
3o Preferably said modifications are substitutions selected from AsnlS->Arg, G1u27->Tyr, Leu31 ~Arg, Tyr34~Ser, Tyr34~Gly and G1u43-~Leu and their equivalents in other Plasmodium MSP-1,9 polypeptides. More preferably said substitutions are combinations _8_ of substitutions elected from [G1u27-~Tyr, Leu31 ~Arg and G1u43-~Leu], [G1u27--~Tyr, Leu31-~Arg, Tyr34-~Ser and G1u43~Leu], [AsnlS~Arg, G1u27~Tyr, Leu3l~Arg and G1u43~Leu) and their equivalents in other Plasmodium MSP-1,~ polypeptides.
In a preferred embodiment, a variant MSP-1 polypeptide of the invention further comprises a mutation at Cysl2 and/or Cys28 of the Plasmodium falciparum MSP-1,~
amino acid sequence shown as SEQ LD. No. 1.
The present invention also provides a method for producing a Plasmodium MSP-1 variant 1o for use in preparing a vaccine composition which method comprises modifying one or more amino acid residues of a Plasmodium MSP-1 C-terminal fragment such that the resulting derivative has (i) a reduced affinity, compared with a naturally occurring Plasmodium MSP-1,9, for at least one first antibody capable of blocking the binding of a second antibody, which second antibody inhibits the proteolytic cleavage of Plasmodium MSP-142 and (ii) substantially the same affinity for said second antibody compared with said naturally occurring Plasmodium MSP-1,~. In particular the method of the invention preferably comprises as a preliminary step, selecting a candidate amino acid residue by reference to a three dimensional NMR model structure, preferably as set out in Table 2.
More specifically, the 3D model structure is used to select a surface exposed amino acid 2o residue. Advantageously, a fiuther step is included of computer modelling the three dimensional structure of the variant to exclude polypeptides that do not fold correctly.
The present invention also provides a non-naturally occurring Plasmodium MSP-1 variant obtained by the method of the invention.
In a further aspect, the present invention provides a polynucleotide encoding a variant of the invention operably linked to a regulatory sequence capable of directing the expression of said nucleotide in a host cell. Also provided is a nucleic acid vector comprising a polynucleotide of the invention, including viral vectors, and a host cell comprising a 3o nucleotide or vector of the invention.
In another aspect, the present invention provides a pharmaceutical composition comprising a variant of the invention, a polynucleotide of the invention or a vector of the invention together with a pharmaceutically acceptable carrier or diluent.
Preferably, the composition further comprises an immunogenic Plasmodium polypeptide or fragment or derivative thereof such as MSP-133 or a fragment or derivative thereof. It is preferred not to use wild-type MPS-l,9 sequences.
The present invention also provides a method for producing anti-MSP-1 antibodies which to method comprises administering a polypeptide variant of the invention, or a polynucleotide of the invention or a vector of the invention to a mammal, typically a non-human mammal.
In a preferred embodiment, the present invention provides a method for producing polyclonal anti-MSP-1 antibodies which method comprises adminstering a polypeptide variant of the invention, or a polynucleotide of the invention or a vector of the invention to a mammal, typically a non-human mammal, and extracting the serum from said mammal. Also provided is an antibody produced by the said methods.
2o The polypeptides, nucleotides and vectors of the present invention may be used in methods of treating and/or preventing malaria caused by Plasmodium species, in particular Plasmodium falciparum. Accordingly, the present invention provides a method of inducing immunity against malaria induced by Plasmodium falciparum which comprises administering to a person in need of such immunity an effective amount of a variant, a polynucleotide or a vector of the invention.
Also provided is a method of immunizing a mammal, said method comprising administering an effective amount of a variant, a polynucleotide or a vector of the invention. In particular, said mammal is immunized against malaria. Preferably the 3o mammal is a human.
The present invention also provides a method of treating a malaria infection in a human patient which comprises administering to the patient an effective amount of the pharmaceutical composition of the invention.
Detailed descrit~tion of the invention Although in general the techniques mentioned herein are well known in the art, reference may be made in particular to Sambrook et al., Molecular Cloning, A Laboratory Manual (1989) and Ausubel et al., Current Protocols in Molecular Biology (1995), John Wiley &
to Sons, Inc.
A. MSP-1 variant polypeptides The variant MSP-1 polypeptides of the present invention will be described with reference to Plasmodium falciparum MSP-1 amino acid sequences. However, it should be appreciated that except where otherwise stated, all references to MSP-1 polypeptides include homologues of MSP-1 found in other Plasmodium species, such as P.
vivax, P. malariae and P. ovale which all infect humans and P. yoelli which infects mice.
The variant MSP-1 polypeptides of the present invention are based on C-terminal fragments of the Plasmodium.falciparum MSP-I4z polypeptide shown as SEQ LD.
No. 2.
Such polypeptides will comprise some or all of the MSP-1,9 region (SEQ LD. No.
1), preferably at least substantially all of the domain 1 and/or domain 2 EGF-like sequences found in MSP-1,9 (approximately amino acids 1-47 and amino acids 48-96, respectively, of SEQ LD. No. 1). It is particularly preferred to use regions that are conserved in most, more preferably all parasites of a single species to increase the effectiveness of the variant as a vaccine against a wide range of strains.
Variant MSP-1 polypeptides of the present invention comprise modifications to their 3o primary amino acid sequence that reduce the ability of blocking antibodies to bind to the MSP-1 polypeptides. In addition, any modifications made should maintain epitopes recognised by neutralising antibodies such that the affinity of the neutralising antibodies for the MSP-1 variant is substantially the same as for naturally-occurring MSP-polypeptides (such as an MSP-14, polypeptide having the sequence shown in SEQ
LD.
No. 2). Some reduction in the binding of some neutralising antibodies may be tolerated since the primary objective is to inhibit the binding of blocking antibodies and it is likely that an effective reduction in the binding of blocking antibodies will compensate in terms of overall vaccine efficacy for a small reduction in neutralising antibody binding.
Neutralising antibodies in the context of the present invention are antibodies that inhibit malaria parasite replication. A variety of neutralising antibodies, polyclonal and I o monoclonal, are known in the art, including mAbs 12.8, 12.10 and 5B 1 referred to in the Examples. The activity of neutralising antibodies can be determined in a variety of ways that have been described in the art. For example, a convenient assay method described in Blackman et al., 1994 involves using preparations of merozoites (Blackman et al., 1993;
Mrema et al., 1982) to measure cleavage of MSP-14~ into MSP-133 and MSP-1,~.
Briefly, freshly isolated merozoites are washed in ice-cold buffer and divided up into aliquots of about 2x109 merozoites. A test antibody is added to each aliquot and the sample incubated at 37°C for 1 hour. The samples are then subjected to SDS-PAGE under non-reducing conditions on a 12.5% polyacrylamide gel, Western blotted and the blot probed with antiserum to MSP-133. In the control sample, two main bands are seen -one 2o corresponding to MSP-142 and one lower molecular weight band corresponding to MSP-133. Neutralising antibodies will reduce the amount of the lower molecular weight band as a result of inhibiting secondary proteolytic processing of MSP-14,.
This method is a particularly preferred method for assessing the efficacy of neutralising antibodies in the presence of antibodies believed to act as blocking antibodies. Where candidate competing blocking antibodies are to be tested, the merozoite sample is preincubated with a blocking antibody for 15 mins on ice prior to incubation with a neutralising antibody at 37°C for 1 hour as described above. Thus blocking antibodies can readily be identified and/or characterised using such an assay method.
Other assay methods include merozoite invasion inhibition tests as described in Blackman et al., 1982.
As discussed above, blocking antibodies are defined in the context of the present invention as antibodies that inhibit the binding of neutralising antibodies to MSP-1 but which do not themselves inhibit invasion of red blood cells by malaria parasites. Thus they "block" the neutralising function of the neutralising antibodies. A
variety of blocking antibodies have been characterised in the art, including mAbs 2.2, 7.5 and 111.2 referred to in the Examples. As discussed above, blocking antibodies can conveniently be identified and/or characterised using assays that test their effect on neutralising antibody function.
to Modifications that may be made to produce MSP-1 variants of the invention include substitutions, deletions and insertions. It is particularly preferred to use substitutions to minimise disruption of the secondary/tertiary structure of the polypeptide.
Furthermore, particularly preferred substitutions are those that replace one class of amino acid with another class, such as an aliphatic non-polar residue with a charged polar residue. For example, the twenty naturally occurring amino acids may be divided into four main groups (aliphatic non-polar [G, A, P, I, L and V], aliphatic polar un-charged [C, S, T, M, N and Q], aliphatic polar charged [D, E, K and R] and aromatic [H, F, W and Y]) and it is preferred to replace an amino acid from one group with an amino acid from another 2o group.
Other possibilities include replacing a positively charged side chain with a negatively charged side chain, replacing an amino acid with a large side chain with an amino acid with a smaller or no side chain (glycine), replacing a polar amino acid with a charged polar amino acid, replacing a large aromatic amino acid with an amino acid with a small side chain, and replacing cysteine residues that are involved in disulphide bonds.
Particularly preferred modifications are an amino acid modification at any one of amino acid residues 15, 27, 31, 34 and 43 of the Plasmodium falciparum MSP-1,~ amino acid 3o sequence shown as SEQ LD. No. 1 or their equivalent positions in other Plasmodium MSP-1,9 polypeptides. These residues are all within the EGF-like domain 1. It is known that the epitopes of some antibodies contain amino acid sequences that are within EGF-like domain 2, therefore equivalent modifications may also be made in EGF-like domain 2. Preferred examples of modifications include the following substitutions AsnlS-~Arg, G1u27~Tyr, Leu31-~Arg, Tyr34~Ser, Tyr34~Gly and/or G1u43~Leu and their equivalents in other Plasmodium MSP-1,~ polypeptides.
It is especially preferred to carry out more than one modification, i.e. to use combinations of modifications, such as two or more or three or more. In a preferred embodiment, an MSP-1 variant of the invention comprises a combination of amino acid substitutions selected from [G1u27~Tyr, Leu31-~Arg and G1u43~Leu], [G1u27~Tyr, Leu3l~Arg, to Tyr34~Ser and G1u43-~Leu], [AsnlS~Arg, G1u27-~Tyr, Leu31-~Arg and G1u43-~Leu] and their equivalents in other Plasmodium MSP-119 polypeptides.
A particularly preferred combination further comprises a modification to Cysl2 and/or Cys28 (and/or their equivalent residues in EGF-like domain 2) to disrupt the disulphide bond.
Substitutions are not confined to using naturally occurring amino acids - non-naturally occurring amino acid analogues may also be used, in particular where solid phase synthesis is to be used to chemically synthesise the variant, as opposed to recombinant 2o technology.
Modifications to MSP-1 amino acid sequences may be carried out using standard techniques such as site-directed mutagenesis using the polymerase chain reaction.
Alternatively, variants may be obtained by solid phase synthetic techniques.
To determine whether a variant MSP-1 polypeptide produced by modification of its primary amino acid sequence complies with the criteria specified above, the affinity of at least one neutralising antibody and at least one blocking antibody for the variant polypeptide compared with the naturally occurnng MSP-1 sequence may be tested.
3o Ideally more than one of each type of antibody should be used, for example two or three.
The ability of antibodies to bind to the variant and wild-type polypeptides may be determined using any one of a variety of methods available in the art for determining antibody-epitope binding. One such method, described in the Examples, involves the use of MSP-1 sequences expressed as fusion proteins with a protein tag such as glutathione-S-transferase (GST). These GST-fusion proteins are typically immobilised to a solid phase such as glutathione sepharose beads or a BIAcore sensor chip. Binding of antibodies, such as monoclonal antibodies, to the fusion proteins may be determined using standard techniques such as Western blotting and/or by labelling the antibodies with a radioactive label such as ''SI. The use of BIAcore technology allows easy quantitation of the results.
to Preferably, the reduction in binding of at least one of the blocking antibodies tested is at least 50% compared to wild-type MSP-1, more preferably at least 75, 80 or 90%, typically as assessed using recombinantly expressed MSP-1 immobilised to a BIAcore sensor chip.
By contrast, the binding of at least one, for example at least two or three, of the neutralising antibodies tested, more preferably at least half of the neutralising antibodies tested, more preferably substantially all of the neutralising antibodies tested is reduced by less than 50%, more preferably less than 25%. The number of neutralising antibodies that need be tested to confirm compliance with the test criteria will not typically exceed from three to five different antibodies (three antibodies are used in the Examples). In a 2o particularly preferred embodiment the binding of at least one neutralising antibody is increased by at least 10%.
The results given in Table 2 in the Examples provide partial guidance to the skilled person as to which residues may be modified to produce a variant MSP-1 of the invention.
However, the provision herein for the first time of the three dimensional solution structure of MSP-I,9 provides the skilled person with further detailed guidance as to which residues may be altered. In particular, epitopes are expected to be exposed to the aqueous environment on the exterior of the MSP-1,9 fragment. Consequently, the precise structural information provided which teaches the position of surface exposed amino acids 3o allows the skilled person to target those residues for modification. This data is given in Tables A/B and has also been submitted to the BioMagRes Bank (accession no. ~.
It enables the skilled person to identify the precise location of individual amino acids in the three dimensional structure. Typically, the data is loaded into suitable software, well-known in the art such as Insight II, MOLSCRIPT and GRASP.
Further, knowing the location of a modification in the 3-dimensional structure which affects the binding of a blocking antibody without affecting the binding of the neutralising antibodies, it is possible to identify other. residues that are on the surface and in the vicinity of the original modification and which may be easily modified to further improve the properties of a modified protein. These residues may be in either the first or the second EGF-like motifs or in the sequence between them. Since it is known that an antibody to binding site can encompass a volume that corresponds approximately to the range of 5 to 8 amino acids, it is clear that modifications of these adjacent residues may also affect the affinity of the protein for the blocking antibodies. Once an adjacent amino acid has been identified it can be modified according to the principles outlined above and the contribution of the modification to the overall antigenicity and immunogenicity of the protein, either alone or in combination with other modifications, can be assessed. Those changes that contribute to a reduced affinity for the blocking antibodies, without a substantial affect on binding of the neutralising antibodies can be incorporated into the improved protein. This can be a reiterative process.
2o In addition, the 3D NMR structure will enable the skilled person to carry out preliminary computer modelling studies of MSP-1,9 variants with specific modifications so that, for example variants that cannot fold properly may be discarded. This will assist in minimising the number of candidate MSP-1,~ variants that need be tested.
Thus the present invention also provides a computer readable medium having stored thereon a model of the MSP-1,9 NMR structure. In a preferred embodiment, said model is built from all or some of the NMR data shown in Tables A and B.
Variants of the present invention may optionally include additional MSP-1 sequences, in 3o particular regions of the MSP-13~ region of MSP-14z to confer additional immunogenicity to the variant. Furthermore, additional sequences known to contain and promote T cell responses are advantageously included (i.e. T cell epitopes). Other modifications may also be made that increase immunogenicity such as modifications that alter the pathway of antigen processing and presentation.
Polypeptide variants of the invention are typically made by recombinant means, for example as described below. However they may also be made by synthetic means using techniques well known to skilled persons such as solid phase synthesis.
Proteins of the invention may also be produced as fusion proteins, for example to aid in extraction and purification. Examples of fusion protein partners include glutathione-S-transferase (GST), 6xHis, GAL4 (DNA binding and/or transcriptional activation domains) and (3-galactosidase. It may also be convenient to include a proteolytic cleavage site between the fusion protein partner and the protein sequence of interest to allow removal of fusion protein sequences. Preferably the fusion protein will not hinder the immunogenicity of the MSP-1 variant.
Polypeptides of the invention may be in a substantially isolated form. It will be understood that the polypeptide may be mixed with carriers or diluents which will not interfere with the intended purpose of the polypeptide and still be regarded as substantially isolated. A polypeptide of the invention may also be in a substantially purified form, in which case it will generally comprise the polypeptide in a preparation in 2o which more than 90%, e.g. 95%, 98% or 99% of the polypeptide in the preparation is a polypeptide of the invention.
B. Polynucleotides and vectors As discussed above, the variants of the present invention may be produced recombinantly using standard techniques. Thus, the present invention also provides a polynucleotide encoding a polypeptide MSP-I variant of the invention. Polynucleotides of the invention may comprise DNA or RNA. They may also be polynucleotides which include within them synthetic or modified nucleotides. A number of different types of modification to oligonucleotides are known in the art. These include methylphosphonate and phosphorothioate backbones, addition of acridine or polylysine chains at the 3' and/or 5' ends of the molecule. For the purposes of the present invention, it is to be understood that _ l 7_ the polynucleotides described herein may be modified by any method available in the art.
Such modifications may be carried out in order to enhance the in vivo activity or life span of polynucleotides of the invention. It will be understood by a skilled person that numerous different polynucleotides can encode the same polypeptide as a result of the degeneracy of the genetic code.
Polynucleotides of the invention comprise can be incorporated into a recombinant replicable vector. The vector may be used to replicate the nucleic acid in a compatible host cell. Thus in a further embodiment, the invention provides a method of making 1o polynucleotides of the invention by introducing a polynucleotide of the invention into a replicable vector, introducing the vector into a compatible host cell, and growing the host cell under conditions which bring about replication of the vector. The vector may be recovered from the host cell. Suitable host cells include bacteria such as E.
coli, yeast, mammalian cell lines and other eukaryotic cell lines, for example insect Sfi7 cells.
Preferably, a polynucleotide of the invention in a vector is operably linked to a regulatory sequence that is capable of providing for the expression of the coding sequence by the host cell, i.e. the vector is an expression vector. The term "operably linked"
refers to a juxtaposition wherein the components described are in a relationship permitting them to 2o function in their intended manner. A regulatory sequence "operably linked"
to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under condition compatible with the control sequences.
Such vectors may be transformed or transfected into a suitable host cell using standard techniques above to provide for expression of a polypeptide of the invention.
This process may comprise culturing a host cell transformed with an expression vector as described above under conditions to provide for expression by the vector of a coding sequence encoding the polypeptides, and optionally recovering the expressed polypeptides.
The vectors may be for example, plasmid or virus vectors provided with an origin of replication, optionally a promoter for the expression of the said polynucleotide and _18_ optionally a regulator of the promoter. The vectors may contain one or more selectable marker genes, for example an ampicillin resistance gene in the case of a bacterial plasmid or a neomycin resistance gene for a mammalian vector. Vectors may be used in vitro, for example for the production of RNA or used to transfect or transform a host cell. The vector may also be adapted to be used in vivo, for example in a method of gene therapy.
Promoters/enhancers and other expression regulation signals may be selected to be compatible with the host cell for which the expression vector is designed. For example, prokaryotic promoters may be used, in particular those suitable for use in E.
coli strains (such as E. coli HB141 or DHSa).
When expression of the polypeptides of the invention in carried out in mammalian cells, either in vitro or in vivo, mammalian promoters may be used. Tissue-specific promoters may also be used. Viral promoters may also be used, for example the Moloney marine leukaemia virus long terminal repeat (MMLV LTR), the promoter rous sarcoma virus (RSV) LTR promoter, the SV40 promoter, the human cytomegalovirus (CMV) IE
promoter, herpes simplex virus promoters or adenovirus promoters. All these promoters are readily available in the art.
2o C. Administration The variant MSP-1 polypeptides of the present invention and nucleic acid molecules may be used to treat or prevent malaria in animals, specifically humans.
The polypeptides of the invention may be administered by direct injection.
Preferably the polypeptides are combined with a pharmaceutically acceptable carrier or diluent to produce a pharmaceutical composition. Suitable carriers and diluents include isotonic saline solutions, for example phosphate-buffered saline. The composition may be formulated for parenteral, intramuscular, intravenous, subcutaneous, intraocular or 3o transdermal administration. Typically, each polypeptide is administered at a dose of from 0.01 to 30 p.g/kg body weight, preferably from 0.1 to 10 pg/kg, more preferably from 0.1 to 1 pg/kg body weight. It is also possible to use antibodies prepared using the polypeptides of the invention, as described below, in treating or preventing Plasmodium infection. Neutralising antibodies, or fragments thereof which retain specificity for Plasmodium antigens, can be administered in a similar manner to the polypeptides of the invention.
The polynucleotides of the invention may be administered directly as a naked nucleic acid construct. When the expression cassette is administered as a naked nucleic acid, the amount of nucleic acid administered is typically in the range of from 1 ~g to 10 mg, preferably from 100 qg to 1 mg.
to Uptake of naked nucleic acid constructs by mammalian cells is enhanced by several known transfection techniques for example those including the use of transfection agents.
Example of these agents include cationic agents (for example calcium phosphate and DEAE-dextran) and lipofectants (for example lipofectamT°'' and transfectamT'~'').
Typically, nucleic acid constructs are mixed with the transfection agent to produce a composition.
Alternatively, the polynucleotide may be administered as part of a nucleic acid vector, including a plasmid vector or viral vector, such as a vaccinia virus vector.
When the 2o polynucleotide of the invention is delivered to cells by a viral vector of the invention, the amount of virus administered is in the range of from 103 to 101° pfu, preferably from 105 to 10$ pfu, more preferably from 106 to 10~ pfu. When injected, typically 1-10 pl of virus in a pharmaceutically acceptable suitable carrier or diluent is administered.
Preferably the delivery vehicle (i.e. naked nucleic acid construct or viral vector comprising the polynucleotide for example) is combined with a pharmaceutically acceptable carrier or diluent to produce a pharmaceutical composition.
Suitable carriers and diluents include isotonic saline solutions, for example phosphate-buffered saline. The composition may be formulated for parenteral, intramuscular, intravenous, subcutaneous, 3o intraocular or transdermal administration.
The routes of administration and dosages described are intended only as a guide since a skilled practitioner will be able to determine readily the optimum route of administration and dosage for any particular patient and condition.
D. Preparation of Vaccines Vaccines may be prepared from one or more polypeptides of the invention. They may also include one or more immunogenic Plasmodium polypeptides known in the art.
Thus a vaccine of the invention may comprise one or more polypeptides of the invention and I o optionally, one or more polypeptides selected from, for example, the asexual blood stage proteins: apical merozoite antigen-1, erythrocyte binding antigen 175, erythrocyte membrane protein-1; the hepatic stage proteins: liver stage antigens 1 and 3;
the sporozoite stage proteins: circumsporozoite protein , thrombospondin related adhesive protein; and the sexual stage proteins Pfs25 and Pfs28 polypeptides and immunogenic fragments thereof. Preferably, the other immunogenic Plasmodium polypeptides known in the art do not contain wild type MSP-1,9 sequences.
The preparation of vaccines which contain an immunogenic polypeptide(s) as active ingredient(s), is known to one skilled in the art. Typically, such vaccines are prepared as 2o injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to injection may also be prepared. The preparation may also be emulsified, or the protein encapsulated in liposomes. The active immunogenic ingredients are often mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol, or the like and combinations thereof. In addition, if desired, the vaccine may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and/or adjuvants which enhance the effectiveness of the vaccine. Examples of adjuvants which may be effective include but are not limited to: aluminum hydroxide, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine (CGP 11637, referred to as nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1'-2'-dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine (CGP 19835A, referred to as MTP-PE), and RIBI, which contains three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2%
squalene/Tween 80 emulsion. The effectiveness of an adjuvant may be determined by measuring the amount of antibodies directed against an immunogenic polypeptide containing an MSP-1 antigenic sequence resulting from administration of this polypeptide in vaccines which are also comprised of the various adjuvants.
The vaccines are conventionally administered parenterally, by injection, for example, either subcutaneously or intramuscularly. Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral formulations.
For suppositories, traditional binders and carriers may include, for example, polyalkylene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1% to 2%. Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10% to 95%
of active ingredient, preferably 25% to 70%. Where the vaccine composition is lyophilised, the lyophilised material may be reconstituted prior to administration, e.g. as a 2o suspension. Reconstitution is preferably effected in buffer Capsules, tablets and pills for oral administration to a patient may be provided with an enteric coating comprising, for example, Eudragit "S", Eudragit "L", cellulose acetate, cellulose acetate phthalate or hydroxypropylmethyl cellulose. These capsules may be used as such, or alternatively, The polypeptides of the invention may be formulated into the vaccine as neutral or salt forms. Pharmaceutically acceptable salts include the acid addition salts (formed with free amino groups of the peptide) and which are formed with inorganic acids such as, for 3o example, hydrochloric or phosphoric acids, or such organic acids such as acetic, oxalic, tartaric and malefic. Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine and procaine.
E. Dosage and Administration of Vaccines The vaccines are administered in a manner compatible with the dosage formulation, and in such amount as will be prophylactically and/or therapeutically effective. The quantity to be administered, which is generally in the range of 5 ~g to 250 pg of antigen per dose, depends on the subject to be treated, capacity of the subject's immune system to synthesise antibodies, and the degree of protection desired. Precise amounts of active ingredient required to be administered may depend on the judgement of the practitioner and may be peculiar to each subject.
The vaccine may be given in a single dose schedule, or preferably in a multiple dose schedule. A multiple dose schedule is one in which a primary course of vaccination may be with 1-10 separate doses, followed by other doses given at subsequent time intervals required to maintain and or reinforce the immune response, for example, at 1 to 4 months for a second dose, and if needed, a subsequent doses) after several months.
The dosage regimen will also, at least in part, be determined by the need of the individual and be dependent upon the judgement of the practitioner.
In addition, the vaccine containing the immunogenic MSP-1 antigens) may be administered in conjunction with other immunoregulatory agents, for example, immunoglobulins.
F. Preparation of antibodies against the polypeptides of the invention The variant MSP-1 polypeptides prepared as described above can be used to produce antibodies, both polyclonal and monoclonal. If polyclonal antibodies are desired, a 3o selected mammal (e.g., mouse, rabbit, goat, horse, etc.) is immunised with an immunogenic polypeptide bearing an MSP-1 epitope(s). Serum from the immunised animal is collected and treated according to known procedures. If serum containing polyclonal antibodies to an MSP-1 epitope contains antibodies to other antigens, the polyclonal antibodies can be purified by immunoaffinity chromatography.
Techniques for producing and processing polyclonal antisera are known in the art.
Monoclonal antibodies directed against MSP-1 epitopes in the polypeptides of the invention can also be readily produced by one skilled in the art. The general methodology for making monoclonal antibodies by hybridomas is well known. Immortal antibody-producing cell lines can be created by cell fusion, and also by other techniques such as direct transformation of B lymphocytes with oncogenic DNA, or transfection with 1o Epstein-Barr virus. Panels of monoclonal antibodies produced against MSP-1 epitopes can be screened for various properties; i.e., for isotype and epitope affinity.
Antibodies, both monoclonal and polyclonal, which are directed against MSP-1 epitopes are particularly useful in diagnosis, and those which are neutralising are useful in passive immunotherapy. Monoclonal antibodies, in particular, may be used to raise anti-idiotype antibodies. Anti-idiotype antibodies are immunoglobulins which carry an "internal image" of the antigen of the infectious agent against which protection is desired.
Techniques for raising anti-idiotype antibodies are known in the art. These anti-idiotype 2o antibodies may also be useful for treatment of Plasmodium infections, as well as for an elucidation of the immunogenic regions of MSP-1 antigens. It is also possible to use fragments of the antibodies described above, for example, F(ab')Z, Fab, Facb and scFv fragments.
It should be appeciated that features from various sections, aspects and embodiments of the invention as described above are generally equally applicable to other sections, aspects and embodiments mutatis mutandis.
The invention will now be further described by way of Examples, which are meant to 3o serve to assist one of ordinary skill in the art in carrying out the invention and are not intended in any way to limit the scope of the invention. The Examples refer to the Figures. In the Figures:
_24_ Detailed Description of the Figures Figure 1 - MSP-1 sequences aligned according to the EGF-like motif consensus.
Top sequence: P. falciparum (SWISS-PROT MSP1 PLAFW). Second sequence: P. vivax Belem strain (PIR A45604). Third sequence: human EGF (PDB 1 egf). Fourth sequence:
EGF-like domain consensus (Prosite EGF1). Bottom sequence: 14 residue EGF core region used for structure alignment in Figure 6. Black highlighting indicates conserved residues of the EGF-like domain. Dark shading shows hydrophobic residues at the EGF-module pair interface in the P. falciparum, and corresponding conserved residues in the P. vivax sequence.
Figure 2 - Sample of multidimensional heteronuclear NOESY experiments showing planes containing NOE connections to the MSP-1 C-terminal fragment Lys35 NH
proton.
~5 Top: '3C (D4) and 'H(D3) plane from the 4D-['3C]-HMQC-NOESY-['SN]-HSQC
experiment, taken at the chemical shift values of Lys35 NH in 'SN(D2) and 'H(Dl).
Bottom: strip from the 3D ['SN]-NOESY-HSQC at the 'H chemical shift value of Lys35 NH (vertical axis, D1) taken at the plane of its'SN (D3) value. The horizontal'H axis is aligned with that of the top spectrum. The weak cross-peaks at 2.72 and 3.01 ppm in the 20 3D spectrum do not show corresponding cross-peaks in the 4D spectrum because of the lower signal-to-noise ratio in the latter. These peaks have been assigned as the cross-peaks between Lys35 NH and Asn44 Hpz (2.72 ppm), and Cys30 Ha3 and/or Cys41 Haz (3.01 Ppm) 25 Figure 3 - Stereo drawing showing the backbone C, N, Ca atoms of the 32 refined structures in the final ensemble. The domain-1 is on the left (red), with domain-2 on the right (green), and both the N- and C-termini are near the bottom.
Figure 4 - MOLSCRIPT picture of the most representative model of the ensemble, 3o showing the backbone Ca trace, antiparallel (3-sheet elements, and disulphide bridges (SY
atoms in yellow). Domain-1, red; Domain-2, green.
Figure 5 - Alignment of typical EGF-like family members with the fitpdb program, using the 14 amino acid "reduced core" consensus (Bersch et al., 1998) (see Figure 1). The aligned backbone segment in each structure is white. The structures are aligned relative to the most representative structure of the group (factor Xa), with increasing divergence from left to right. Numbers indicate the rmsd value of the aligned C, N, Cu atoms.
PDB
identification codes: factor Xa (crystal structure), 1 hcg; Complement C 1 r component, lapq (14''' model); human EGF, legf (11''' model); fibrillin-1, domains-32 and -33, lemn (minimized average structure); transforming growth factor-a, 2tgf (minimized average structure); MSP-1 domains-1 and -2, this study.
to Figure 6 - Backbone ribbon view of fibrillin-1 versus MSP-1 EGF module pair arrangements. Fibrillin-1 (lemn) cyan (domain-32) and magenta (domain-33) (Downing et al., 1996); MSP-1 domain-1 (yellow) and domain-2 (green). Structures were aligned as in Figure 6 by the core consensus of the N-terminal domain of each pair. The bound Ca'-+
ions in the fibrillin-1 structure are shown as magenta spheres.
Figure 7 - Two views, a and b, (rotated 180° about the y-axis) of the electrostatic potential surface of the MSP-1 EGF module pair, calculated with GRASP. Red indicates negative charge, blue indicates positive charge, and white is neutral. The orientation of the views 2o is shown by the adjacent worm diagrams.
Figure 8 - CPK model of the MSP-1 C-terminal fragment, showing the location of some mutations that affect binding of monoclonal antibodies. Domain-1 is towards the top and right sides, and domain-2 towards the bottom left.
Figure 9 - Examples of the binding of monoclonal antibodies to GST-MSP-1,~
detected by Western blotting. The binding of each monoclonal antibody to protein based on the wild type sequence and to proteins containing modified sequences is shown. The monoclonal antibodies are shown across the top. On the left is shown the proteins: WT, wild type 3o sequence; 22, Leu22 to Arg; 26, G1u26 to Ile; 15, AsnlS to Arg; 27, G1u27 to Tyr; 31, Leu31 to Arg; 43, G1u43 to Leu; 27+31+43, G1u27 to Tyr and Leu31 to Arg and G1u43 to Leu; 15+27+31+43, AsnlS to Arg and G1u27 to Tyr and Leu31 to Arg and G1u43 to Leu.
Figure 10 - The binding of monoclonal antibodies to GST-MSP-1,~ detected by BIAcore analysis. The binding of each monoclonal antibody is normalised to 100%
binding to protein based on the wild type sequence and the binding to proteins containing modified sequences is expressed as a percentage of this. WT, wild type sequence; 27;
G1u27 to Tyr;
31, Leu31 to Arg; 34, Tyr34 to Ser; 43, G1u43 to Leu. The combinations contain 3 or 4 substitutions, respectively, in the protein.
Examples Materials and Methods Protein expression and stable-isotope labelling for NMR
The coding sequence of the MSP-1 C-terminal fragment was cloned by polymerase chain reaction with Vent polymerase (New England Biolabs) from a plasmid containing the Plasmodium falciparum strain T9/94 fragment (Blackman et al., 1991), using primers that included codons for a 6 residue N-terminal His tag (CACCATCATCATCATCAC), and inserted into the SnaBI restriction site of the pPIC9K vector (Invitrogen).
The sequence 2o corresponds to residues 1526-1621 of the SWISS-PROT entry MSP1 PLAFW
(accession number P04933). This produced an a-factor fusion protein with the sequence ...KR/EA/EA/YHHHHHHNISQ....SSSN, where the slashes indicate kex2 and STE13 processing sites. High copy number transformants of the methylotrophic yeast Komagataella (Pichia) pastoris protease-deficient strain SMD1168 (his4 pep4) were isolated by screening for high 6418 resistance (Clare et al., 1995).
A Mut+ transformant was grown at 29.4 °C in a shaker-incubator in buffered minimal medium (100 mM potassium phosphate, pH 6.0, yeast nitrogen base (0.34 % w/vol) (DIFCO: YNB without amino acids and without (NHa)zS04), biotin (4x10'5%
w/vol), Sigma antifoam 289 (0.01% vol/vol), and carbon and nitrogen sources as described below.
Unlabelled samples were initially grown in medium containing 1 % w/vol (NH4)ZS04 and 1 % w/vol glycerol, and induced by transfer to medium containing 0.5 % CH30H
as the carbon source. Labelled samples were initially grown in medium containing 0.2 % w/vol ['SN]-(NHa)ZSO~ (Isotech), and 0.5 % w/vol glucose or ['3C6]-glucose (Isotech), and induced by transfer to medium containing as carbon source 0.5 % w/vol CH30H or [''C]-CH30H (Isotech). The initial cultures were grown in 150 ml to a density of ~10 ODboo~
then harvested and resuspended in methanol medium at 1 OD6oo in a volume of 1.5 L.
Methanol-induced cultures were grown for 4 d, with daily addition of 7.5 ml CH;OH or ['3C]-CH30H, to a final density of ~18 ODboo. This protocol produced a maximum yield of 24 mg/L of purified, "C/'SN uniformly labelled protein at the final stage (see below).
The YNB-based medium produced about 3-fold higher yields than the FM22 medium to (Laroche et al., 1994), for stable-isotope labeling of the MSP-1 C-terminal fragment.
Cells were removed by low-speed centrifugation, protease inhibitors added (COMPLETET'~'' tablets, Boehringer-Mannheim; 1 tablet/500 ml supernatant), and the supernatant was filter-sterilized. The supernatant was concentrated ~20-fold by t 5 ultrafiltration in a stirred cell (Amicon, YM3 membrane) at 4 °C.
The pH was adjusted to 7.25 with KOH, and the partially N-glycosylated MSP-1 fragment was deglycosylated for 72 h at 37 °C with 5000 U PNGaseF (New England Biolabs). The carbohydrate was completely removed (as shown by electrophoresis and mass spectrometry), with the Asn 1 residue presumably converted to Asp in the process. The supernatant was clarified by low-2o speed centrifugation, 5 M NaCI was added to a final concentration of 0.3 M, and the sample was applied to a 2 ml Ni-NTA affinity column (QIAGEN), washed, and eluted with 250 mM imidazole according to manufacturer's instructions. The eluate was dialyzed against 50 mM sodium phosphate (pH 6.5), 50 mM NaCI, and then passed through a 1 ml Hi-Trap Q anion exchange resin (Pharmacia) to remove misfolded 25 that bound to the column. The MSP-1 fragment was characterized by Western blotting and electrospray mass spectrometry (data not shown). Two principal species of mass and 11807 Da were observed corresponding to the expected fragment, as well as a fragment with an additional N-terminal Glu - Ala dipeptide resulting from incomplete STE13 processing of the a-factor secretion signal.
Samples for NMR experiments were prepared in either 90 % HZO/10 % Dz0 with 0.01 w/vol NaN,, or 100 % DZO, 50 mM sodium phosphate, 100 mM NaCI at pH 6.5, (pH
uncorrected for deuterium isotope effects), at a concentration of 2.1 to 2.6 mM in 0.6 ml.
Protein concentration was measured by UV absorbance at 280 nm, using a calculated molar extinction coefficient of 5220 liter mol-' cm'. The protein was demonstrated to be monomeric by equilibrium ultracentrifugation of a 0.12 mM sample in the above buffer at 293 K.
NMR experiments and data processing Most of the experiments were performed at 298 K, using Varian Unity and Unity-Plus to spectrometers operating at 600 MHz and 500 MHz respectively. Details of the multidimensional experiments (Clore & Gronenborn, 1998) and acquisition parameters used for resonance assignments and structure determination are given in Tables A/B and have been submitted to the BioMagResBank database (Accession No ~
All spectra were processed using Felix 95.0 or 97.0 (BiosymlMSI) using a 90 degree- or 72 degree-shifted sinebell-squared window function. Dimensions, zero-filling, and linear prediction details are summarized in Table A and in the submission to the BioMagResBank. Four dimensional and interleaved spectra were processed in Felix using macros written in-house.
Signal assignments: Sequential assignments were made based on connectivities established primarily by CBCA(CO)NH and CBCANH experiments on uniformly '3C/'SN
labelled protein. Side chain-spin system assignments were made on the basis of data from '3C/'H -HCCH-TOCSY experiment correlated with information from 'SNfH-TOCSY-HSQC and 'SN/'H-NOESY-HSQC, and HNHA and HNHB experiments. Assignments were obtained for 'H, ''N and aliphatic '3C signals for 98% of side-chains and 96% of backbone amide groups. The list of assignments is given in Table A and in the submission to the BioMagResBank database (Accession No ~. The 'SN{'H} heteronuclear NOE experiment was carried out as described previously (Kay et al., 1989;
Polshakov et 3o al., 1997).
Distance Restraints: NOE- and ROE-derived distance restraints between backbone and side chain amide protons were obtained primarily from the 3D 'SN-NOESY-HSQC, 'SN-ROESY-HSQC, and 4D '3C-HMQC-NOESY-'SN-HSQC experiments. Aliphatic to aliphatic proton distance restraints were obtained from a 4D ''C-HMQC-NOESY-'3C-HSQC experiment. A 3D '3C-HMQC-NOESY experiment in DZO was used to identify aliphatic to aromatic proton NOES and 2D NOESY experiments were used to measure aromatic to aromatic proton NOES. Crosspeaks were quantified by volume integration in Felix for 2D and 3D experiments and for the 4D '3C-HMQC-NOESY-''N-HSQC
experiment, and from peak height measurements in the 4D '3C-HMQC-NOESY-'3C-to HMQC spectra. Crosspeaks were classified as strong, medium and weak and these were assigned to distance restraints of 0 - 2.8, 0 - 3.6, and 0 - 5.5 ~. Restraints from backbone amide signals were initially treated in this manner, and then recalibrated more precisely using 3D-'SN-ROESY-HSQC data into four classes involving maximum distances of 2.6, 3.1, 3.6, and 4.1 ~. Restraints to groups of equivalent or non-stereoassigned protons were treated by r 6 summation. Most intraresidue distances (HN-Hp and Ha-Hp) were converted to x, angle restraints as described below and these distance restraints were not included in the final list.
Dihedral Angle Restraints: x, angles and stereospeciflc assignments of (3-methylene 2o protons were obtained using the grid-search program AngleSearch, with coupling constant and intraresidue ROE distance information (Polshakov et al., 1995). The coupling constant information was provided by HNHB and HN(CO)HB spectral intensities for 3J(HN-Ha) and 3J(CO-H~), and intraresidue distances (HN-Hp, Ha-Ha) were obtained from 3D 'SN-ROESY-HSQC and 2D ROESY (D20) experiments. 3J(HN-Ha) coupling constants were obtained from the HNHA experiment. Residues with positive ~
angles (ca.
+60 degrees) were identified by large intraresidue Hn crosspeak intensities in the HN(CO)HB experiment, and y angles near -60° degrees from strong Ha~;_,~
crosspeaks in the HNHB experiment. Ile and Leu x2 angles and Leu 8 stereoassignments were derived from the LRCH experiment. Minimum ranges of 40 degrees (x,, x2) and 50 degrees (~, yr) 3o were used to account for errors and local dynamic effects on the coupling constants.
Disulphide Bonding Pattern: An initial set of 20 structures was calculated by simulated annealing using approximately 550 unambiguous NOE-derived distance restraints and 36 x, and ~ dihedral angle restraints but with no hydrogen bonding or disulphide bond constraints. The Cys - Cys SY distances in these structures were examined in order to establish the probable bonding pattern. Prior to the calculations, the formation of disulphide bridges for 4 Cys residues (Cysl2 - Cys28, Cys78 - Cys92) was already established with high probability by the observation of HR-Ha NOES between these pairs of Cys residues. Examination of the initial structures confirmed these disulphide bridges and also indicated a disulphide bridge between residues Cys30 and Cys4l. The third disulphide bridge in domain-1 (Cys7 - Cysl8) could thus be assigned by default, although the structure of the N-terminus was not well-defined by the NMR data. The best six structures in terms of total X-PLOR energy and violations indicated that the average Cys -Cys SY distance was lowest for the disulphide bonding pattern [1-3, 2-4, 5-6]
in each domain, and only this combination allowed all Cys residues to form contacts with a partner <3.5 A away. Thus, this disulphide bonding pattern was most consistent with the experimental data for both domains, and was imposed (initially as NOE-style distance restraints) in subsequent calculations. The [1-3, 2-4, 5-6] pattern is that expected for an EGF-like domain.
Hydrogen Bonds: Non-exchanging amide groups involved in stable hydrogen bonds were identified in spectra of samples examined in 100 % D20. The corresponding hydrogen bond acceptors were determined by examining the initial structural ensemble, using the Insight II and HBPIus (McDonald et al., 1994) programs, and hydrogen bond distance restraints were included in subsequent calculations. Further hydrogen bonds were identified in a similar manner in iterative calculations. Only 10 backbone hydrogen bonds in the antiparallel (3 sheets were used as restraints. Two distance restraints were used for each hydrogen bond, 1.7 - 2.3 A from proton to acceptor, and 3.0 - 3.6 A from donor nitrogen atom to acceptor.
3o Structure Calculations All the structure calculations were performed following standard protocols for ab initio _; l _ simulated annealing from an extended chain using X-PLOR version 3.843 on a Silicon Graphics Origin 200 computer. The initial calculations used an initial temperature of 1000K, and 9000 steps of 5 fs in the restrained molecular dynamics stage. A
soft-square potential was used for distance restraints. The SHAKE (Ryckaert et al., 1977) algorithm was employed during molecular dynamics to maintain correct bond lengths.
Refinement used a square well potential for restraints, and a final slow cooling of 30000 steps of 4 fs each from 2000K. A modified "parallhdg.pro" force-field parameter set was used, with modifications to parameters for Arg and Pro residues, and for hydrogen bonds (Polshakov et al., 1997). Force constants were 50 kcal mol-' A-z for all distance restraints including hydrogen bonds, and 200 kcal mol~' rad~' for dihedral restraints. The N-terminal sequence including the vector-encoded residues and (His)6 tag was excluded from the structure calculations. All peptide bonds were constrained to be trans. NOE data for all 5 Pro residues showed strong Ha~,_,~-ProHa crosspeaks, consistent with the trans peptide conformation.
Initial structures were calculated as described above to determine the disulphide bonding pattern. Then the calculation was repeated with identical NOE-derived distance and dihedral angle restraints, with the addition of 6 distance restraints ( 1.92-3.12 A) representing the disulphide bridges. A new set of 50 structures was obtained, from which the best 20 structures were selected. The criteria used for selection were that the structures were below the median value of both total X-PLOR energy and rms NOE
difference, and had no dihedral angle violations. The resulting structures had good geometry and between zero and two NOE violations > 0.5 A. These structures were used to assign previously ambiguous NOES and to determine the hydrogen bonds as described above.
The final structure calculation and refinement used an expanded restraint list including hydrogen bonds, additional dihedral restraints, stereoassignments of (3-methylene and Leu 8 signals, and more precisely calibrated ROE data (see Table 1 ). A set of 100 structures 3o was obtained using this list, and 38 structures with 0-2 NOE violations >
0.5 A and no dihedral angle violations > 5° were accepted. These 38 structures were refined by the slow-cooling procedure described above, producing a final ensemble of 32 accepted structures with no NOE violations > 0.5 A and no dihedral angle violations >
5°. These selection criteria produced an ensemble of structures that extend to the end of the continuum of total potential energies in order to include structures having large scale correlated motions (Abseher et al., 1998). Statistics for the final ensemble are given in Table 1. Coordinates for the 32 refined structures have been deposited in the Brookhaven Protein Data Bank (coordinates ID code lcej; NMR restraints ID code rlcejmr).
Structures were analyzed during the calculation process using X-PLOR 3.8 (Nilges et al., 1991), PROCHECK-NMR/AQUA (Laskowski et al., 1996), and Insight II for quality of 1o agreement with experimental data, precision, geometry, and energy. Models were aligned with Insight II and fitpdb, and displayed with Insight II, MOLSCRIPT (Kraulis, 1991), and GRASP (Nicholls et al.,1991 ).
Table 1.
A: RESTRAINTS SUMMARY
Number of conformers calculated: 100 Number of conformers accepted: 32 Acceptance criteria:
2o No distance violation: > 0.5 A No dihedral angle violation: > 5 NOE/ROE distance restraints:
Intraresidue: 73 Sequential: 222 Medium range ( 2-4 ): 90 Long range ( > 4 ): 185 Tota1:570 Dihedral angle restraints:
phi:25 psi:33 chi-1:22 chi-2:5 Tota1:85 3o Hydrogen bonds: 10 Disulphide bonds: 6 B: STRUCTURE QUALITY
average +l s. d.
Total X PLOR energy (kcal mol-') 168 20 NOE X-PLOR energy (kcal mol~') 21 8 rmsd NOE 0.026 0.005 rmsd dihedral angle 0.236 0.095 rmsd bond length 0.0029 0.0002 rmsd bond angle 0.357 0.023 l0 rmsd improper 0.266 0.018 Backbone rmsd of structured (69 residues) region:
Overall: 1.05 0.28 Domain-1: 0.81 0.32 Domain-2: 0.83 0.35 Ramachandran plot quality (phi/psi angles):
Most favoured 49.5 Additional allowed 42.1 2o Generously allowed 5.6 Disallowed 2.7 Monoclonal antibodies (mAbs) Anti-MSP-1,~ monoclonal antibodies used in this study were : mouse IgG mAbs lEl, 1E8, 2F10, 111.2, 111.4 2.2, 5.2, 7.5, 9C8, 12.8, 12.10 (Holder et al., 1985;
McBride &
Heidrich, 1987; Blackman et al., 1987; Guevara Patino et al., 1997); and mouse IgM mAb 5B 1 (Pirson & Perkins, 1985). Of these, mAbs 12.8, 12.10 and 5B 1 are neutralising, inhibitory antibodies and 2.2, 7.5 and 111.4 are blocking antibodies. Some antibodies 3o such as 2F10 are neither inhibitory nor blocking.
Construction of modified MSP-l,~ clones The DNA coding the wild type MSP-l,~ domain of Plasmodium falciparum (T9-94/Wellcome strain) MSP-1 has been cloned in expression vector pGEX-3X to produce MSP-1,~ fused to the carboxy-terminus of the Schistosoma japoniczrm glutathione S-transferase (GST) in Escherichia coli (Burghaus & Holder, 1994). Site-directed mutagenesis of MSP-1,9 DNA sequence was done in either of two ways.
The first method was a modification of the method of Perrin & Gilliland ( 1990) to carry out polymerase chain reaction (PCR)-mediated site specific mutagenesis. DNA
was amplified using the plasmid as a template together with one oligonucleotide to introduce the point mutation and a 5' primer from outside of the MSP-1,~ sequence. The amplified product was purified after electrophoresis on an agarose gel and used in a second amplification step together with a 3' primer from outside of the other end of the MSP-l,~
sequence and the plasmid as template. This second PCR product was digested with the restriction enzymes EcoRl and BamHl and the product consisting of the modified MSP-1,~ coding sequence was inserted back into pGEX-3X and the products were used to transform DHSa, cells.
2o The second method used the QuikChange Site-directed mutagenesis kit from Stratagene.
Briefly, using the plasmid pGEX-MSP-1,9 as a template, two complementary synthetic oligonucleotide primers containing the desired point mutation were designed and were extended on the template by temperature cycling with the enzyme Pfu DNA
Polymerase.
This incorporation of the oligonucleotide primers results in the generation of a mutated plasmid containing staggered nicks in the DNA sequence. Following the temperature cycling, the product was treated with DpnI endonulease which will digest the methylated parental DNA template and leaves the mutation-containing newly synthesised DNA
intact. The DNA incorporating the desired mutation was then transformed into E. coli strain DHSa, (Life technologies) competent cells where the nicks will be repaired.
Clones were screened by analysis of restriction enzyme digests and by PCR
screening of the insert gene. The DNA sequence of the selected mutant clones was confirmed using a PerkinElmer Applied Biosystems ABI 377 automatic sequencer according to the manufacturer's instructions.
Expression of the GST-MSP-1,~ fusion proteins Expression of GST-MSP-l,~ was induced with 1 mM isopropyl-~i-D-thiogalactopyranoside (IPTG; Melford Laboratories) for 1 hour in the E. coli strain TOPP
1 (Stratagene). The cells were then harvested by centrifugation and the cell pellet was resuspended in cell lysis buffer (50 mM Tris-HCl/1 mM EDTA pH 8.0 containing 0.2%
(v/v) Nonidet P40 (NP40; BDH). Phenylmethylsulphonyl fluoride (PMSF; Sigma) in isopropanol was added to a final concentration of 1 mM. The cell suspension was sonicated, on ice, using VibraCell sonicator (Sonics & Materials) at 50% duty cycle for 3 min (six 30 sec pulses with 30 sec in between). The cell lysate was centrifuged at 65000 x g for 1 hour at 4°C. Supernatant containing soluble GST-fusion protein was applied to a glutathione-agrose column (Sigma) and the GST-fusion protein was eluted with 5 mM
reduced glutathione. The eluted GST-fusion protein was dialysed extensively against phosphate buffered saline (PBS) at 4°C.
SDS-PAGE and Western Blotting Proteins were analysed by polyacrylamide gel electrophoresis in the presence of sodium dodecyl sulphate (SDS-PAGE). Samples were solubilised in SDS-PAGE buffer without reducing agents, then fractionated on a homogeneous 12.5% polyacrylamide gel.
The pre-stained low range molecular mass markers (24-102kDa) from Bio-Rad were used as markers. When required, SDS-PAGE-fractionated polypeptides were either stained with Coomassie Brilliant Blue R-250 (CBB; Sigma) or electrophoretically transferred to Optitran BA-S 83 reinforced nitrocellulose (Schleicher & Schull, 0.2 im pore size) for analysis by western blotting. Blots were blocked with 5% BSA, 0.5% Tween 20 in PBS
(PBS-T) for 1 h at room temperature, then washed in PBS-T. Blots were probed with first 3o antibodies for 2 h at room temperature, washed 3 times in PBS-T, and then incubated in 1/1000 dilution of horse radish peroxidase (HRP)-conjugated sheep anti-mouse IgG
(H+L) (ICN Immunobiologicals) or Goat anti-mouse IgM (p chain) (Sigma) for 1 h at room temperature. Blots were then washed 3 times in PBS-T and developed using Super Signal Substrate (Pierce) as HRP substrate for 1 min. Blots were then placed in plastic wrap and exposed to X-ray film (XB-200, X-ograph Imaging Systems). The films were processed with an Agfa Gevamatic60 film processor (Agfa).
Analysis of antibody-antigen interaction using a BIAcore machine GST-MSP-1,9 containing either the wild type or various modified sequences was used to coat a carboxmethyl dextran hydrogen sensor chip by the following methodology.
The to binding of the GST-MSP-1,9 was via amino groups using EDC/NHS chemistry.
Immobilisation was done with the amine coupling kit (Pharmacia BIAcore). The CM
dextran surface was activated with 35 ~1 of 200 mM 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) and 5 mM N-hydroxysuccinamide (NHS) for 7 min. GST-MSP-1,9 was then coupled to the BIAcore sensor surface using 20 P.l of a solution at 100 ~,g ml-' in coating buffer (0.01 M sodium acetate buffer, pH 3.5) for 4 min. Unreacted carboxyl groups were blocked by adding 35 ~tl 1 M ethanolamine, pH 8.5 for 7 min. The cells were washed with two pulses of 20 ~l 10 mM glycine-HCI, pH 2.8 for 8 min in total to remove any non-covalently bound protein. The immobilisation procedure was carried out at a flow rate of 5 ~1 min'. Measurements were performed on the BIAcore 2000 instrument.
RESULTS
Example 1 - Resonance assignments, NMR restraints and structure determination The assignments and restraints were obtained as described in Materials and Methods using a range of multidimensional heteronuclear experiments with '3C/'SN uniformly labelled protein. Sample spectra from 3D and 4D experiments showing NOE connections to the Lys35 backbone amide NH proton, resolved and unambiguously assigned using the '3C
chemical shift information, are shown in Figure 2. The distance, dihedral angle and 3o hydrogen bond restraints used in the final set of structure calculations are summarized in Table 1. A total of 570 unambiguously assigned distance restraints, 85 dihedral angle restraints, and 10 hydrogen bonds were used in the final set. The assignments and restraint list shown in Table A have been submitted to the BioMagResBank database. Three disulphide bonds, with the (1-3, 2-4, 5-6) pattern for each domain were experimentally determined from the NMR data in preliminary calculations as described in Materials and Methods, and these were also included in the final refinement. A final set of 32 models was calculated and refined using these restraints and these structures are shown in Figure 3 superimposed on the backbone of the representative structure S~eP. Table 1 shows that all 32 models have good geometry and are in good agreement with the experimental data with no NOE violations > 0.5 A and no dihedral angle violations > 5°.
The atomic rmsd value for the backbone atoms of the well-structured region (residues 15 - 64, 74 - 92) is 1o 1.05 A (see Table 1). The local backbone rmsd is highest at the N-terminus (up to Cysl2), in the loop G1u65 - Lys73, and following Cys92 at the C-terminus. The Ramachandran plot quality is typical of that found for other EGF structures (Doreleijers et al., 1998).
Description of the structure EGF domains Analysis of the final ensemble by PROCHECK-NMR indicated that each domain contains a major stretch of antiparallel (3-sheet containing the third and fourth Cys residues of each domain, as expected for an EGF-like fold, as well as an additional minor antiparallel 2o (3-sheet at the C-terminal end of domain-1, similar to some (but not all) EGF family members. These secondary structure features, together with the disulphide bonding patterns, can be seen in Figure 4. There is also a well-defined type II tight turn in domain-1, with a hydrogen bond from Tyr 34NH proton to Leu31 carbonyl oxygen. The normally conserved EGF consensus Gly residue in the tight turn is replaced in domain-1 by a residue with a positive ~ angle (Asn33), while the conserved aromatic residue is present (Tyr34). There is a probable hydrogen bond between Leu 31NH proton to AsnlS
carbonyl oxygen. Domain-2 contains two turns preceding the major ~3-sheet, (Asn53 -Cys56, Asp57 - A1a60), and a final bend from Leu86 - Phe91 with a probable hydrogen bond from Asp57 NH proton to the carbonyl oxygen of I1e90 or G1y89. A surface-exposed loop 3o from Pro81 to Pro85 replaces the tight turn, while the aromatic residue is not conserved.
The large loop at the end of the major b-sheet (G1u65 - Lys73) is relatively disordered, and high mobility for the segment G1y68 - G1y71 was confirmed by backbone amide 'SN{'H} heteronuclear NOE measurements (Barbato et al., 1992). The heteronuclear NOE
values are dramatically reduced for residues in this region. At the N-terminus: the low NOE intensities correspond to increased mobility compared with the rest of the protein.
The interdomain linker region from Pro45 to Pro47 is distinct from other EGF-like module pairs. The conformations of the disulphide bridges between Cys30 -Cys41 in domain-1, and the three Cys - Cys bonds in domain-2 are all left handed spirals (Richardson, 1981). Bridges between Cys30 - Cys4l, Cys56 - Cys76, and Cys78 -Cys92 are particularly close to their equivalents in the blood coagulation factor Xa structure (lhcg). The conformations of the first two disulphide bridges in the relatively disordered N-terminal segment of domain-1 were not determined.
Figure 5 shows the backbone C, N, Cn atom alignments of the two MSP-1 C-terminal fragment domains made with typical examples of EGF-like domains from several proteins, using the fitpdb program. Pairwise alignments showed that the two domains i 5 from MSP-1 are more similar to the factor Xa structure and its close relative from C 1 r, than to each other or to the other structures tested. The rmsd values for MSP-1 domains compared to factor Xa are comparable to those of the more distantly related structures fibrillin-1 and transforming growth factor-a.
2o The overall fold of each MSP-1 domain is thus similar to typical EGF family members, with the turns following the fifth Cys residue roughly equivalent, in spite of the divergence from the EGF consensus (C(5)xxGa) where a is a Phe or Tyr residue.
Although some of the external loops are disordered, the scaffold is quite stable, as indicated by the non-exchangeable backbone amides (see above and in Protein Data 25 Bank/BioMagResBank submission for details).
Unlike many EGF-like domains such as fibrillin-1, the MSP-1 C-terminal fragment lacks the conserved EGF Ca2+-binding sequence and there was no evidence of Ca2+
binding to the MSP-1 C-terminal fragment. The 2D 'H-NOESY spectra were virtually identical in 3o the absence or presence of 20 mM CaCl2, indicating that any binding that might occur has, at most, only a small affect the overall structure.
Domain interface crnd srrrface The most striking feature of the MSP-1 C-terminal fragment structure is the interface between the domains, which consists of several nonpolar amino acids (Phel9, Leu3l, Leu32, Leu86, Phe87, I1e90 and Phe91) involved in hydrophobic interactions.
These residues join the base of the major ~3-sheet and the tight turn in domain-1 with the final bend from residue 86 to 91 in domain-2. The domain interactions result in the domains forming a U-shaped structure which contrasts with structures observed for other pairs of EGF domains (Downing et al., 1996; Brandstetter et al., 1995). For example, in fibrillin-1, the interface between EGF domains 32 and 33 is largely formed by a shared 1 o Caz+ ligation site (Downing et al., 1996), and the overall structure resembles a rigid rod, with distant N- and C-termini. This contrasts with MSP-1 where the EGF-like domains are folded against each other so that their termini are relatively close together. A
comparison of fibrillin-l and MSP-1 EGF module pairs is shown in Figure 6.
Although both termini of the MSP-1 C-terminal fragment are somewhat disordered, NOE
contacts were observed between nuclei in the two ends. The proximity of the C- and N-terminal positions may be significant, since it suggests that the proteolytic processing site that produces the C-terminal 96 amino acid fragment may be very close to the GPI
membrane attachment site at or near residue 96. This proximity is consistent with the idea that a membrane-bound Plasmodiarm proteinase is responsible for secondary processing.
The electrostatic potential surface of the MSP-1 C-terminal fragment is shown in two views in Figure 7. The surface in Figure 7a is highly charged, especially in the protruding loop regions 23 - 27, 35 - 40 and 64 - 66. The surface in Figure 7b contains more neutral hydrophilic residues as well as a small hydrophobic patch from Pro85 - Phe87 near the center of the surface. In the future, such information could assist in understanding how these different surfaces may be involved in interactions with the rest of the precursor, the processing proteinase, other proteins on the merozoite surface, or unknown targets on the erythrocyte or parasite vacuolar membrane surfaces.
3o Primary sequence conservation The residues involved in the hydrophobic domain interface in P. falciparum are also shown in Figure 1, together with corresponding residues in MSP-1 of the less virulent human malaria parasite, P. vivax (Del Portillo et al., 1991; Gibson et al., 1992).
Extensive conservation of the interface residues (with conservative substitutions) suggests that P. vivax and perhaps other Plasmodium species as well, may have a similar U-shaped EGF module pair arrangement. Another feature of the P. vivax sequence, also seen in other Plasmodium species, is the single disulphide bond deficiency in the first EGF-like domain resulting from the absence of cysteine residues equivalent to the P.
falciparum Cysl2 and Cys28.
P. falciparum dimorphic sites Five dimorphic sites have been observed in the P. falciparum MSP-1 C-terminal fragment from different isolates (Qari et al., 1998). Several observations can be made about the position of these sites on the MSP-1 structure. Two sites, G1n14/G1u14 and Lys61/Thr6l, involve residues in relatively well-structured backbone regions, with surface-exposed hydrophilic or charged side-chains. A pair of adjacent sites, with the sequence variants Asn70 - G1y71/Ser70 - Arg7l, occurs in the disordered loop of domain-2, within a segment (residues 68 - 71 ) that has been shown to be highly mobile. The region from G1u65 to Lys73 also appears to be the most variable region among different Plasmodium 2o species (Daly et al., 1992; Holder et al., 1992). Finally, the fifth site has a substitution between hydrophobic residues (Leu86/Phe86). This partially-exposed side-chain is located at the hydrophobic domain interface, and the conservative substitution is consistent with a role in this interaction.
Example 2 - Mutation and Monoclonal Antibody Binding studies As a step towards understanding antibody interactions with the MSP-1 C-terminal fragment, the effect of engineered point mutations (within domain-1) on antibody binding has been studied. Amino acid substitutions were made that consisted of radical changes.
3o These radical changes consisted of, for example, replacing an aliphatic residue with a charged polar residue, replacing a positively charged side chain with a negatively charged side chain, replacing an amino acid with a large side chain with an amino acid with a smaller or no side chain (glycine), replacing a polar amino acid with a charged polar amino acid, replacing a polar amino acid with an aromatic amino acid, replacing a large aromatic amino acid with an amino acid with a small side chain, and replacing cysteine residues that are involved in disulphide bonds.
Four individual amino acid substitutions shown in Figure 8, each completely abolish binding of one or more mAbs to the mutant fragment, as detected by Western blotting.
The G1u26 mutation, shown in cyan, is closest to the N-terminal proteolytic processing site (magenta) at Asnl, and is the only one of this group of mutations that affects binding of a processing-inhibitory antibody, i.e. one that is capable of preventing both proteolytic processing of the MSP-1 precursor and erythrocyte invasion in vitro. The other three mutations abolish binding of blocking antibodies that bind to the native C-terminal fragment and interfere with the binding of processing-inhibitory antibodies.
~ 5 Additional mutations were made based on the immunochemical analyses and the tertiary structure of the molecule, and the binding of the mAbs was assessed by western blotting and BIAcore analysis. The results are summarised in Table 2. The results of the binding of selected mAbs to the modified proteins as detected by Western blotting are shown in Figure 9, and by BIAcore analysis in Figurel0. Some individual amino acid changes have 2o no effect on the binding of any of the mAbs tested (for example Leu22 to Arg). Other substitutions affect the binding of one or more mAbs.
Of particular interest are those changes that prevent the binding of blocking antibodies but have no effect on the binding of the inhibitory antibodies. For example, replacement of 25 AsnlS by Arg prevents the binding of mAb 7.5, replacement of G1u27 by Tyr prevents the binding of mAb 2.2, replacement of Leu31 by Arg prevents the binding of mAb 1 E 1, replacement of Tyr34 by Ser prevents the binding of mAb 7.5, and replacement of G1u43 by Leu prevents the binding of mAb 111.4.
3o Three combinations of substitutions that prevent the binding of blocking antibodies but do not affect the binding of inhibitory antibodies were made in single proteins.
In the first GIu27~Tyr, Leu31 ~Arg and G1u43-~Leu were combined, in the second G1u27~Tyr, Leu3l~Arg, Tyr34~Ser, and G1u43-~Leu were combined, and the third AsnlS~Arg, G1u27-~Tyr, Leu31-~Arg and G1u43-~Leu were combined. None of these modified proteins bound any of the blocking antibodies but continued to bind the inhibitory antibodies. We propose that the mutant proteins will induce a polyclonal response that is more inhibitory than that induced by the wild type protein. This will be tested by immunising mice and rabbits with both the wild type and mutant proteins and comparing the ability of the induced antibodies to inhibit secondary processing.
The modified recombinant proteins will also be used to affinity select antibodies from 1o pooled serum from individuals exposed to malaria. We hypothesise that the modified proteins will select less blocking antibody than the wild type protein and that therefore these selected antibodies will be more effective in inhibiting parasite invasion in vitro and secondary processing.
In the first EGF-like domain of MSP-1 from the rodent, primate and P. vivar malaria parasites, cysteines 2 and 4 are not present. We have replaced this cysteine pair (Cys 12 and Cys28) in the P. falciparum protein. This does not have appear to have any effect on the binding of any of the inhibitory antibodies, but does abolish the binding of the blocking antibody mAb 2.2. We propose that one reason why the proteins from these other malaria parasites are more immunogenic is that T cell recognition is more effective or that processing by antigen processing cells proceeds by a different degradation pathway that drives the fine specificity of the antibody response in a more productive direction (see for example Egan et al., 1997). Removal of the cysteine pair may improve the immunogenicity of the modified protein and this will be assessed by measuring the level of antibodies induced by the P. falciparum protein without the two cysteines with the level of antibodies induced by the wild type protein.
++ + + ++ ++
+
N
V1 ++ + + + ++ ++
N
+ + +
++ + + + ++ ++
~
_ b O
N
++ + + + ++ n+
~r O N + + + + + + +
O
U
+
U ~ + + + ++
+ + + +
To assist in the design of candidate vaccine polypeptides fulfilling these three criteria, it is important to determine the three-dimensional structure of the MSP-1 C-terminal fragment since this will help in mapping sites of antibody interactions with this fragment. We have therefore determined the solution structure of the MSP-1 C-terminal, including the pattern of disulphide bonding, using NMR techniques.
We have made amino acid substitutions in the sequence of MSP-l,~ that prevent the binding of individual blocking monoclonal antibodies, without affecting the binding of neutralising antibodies. By determining the 3-dimensional structure of MSP-1,9 we have identified where these antibody binding sites are located in the tertiary structure and this has allowed other amino acid substitutions to be made that have similar properties. We have shown that several substitutions, each affecting the binding of one or more blocking antibodies can be combined into a single molecule, and that these modified molecules 3o continue to bind the neutralising antibodies but fail to bind any of the blocking antibodies.
Such modified molecules are expected to be much more effective than the natural or wild-type protein structure at inducing a protective neutralising antibody response when used to immunise individuals as a malaria vaccine. In addition we have made other modifications in the primary structure of the molecule which do not affect the binding of the neutralising antibodies but which may contribute to increased immunogenicity of the molecule. The modified MSP-l,~ structures, either alone or coupled to other carriers, which may or may not contain other parts of MSP-1 to enhance the immunogenicity (for example a combination of the remainder of the MSP-l~z kDa fragment with the modified MSP-1,9) and provide additional T cell epitopes, would be more effective vaccines than equivalent structures that have not been modified in this way.
1 o Accordingly, the present invention provides a non-naturally occurring variant of a C-terminal fragment of a Plasmodium merozoite surface protein-1 (MSP-1) wherein said variant has (i) a reduced affinity, compared with a naturally occurring Plasmodium MSP-1,9, for at least one first antibody capable of blocking the binding of a second antibody, which second antibody inhibits the proteolytic cleavage of Plasmodium MSP-14z and (ii) substantially the same affinity for said second antibody compared with said naturally occurring Plasmodium MSP-1,9.
Preferably, the Plasmodium MSP-1,9 and MSP-14z are Plasmodium falciparum MSP-1,~
and MSP-14z.
The first antibody is preferably selected from mAbs 2.2, 7.5 and 111.4. The second antibody is preferably selected from mAbs 12.8, 12.10 and SB 1.
The present invention further provides a non-naturally occurring variant of a C-terminal fragment of a Plasmodium merozoite surface protein-1 (MSP-1) comprising an amino acid modification at any one of amino acid residues 15, 27, 31, 34 and 43 of the Plasmodium falciparum MSP-1,9 amino acid sequence shown as SEQ LD. No. 1 or their equivalent positions in other Plasmodium MSP-1,9 polypeptides.
3o Preferably said modifications are substitutions selected from AsnlS->Arg, G1u27->Tyr, Leu31 ~Arg, Tyr34~Ser, Tyr34~Gly and G1u43-~Leu and their equivalents in other Plasmodium MSP-1,9 polypeptides. More preferably said substitutions are combinations _8_ of substitutions elected from [G1u27-~Tyr, Leu31 ~Arg and G1u43-~Leu], [G1u27--~Tyr, Leu31-~Arg, Tyr34-~Ser and G1u43~Leu], [AsnlS~Arg, G1u27~Tyr, Leu3l~Arg and G1u43~Leu) and their equivalents in other Plasmodium MSP-1,~ polypeptides.
In a preferred embodiment, a variant MSP-1 polypeptide of the invention further comprises a mutation at Cysl2 and/or Cys28 of the Plasmodium falciparum MSP-1,~
amino acid sequence shown as SEQ LD. No. 1.
The present invention also provides a method for producing a Plasmodium MSP-1 variant 1o for use in preparing a vaccine composition which method comprises modifying one or more amino acid residues of a Plasmodium MSP-1 C-terminal fragment such that the resulting derivative has (i) a reduced affinity, compared with a naturally occurring Plasmodium MSP-1,9, for at least one first antibody capable of blocking the binding of a second antibody, which second antibody inhibits the proteolytic cleavage of Plasmodium MSP-142 and (ii) substantially the same affinity for said second antibody compared with said naturally occurring Plasmodium MSP-1,~. In particular the method of the invention preferably comprises as a preliminary step, selecting a candidate amino acid residue by reference to a three dimensional NMR model structure, preferably as set out in Table 2.
More specifically, the 3D model structure is used to select a surface exposed amino acid 2o residue. Advantageously, a fiuther step is included of computer modelling the three dimensional structure of the variant to exclude polypeptides that do not fold correctly.
The present invention also provides a non-naturally occurring Plasmodium MSP-1 variant obtained by the method of the invention.
In a further aspect, the present invention provides a polynucleotide encoding a variant of the invention operably linked to a regulatory sequence capable of directing the expression of said nucleotide in a host cell. Also provided is a nucleic acid vector comprising a polynucleotide of the invention, including viral vectors, and a host cell comprising a 3o nucleotide or vector of the invention.
In another aspect, the present invention provides a pharmaceutical composition comprising a variant of the invention, a polynucleotide of the invention or a vector of the invention together with a pharmaceutically acceptable carrier or diluent.
Preferably, the composition further comprises an immunogenic Plasmodium polypeptide or fragment or derivative thereof such as MSP-133 or a fragment or derivative thereof. It is preferred not to use wild-type MPS-l,9 sequences.
The present invention also provides a method for producing anti-MSP-1 antibodies which to method comprises administering a polypeptide variant of the invention, or a polynucleotide of the invention or a vector of the invention to a mammal, typically a non-human mammal.
In a preferred embodiment, the present invention provides a method for producing polyclonal anti-MSP-1 antibodies which method comprises adminstering a polypeptide variant of the invention, or a polynucleotide of the invention or a vector of the invention to a mammal, typically a non-human mammal, and extracting the serum from said mammal. Also provided is an antibody produced by the said methods.
2o The polypeptides, nucleotides and vectors of the present invention may be used in methods of treating and/or preventing malaria caused by Plasmodium species, in particular Plasmodium falciparum. Accordingly, the present invention provides a method of inducing immunity against malaria induced by Plasmodium falciparum which comprises administering to a person in need of such immunity an effective amount of a variant, a polynucleotide or a vector of the invention.
Also provided is a method of immunizing a mammal, said method comprising administering an effective amount of a variant, a polynucleotide or a vector of the invention. In particular, said mammal is immunized against malaria. Preferably the 3o mammal is a human.
The present invention also provides a method of treating a malaria infection in a human patient which comprises administering to the patient an effective amount of the pharmaceutical composition of the invention.
Detailed descrit~tion of the invention Although in general the techniques mentioned herein are well known in the art, reference may be made in particular to Sambrook et al., Molecular Cloning, A Laboratory Manual (1989) and Ausubel et al., Current Protocols in Molecular Biology (1995), John Wiley &
to Sons, Inc.
A. MSP-1 variant polypeptides The variant MSP-1 polypeptides of the present invention will be described with reference to Plasmodium falciparum MSP-1 amino acid sequences. However, it should be appreciated that except where otherwise stated, all references to MSP-1 polypeptides include homologues of MSP-1 found in other Plasmodium species, such as P.
vivax, P. malariae and P. ovale which all infect humans and P. yoelli which infects mice.
The variant MSP-1 polypeptides of the present invention are based on C-terminal fragments of the Plasmodium.falciparum MSP-I4z polypeptide shown as SEQ LD.
No. 2.
Such polypeptides will comprise some or all of the MSP-1,9 region (SEQ LD. No.
1), preferably at least substantially all of the domain 1 and/or domain 2 EGF-like sequences found in MSP-1,9 (approximately amino acids 1-47 and amino acids 48-96, respectively, of SEQ LD. No. 1). It is particularly preferred to use regions that are conserved in most, more preferably all parasites of a single species to increase the effectiveness of the variant as a vaccine against a wide range of strains.
Variant MSP-1 polypeptides of the present invention comprise modifications to their 3o primary amino acid sequence that reduce the ability of blocking antibodies to bind to the MSP-1 polypeptides. In addition, any modifications made should maintain epitopes recognised by neutralising antibodies such that the affinity of the neutralising antibodies for the MSP-1 variant is substantially the same as for naturally-occurring MSP-polypeptides (such as an MSP-14, polypeptide having the sequence shown in SEQ
LD.
No. 2). Some reduction in the binding of some neutralising antibodies may be tolerated since the primary objective is to inhibit the binding of blocking antibodies and it is likely that an effective reduction in the binding of blocking antibodies will compensate in terms of overall vaccine efficacy for a small reduction in neutralising antibody binding.
Neutralising antibodies in the context of the present invention are antibodies that inhibit malaria parasite replication. A variety of neutralising antibodies, polyclonal and I o monoclonal, are known in the art, including mAbs 12.8, 12.10 and 5B 1 referred to in the Examples. The activity of neutralising antibodies can be determined in a variety of ways that have been described in the art. For example, a convenient assay method described in Blackman et al., 1994 involves using preparations of merozoites (Blackman et al., 1993;
Mrema et al., 1982) to measure cleavage of MSP-14~ into MSP-133 and MSP-1,~.
Briefly, freshly isolated merozoites are washed in ice-cold buffer and divided up into aliquots of about 2x109 merozoites. A test antibody is added to each aliquot and the sample incubated at 37°C for 1 hour. The samples are then subjected to SDS-PAGE under non-reducing conditions on a 12.5% polyacrylamide gel, Western blotted and the blot probed with antiserum to MSP-133. In the control sample, two main bands are seen -one 2o corresponding to MSP-142 and one lower molecular weight band corresponding to MSP-133. Neutralising antibodies will reduce the amount of the lower molecular weight band as a result of inhibiting secondary proteolytic processing of MSP-14,.
This method is a particularly preferred method for assessing the efficacy of neutralising antibodies in the presence of antibodies believed to act as blocking antibodies. Where candidate competing blocking antibodies are to be tested, the merozoite sample is preincubated with a blocking antibody for 15 mins on ice prior to incubation with a neutralising antibody at 37°C for 1 hour as described above. Thus blocking antibodies can readily be identified and/or characterised using such an assay method.
Other assay methods include merozoite invasion inhibition tests as described in Blackman et al., 1982.
As discussed above, blocking antibodies are defined in the context of the present invention as antibodies that inhibit the binding of neutralising antibodies to MSP-1 but which do not themselves inhibit invasion of red blood cells by malaria parasites. Thus they "block" the neutralising function of the neutralising antibodies. A
variety of blocking antibodies have been characterised in the art, including mAbs 2.2, 7.5 and 111.2 referred to in the Examples. As discussed above, blocking antibodies can conveniently be identified and/or characterised using assays that test their effect on neutralising antibody function.
to Modifications that may be made to produce MSP-1 variants of the invention include substitutions, deletions and insertions. It is particularly preferred to use substitutions to minimise disruption of the secondary/tertiary structure of the polypeptide.
Furthermore, particularly preferred substitutions are those that replace one class of amino acid with another class, such as an aliphatic non-polar residue with a charged polar residue. For example, the twenty naturally occurring amino acids may be divided into four main groups (aliphatic non-polar [G, A, P, I, L and V], aliphatic polar un-charged [C, S, T, M, N and Q], aliphatic polar charged [D, E, K and R] and aromatic [H, F, W and Y]) and it is preferred to replace an amino acid from one group with an amino acid from another 2o group.
Other possibilities include replacing a positively charged side chain with a negatively charged side chain, replacing an amino acid with a large side chain with an amino acid with a smaller or no side chain (glycine), replacing a polar amino acid with a charged polar amino acid, replacing a large aromatic amino acid with an amino acid with a small side chain, and replacing cysteine residues that are involved in disulphide bonds.
Particularly preferred modifications are an amino acid modification at any one of amino acid residues 15, 27, 31, 34 and 43 of the Plasmodium falciparum MSP-1,~ amino acid 3o sequence shown as SEQ LD. No. 1 or their equivalent positions in other Plasmodium MSP-1,9 polypeptides. These residues are all within the EGF-like domain 1. It is known that the epitopes of some antibodies contain amino acid sequences that are within EGF-like domain 2, therefore equivalent modifications may also be made in EGF-like domain 2. Preferred examples of modifications include the following substitutions AsnlS-~Arg, G1u27~Tyr, Leu31-~Arg, Tyr34~Ser, Tyr34~Gly and/or G1u43~Leu and their equivalents in other Plasmodium MSP-1,~ polypeptides.
It is especially preferred to carry out more than one modification, i.e. to use combinations of modifications, such as two or more or three or more. In a preferred embodiment, an MSP-1 variant of the invention comprises a combination of amino acid substitutions selected from [G1u27~Tyr, Leu31-~Arg and G1u43~Leu], [G1u27~Tyr, Leu3l~Arg, to Tyr34~Ser and G1u43-~Leu], [AsnlS~Arg, G1u27-~Tyr, Leu31-~Arg and G1u43-~Leu] and their equivalents in other Plasmodium MSP-119 polypeptides.
A particularly preferred combination further comprises a modification to Cysl2 and/or Cys28 (and/or their equivalent residues in EGF-like domain 2) to disrupt the disulphide bond.
Substitutions are not confined to using naturally occurring amino acids - non-naturally occurring amino acid analogues may also be used, in particular where solid phase synthesis is to be used to chemically synthesise the variant, as opposed to recombinant 2o technology.
Modifications to MSP-1 amino acid sequences may be carried out using standard techniques such as site-directed mutagenesis using the polymerase chain reaction.
Alternatively, variants may be obtained by solid phase synthetic techniques.
To determine whether a variant MSP-1 polypeptide produced by modification of its primary amino acid sequence complies with the criteria specified above, the affinity of at least one neutralising antibody and at least one blocking antibody for the variant polypeptide compared with the naturally occurnng MSP-1 sequence may be tested.
3o Ideally more than one of each type of antibody should be used, for example two or three.
The ability of antibodies to bind to the variant and wild-type polypeptides may be determined using any one of a variety of methods available in the art for determining antibody-epitope binding. One such method, described in the Examples, involves the use of MSP-1 sequences expressed as fusion proteins with a protein tag such as glutathione-S-transferase (GST). These GST-fusion proteins are typically immobilised to a solid phase such as glutathione sepharose beads or a BIAcore sensor chip. Binding of antibodies, such as monoclonal antibodies, to the fusion proteins may be determined using standard techniques such as Western blotting and/or by labelling the antibodies with a radioactive label such as ''SI. The use of BIAcore technology allows easy quantitation of the results.
to Preferably, the reduction in binding of at least one of the blocking antibodies tested is at least 50% compared to wild-type MSP-1, more preferably at least 75, 80 or 90%, typically as assessed using recombinantly expressed MSP-1 immobilised to a BIAcore sensor chip.
By contrast, the binding of at least one, for example at least two or three, of the neutralising antibodies tested, more preferably at least half of the neutralising antibodies tested, more preferably substantially all of the neutralising antibodies tested is reduced by less than 50%, more preferably less than 25%. The number of neutralising antibodies that need be tested to confirm compliance with the test criteria will not typically exceed from three to five different antibodies (three antibodies are used in the Examples). In a 2o particularly preferred embodiment the binding of at least one neutralising antibody is increased by at least 10%.
The results given in Table 2 in the Examples provide partial guidance to the skilled person as to which residues may be modified to produce a variant MSP-1 of the invention.
However, the provision herein for the first time of the three dimensional solution structure of MSP-I,9 provides the skilled person with further detailed guidance as to which residues may be altered. In particular, epitopes are expected to be exposed to the aqueous environment on the exterior of the MSP-1,9 fragment. Consequently, the precise structural information provided which teaches the position of surface exposed amino acids 3o allows the skilled person to target those residues for modification. This data is given in Tables A/B and has also been submitted to the BioMagRes Bank (accession no. ~.
It enables the skilled person to identify the precise location of individual amino acids in the three dimensional structure. Typically, the data is loaded into suitable software, well-known in the art such as Insight II, MOLSCRIPT and GRASP.
Further, knowing the location of a modification in the 3-dimensional structure which affects the binding of a blocking antibody without affecting the binding of the neutralising antibodies, it is possible to identify other. residues that are on the surface and in the vicinity of the original modification and which may be easily modified to further improve the properties of a modified protein. These residues may be in either the first or the second EGF-like motifs or in the sequence between them. Since it is known that an antibody to binding site can encompass a volume that corresponds approximately to the range of 5 to 8 amino acids, it is clear that modifications of these adjacent residues may also affect the affinity of the protein for the blocking antibodies. Once an adjacent amino acid has been identified it can be modified according to the principles outlined above and the contribution of the modification to the overall antigenicity and immunogenicity of the protein, either alone or in combination with other modifications, can be assessed. Those changes that contribute to a reduced affinity for the blocking antibodies, without a substantial affect on binding of the neutralising antibodies can be incorporated into the improved protein. This can be a reiterative process.
2o In addition, the 3D NMR structure will enable the skilled person to carry out preliminary computer modelling studies of MSP-1,9 variants with specific modifications so that, for example variants that cannot fold properly may be discarded. This will assist in minimising the number of candidate MSP-1,~ variants that need be tested.
Thus the present invention also provides a computer readable medium having stored thereon a model of the MSP-1,9 NMR structure. In a preferred embodiment, said model is built from all or some of the NMR data shown in Tables A and B.
Variants of the present invention may optionally include additional MSP-1 sequences, in 3o particular regions of the MSP-13~ region of MSP-14z to confer additional immunogenicity to the variant. Furthermore, additional sequences known to contain and promote T cell responses are advantageously included (i.e. T cell epitopes). Other modifications may also be made that increase immunogenicity such as modifications that alter the pathway of antigen processing and presentation.
Polypeptide variants of the invention are typically made by recombinant means, for example as described below. However they may also be made by synthetic means using techniques well known to skilled persons such as solid phase synthesis.
Proteins of the invention may also be produced as fusion proteins, for example to aid in extraction and purification. Examples of fusion protein partners include glutathione-S-transferase (GST), 6xHis, GAL4 (DNA binding and/or transcriptional activation domains) and (3-galactosidase. It may also be convenient to include a proteolytic cleavage site between the fusion protein partner and the protein sequence of interest to allow removal of fusion protein sequences. Preferably the fusion protein will not hinder the immunogenicity of the MSP-1 variant.
Polypeptides of the invention may be in a substantially isolated form. It will be understood that the polypeptide may be mixed with carriers or diluents which will not interfere with the intended purpose of the polypeptide and still be regarded as substantially isolated. A polypeptide of the invention may also be in a substantially purified form, in which case it will generally comprise the polypeptide in a preparation in 2o which more than 90%, e.g. 95%, 98% or 99% of the polypeptide in the preparation is a polypeptide of the invention.
B. Polynucleotides and vectors As discussed above, the variants of the present invention may be produced recombinantly using standard techniques. Thus, the present invention also provides a polynucleotide encoding a polypeptide MSP-I variant of the invention. Polynucleotides of the invention may comprise DNA or RNA. They may also be polynucleotides which include within them synthetic or modified nucleotides. A number of different types of modification to oligonucleotides are known in the art. These include methylphosphonate and phosphorothioate backbones, addition of acridine or polylysine chains at the 3' and/or 5' ends of the molecule. For the purposes of the present invention, it is to be understood that _ l 7_ the polynucleotides described herein may be modified by any method available in the art.
Such modifications may be carried out in order to enhance the in vivo activity or life span of polynucleotides of the invention. It will be understood by a skilled person that numerous different polynucleotides can encode the same polypeptide as a result of the degeneracy of the genetic code.
Polynucleotides of the invention comprise can be incorporated into a recombinant replicable vector. The vector may be used to replicate the nucleic acid in a compatible host cell. Thus in a further embodiment, the invention provides a method of making 1o polynucleotides of the invention by introducing a polynucleotide of the invention into a replicable vector, introducing the vector into a compatible host cell, and growing the host cell under conditions which bring about replication of the vector. The vector may be recovered from the host cell. Suitable host cells include bacteria such as E.
coli, yeast, mammalian cell lines and other eukaryotic cell lines, for example insect Sfi7 cells.
Preferably, a polynucleotide of the invention in a vector is operably linked to a regulatory sequence that is capable of providing for the expression of the coding sequence by the host cell, i.e. the vector is an expression vector. The term "operably linked"
refers to a juxtaposition wherein the components described are in a relationship permitting them to 2o function in their intended manner. A regulatory sequence "operably linked"
to a coding sequence is ligated in such a way that expression of the coding sequence is achieved under condition compatible with the control sequences.
Such vectors may be transformed or transfected into a suitable host cell using standard techniques above to provide for expression of a polypeptide of the invention.
This process may comprise culturing a host cell transformed with an expression vector as described above under conditions to provide for expression by the vector of a coding sequence encoding the polypeptides, and optionally recovering the expressed polypeptides.
The vectors may be for example, plasmid or virus vectors provided with an origin of replication, optionally a promoter for the expression of the said polynucleotide and _18_ optionally a regulator of the promoter. The vectors may contain one or more selectable marker genes, for example an ampicillin resistance gene in the case of a bacterial plasmid or a neomycin resistance gene for a mammalian vector. Vectors may be used in vitro, for example for the production of RNA or used to transfect or transform a host cell. The vector may also be adapted to be used in vivo, for example in a method of gene therapy.
Promoters/enhancers and other expression regulation signals may be selected to be compatible with the host cell for which the expression vector is designed. For example, prokaryotic promoters may be used, in particular those suitable for use in E.
coli strains (such as E. coli HB141 or DHSa).
When expression of the polypeptides of the invention in carried out in mammalian cells, either in vitro or in vivo, mammalian promoters may be used. Tissue-specific promoters may also be used. Viral promoters may also be used, for example the Moloney marine leukaemia virus long terminal repeat (MMLV LTR), the promoter rous sarcoma virus (RSV) LTR promoter, the SV40 promoter, the human cytomegalovirus (CMV) IE
promoter, herpes simplex virus promoters or adenovirus promoters. All these promoters are readily available in the art.
2o C. Administration The variant MSP-1 polypeptides of the present invention and nucleic acid molecules may be used to treat or prevent malaria in animals, specifically humans.
The polypeptides of the invention may be administered by direct injection.
Preferably the polypeptides are combined with a pharmaceutically acceptable carrier or diluent to produce a pharmaceutical composition. Suitable carriers and diluents include isotonic saline solutions, for example phosphate-buffered saline. The composition may be formulated for parenteral, intramuscular, intravenous, subcutaneous, intraocular or 3o transdermal administration. Typically, each polypeptide is administered at a dose of from 0.01 to 30 p.g/kg body weight, preferably from 0.1 to 10 pg/kg, more preferably from 0.1 to 1 pg/kg body weight. It is also possible to use antibodies prepared using the polypeptides of the invention, as described below, in treating or preventing Plasmodium infection. Neutralising antibodies, or fragments thereof which retain specificity for Plasmodium antigens, can be administered in a similar manner to the polypeptides of the invention.
The polynucleotides of the invention may be administered directly as a naked nucleic acid construct. When the expression cassette is administered as a naked nucleic acid, the amount of nucleic acid administered is typically in the range of from 1 ~g to 10 mg, preferably from 100 qg to 1 mg.
to Uptake of naked nucleic acid constructs by mammalian cells is enhanced by several known transfection techniques for example those including the use of transfection agents.
Example of these agents include cationic agents (for example calcium phosphate and DEAE-dextran) and lipofectants (for example lipofectamT°'' and transfectamT'~'').
Typically, nucleic acid constructs are mixed with the transfection agent to produce a composition.
Alternatively, the polynucleotide may be administered as part of a nucleic acid vector, including a plasmid vector or viral vector, such as a vaccinia virus vector.
When the 2o polynucleotide of the invention is delivered to cells by a viral vector of the invention, the amount of virus administered is in the range of from 103 to 101° pfu, preferably from 105 to 10$ pfu, more preferably from 106 to 10~ pfu. When injected, typically 1-10 pl of virus in a pharmaceutically acceptable suitable carrier or diluent is administered.
Preferably the delivery vehicle (i.e. naked nucleic acid construct or viral vector comprising the polynucleotide for example) is combined with a pharmaceutically acceptable carrier or diluent to produce a pharmaceutical composition.
Suitable carriers and diluents include isotonic saline solutions, for example phosphate-buffered saline. The composition may be formulated for parenteral, intramuscular, intravenous, subcutaneous, 3o intraocular or transdermal administration.
The routes of administration and dosages described are intended only as a guide since a skilled practitioner will be able to determine readily the optimum route of administration and dosage for any particular patient and condition.
D. Preparation of Vaccines Vaccines may be prepared from one or more polypeptides of the invention. They may also include one or more immunogenic Plasmodium polypeptides known in the art.
Thus a vaccine of the invention may comprise one or more polypeptides of the invention and I o optionally, one or more polypeptides selected from, for example, the asexual blood stage proteins: apical merozoite antigen-1, erythrocyte binding antigen 175, erythrocyte membrane protein-1; the hepatic stage proteins: liver stage antigens 1 and 3;
the sporozoite stage proteins: circumsporozoite protein , thrombospondin related adhesive protein; and the sexual stage proteins Pfs25 and Pfs28 polypeptides and immunogenic fragments thereof. Preferably, the other immunogenic Plasmodium polypeptides known in the art do not contain wild type MSP-1,9 sequences.
The preparation of vaccines which contain an immunogenic polypeptide(s) as active ingredient(s), is known to one skilled in the art. Typically, such vaccines are prepared as 2o injectables, either as liquid solutions or suspensions; solid forms suitable for solution in, or suspension in, liquid prior to injection may also be prepared. The preparation may also be emulsified, or the protein encapsulated in liposomes. The active immunogenic ingredients are often mixed with excipients which are pharmaceutically acceptable and compatible with the active ingredient. Suitable excipients are, for example, water, saline, dextrose, glycerol, ethanol, or the like and combinations thereof. In addition, if desired, the vaccine may contain minor amounts of auxiliary substances such as wetting or emulsifying agents, pH buffering agents, and/or adjuvants which enhance the effectiveness of the vaccine. Examples of adjuvants which may be effective include but are not limited to: aluminum hydroxide, N-acetyl-muramyl-L-threonyl-D-isoglutamine (thr-MDP), N-acetyl-nor-muramyl-L-alanyl-D-isoglutamine (CGP 11637, referred to as nor-MDP), N-acetylmuramyl-L-alanyl-D-isoglutaminyl-L-alanine-2-(1'-2'-dipalmitoyl-sn-glycero-3-hydroxyphosphoryloxy)-ethylamine (CGP 19835A, referred to as MTP-PE), and RIBI, which contains three components extracted from bacteria, monophosphoryl lipid A, trehalose dimycolate and cell wall skeleton (MPL+TDM+CWS) in a 2%
squalene/Tween 80 emulsion. The effectiveness of an adjuvant may be determined by measuring the amount of antibodies directed against an immunogenic polypeptide containing an MSP-1 antigenic sequence resulting from administration of this polypeptide in vaccines which are also comprised of the various adjuvants.
The vaccines are conventionally administered parenterally, by injection, for example, either subcutaneously or intramuscularly. Additional formulations which are suitable for other modes of administration include suppositories and, in some cases, oral formulations.
For suppositories, traditional binders and carriers may include, for example, polyalkylene glycols or triglycerides; such suppositories may be formed from mixtures containing the active ingredient in the range of 0.5% to 10%, preferably 1% to 2%. Oral formulations include such normally employed excipients as, for example, pharmaceutical grades of mannitol, lactose, starch, magnesium stearate, sodium saccharine, cellulose, magnesium carbonate, and the like. These compositions take the form of solutions, suspensions, tablets, pills, capsules, sustained release formulations or powders and contain 10% to 95%
of active ingredient, preferably 25% to 70%. Where the vaccine composition is lyophilised, the lyophilised material may be reconstituted prior to administration, e.g. as a 2o suspension. Reconstitution is preferably effected in buffer Capsules, tablets and pills for oral administration to a patient may be provided with an enteric coating comprising, for example, Eudragit "S", Eudragit "L", cellulose acetate, cellulose acetate phthalate or hydroxypropylmethyl cellulose. These capsules may be used as such, or alternatively, The polypeptides of the invention may be formulated into the vaccine as neutral or salt forms. Pharmaceutically acceptable salts include the acid addition salts (formed with free amino groups of the peptide) and which are formed with inorganic acids such as, for 3o example, hydrochloric or phosphoric acids, or such organic acids such as acetic, oxalic, tartaric and malefic. Salts formed with the free carboxyl groups may also be derived from inorganic bases such as, for example, sodium, potassium, ammonium, calcium, or ferric hydroxides, and such organic bases as isopropylamine, trimethylamine, 2-ethylamino ethanol, histidine and procaine.
E. Dosage and Administration of Vaccines The vaccines are administered in a manner compatible with the dosage formulation, and in such amount as will be prophylactically and/or therapeutically effective. The quantity to be administered, which is generally in the range of 5 ~g to 250 pg of antigen per dose, depends on the subject to be treated, capacity of the subject's immune system to synthesise antibodies, and the degree of protection desired. Precise amounts of active ingredient required to be administered may depend on the judgement of the practitioner and may be peculiar to each subject.
The vaccine may be given in a single dose schedule, or preferably in a multiple dose schedule. A multiple dose schedule is one in which a primary course of vaccination may be with 1-10 separate doses, followed by other doses given at subsequent time intervals required to maintain and or reinforce the immune response, for example, at 1 to 4 months for a second dose, and if needed, a subsequent doses) after several months.
The dosage regimen will also, at least in part, be determined by the need of the individual and be dependent upon the judgement of the practitioner.
In addition, the vaccine containing the immunogenic MSP-1 antigens) may be administered in conjunction with other immunoregulatory agents, for example, immunoglobulins.
F. Preparation of antibodies against the polypeptides of the invention The variant MSP-1 polypeptides prepared as described above can be used to produce antibodies, both polyclonal and monoclonal. If polyclonal antibodies are desired, a 3o selected mammal (e.g., mouse, rabbit, goat, horse, etc.) is immunised with an immunogenic polypeptide bearing an MSP-1 epitope(s). Serum from the immunised animal is collected and treated according to known procedures. If serum containing polyclonal antibodies to an MSP-1 epitope contains antibodies to other antigens, the polyclonal antibodies can be purified by immunoaffinity chromatography.
Techniques for producing and processing polyclonal antisera are known in the art.
Monoclonal antibodies directed against MSP-1 epitopes in the polypeptides of the invention can also be readily produced by one skilled in the art. The general methodology for making monoclonal antibodies by hybridomas is well known. Immortal antibody-producing cell lines can be created by cell fusion, and also by other techniques such as direct transformation of B lymphocytes with oncogenic DNA, or transfection with 1o Epstein-Barr virus. Panels of monoclonal antibodies produced against MSP-1 epitopes can be screened for various properties; i.e., for isotype and epitope affinity.
Antibodies, both monoclonal and polyclonal, which are directed against MSP-1 epitopes are particularly useful in diagnosis, and those which are neutralising are useful in passive immunotherapy. Monoclonal antibodies, in particular, may be used to raise anti-idiotype antibodies. Anti-idiotype antibodies are immunoglobulins which carry an "internal image" of the antigen of the infectious agent against which protection is desired.
Techniques for raising anti-idiotype antibodies are known in the art. These anti-idiotype 2o antibodies may also be useful for treatment of Plasmodium infections, as well as for an elucidation of the immunogenic regions of MSP-1 antigens. It is also possible to use fragments of the antibodies described above, for example, F(ab')Z, Fab, Facb and scFv fragments.
It should be appeciated that features from various sections, aspects and embodiments of the invention as described above are generally equally applicable to other sections, aspects and embodiments mutatis mutandis.
The invention will now be further described by way of Examples, which are meant to 3o serve to assist one of ordinary skill in the art in carrying out the invention and are not intended in any way to limit the scope of the invention. The Examples refer to the Figures. In the Figures:
_24_ Detailed Description of the Figures Figure 1 - MSP-1 sequences aligned according to the EGF-like motif consensus.
Top sequence: P. falciparum (SWISS-PROT MSP1 PLAFW). Second sequence: P. vivax Belem strain (PIR A45604). Third sequence: human EGF (PDB 1 egf). Fourth sequence:
EGF-like domain consensus (Prosite EGF1). Bottom sequence: 14 residue EGF core region used for structure alignment in Figure 6. Black highlighting indicates conserved residues of the EGF-like domain. Dark shading shows hydrophobic residues at the EGF-module pair interface in the P. falciparum, and corresponding conserved residues in the P. vivax sequence.
Figure 2 - Sample of multidimensional heteronuclear NOESY experiments showing planes containing NOE connections to the MSP-1 C-terminal fragment Lys35 NH
proton.
~5 Top: '3C (D4) and 'H(D3) plane from the 4D-['3C]-HMQC-NOESY-['SN]-HSQC
experiment, taken at the chemical shift values of Lys35 NH in 'SN(D2) and 'H(Dl).
Bottom: strip from the 3D ['SN]-NOESY-HSQC at the 'H chemical shift value of Lys35 NH (vertical axis, D1) taken at the plane of its'SN (D3) value. The horizontal'H axis is aligned with that of the top spectrum. The weak cross-peaks at 2.72 and 3.01 ppm in the 20 3D spectrum do not show corresponding cross-peaks in the 4D spectrum because of the lower signal-to-noise ratio in the latter. These peaks have been assigned as the cross-peaks between Lys35 NH and Asn44 Hpz (2.72 ppm), and Cys30 Ha3 and/or Cys41 Haz (3.01 Ppm) 25 Figure 3 - Stereo drawing showing the backbone C, N, Ca atoms of the 32 refined structures in the final ensemble. The domain-1 is on the left (red), with domain-2 on the right (green), and both the N- and C-termini are near the bottom.
Figure 4 - MOLSCRIPT picture of the most representative model of the ensemble, 3o showing the backbone Ca trace, antiparallel (3-sheet elements, and disulphide bridges (SY
atoms in yellow). Domain-1, red; Domain-2, green.
Figure 5 - Alignment of typical EGF-like family members with the fitpdb program, using the 14 amino acid "reduced core" consensus (Bersch et al., 1998) (see Figure 1). The aligned backbone segment in each structure is white. The structures are aligned relative to the most representative structure of the group (factor Xa), with increasing divergence from left to right. Numbers indicate the rmsd value of the aligned C, N, Cu atoms.
PDB
identification codes: factor Xa (crystal structure), 1 hcg; Complement C 1 r component, lapq (14''' model); human EGF, legf (11''' model); fibrillin-1, domains-32 and -33, lemn (minimized average structure); transforming growth factor-a, 2tgf (minimized average structure); MSP-1 domains-1 and -2, this study.
to Figure 6 - Backbone ribbon view of fibrillin-1 versus MSP-1 EGF module pair arrangements. Fibrillin-1 (lemn) cyan (domain-32) and magenta (domain-33) (Downing et al., 1996); MSP-1 domain-1 (yellow) and domain-2 (green). Structures were aligned as in Figure 6 by the core consensus of the N-terminal domain of each pair. The bound Ca'-+
ions in the fibrillin-1 structure are shown as magenta spheres.
Figure 7 - Two views, a and b, (rotated 180° about the y-axis) of the electrostatic potential surface of the MSP-1 EGF module pair, calculated with GRASP. Red indicates negative charge, blue indicates positive charge, and white is neutral. The orientation of the views 2o is shown by the adjacent worm diagrams.
Figure 8 - CPK model of the MSP-1 C-terminal fragment, showing the location of some mutations that affect binding of monoclonal antibodies. Domain-1 is towards the top and right sides, and domain-2 towards the bottom left.
Figure 9 - Examples of the binding of monoclonal antibodies to GST-MSP-1,~
detected by Western blotting. The binding of each monoclonal antibody to protein based on the wild type sequence and to proteins containing modified sequences is shown. The monoclonal antibodies are shown across the top. On the left is shown the proteins: WT, wild type 3o sequence; 22, Leu22 to Arg; 26, G1u26 to Ile; 15, AsnlS to Arg; 27, G1u27 to Tyr; 31, Leu31 to Arg; 43, G1u43 to Leu; 27+31+43, G1u27 to Tyr and Leu31 to Arg and G1u43 to Leu; 15+27+31+43, AsnlS to Arg and G1u27 to Tyr and Leu31 to Arg and G1u43 to Leu.
Figure 10 - The binding of monoclonal antibodies to GST-MSP-1,~ detected by BIAcore analysis. The binding of each monoclonal antibody is normalised to 100%
binding to protein based on the wild type sequence and the binding to proteins containing modified sequences is expressed as a percentage of this. WT, wild type sequence; 27;
G1u27 to Tyr;
31, Leu31 to Arg; 34, Tyr34 to Ser; 43, G1u43 to Leu. The combinations contain 3 or 4 substitutions, respectively, in the protein.
Examples Materials and Methods Protein expression and stable-isotope labelling for NMR
The coding sequence of the MSP-1 C-terminal fragment was cloned by polymerase chain reaction with Vent polymerase (New England Biolabs) from a plasmid containing the Plasmodium falciparum strain T9/94 fragment (Blackman et al., 1991), using primers that included codons for a 6 residue N-terminal His tag (CACCATCATCATCATCAC), and inserted into the SnaBI restriction site of the pPIC9K vector (Invitrogen).
The sequence 2o corresponds to residues 1526-1621 of the SWISS-PROT entry MSP1 PLAFW
(accession number P04933). This produced an a-factor fusion protein with the sequence ...KR/EA/EA/YHHHHHHNISQ....SSSN, where the slashes indicate kex2 and STE13 processing sites. High copy number transformants of the methylotrophic yeast Komagataella (Pichia) pastoris protease-deficient strain SMD1168 (his4 pep4) were isolated by screening for high 6418 resistance (Clare et al., 1995).
A Mut+ transformant was grown at 29.4 °C in a shaker-incubator in buffered minimal medium (100 mM potassium phosphate, pH 6.0, yeast nitrogen base (0.34 % w/vol) (DIFCO: YNB without amino acids and without (NHa)zS04), biotin (4x10'5%
w/vol), Sigma antifoam 289 (0.01% vol/vol), and carbon and nitrogen sources as described below.
Unlabelled samples were initially grown in medium containing 1 % w/vol (NH4)ZS04 and 1 % w/vol glycerol, and induced by transfer to medium containing 0.5 % CH30H
as the carbon source. Labelled samples were initially grown in medium containing 0.2 % w/vol ['SN]-(NHa)ZSO~ (Isotech), and 0.5 % w/vol glucose or ['3C6]-glucose (Isotech), and induced by transfer to medium containing as carbon source 0.5 % w/vol CH30H or [''C]-CH30H (Isotech). The initial cultures were grown in 150 ml to a density of ~10 ODboo~
then harvested and resuspended in methanol medium at 1 OD6oo in a volume of 1.5 L.
Methanol-induced cultures were grown for 4 d, with daily addition of 7.5 ml CH;OH or ['3C]-CH30H, to a final density of ~18 ODboo. This protocol produced a maximum yield of 24 mg/L of purified, "C/'SN uniformly labelled protein at the final stage (see below).
The YNB-based medium produced about 3-fold higher yields than the FM22 medium to (Laroche et al., 1994), for stable-isotope labeling of the MSP-1 C-terminal fragment.
Cells were removed by low-speed centrifugation, protease inhibitors added (COMPLETET'~'' tablets, Boehringer-Mannheim; 1 tablet/500 ml supernatant), and the supernatant was filter-sterilized. The supernatant was concentrated ~20-fold by t 5 ultrafiltration in a stirred cell (Amicon, YM3 membrane) at 4 °C.
The pH was adjusted to 7.25 with KOH, and the partially N-glycosylated MSP-1 fragment was deglycosylated for 72 h at 37 °C with 5000 U PNGaseF (New England Biolabs). The carbohydrate was completely removed (as shown by electrophoresis and mass spectrometry), with the Asn 1 residue presumably converted to Asp in the process. The supernatant was clarified by low-2o speed centrifugation, 5 M NaCI was added to a final concentration of 0.3 M, and the sample was applied to a 2 ml Ni-NTA affinity column (QIAGEN), washed, and eluted with 250 mM imidazole according to manufacturer's instructions. The eluate was dialyzed against 50 mM sodium phosphate (pH 6.5), 50 mM NaCI, and then passed through a 1 ml Hi-Trap Q anion exchange resin (Pharmacia) to remove misfolded 25 that bound to the column. The MSP-1 fragment was characterized by Western blotting and electrospray mass spectrometry (data not shown). Two principal species of mass and 11807 Da were observed corresponding to the expected fragment, as well as a fragment with an additional N-terminal Glu - Ala dipeptide resulting from incomplete STE13 processing of the a-factor secretion signal.
Samples for NMR experiments were prepared in either 90 % HZO/10 % Dz0 with 0.01 w/vol NaN,, or 100 % DZO, 50 mM sodium phosphate, 100 mM NaCI at pH 6.5, (pH
uncorrected for deuterium isotope effects), at a concentration of 2.1 to 2.6 mM in 0.6 ml.
Protein concentration was measured by UV absorbance at 280 nm, using a calculated molar extinction coefficient of 5220 liter mol-' cm'. The protein was demonstrated to be monomeric by equilibrium ultracentrifugation of a 0.12 mM sample in the above buffer at 293 K.
NMR experiments and data processing Most of the experiments were performed at 298 K, using Varian Unity and Unity-Plus to spectrometers operating at 600 MHz and 500 MHz respectively. Details of the multidimensional experiments (Clore & Gronenborn, 1998) and acquisition parameters used for resonance assignments and structure determination are given in Tables A/B and have been submitted to the BioMagResBank database (Accession No ~
All spectra were processed using Felix 95.0 or 97.0 (BiosymlMSI) using a 90 degree- or 72 degree-shifted sinebell-squared window function. Dimensions, zero-filling, and linear prediction details are summarized in Table A and in the submission to the BioMagResBank. Four dimensional and interleaved spectra were processed in Felix using macros written in-house.
Signal assignments: Sequential assignments were made based on connectivities established primarily by CBCA(CO)NH and CBCANH experiments on uniformly '3C/'SN
labelled protein. Side chain-spin system assignments were made on the basis of data from '3C/'H -HCCH-TOCSY experiment correlated with information from 'SNfH-TOCSY-HSQC and 'SN/'H-NOESY-HSQC, and HNHA and HNHB experiments. Assignments were obtained for 'H, ''N and aliphatic '3C signals for 98% of side-chains and 96% of backbone amide groups. The list of assignments is given in Table A and in the submission to the BioMagResBank database (Accession No ~. The 'SN{'H} heteronuclear NOE experiment was carried out as described previously (Kay et al., 1989;
Polshakov et 3o al., 1997).
Distance Restraints: NOE- and ROE-derived distance restraints between backbone and side chain amide protons were obtained primarily from the 3D 'SN-NOESY-HSQC, 'SN-ROESY-HSQC, and 4D '3C-HMQC-NOESY-'SN-HSQC experiments. Aliphatic to aliphatic proton distance restraints were obtained from a 4D ''C-HMQC-NOESY-'3C-HSQC experiment. A 3D '3C-HMQC-NOESY experiment in DZO was used to identify aliphatic to aromatic proton NOES and 2D NOESY experiments were used to measure aromatic to aromatic proton NOES. Crosspeaks were quantified by volume integration in Felix for 2D and 3D experiments and for the 4D '3C-HMQC-NOESY-''N-HSQC
experiment, and from peak height measurements in the 4D '3C-HMQC-NOESY-'3C-to HMQC spectra. Crosspeaks were classified as strong, medium and weak and these were assigned to distance restraints of 0 - 2.8, 0 - 3.6, and 0 - 5.5 ~. Restraints from backbone amide signals were initially treated in this manner, and then recalibrated more precisely using 3D-'SN-ROESY-HSQC data into four classes involving maximum distances of 2.6, 3.1, 3.6, and 4.1 ~. Restraints to groups of equivalent or non-stereoassigned protons were treated by r 6 summation. Most intraresidue distances (HN-Hp and Ha-Hp) were converted to x, angle restraints as described below and these distance restraints were not included in the final list.
Dihedral Angle Restraints: x, angles and stereospeciflc assignments of (3-methylene 2o protons were obtained using the grid-search program AngleSearch, with coupling constant and intraresidue ROE distance information (Polshakov et al., 1995). The coupling constant information was provided by HNHB and HN(CO)HB spectral intensities for 3J(HN-Ha) and 3J(CO-H~), and intraresidue distances (HN-Hp, Ha-Ha) were obtained from 3D 'SN-ROESY-HSQC and 2D ROESY (D20) experiments. 3J(HN-Ha) coupling constants were obtained from the HNHA experiment. Residues with positive ~
angles (ca.
+60 degrees) were identified by large intraresidue Hn crosspeak intensities in the HN(CO)HB experiment, and y angles near -60° degrees from strong Ha~;_,~
crosspeaks in the HNHB experiment. Ile and Leu x2 angles and Leu 8 stereoassignments were derived from the LRCH experiment. Minimum ranges of 40 degrees (x,, x2) and 50 degrees (~, yr) 3o were used to account for errors and local dynamic effects on the coupling constants.
Disulphide Bonding Pattern: An initial set of 20 structures was calculated by simulated annealing using approximately 550 unambiguous NOE-derived distance restraints and 36 x, and ~ dihedral angle restraints but with no hydrogen bonding or disulphide bond constraints. The Cys - Cys SY distances in these structures were examined in order to establish the probable bonding pattern. Prior to the calculations, the formation of disulphide bridges for 4 Cys residues (Cysl2 - Cys28, Cys78 - Cys92) was already established with high probability by the observation of HR-Ha NOES between these pairs of Cys residues. Examination of the initial structures confirmed these disulphide bridges and also indicated a disulphide bridge between residues Cys30 and Cys4l. The third disulphide bridge in domain-1 (Cys7 - Cysl8) could thus be assigned by default, although the structure of the N-terminus was not well-defined by the NMR data. The best six structures in terms of total X-PLOR energy and violations indicated that the average Cys -Cys SY distance was lowest for the disulphide bonding pattern [1-3, 2-4, 5-6]
in each domain, and only this combination allowed all Cys residues to form contacts with a partner <3.5 A away. Thus, this disulphide bonding pattern was most consistent with the experimental data for both domains, and was imposed (initially as NOE-style distance restraints) in subsequent calculations. The [1-3, 2-4, 5-6] pattern is that expected for an EGF-like domain.
Hydrogen Bonds: Non-exchanging amide groups involved in stable hydrogen bonds were identified in spectra of samples examined in 100 % D20. The corresponding hydrogen bond acceptors were determined by examining the initial structural ensemble, using the Insight II and HBPIus (McDonald et al., 1994) programs, and hydrogen bond distance restraints were included in subsequent calculations. Further hydrogen bonds were identified in a similar manner in iterative calculations. Only 10 backbone hydrogen bonds in the antiparallel (3 sheets were used as restraints. Two distance restraints were used for each hydrogen bond, 1.7 - 2.3 A from proton to acceptor, and 3.0 - 3.6 A from donor nitrogen atom to acceptor.
3o Structure Calculations All the structure calculations were performed following standard protocols for ab initio _; l _ simulated annealing from an extended chain using X-PLOR version 3.843 on a Silicon Graphics Origin 200 computer. The initial calculations used an initial temperature of 1000K, and 9000 steps of 5 fs in the restrained molecular dynamics stage. A
soft-square potential was used for distance restraints. The SHAKE (Ryckaert et al., 1977) algorithm was employed during molecular dynamics to maintain correct bond lengths.
Refinement used a square well potential for restraints, and a final slow cooling of 30000 steps of 4 fs each from 2000K. A modified "parallhdg.pro" force-field parameter set was used, with modifications to parameters for Arg and Pro residues, and for hydrogen bonds (Polshakov et al., 1997). Force constants were 50 kcal mol-' A-z for all distance restraints including hydrogen bonds, and 200 kcal mol~' rad~' for dihedral restraints. The N-terminal sequence including the vector-encoded residues and (His)6 tag was excluded from the structure calculations. All peptide bonds were constrained to be trans. NOE data for all 5 Pro residues showed strong Ha~,_,~-ProHa crosspeaks, consistent with the trans peptide conformation.
Initial structures were calculated as described above to determine the disulphide bonding pattern. Then the calculation was repeated with identical NOE-derived distance and dihedral angle restraints, with the addition of 6 distance restraints ( 1.92-3.12 A) representing the disulphide bridges. A new set of 50 structures was obtained, from which the best 20 structures were selected. The criteria used for selection were that the structures were below the median value of both total X-PLOR energy and rms NOE
difference, and had no dihedral angle violations. The resulting structures had good geometry and between zero and two NOE violations > 0.5 A. These structures were used to assign previously ambiguous NOES and to determine the hydrogen bonds as described above.
The final structure calculation and refinement used an expanded restraint list including hydrogen bonds, additional dihedral restraints, stereoassignments of (3-methylene and Leu 8 signals, and more precisely calibrated ROE data (see Table 1 ). A set of 100 structures 3o was obtained using this list, and 38 structures with 0-2 NOE violations >
0.5 A and no dihedral angle violations > 5° were accepted. These 38 structures were refined by the slow-cooling procedure described above, producing a final ensemble of 32 accepted structures with no NOE violations > 0.5 A and no dihedral angle violations >
5°. These selection criteria produced an ensemble of structures that extend to the end of the continuum of total potential energies in order to include structures having large scale correlated motions (Abseher et al., 1998). Statistics for the final ensemble are given in Table 1. Coordinates for the 32 refined structures have been deposited in the Brookhaven Protein Data Bank (coordinates ID code lcej; NMR restraints ID code rlcejmr).
Structures were analyzed during the calculation process using X-PLOR 3.8 (Nilges et al., 1991), PROCHECK-NMR/AQUA (Laskowski et al., 1996), and Insight II for quality of 1o agreement with experimental data, precision, geometry, and energy. Models were aligned with Insight II and fitpdb, and displayed with Insight II, MOLSCRIPT (Kraulis, 1991), and GRASP (Nicholls et al.,1991 ).
Table 1.
A: RESTRAINTS SUMMARY
Number of conformers calculated: 100 Number of conformers accepted: 32 Acceptance criteria:
2o No distance violation: > 0.5 A No dihedral angle violation: > 5 NOE/ROE distance restraints:
Intraresidue: 73 Sequential: 222 Medium range ( 2-4 ): 90 Long range ( > 4 ): 185 Tota1:570 Dihedral angle restraints:
phi:25 psi:33 chi-1:22 chi-2:5 Tota1:85 3o Hydrogen bonds: 10 Disulphide bonds: 6 B: STRUCTURE QUALITY
average +l s. d.
Total X PLOR energy (kcal mol-') 168 20 NOE X-PLOR energy (kcal mol~') 21 8 rmsd NOE 0.026 0.005 rmsd dihedral angle 0.236 0.095 rmsd bond length 0.0029 0.0002 rmsd bond angle 0.357 0.023 l0 rmsd improper 0.266 0.018 Backbone rmsd of structured (69 residues) region:
Overall: 1.05 0.28 Domain-1: 0.81 0.32 Domain-2: 0.83 0.35 Ramachandran plot quality (phi/psi angles):
Most favoured 49.5 Additional allowed 42.1 2o Generously allowed 5.6 Disallowed 2.7 Monoclonal antibodies (mAbs) Anti-MSP-1,~ monoclonal antibodies used in this study were : mouse IgG mAbs lEl, 1E8, 2F10, 111.2, 111.4 2.2, 5.2, 7.5, 9C8, 12.8, 12.10 (Holder et al., 1985;
McBride &
Heidrich, 1987; Blackman et al., 1987; Guevara Patino et al., 1997); and mouse IgM mAb 5B 1 (Pirson & Perkins, 1985). Of these, mAbs 12.8, 12.10 and 5B 1 are neutralising, inhibitory antibodies and 2.2, 7.5 and 111.4 are blocking antibodies. Some antibodies 3o such as 2F10 are neither inhibitory nor blocking.
Construction of modified MSP-l,~ clones The DNA coding the wild type MSP-l,~ domain of Plasmodium falciparum (T9-94/Wellcome strain) MSP-1 has been cloned in expression vector pGEX-3X to produce MSP-1,~ fused to the carboxy-terminus of the Schistosoma japoniczrm glutathione S-transferase (GST) in Escherichia coli (Burghaus & Holder, 1994). Site-directed mutagenesis of MSP-1,9 DNA sequence was done in either of two ways.
The first method was a modification of the method of Perrin & Gilliland ( 1990) to carry out polymerase chain reaction (PCR)-mediated site specific mutagenesis. DNA
was amplified using the plasmid as a template together with one oligonucleotide to introduce the point mutation and a 5' primer from outside of the MSP-1,~ sequence. The amplified product was purified after electrophoresis on an agarose gel and used in a second amplification step together with a 3' primer from outside of the other end of the MSP-l,~
sequence and the plasmid as template. This second PCR product was digested with the restriction enzymes EcoRl and BamHl and the product consisting of the modified MSP-1,~ coding sequence was inserted back into pGEX-3X and the products were used to transform DHSa, cells.
2o The second method used the QuikChange Site-directed mutagenesis kit from Stratagene.
Briefly, using the plasmid pGEX-MSP-1,9 as a template, two complementary synthetic oligonucleotide primers containing the desired point mutation were designed and were extended on the template by temperature cycling with the enzyme Pfu DNA
Polymerase.
This incorporation of the oligonucleotide primers results in the generation of a mutated plasmid containing staggered nicks in the DNA sequence. Following the temperature cycling, the product was treated with DpnI endonulease which will digest the methylated parental DNA template and leaves the mutation-containing newly synthesised DNA
intact. The DNA incorporating the desired mutation was then transformed into E. coli strain DHSa, (Life technologies) competent cells where the nicks will be repaired.
Clones were screened by analysis of restriction enzyme digests and by PCR
screening of the insert gene. The DNA sequence of the selected mutant clones was confirmed using a PerkinElmer Applied Biosystems ABI 377 automatic sequencer according to the manufacturer's instructions.
Expression of the GST-MSP-1,~ fusion proteins Expression of GST-MSP-l,~ was induced with 1 mM isopropyl-~i-D-thiogalactopyranoside (IPTG; Melford Laboratories) for 1 hour in the E. coli strain TOPP
1 (Stratagene). The cells were then harvested by centrifugation and the cell pellet was resuspended in cell lysis buffer (50 mM Tris-HCl/1 mM EDTA pH 8.0 containing 0.2%
(v/v) Nonidet P40 (NP40; BDH). Phenylmethylsulphonyl fluoride (PMSF; Sigma) in isopropanol was added to a final concentration of 1 mM. The cell suspension was sonicated, on ice, using VibraCell sonicator (Sonics & Materials) at 50% duty cycle for 3 min (six 30 sec pulses with 30 sec in between). The cell lysate was centrifuged at 65000 x g for 1 hour at 4°C. Supernatant containing soluble GST-fusion protein was applied to a glutathione-agrose column (Sigma) and the GST-fusion protein was eluted with 5 mM
reduced glutathione. The eluted GST-fusion protein was dialysed extensively against phosphate buffered saline (PBS) at 4°C.
SDS-PAGE and Western Blotting Proteins were analysed by polyacrylamide gel electrophoresis in the presence of sodium dodecyl sulphate (SDS-PAGE). Samples were solubilised in SDS-PAGE buffer without reducing agents, then fractionated on a homogeneous 12.5% polyacrylamide gel.
The pre-stained low range molecular mass markers (24-102kDa) from Bio-Rad were used as markers. When required, SDS-PAGE-fractionated polypeptides were either stained with Coomassie Brilliant Blue R-250 (CBB; Sigma) or electrophoretically transferred to Optitran BA-S 83 reinforced nitrocellulose (Schleicher & Schull, 0.2 im pore size) for analysis by western blotting. Blots were blocked with 5% BSA, 0.5% Tween 20 in PBS
(PBS-T) for 1 h at room temperature, then washed in PBS-T. Blots were probed with first 3o antibodies for 2 h at room temperature, washed 3 times in PBS-T, and then incubated in 1/1000 dilution of horse radish peroxidase (HRP)-conjugated sheep anti-mouse IgG
(H+L) (ICN Immunobiologicals) or Goat anti-mouse IgM (p chain) (Sigma) for 1 h at room temperature. Blots were then washed 3 times in PBS-T and developed using Super Signal Substrate (Pierce) as HRP substrate for 1 min. Blots were then placed in plastic wrap and exposed to X-ray film (XB-200, X-ograph Imaging Systems). The films were processed with an Agfa Gevamatic60 film processor (Agfa).
Analysis of antibody-antigen interaction using a BIAcore machine GST-MSP-1,9 containing either the wild type or various modified sequences was used to coat a carboxmethyl dextran hydrogen sensor chip by the following methodology.
The to binding of the GST-MSP-1,9 was via amino groups using EDC/NHS chemistry.
Immobilisation was done with the amine coupling kit (Pharmacia BIAcore). The CM
dextran surface was activated with 35 ~1 of 200 mM 1-ethyl-3-(3-dimethylaminopropyl) carbodiimide (EDC) and 5 mM N-hydroxysuccinamide (NHS) for 7 min. GST-MSP-1,9 was then coupled to the BIAcore sensor surface using 20 P.l of a solution at 100 ~,g ml-' in coating buffer (0.01 M sodium acetate buffer, pH 3.5) for 4 min. Unreacted carboxyl groups were blocked by adding 35 ~tl 1 M ethanolamine, pH 8.5 for 7 min. The cells were washed with two pulses of 20 ~l 10 mM glycine-HCI, pH 2.8 for 8 min in total to remove any non-covalently bound protein. The immobilisation procedure was carried out at a flow rate of 5 ~1 min'. Measurements were performed on the BIAcore 2000 instrument.
RESULTS
Example 1 - Resonance assignments, NMR restraints and structure determination The assignments and restraints were obtained as described in Materials and Methods using a range of multidimensional heteronuclear experiments with '3C/'SN uniformly labelled protein. Sample spectra from 3D and 4D experiments showing NOE connections to the Lys35 backbone amide NH proton, resolved and unambiguously assigned using the '3C
chemical shift information, are shown in Figure 2. The distance, dihedral angle and 3o hydrogen bond restraints used in the final set of structure calculations are summarized in Table 1. A total of 570 unambiguously assigned distance restraints, 85 dihedral angle restraints, and 10 hydrogen bonds were used in the final set. The assignments and restraint list shown in Table A have been submitted to the BioMagResBank database. Three disulphide bonds, with the (1-3, 2-4, 5-6) pattern for each domain were experimentally determined from the NMR data in preliminary calculations as described in Materials and Methods, and these were also included in the final refinement. A final set of 32 models was calculated and refined using these restraints and these structures are shown in Figure 3 superimposed on the backbone of the representative structure S~eP. Table 1 shows that all 32 models have good geometry and are in good agreement with the experimental data with no NOE violations > 0.5 A and no dihedral angle violations > 5°.
The atomic rmsd value for the backbone atoms of the well-structured region (residues 15 - 64, 74 - 92) is 1o 1.05 A (see Table 1). The local backbone rmsd is highest at the N-terminus (up to Cysl2), in the loop G1u65 - Lys73, and following Cys92 at the C-terminus. The Ramachandran plot quality is typical of that found for other EGF structures (Doreleijers et al., 1998).
Description of the structure EGF domains Analysis of the final ensemble by PROCHECK-NMR indicated that each domain contains a major stretch of antiparallel (3-sheet containing the third and fourth Cys residues of each domain, as expected for an EGF-like fold, as well as an additional minor antiparallel 2o (3-sheet at the C-terminal end of domain-1, similar to some (but not all) EGF family members. These secondary structure features, together with the disulphide bonding patterns, can be seen in Figure 4. There is also a well-defined type II tight turn in domain-1, with a hydrogen bond from Tyr 34NH proton to Leu31 carbonyl oxygen. The normally conserved EGF consensus Gly residue in the tight turn is replaced in domain-1 by a residue with a positive ~ angle (Asn33), while the conserved aromatic residue is present (Tyr34). There is a probable hydrogen bond between Leu 31NH proton to AsnlS
carbonyl oxygen. Domain-2 contains two turns preceding the major ~3-sheet, (Asn53 -Cys56, Asp57 - A1a60), and a final bend from Leu86 - Phe91 with a probable hydrogen bond from Asp57 NH proton to the carbonyl oxygen of I1e90 or G1y89. A surface-exposed loop 3o from Pro81 to Pro85 replaces the tight turn, while the aromatic residue is not conserved.
The large loop at the end of the major b-sheet (G1u65 - Lys73) is relatively disordered, and high mobility for the segment G1y68 - G1y71 was confirmed by backbone amide 'SN{'H} heteronuclear NOE measurements (Barbato et al., 1992). The heteronuclear NOE
values are dramatically reduced for residues in this region. At the N-terminus: the low NOE intensities correspond to increased mobility compared with the rest of the protein.
The interdomain linker region from Pro45 to Pro47 is distinct from other EGF-like module pairs. The conformations of the disulphide bridges between Cys30 -Cys41 in domain-1, and the three Cys - Cys bonds in domain-2 are all left handed spirals (Richardson, 1981). Bridges between Cys30 - Cys4l, Cys56 - Cys76, and Cys78 -Cys92 are particularly close to their equivalents in the blood coagulation factor Xa structure (lhcg). The conformations of the first two disulphide bridges in the relatively disordered N-terminal segment of domain-1 were not determined.
Figure 5 shows the backbone C, N, Cn atom alignments of the two MSP-1 C-terminal fragment domains made with typical examples of EGF-like domains from several proteins, using the fitpdb program. Pairwise alignments showed that the two domains i 5 from MSP-1 are more similar to the factor Xa structure and its close relative from C 1 r, than to each other or to the other structures tested. The rmsd values for MSP-1 domains compared to factor Xa are comparable to those of the more distantly related structures fibrillin-1 and transforming growth factor-a.
2o The overall fold of each MSP-1 domain is thus similar to typical EGF family members, with the turns following the fifth Cys residue roughly equivalent, in spite of the divergence from the EGF consensus (C(5)xxGa) where a is a Phe or Tyr residue.
Although some of the external loops are disordered, the scaffold is quite stable, as indicated by the non-exchangeable backbone amides (see above and in Protein Data 25 Bank/BioMagResBank submission for details).
Unlike many EGF-like domains such as fibrillin-1, the MSP-1 C-terminal fragment lacks the conserved EGF Ca2+-binding sequence and there was no evidence of Ca2+
binding to the MSP-1 C-terminal fragment. The 2D 'H-NOESY spectra were virtually identical in 3o the absence or presence of 20 mM CaCl2, indicating that any binding that might occur has, at most, only a small affect the overall structure.
Domain interface crnd srrrface The most striking feature of the MSP-1 C-terminal fragment structure is the interface between the domains, which consists of several nonpolar amino acids (Phel9, Leu3l, Leu32, Leu86, Phe87, I1e90 and Phe91) involved in hydrophobic interactions.
These residues join the base of the major ~3-sheet and the tight turn in domain-1 with the final bend from residue 86 to 91 in domain-2. The domain interactions result in the domains forming a U-shaped structure which contrasts with structures observed for other pairs of EGF domains (Downing et al., 1996; Brandstetter et al., 1995). For example, in fibrillin-1, the interface between EGF domains 32 and 33 is largely formed by a shared 1 o Caz+ ligation site (Downing et al., 1996), and the overall structure resembles a rigid rod, with distant N- and C-termini. This contrasts with MSP-1 where the EGF-like domains are folded against each other so that their termini are relatively close together. A
comparison of fibrillin-l and MSP-1 EGF module pairs is shown in Figure 6.
Although both termini of the MSP-1 C-terminal fragment are somewhat disordered, NOE
contacts were observed between nuclei in the two ends. The proximity of the C- and N-terminal positions may be significant, since it suggests that the proteolytic processing site that produces the C-terminal 96 amino acid fragment may be very close to the GPI
membrane attachment site at or near residue 96. This proximity is consistent with the idea that a membrane-bound Plasmodiarm proteinase is responsible for secondary processing.
The electrostatic potential surface of the MSP-1 C-terminal fragment is shown in two views in Figure 7. The surface in Figure 7a is highly charged, especially in the protruding loop regions 23 - 27, 35 - 40 and 64 - 66. The surface in Figure 7b contains more neutral hydrophilic residues as well as a small hydrophobic patch from Pro85 - Phe87 near the center of the surface. In the future, such information could assist in understanding how these different surfaces may be involved in interactions with the rest of the precursor, the processing proteinase, other proteins on the merozoite surface, or unknown targets on the erythrocyte or parasite vacuolar membrane surfaces.
3o Primary sequence conservation The residues involved in the hydrophobic domain interface in P. falciparum are also shown in Figure 1, together with corresponding residues in MSP-1 of the less virulent human malaria parasite, P. vivax (Del Portillo et al., 1991; Gibson et al., 1992).
Extensive conservation of the interface residues (with conservative substitutions) suggests that P. vivax and perhaps other Plasmodium species as well, may have a similar U-shaped EGF module pair arrangement. Another feature of the P. vivax sequence, also seen in other Plasmodium species, is the single disulphide bond deficiency in the first EGF-like domain resulting from the absence of cysteine residues equivalent to the P.
falciparum Cysl2 and Cys28.
P. falciparum dimorphic sites Five dimorphic sites have been observed in the P. falciparum MSP-1 C-terminal fragment from different isolates (Qari et al., 1998). Several observations can be made about the position of these sites on the MSP-1 structure. Two sites, G1n14/G1u14 and Lys61/Thr6l, involve residues in relatively well-structured backbone regions, with surface-exposed hydrophilic or charged side-chains. A pair of adjacent sites, with the sequence variants Asn70 - G1y71/Ser70 - Arg7l, occurs in the disordered loop of domain-2, within a segment (residues 68 - 71 ) that has been shown to be highly mobile. The region from G1u65 to Lys73 also appears to be the most variable region among different Plasmodium 2o species (Daly et al., 1992; Holder et al., 1992). Finally, the fifth site has a substitution between hydrophobic residues (Leu86/Phe86). This partially-exposed side-chain is located at the hydrophobic domain interface, and the conservative substitution is consistent with a role in this interaction.
Example 2 - Mutation and Monoclonal Antibody Binding studies As a step towards understanding antibody interactions with the MSP-1 C-terminal fragment, the effect of engineered point mutations (within domain-1) on antibody binding has been studied. Amino acid substitutions were made that consisted of radical changes.
3o These radical changes consisted of, for example, replacing an aliphatic residue with a charged polar residue, replacing a positively charged side chain with a negatively charged side chain, replacing an amino acid with a large side chain with an amino acid with a smaller or no side chain (glycine), replacing a polar amino acid with a charged polar amino acid, replacing a polar amino acid with an aromatic amino acid, replacing a large aromatic amino acid with an amino acid with a small side chain, and replacing cysteine residues that are involved in disulphide bonds.
Four individual amino acid substitutions shown in Figure 8, each completely abolish binding of one or more mAbs to the mutant fragment, as detected by Western blotting.
The G1u26 mutation, shown in cyan, is closest to the N-terminal proteolytic processing site (magenta) at Asnl, and is the only one of this group of mutations that affects binding of a processing-inhibitory antibody, i.e. one that is capable of preventing both proteolytic processing of the MSP-1 precursor and erythrocyte invasion in vitro. The other three mutations abolish binding of blocking antibodies that bind to the native C-terminal fragment and interfere with the binding of processing-inhibitory antibodies.
~ 5 Additional mutations were made based on the immunochemical analyses and the tertiary structure of the molecule, and the binding of the mAbs was assessed by western blotting and BIAcore analysis. The results are summarised in Table 2. The results of the binding of selected mAbs to the modified proteins as detected by Western blotting are shown in Figure 9, and by BIAcore analysis in Figurel0. Some individual amino acid changes have 2o no effect on the binding of any of the mAbs tested (for example Leu22 to Arg). Other substitutions affect the binding of one or more mAbs.
Of particular interest are those changes that prevent the binding of blocking antibodies but have no effect on the binding of the inhibitory antibodies. For example, replacement of 25 AsnlS by Arg prevents the binding of mAb 7.5, replacement of G1u27 by Tyr prevents the binding of mAb 2.2, replacement of Leu31 by Arg prevents the binding of mAb 1 E 1, replacement of Tyr34 by Ser prevents the binding of mAb 7.5, and replacement of G1u43 by Leu prevents the binding of mAb 111.4.
3o Three combinations of substitutions that prevent the binding of blocking antibodies but do not affect the binding of inhibitory antibodies were made in single proteins.
In the first GIu27~Tyr, Leu31 ~Arg and G1u43-~Leu were combined, in the second G1u27~Tyr, Leu3l~Arg, Tyr34~Ser, and G1u43-~Leu were combined, and the third AsnlS~Arg, G1u27-~Tyr, Leu31-~Arg and G1u43-~Leu were combined. None of these modified proteins bound any of the blocking antibodies but continued to bind the inhibitory antibodies. We propose that the mutant proteins will induce a polyclonal response that is more inhibitory than that induced by the wild type protein. This will be tested by immunising mice and rabbits with both the wild type and mutant proteins and comparing the ability of the induced antibodies to inhibit secondary processing.
The modified recombinant proteins will also be used to affinity select antibodies from 1o pooled serum from individuals exposed to malaria. We hypothesise that the modified proteins will select less blocking antibody than the wild type protein and that therefore these selected antibodies will be more effective in inhibiting parasite invasion in vitro and secondary processing.
In the first EGF-like domain of MSP-1 from the rodent, primate and P. vivar malaria parasites, cysteines 2 and 4 are not present. We have replaced this cysteine pair (Cys 12 and Cys28) in the P. falciparum protein. This does not have appear to have any effect on the binding of any of the inhibitory antibodies, but does abolish the binding of the blocking antibody mAb 2.2. We propose that one reason why the proteins from these other malaria parasites are more immunogenic is that T cell recognition is more effective or that processing by antigen processing cells proceeds by a different degradation pathway that drives the fine specificity of the antibody response in a more productive direction (see for example Egan et al., 1997). Removal of the cysteine pair may improve the immunogenicity of the modified protein and this will be assessed by measuring the level of antibodies induced by the P. falciparum protein without the two cysteines with the level of antibodies induced by the wild type protein.
++ + + ++ ++
+
N
V1 ++ + + + ++ ++
N
+ + +
++ + + + ++ ++
~
_ b O
N
++ + + + ++ n+
~r O N + + + + + + +
O
U
+
U ~ + + + ++
+ + + +
4-a O N
++ + + ++ ++
.t', ++ + + + ++ ++
_ ~
_ '~
.-+ + + ++ + + + ++ + + ++
- + ++ ++ + ++ + + ++ + ++ ++ + + ++
O
+ ++ ++ + ++ ++ + + ++
U t~+ ++ + + ++ + ++ t~ + ++ ++ + ++ ++
4-a N
W N ++ + + ++ + + ++ ++ + ++ ++
U N + ++ ++ + + ++ ++ + ++ ++ + ++ ++
r it O
cd dpW + + ++ + ++ + + + ++ ++ + ++
+ + ++ + ++ + + ++ + ++ ++ + ++ ++
b4 C
CO
_ TCO+ ++ + + + ++ ++ + ++ ++ ++ ++
o~n+ ++ + + ++ + ++ ++ + ++ ++ + ++ ++
.n U C
O
N QN + $+ ++ + ++ + ++ ++ + ++ ++ + ++ ++ O
~
dr G~ + + ++ + ++ + ++ ++ + ++ ++ + ++ ++
V] U
~p0 U cN + ++ + + + + ++ + ++ ++ ++ ++
+ ++ ++ + + + ++ ++ + ++ ++ t ++ ++
O b c C
r :a T T40UC ~ i ' ~~ v ~' W' ~ ~>
D
y y, a aO a N a~ , ~ ~ c~a a~ a ~~-~ aa _~ c~~c~~a ~ .~a a a ~
o .~ +
~
o ~, oa ~ Oy C
U ~ C CC GLD~ ~_,~~ ~~ Cs...~.v~
> ~> > >-~ Ca ~t Q3 C7__ aa a>C7C7, UN a, , .C7C7a T C7f-~a C7C~ ~ J ..7.~ F-fwJ .a Q
N .
b4 H O
i O
N c U = >' z _ "' ~ ~~ v1O N lDt~Q~--N MT etWD t~OvO MCCM +
O ,'~
~N N NN N MM MM M MM MM d'V'~J'V1 +
J
w N
h N
+ +
+ + +
N + + +
O
L.L + + + +
N + + + n + + +
OC
n n +
N
.-.+
~+ n n + t n + n i n n I~+ n n + + '~ + n n n i N
Nn n n + + -~ + n n n W+ +
GIl~+ n i + + + + i n n C
_ C_ + + + + +
0 + ~ ~ + +
.a .., c o ' Q .~~.
+ + n + + d + + + +
O C
U ,C~
O OC
N
+ n n + + + + + + +
.,.i '~ ~, ~ ~ a a ~n L Lp on ~"
a~ L L c ~ c >- cw L L nr > T v' N 'L a a ou N L > a N L T
> L
~.C , a~.U ~ .~Q, , , Y y :a aa,~~ ~Q .~~ U Hda N a~.a_ a ~.~ ~-d~.~
~Uy r ta.
C
c c L a a o a a a '-T ~n ~n a. L L L a L a ~, ~ ._ T ~ L' S a a a ~, ~, m ~J N 7 a v~
--U
c 3UU C~U ~~ Ha . ~H L ~,~~ , dc~.~~
~~ G~- ~.~H~
o~
M M ~y a p C ~ C
' + i, M ~ M
C M
C C + + +
~ L00 00 00 O~ 00 00 00 ~
_ N + ~ + [
+ + + + + +
~ ~
E--" G U'- M V V ~ N N
TABLE A
# 13-10-98 # merozoite surface protein-1 (MSP-1) Plasmodium falciparum (C-terminal fragment) # Reference: 'H : DSS=0.000 dioxane=3.755 (internal) # 'SN: indirect # '3C: indirect # 25C pH 6.5 SOmM NaP04 100mM NaCI 90%H20/10%D20 # --FORMAT--# BioMagResBank # The original sequence entered was:
NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQEGDKCVENPNPTCNENNGGCDADAKCTEEDSGSNGK
KITCECTKPDSYPLFDGIFCSSSN
# Expressed in NMR-STAR, this sequence is:
Mol residue sequence NISQHQCVKKQCPQNSGCFR
HLDEREECKCLLNYKQEGDK
CVENPNPTCNENNGGCDADA
KCTEEDSGSNGKKITCECTK
PDSYPLFDGIFCSSSN
loop-Residue seq-code Residue author seq-code Residue labe1 1 C~ASN 2 Q ILE 3 Q SER 4 C~GLN 5 C~?HIS
6 C~GLN 7 C~CYS 8 ~ VAL 9 C~LYS 10 C~LYS
11Q GLN 12 c~CYS 13 C~PRO 14 ~ GLN 15 UASN
16C~SER 17 Q GLY 18 Q CYS 19 C~PHE 20 ~ARG
21Q HIS 22 Q LEU 23 Q ASP 24 ~ GLU 25 c~ARG
2 C~GLU 2 ~ GLU 2 C~7CYS 2 C~LYS 3 ~CYS
31O LEU 32 p LEU 33 Q ASN 34 ~ TYR 35 QLYS
3 ~ GLN 3 Q GLU 3 C~GLY 3 C~AS 4 QLYS
41c~CYS 42 Q VAL 43 (~GLU 44 ~ ASN 45 QPRO
46C~ASN 47 C~?PRO 48 C~THR 49 U CYS 50 C~ASN
51C~GLU 52 Q ASN 53 Q ASN 54 Q GLY 55 C~GLY
56Q CYS 57 Q ASP 58 C~ALA 59 Q ASP 60 QALA
61Q LYS 62 C~CYS 63 ~ THR 64 C~GLU 65 ~GLU
66C~7ASP 67 C~SER 68 Q GLY 69 C~SER 70 QASN
71C~GLY 7 c~LYS 7 ~ LYS 74 Q ILE 7 C~THR
76C~CYS 77 Q GLU 78 Q CYS 79 C~THR 80 C~LYS
81C~PRO 82 C~ASP 83 ~ SER 84 Q TYR 85 ~PRO
86Q LEU 87 ~ PHE 88 Q ASP 89 C~GLY 90 QILE
91C~PHE 92 ~ CYS 93 Q SER 94 c~SER 95 ~SER
96~ ASN
stop- ##
# Chemical Shift Ambiguity Code Definitions #
# #
# Codes Definition #
# #
# 1 Unique #
# 2 Ambiguity of geminal atoms or geminal methyl #
# proton groups #
# 3 Aromatic atoms on opposite sides of the ring #
# (e.g. Tyr HEl and HE2 protons) #
# 4 Intraresidue ambiguities (e.g.
Lys HG and #
# HD protons) #
# 5 Interresidue ambiguities (Lys 12 vs. Lys 27) #
# 9 Ambiguous, specific ambiguity not defined #
# #
##
# INSTRUCTIONS
# 1 ) Replace the @-signs with appropriate values.
# 2) Text comments concerning the assignments can be supplied in the full deposition.
# 3) Feel free to add or delete rows to the table as needed.
# The row numbers LAtom shift assign ID values) will be re-assigned to sequential values by BMRB
# # The atom table chosen for this sequence is:
loop-Atom shift assign ID
-Residue_seq-code _Residue_label _Atom_name _Atom_type _Chem_shift_value _Chem shift value_error Chem shift ambiguity-code Table AI. Supplementary: 1H, 13C and 15N chemical shift assignments of MSP-1 C-terminal fragment Atom Residue shift Seq Residue Atom Atom ShiftlError/Ambiguity assignno. Name Name Type ppm ppm Code 1 1 ASN H H 8.29 0.02 1 2 1 ASN HA H 4.60 0.02 1 3 1 ASN HB2 H 2.86 0.02 2 4 I ASN HB3 H 2.75 0.02 2 1 ASN HD21 H ? ? ?
6 1 ASN HD22 H ? ? ?
7 1 ASN C C ? ? ?
8 1 ASN CA C 55.5 0.6 1 9 1 ASN CB C 40.9 0.6 I
ll 1 ASN N N 125.8 0.3 l 12 1 ASN ND2 N ? ? ?
13 2 ILE H H 8.29 0.02 14 2 ILE HA H 4.25 0.02 15 2 ILE HB H 1.97 0.02 16 2 ILE HG 12 H 1.39 0.02 17 2 ILE HG 13 H 1.19 0.02 18 2 ILE HG2 H 0.92 0.02 19 2 ILE HD 1 H 0.81 0.02 20 2 ILE C C 173.8 0.6 1 21 2 ILE CA C 62.2 0.6 1 22 2 ILE CB C 38.7 0.6 1 23 2 ILE CG 1 C 27.5 0.6 1 24 2 ILE CG2 C 18.2 0.6 1 25 2 ILE CD1 C 13.7 0.6 1 26 2 ILE N N 121.1 0.3 1 27 3 SER H H 8.47 0.02 28 3 SER HA H 4.20 0.02 29 3 SER HB2 H 3.90 0.02 30 3 SER HB3 H 3.90 0.02 I
32 3 SER C C ? ? ?
33 3 SER CA C 60.9 0.6 1 34 3 SER CB C 63.3 0.6 1 35 3 SER N N 119.3 0.3 1 36 4 GLN H H 8.32 0.02 37 4 GLN HA H 4.02 0.02 38 4 GLN HB2 H 1.88 0.02 39 4 GLN HB3 H 1.88 0.02 40 4 GLN HG2 H 1.75 0.02 41 4 GLN HG3 H 1.75 0.02 42 4 GLN HE21 H ? ? ?
43 4 GLN HE22 H ? ? ?
44 4 GLN C C ? ? ?
45 4 GLN CA C 57.7 0.6 1 46 4 GLN CB C 27.9 0.6 1 47 4 GLN CG C 32.7 0.6 I
49 4 GLN N N 121.6 0.3 1 50 4 GLN NE2 N ? ? ?
51 5 HIS H H 7.76 0.02 52 5 HIS HA H 5.09 0.02 I
53 S HIS HB2 H 2.70 0.02 I
54 5 HIS HB3 H 2.70 0.02 56 5 HIS HD2 H 6.87 0.02 I
57 5 HIS HEI H 7.92 0.02 59 5 HIS C C 175.7 0.6 1 60 5 HIS CA C 54.8 0.6 I
61 5 HIS CB C 29.2 0.6 1 65 S HIS N N 113.6 0.3 9 68 6 GLN H H 7.42 0.02 69 6 GLN HA H 4.43 0.02 70 6 GLN HB2 H 2.05 0.02 71 6 GLN HB3 H 2.05 0.02 72 6 GLN HG2 H 2.42 0.02 73 6 GLN HG3 H 2.42 0.02 74 6 GLN HE21 H 7.59 0.02
++ + + ++ ++
.t', ++ + + + ++ ++
_ ~
_ '~
.-+ + + ++ + + + ++ + + ++
- + ++ ++ + ++ + + ++ + ++ ++ + + ++
O
+ ++ ++ + ++ ++ + + ++
U t~+ ++ + + ++ + ++ t~ + ++ ++ + ++ ++
4-a N
W N ++ + + ++ + + ++ ++ + ++ ++
U N + ++ ++ + + ++ ++ + ++ ++ + ++ ++
r it O
cd dpW + + ++ + ++ + + + ++ ++ + ++
+ + ++ + ++ + + ++ + ++ ++ + ++ ++
b4 C
CO
_ TCO+ ++ + + + ++ ++ + ++ ++ ++ ++
o~n+ ++ + + ++ + ++ ++ + ++ ++ + ++ ++
.n U C
O
N QN + $+ ++ + ++ + ++ ++ + ++ ++ + ++ ++ O
~
dr G~ + + ++ + ++ + ++ ++ + ++ ++ + ++ ++
V] U
~p0 U cN + ++ + + + + ++ + ++ ++ ++ ++
+ ++ ++ + + + ++ ++ + ++ ++ t ++ ++
O b c C
r :a T T40UC ~ i ' ~~ v ~' W' ~ ~>
D
y y, a aO a N a~ , ~ ~ c~a a~ a ~~-~ aa _~ c~~c~~a ~ .~a a a ~
o .~ +
~
o ~, oa ~ Oy C
U ~ C CC GLD~ ~_,~~ ~~ Cs...~.v~
> ~> > >-~ Ca ~t Q3 C7__ aa a>C7C7, UN a, , .C7C7a T C7f-~a C7C~ ~ J ..7.~ F-fwJ .a Q
N .
b4 H O
i O
N c U = >' z _ "' ~ ~~ v1O N lDt~Q~--N MT etWD t~OvO MCCM +
O ,'~
~N N NN N MM MM M MM MM d'V'~J'V1 +
J
w N
h N
+ +
+ + +
N + + +
O
L.L + + + +
N + + + n + + +
OC
n n +
N
.-.+
~+ n n + t n + n i n n I~+ n n + + '~ + n n n i N
Nn n n + + -~ + n n n W+ +
GIl~+ n i + + + + i n n C
_ C_ + + + + +
0 + ~ ~ + +
.a .., c o ' Q .~~.
+ + n + + d + + + +
O C
U ,C~
O OC
N
+ n n + + + + + + +
.,.i '~ ~, ~ ~ a a ~n L Lp on ~"
a~ L L c ~ c >- cw L L nr > T v' N 'L a a ou N L > a N L T
> L
~.C , a~.U ~ .~Q, , , Y y :a aa,~~ ~Q .~~ U Hda N a~.a_ a ~.~ ~-d~.~
~Uy r ta.
C
c c L a a o a a a '-T ~n ~n a. L L L a L a ~, ~ ._ T ~ L' S a a a ~, ~, m ~J N 7 a v~
--U
c 3UU C~U ~~ Ha . ~H L ~,~~ , dc~.~~
~~ G~- ~.~H~
o~
M M ~y a p C ~ C
' + i, M ~ M
C M
C C + + +
~ L00 00 00 O~ 00 00 00 ~
_ N + ~ + [
+ + + + + +
~ ~
E--" G U'- M V V ~ N N
TABLE A
# 13-10-98 # merozoite surface protein-1 (MSP-1) Plasmodium falciparum (C-terminal fragment) # Reference: 'H : DSS=0.000 dioxane=3.755 (internal) # 'SN: indirect # '3C: indirect # 25C pH 6.5 SOmM NaP04 100mM NaCI 90%H20/10%D20 # --FORMAT--# BioMagResBank # The original sequence entered was:
NISQHQCVKKQCPQNSGCFRHLDEREECKCLLNYKQEGDKCVENPNPTCNENNGGCDADAKCTEEDSGSNGK
KITCECTKPDSYPLFDGIFCSSSN
# Expressed in NMR-STAR, this sequence is:
Mol residue sequence NISQHQCVKKQCPQNSGCFR
HLDEREECKCLLNYKQEGDK
CVENPNPTCNENNGGCDADA
KCTEEDSGSNGKKITCECTK
PDSYPLFDGIFCSSSN
loop-Residue seq-code Residue author seq-code Residue labe1 1 C~ASN 2 Q ILE 3 Q SER 4 C~GLN 5 C~?HIS
6 C~GLN 7 C~CYS 8 ~ VAL 9 C~LYS 10 C~LYS
11Q GLN 12 c~CYS 13 C~PRO 14 ~ GLN 15 UASN
16C~SER 17 Q GLY 18 Q CYS 19 C~PHE 20 ~ARG
21Q HIS 22 Q LEU 23 Q ASP 24 ~ GLU 25 c~ARG
2 C~GLU 2 ~ GLU 2 C~7CYS 2 C~LYS 3 ~CYS
31O LEU 32 p LEU 33 Q ASN 34 ~ TYR 35 QLYS
3 ~ GLN 3 Q GLU 3 C~GLY 3 C~AS 4 QLYS
41c~CYS 42 Q VAL 43 (~GLU 44 ~ ASN 45 QPRO
46C~ASN 47 C~?PRO 48 C~THR 49 U CYS 50 C~ASN
51C~GLU 52 Q ASN 53 Q ASN 54 Q GLY 55 C~GLY
56Q CYS 57 Q ASP 58 C~ALA 59 Q ASP 60 QALA
61Q LYS 62 C~CYS 63 ~ THR 64 C~GLU 65 ~GLU
66C~7ASP 67 C~SER 68 Q GLY 69 C~SER 70 QASN
71C~GLY 7 c~LYS 7 ~ LYS 74 Q ILE 7 C~THR
76C~CYS 77 Q GLU 78 Q CYS 79 C~THR 80 C~LYS
81C~PRO 82 C~ASP 83 ~ SER 84 Q TYR 85 ~PRO
86Q LEU 87 ~ PHE 88 Q ASP 89 C~GLY 90 QILE
91C~PHE 92 ~ CYS 93 Q SER 94 c~SER 95 ~SER
96~ ASN
stop-
# Chemical Shift Ambiguity Code Definitions #
# #
# Codes Definition #
# #
# 1 Unique #
# 2 Ambiguity of geminal atoms or geminal methyl #
# proton groups #
# 3 Aromatic atoms on opposite sides of the ring #
# (e.g. Tyr HEl and HE2 protons) #
# 4 Intraresidue ambiguities (e.g.
Lys HG and #
# HD protons) #
# 5 Interresidue ambiguities (Lys 12 vs. Lys 27) #
# 9 Ambiguous, specific ambiguity not defined #
# #
# INSTRUCTIONS
# 1 ) Replace the @-signs with appropriate values.
# 2) Text comments concerning the assignments can be supplied in the full deposition.
# 3) Feel free to add or delete rows to the table as needed.
# The row numbers LAtom shift assign ID values) will be re-assigned to sequential values by BMRB
# # The atom table chosen for this sequence is:
loop-Atom shift assign ID
-Residue_seq-code _Residue_label _Atom_name _Atom_type _Chem_shift_value _Chem shift value_error Chem shift ambiguity-code Table AI. Supplementary: 1H, 13C and 15N chemical shift assignments of MSP-1 C-terminal fragment Atom Residue shift Seq Residue Atom Atom ShiftlError/Ambiguity assignno. Name Name Type ppm ppm Code 1 1 ASN H H 8.29 0.02 1 2 1 ASN HA H 4.60 0.02 1 3 1 ASN HB2 H 2.86 0.02 2 4 I ASN HB3 H 2.75 0.02 2 1 ASN HD21 H ? ? ?
6 1 ASN HD22 H ? ? ?
7 1 ASN C C ? ? ?
8 1 ASN CA C 55.5 0.6 1 9 1 ASN CB C 40.9 0.6 I
ll 1 ASN N N 125.8 0.3 l 12 1 ASN ND2 N ? ? ?
13 2 ILE H H 8.29 0.02 14 2 ILE HA H 4.25 0.02 15 2 ILE HB H 1.97 0.02 16 2 ILE HG 12 H 1.39 0.02 17 2 ILE HG 13 H 1.19 0.02 18 2 ILE HG2 H 0.92 0.02 19 2 ILE HD 1 H 0.81 0.02 20 2 ILE C C 173.8 0.6 1 21 2 ILE CA C 62.2 0.6 1 22 2 ILE CB C 38.7 0.6 1 23 2 ILE CG 1 C 27.5 0.6 1 24 2 ILE CG2 C 18.2 0.6 1 25 2 ILE CD1 C 13.7 0.6 1 26 2 ILE N N 121.1 0.3 1 27 3 SER H H 8.47 0.02 28 3 SER HA H 4.20 0.02 29 3 SER HB2 H 3.90 0.02 30 3 SER HB3 H 3.90 0.02 I
32 3 SER C C ? ? ?
33 3 SER CA C 60.9 0.6 1 34 3 SER CB C 63.3 0.6 1 35 3 SER N N 119.3 0.3 1 36 4 GLN H H 8.32 0.02 37 4 GLN HA H 4.02 0.02 38 4 GLN HB2 H 1.88 0.02 39 4 GLN HB3 H 1.88 0.02 40 4 GLN HG2 H 1.75 0.02 41 4 GLN HG3 H 1.75 0.02 42 4 GLN HE21 H ? ? ?
43 4 GLN HE22 H ? ? ?
44 4 GLN C C ? ? ?
45 4 GLN CA C 57.7 0.6 1 46 4 GLN CB C 27.9 0.6 1 47 4 GLN CG C 32.7 0.6 I
49 4 GLN N N 121.6 0.3 1 50 4 GLN NE2 N ? ? ?
51 5 HIS H H 7.76 0.02 52 5 HIS HA H 5.09 0.02 I
53 S HIS HB2 H 2.70 0.02 I
54 5 HIS HB3 H 2.70 0.02 56 5 HIS HD2 H 6.87 0.02 I
57 5 HIS HEI H 7.92 0.02 59 5 HIS C C 175.7 0.6 1 60 5 HIS CA C 54.8 0.6 I
61 5 HIS CB C 29.2 0.6 1 65 S HIS N N 113.6 0.3 9 68 6 GLN H H 7.42 0.02 69 6 GLN HA H 4.43 0.02 70 6 GLN HB2 H 2.05 0.02 71 6 GLN HB3 H 2.05 0.02 72 6 GLN HG2 H 2.42 0.02 73 6 GLN HG3 H 2.42 0.02 74 6 GLN HE21 H 7.59 0.02
5 75 6 GLN HE22 H 6.92 0.02 76 6 GLN C C 175.7 0.6 1 77 6 GLN CA C 55.1 0.6 1 78 6 GLN CB C 28.8 0.6 I
79 6 GLN CG C 33.8 0.6 1 81 6 GLN N N 122.5 0.3 9 82 6 GLN NE2 N 112.6 0.3 5 83 7 CYS H H 9.18 0.02 84 7 CYS HA H 4.09 0.02 85 7 CYS HB2 H 3.31 0.02 86 7 CYS HB3 H 3.11 0.02 88 7 CYS C C 174.4 0.6 1 89 7 CYS CA C 56.6 0.6 1 90 7 CYS CB C 42.3 0.6 I
91 7 CYS N N 124.5 0.3 1 92 8 VAL H H 10.42 0.02 93 8 VAL HA H 4.33 0.02 l 94 8 VAL HB H 2.15 0.02 95 8 VAL HG1 H 0.84 0.02 96 8 VAL HG2 H 0.82 0.02 97 8 VAL C C 176.6 0.6 1 98 8 VAL CA C 62.5 0.6 1 99 8 VAL CB C 34.4 0.6 I
100 8 VAL CG1 C 21.5 0.6 2 101 8 VAL CG2 C 19.7 0.6 2 102 8 VAL N N 119.1 0.3 1 103 9 LYS H H 9.42 0.02 104 9 LYS HA H 4.51 0.02 105 9 LYS HB2 H 1.81 0.02 106 9 LYS HB3 H 1.81 0.02 I07 9 LYS HG2 H 1.41 0.02 108 9 LYS HG3 H 1.41 0.02 109 9 LYS HD2 H ? ? ?
110 9 LYS HD3 H ? ? ?
I11 9 LYS HE2 H 3.33 0.02 112 9 LYS HE3 H 3.33 0.02 114 9 LYS C C ? ? ?
115 9 LYS CA C 57.7 0.6 1 116 9 LYS CB C ? ? ?
117 9 LYS CG C ? ? ?
118 9 LYS CD C ? ? ?
119 9 LYS CE C ? ? ?
120 9 LYS N N 124.1 0.03 122 10 LYS H H 8.94 0.02 123 10 LYS HA H 4.06 0.02 124 10 LYS HB2 H 1.86 0.02 125 10 LYS HB3 H 1.86 0.02 126 10 LYS HG2 H 1.29 0.02 127 10 LYS HG3 H 1.29 0.02 128 10 LYS HD2 H 1.70 0.02 129 10 LYS HD3 H 1.59 0.02 130 10 LYS HE2 H 3.04 0.02 131 10 LYS HE3 H 3.04 0.02 133 l0 LYS C C ? ? ?
134 l0 LYS CA C 57.1 0.6 1 135 10 LYS CB C 34.3 0.6 1 136 10 LYS CG C 25.6 0.6 1 137 10 LYS CD C 29.6 0.6 1 138 10 LYS CE C 42.4 0.6 1 ~
139 10 LYS N N 122.4 0.3 1 141 11 GLN H H ? ? ?
142 11 GLN HA H 4.47 0.02 143 II GLN HB2 H 2.03 0.02 144 11 GLN HB3 H 1.89 0.02 145 II GLN HG2 H 2.28 0.02 146 Il GLN HG3 H 2.28 0.02 147 11 GLN HE21 H 7.45 0.02 148 11 GLN HE22 H 6.84 0.02 149 11 GLN C C ? ? ?
150 II GLN CA C 54.4 0.6 1 151 II GLN CB C 28.7 0.6 1 152 I1 GLN CG C 33.8 0.6 1 154 I1 GLN N N ? ? ?
155 Il GLN NE2 N 112.9 0.3 1 156 12 CYS H H ? ? ?
157 12 CYS HA H 5.09 0.02 158 12 CYS HB2 H 3.49 0.02 159 12 CYS HB3 H 2.34 0.02 161 12 CYS C C ? ? ?
162 12 CYS CA C 52.4 0.6 1 163 12 CYS CB C 37.2 0.6 I
164 12 CYS N N ? ? ?
165 13 PRO HA H 4.55 0.02 166 13 PRO HB2 H 2.45 0.02 167 l3 PRO HB3 H 1.94 0.02 168 13 PRO HG2 H 1.73 0.02 169 l3 PRO HG3 H 2.04 0.02 170 l3 PRO HD2 H 3.43 0.02 171 13 PRO HD3 H 3.80 0.02 172 13 PRO C C 176.4 0.6 1 173 l3 PRO CA C 62.6 0.6 1 174 13 PRO CB C 33.0 0.6 1 175 13 PRO CG C 27.5 0.6 1 176 13 PRO CD C 50.6 0.6 1 178 14 GLN H H 8.48 0.02 179 14 GLN HA H 4.01 0.02 180 14 GLN HB2 H 1.94 0.02 l 181 14 GLN HB3 H 1.94 0.02 182 14 GLN HG2 H 2.42 0.02 183 14 GLN HG3 H 2.42 0.02 184 14 GLN HE21 H 7.59 0.02 185 14 GLN HE22 H 6.92 0.02 186 14 GLN C C 176.6 0.6 1 187 14 GLN CA C 57.4 0.6 1 188 14 GLN CB C 28.6 0.6 1 189 14 GLN CG C 33.8 0.6 I
191 14 GLN N N 120.5 0.3 1 192 14 GLN NE2 N 112.6 0.3 5 193 15 ASN H H 8.93 0.02 194 15 ASN HA H 3.77 0.02 195 15 ASN HB2 H 2.58 0.02 196 15 ASN HB3 H 1.09 0.02 197 15 ASN HD21 H 6.97 0.02 198 15 ASN HD22 H 7.12 0.02 199 15 ASN C C 171.9 0.6 1 200 l5 ASN CA C 54.6 0.6 1 201 l5 ASN CB C 36.3 0.6 l 203 l5 ASN N N 115.8 0.3 1 204 15 ASN ND2 N 115.4 0.3 1 205 16 SER H H 7.34 0.02 I
206 16 SER HA H 4.93 0.02 207 16 SER HB2 H 3.62 0.02 208 16 SER HB3 H 3.52 0.02 210 16 SER C C 173.5 0.6 l 211 16 SER CA C 57.5 0.6 1 212 16 SER CB C 67.9 0.6 I
213 16 SER N N 109.9 0.3 1 214 17 GLY H H 8.92 0.02 21 17 GLY HA2 H 3.83 0.02 216 17 GLY HA3 H 2.06 0.02 217 17 GLY C C ? ? ?
218 l7 GLY CA C 42.6 0.6 1 219 17 GLY N N 108.5 0.3 1 220 l8 CYS H H 7.01 0.02 221 l8 CYS HA H 5.63 0.02 222 18 CYS HB2 H 3.01 0.02 223 18 CYS HB3 H 3.01 0.02 l 225 18 CYS C C 172.5 0.6 l 226 18 CYS CA C 55.8 0.6 1 227 18 CYS CB C 43.2 0.6 1 228 18 CYS N N 120.5 0.3 1 229 19 PHE H H 9.12 0.02 230 19 PHE HA H 4.43 0.02 l 231 19 PHE HB2 H 1.70 0.02 232 19 PHE HB3 H 0.62 0.02 233 19 PHE HD1 H 6.12 0.02 234 19 PHE HD2 H 6.12 0.02 l 23S 19 PHE HE1 H 6.30 0.02 236 19 PHE HE2 H 6.30 0.02 237 19 PHE HZ H 6.37 0.02 l 238 19 PHE C C 172.3 0.6 1 239 19 PHE CA C 57.0 0.6 1 240 19 PHE CB C 41.7 0.6 I
247 19 PHE N N 132.0 0.6 1 248 20 ARG H H 7.76 0.02 249 20 ARG HA H 4.83 0.02 250 20 ARG HB2 H 1.26 0.02 251 20 ARG HB3 H 0.99 0.02 252 20 ARG HG2 H 1.59 0.02 253 20 ARG HG3 H 1.42 0.02 254 20 ARG HD2 H 3.35 0.02 2SS 20 ARG HD3 H 3.10 0.02 2S6 20 ARG HE H 7.18 0.02 257 20 ARG HH 11 H 6.23 0.02 2S8 20 ARG HH12 H 6.23 0.02 259 20 ARG HH21 H 6.23 0.02 260 20 ARG HH22 H 6.23 0.02 261 20 ARG C C 174.7 0.6 1 262 20 ARG CA C 54.3 0.6 1 263 20 ARG CB C 32.3 0.6 I
264 20 ARG CG C 28.0 0.6 1 265 20 ARG CD C 44.1 0.6 1 267 20 ARG N N 129.4 0.3 1 268 20 ARG NE N 85.0 0.3 1 269 20 ARG NH1 N 70.1 0.3 5 270 20 ARG NH2 N 70.1 0.3 5 271 21 HIS H H 9.30 0.02 272 21 HIS HA H 4.50 0.02 273 21 HIS HB2 H 3.52 0.02 274 21 HIS HB3 H 3.44 0.02 276 21 HIS HD2 H 7.02 0.02 277 21 HIS HE1 H 8.44 0.02 279 21 HIS C C 177.6 0.6 1 280 21 HIS CA C 56.4 0.6 1 281 21 HIS CB C 32.2 0.6 1 285 21 HIS N N 125.9 0.3 1 288 22 LEU H H 9.30 0.02 289 22 LEU HA H 4.11 0.02 I
290 22 LEU HB2 H 1.87 0.02 291 22 LEU HB3 H 1.65 0.02 l 292 22 LEU HG H 1.87 0.02 293 22 LEU HD 1 H 0.77 0.02 294 22 LEU HD2 H 0.98 0.02 295 22 LEU C C 177.7 0.6 1 296 22 LEU CA C 57.7 0.6 I
297 22 LEU CB C 40.8 0.6 l 298 22 LEU CG C 27.6 0.6 l 299 22 LEU CD 1 C 22.6 0.6 2 300 22 LEU CD2 C 25.3 0.6 2 301 22 LEU N N 122.0 0.3 1 302 23 ASP H H 7.86 0.02 303 23 ASP HA H 4.52 0.02 l 304 23 ASP HB2 H 3.10 0.02 305 23 ASP HB3 H 2.53 0.02 306 23 ASP C C 176.8 0.6 1 307 23 ASP CA C 53.6 0.6 1 308 23 ASP CB C 39.7 0.6 1 310 23 ASP N N 116.9 0.3 I
311 24 GLU H H 8.01 0.02 312 24 GLU HA H 3.63 0.02 313 24 GLU HB2 H 2.57 0.02 314 24 GLU HB3 H 2.17 0.02 315 24 GLU HG2 H 2.14 0.02 I
316 24 GLU HG3 H 2.14 0.02 317 24 GLU C C 176.1 0.6 l 318 24 GLU CA C 59.4 0.6 1 319 24 GLU CB C 27.5 0.6 1 320 24 GLU CG C 37.0 0.6 I
322 24 GLU N N 110.3 0.3 1 323 25 ARG H H 8.04 0.02 I
324 25 ARG HA H 4.24 0.02 325 25 ARG HB2 H 1.84 0.02 326 25 ARG HB3 H 1.75 0.02 327 25 ARG HG2 H 1.56 0.02 328 25 ARG HG3 H 1.56 0.02 329 25 ARG HD2 H 3.16 0.02 l 330 25 ARG HD3 H 3.16 0.02 331 25 ARG HE H 8.01 0.02 332 25 ARG HH11 H 6.71 0.02 333 25 ARG HH12 H 6.71 0.02 334 25 ARG HH21 H 6.71 0.02 335 25 ARG HH22 H 6.71 0.02 336 25 ARG C C 175.6 0.6 1 337 25 ARG CA C 57.8 0.6 1 338 25 ARG CB C 31.0 0.6 1 339 25 ARG CG C 28.3 0.6 1 340 25 ARG CD C 43.5 0.6 1 342 25 ARG N N 121.9 0.3 1 343 25 ARG NE N 85.8 0.3 1 344 25 ARG NH1 N 70.3 0.3 5 345 25 ARG NH2 N 70.3 0.3 5 346 26 GLU H H 8.69 0.02 347 26 GLU HA H 5.40 0.02 348 26 GLU HB2 H 1.90 0.02 349 26 GLU HB3 H 1.90 0.02 I
350 26 GLU HG2 H 2.63 0.02 351 26 GLU HG3 H 2.09 0.02 352 26 GLU C C 173.6 0.6 1 353 26 GLU CA C 55.6 0.6 1 354 26 GLU CB C 37.9 0.6 1 355 26 GLU CG C 31.5 0.6 1 357 26 GLU N N 124.3 0.3 1 358 27 GLU H H 9.07 0.02 359 27 GLU HA H 4.84 0.02 360 27 GLU HB2 H 2.15 0.02 361 27 GLU HB3 H 2.27 0.02 362 27 GLU HG2 H 2.48 0.02 363 27 GLU HG3 H 2.32 0.02 364 27 GLU C C 174.5 0.6 1 365 27 GLU CA C 54.6 0.6 l 366 27 GLU CB C 34.8 0.6 I
367 27 GLU CG C 36.5 0.6 1 369 27 GLU N N 123.9 0.3 1 370 28 CYS H H 8.88 0.02 371 28 CYS HA H 5.65 0.02 372 28 CYS HB2 H 3.00 0.02 373 28 CYS HB3 H 2.81 0.02 375 28 CYS C C 175.5 0.6 l 376 28 CYS CA C 53.0 0.6 l 377 28 CYS CB C 40.9 0.6 1 378 28 CYS N N 122.0 0.3 1 379 29 LYS H H 8.76 0.02 380 29 LYS HA H 4.56 0.02 I
381 29 LYS HB2 H 1.40 0.02 I
382 29 LYS HB3 H 1.40 0.02 I
383 29 LYS HG2 H 1.38 0.02 384 29 LYS HG3 H 1.38 0.02 I
385 29 LYS HD2 H 1.13 0.02 386 29 LYS HD3 H 0.92 0.02 387 29 LYS HE2 H 2.86 0.02 388 29 LYS HE3 H 2.86 0.02 389 29 LYS HZ H 7.23 0.02 390 29 LYS C C 174.6 0.6 1 391 29 LYS CA C 56.4 0.6 1 392 29 LYS CB C 38.4 0.6 1 393 29 LYS CG C 25.8 0.6 1 394 29 LYS CD C 29.6 0.6 l 395 29 LYS CE C 42.4 0.6 1 396 29 LYS N N 124.0 0.3 1 397 29 LYS NZ N 33.0 0.3 5 398 30 CYS H H 8.78 0.02 I
399 30 CYS HA H 4.65 0.02 l 2.49 0.02 401 30 CYS HB3 H 3.01 0.02 403 30 CYS C C 173.3 0.6 I
404 30 CYS CA C 54.6 0.6 1 405 30 CYS CB C 35.9 0.6 1 406 30 CYS N N 121.7 0.3 1 407 31 LEU H H 7.81 0.02 I
408 31 LEU HA H 4.23 0.02 409 31 LEU HB2 H 1.39 0.02 410 31 LEU HB3 H 1.73 0.02 411 31 LEU HG H 0.94 0.02 412 3 I LEU HD 1 H 0.68 0.02 413 31 LEU HD2 H 0.77 0.02 414 31 LEU C C 176.2 0.6 1 415 31 LEU CA C 54.8 0.6 1 416 31 LEU CB C 42.5 0.6 1 417 31 LEU CG C 27.1 0.6 1 418 31 LEU CD 1 C 26.0 0.6 1 419 31 LEU CD2 C 21.9 0.6 I
420 31 LEU N N 119.2 0.3 l 421 32 LEU H H 8.91 0.02 l 422 32 LEU HA H 4.26 0.02 423 32 LEU HB2 H 1.75 0.02 l 424 32 LEU HB3 H 1.32 0.02 425 32 LEU HG H 1.77 0.02 l 426 32 LEU HD1 H 0.96 0.02 l 427 32 LEU HD2 H 0.77 0.02 I
428 32 LEU C C 179.0 0.6 l 429 32 LEU CA C 56.4 0.6 1 430 32 LEU CB C 42.1 0.6 1 431 32 LEU CG C 26.9 0.6 l 432 32 LEU CD1 C 26.0 0.6 l 433 32 LEU CD2 C 23.4 0.6 1 434 32 LEU N N 118.4 0.3 1 435 33 ASN H H 8.84 0.02 436 33 ASN HA H 3.90 0.02 437 33 ASN HB2 H 3.26 0.02 l 438 33 ASN HB3 H 2.88 0.02 439 33 ASN HD21 H 6.86 0.02 I
440 33 ASN HD22 H 7.25 0.02 l 441 33 ASN C C 173.8 0.6 I
442 33 ASN CA C 56.9 0.6 1 443 33 ASN CB C 37.3 0.6 1 445 33 ASN N N 110.8 0.3 1 446 33 ASN ND2 N 112.0 0.3 1 447 34 TYR H H 8.61 0.02 448 34 TYR HA H 5.02 0.02 449 34 TYR HB2 H 3.35 0.02 450 34 TYR HB3 H 2.52 0.02 45 34 TYR HD 1 H 6.74 0.02 l 1 452 34 TYR HD2 H 6.74 0.02 453 34 TYR HEI H 6.69 0.02 454 34 TYR HE2 H 6.69 0.02 456 34 TYR C C 174.7 0.6 I
457 34 TYR CA C 57.6 0.6 l 458 34 TYR CB C 41.0 0.6 1 465 34 TYR N N 118.6 0.3 1 466 35 LYS H H 9.99 0.02 467 35 LYS HA H 4.84 0.02 468 35 LYS HB2 H 1.82 0.02 469 35 LYS HB3 H 1.59 0.02 470 35 LYS HG2 H 1.18 0.02 471 35 LYS HG3 H 1.18 0.02 472 35 LYS HD2 H 1.48 0.02 473 35 LYS HD3 H 1.48 0.02 474 35 LYS HE2 H 2.89 0.02 475 35 LYS HE3 H 2.89 0.02 477 35 LYS C C 174.1 0.6 1 478 35 LYS CA C 54.2 0.6 I
479 35 LYS CB C 36.3 0.6 1 480 35 LYS CG C 24.1 0.6 1 481 35 LYS CD C 29.6 0.6 I
482 35 LYS CE C 41.6 0.6 I
483 35 LYS N N 119.7 0.3 1 485 36 GLN H H 8.77 0.02 I
486 36 GLN HA H 4.67 0.02 487 36 GLN HB2 H 2.06 0.02 488 36 GLN HB3 H 2.06 0.02 489 36 GLN HG2 H 2.35 0.02 490 36 GLN HG3 H 2.35 0.02 I
491 36 GLN HE21 H 7.50 0.02 492 36 GLN HE22 H 6.55 0.02 493 36 GLN C C 176.3 0.6 I
494 36 GLN CA C 56.7 0.6 I
495 36 GLN CB C 28.6 0.6 1 496 36 GLN CG C 33.7 0.6 I
498 36 GLN N N 124.9 0.3 1 499 36 GLN NE2 N 110.9 0.3 1 500 37 GLU H H 8.96 0.02 I
501 37 GLU HA H 4.51 0.02 I
502 37 GLU HB2 H 1.96 0.02 503 37 GLU HB3 H 1.80 0.02 504 37 GLU HG2 H 2.11 0.02 505 37 GLU HG3 H 2.11 0.02 506 37 GLU C C 176.2 0.6 I
507 37 GLU CA C 56.0 0.6 1 508 37 GLU CB C 31.9 0.6 1 509 37 GLU CG C 36.6 0.6 1 5ll 37 GLU N N 130.2 0.3 1 512 38 GLY H H 9.20 0.02 513 38 GLY HA2 H 3.69 0.02 514 38 GLY HA3 H 4.05 0.02 515 38 GLY C C 174.7 0.6 1 516 38 GLY CA C 47.4 0.6 l 517 38 GLY N N 118.4 0.3 l 518 39 ASP H H 8.81 0.02 519 39 ASP HA H 4.69 0.02 520 39 ASP HB2 H 2.78 0.02 521 39 ASP HB3 H 2.78 0.02 522 39 ASP C C 175.2 0.6 1 523 39 ASP CA C 54.2 0.6 1 524 39 ASP CB C 41.0 0.6 1 526 39 ASP N N 127.1 0.3 1 527 40 LYS H H 7.86 0.02 528 40 LYS HA H 4.71 0.02 529 40 LYS HB2 H 1.86 0.02 530 40 LYS HB3 H 1.86 0.02 531 40 LYS HG2 H 1.52 0.02 532 40 LYS HG3 H 1.52 0.02 I
533 40 LYS HD2 H 1.69 0.02 534 40 LYS HD3 H 1.69 0.02 535 40 LYS HE2 H 3.02 0.02 536 40 LYS HE3 H 3.02 0.02 538 40 LYS C C 175.4 0.6 I
539 40 LYS CA C 54.8 0.6 1 540 40 LYS CB C 36.3 0.6 1 541 40 LYS CG C 24.9 0.6 1 542 40 LYS CD C 29.0 0.6 1 543 40 LYS CE C 42.0 0.6 1 544 40 LYS N N 118.0 0.3 1 546 41 CYS H H 8.95 0.02 547 41 CYS HA H 5.29 0.02 548 41 CYS HB2 H 3.00 0.02 549 41 CYS HB3 H 2.58 0.02 551 41 CYS C C 174.4 0.6 1 552 41 CYS CA C 55.0 0.6 l 553 4l CYS CB C 41.9 0.6 1 554 4l CYS N N 119.8 0.3 1 555 42 VAL H H 9.35 0.02 556 42 VAL HA H 4.88 0.02 557 42 VAL HB H 2.32 0.02 l 558 42 VAL HG1 H 1.00 0.02 559 42 VAL HG2 H 0.88 0.02 560 42 VAL C C 175.6 0.6 I
561 42 VAL CA C 59.2 0.6 1 562 42 VAL CB C 35.2 0.6 1 563 42 VAL CG 1 C 21.6 0.6 1 564 42 VAL CG2 C 19.3 0.6 1 565 42 VAL N N 118.7 0.3 1 566 43 GLU H H 9.18 0.02 567 43 GLU HA H 3.34 0.02 568 43 GLU HB2 H 1.84 0.02 569 43 GLU HB3 H 1.75 0.02 570 43 GLU HG2 H 2.15 0.02 571 43 GLU HG3 H 2.07 0.02 572 43 GLU C C 175.4 0.6 1 573 43 GLU CA C 59.0 0.6 1 574 43 GLU CB C 29.8 0.6 1 575 43 GLU CG C 36.8 0.6 I
577 43 GLU N N 123.4 0.3 1 578 44 ASN H H 8.25 0.02 l 579 44 ASN HA H 4.95 0.02 580 44 ASN HB2 H 2.72 0.02 581 44 ASN HB3 H 1.97 0.02 582 44 ASN HD21 H 8.07 0.02 583 44 ASN HD22 H 7.24 0.02 584 44 ASN C C ? ? ?
585 44 ASN CA C 48.5 0.6 1 586 44 ASN CB C 39.2 0.6 1 588 44 ASN N N 120.2 0.3 589 44 ASN ND2 N 112.1 0.3 l 590 45 PRO HA H 4.40 0.02 l 591 45 PRO HB2 H 2.31 0.02 I
592 45 PRO HB3 H 1.95 0.02 l 593 45 PRO HG2 H 1.97 0.02 l 594 45 PRO HG3 H 1.97 0.02 l 595 45 PRO HD2 H 3.86 0.02 596 45 PRO HD3 H 3.81 0.02 597 45 PRO C C 176.2 0.6 1 598 45 PRO CA C 63.7 0.6 l 599 45 PRO CB C 32.6 0.6 l 600 45 PRO CG C 26.8 0.6 I
601 45 PRO CD C 50.9 0.6 I
603 46 ASN H H 7.47 0.02 604 46 ASN HA H 5.09 0.02 605 46 ASN HB2 H 2.72 0.02 606 46 ASN HB3 H 2.43 0.02 607 46 ASN HD21 H 7.57 0.02 608 46 ASN HD22 H 6.91 0.02 609 46 ASN C C ? ? ?
610 46 ASN CA C 51.6 0.6 1 611 46 ASN CB C 40.1 0.6 1 613 46 ASN N N 114.0 0.3 1 614 46 ASN ND2 N 112.6 0.3 1 615 47 PRO HA H 4.34 0.02 616 47 PRO HB2 H 1.97 0.02 617 47 PRO HB3 H 1.77 0.02 618 47 PRO HG2 H 1.96 0.02 619 47 PRO HG3 H 1.96 0.02 620 47 PRO HD2 H 3.52 0.02 621 47 PRO HD3 H 3.39 0.02 622 47 PRO C C 175.5 0.6 1 623 47 PRO CA C 63.7 0.6 1 624 47 PRO CB C 32.4 0.6 1 625 47 PRO CG C 27.5 0.6 1 626 47 PRO CD C 49.8 0.6 1 628 48 THR H H 8.28 0.02 629 48 THR HA H 4.68 0.02 630 48 THR HB H 4.32 0.02 632 48 THR HG2 H 1.13 0.02 633 48 THR C C 174.5 0.6 1 634 48 THR CA C 59.1 0.6 1 635 48 THR CB C 69.9 0.6 1 636 48 THR CG2 C 19.3 0.6 1 637 48 THR N N 112.4 0.3 1 638 49 CYS H H 9.35 0.02 639 49 CYS HA H 4.44 0.02 l 640 49 CYS HB2 H 2.64 0.02 l 641 49 CYS HB3 H 3.14 0.02 643 49 CYS C C 175.8 0.6 l 644 49 CYS CA C 55.5 0.6 1 645 49 CYS CB C 37.7 0.6 1 646 49 CYS N N 125.3 0.3 1 647 50 ASN H H 8.36 0.02 648 50 ASN HA H 4.60 0.02 649 50 ASN HB2 H 2.88 0.02 I
650 50 ASN HB3 H 2.70 0.02 I
651 50 ASN HD21 H 7.60 0.02 652 50 ASN HD22 H 6.97 0.02 653 50 ASN C C 174.4 0.6 1 654 50 ASN CA C 54.8 0.6 I
655 50 ASN CB C 38.9 0.6 1 657 50 ASN N N 116.4 0.3 1 658 50 ASN ND2 N 113.6 0.3 1 659 51 GLU H H 7.43 0.02 660 5l GLU HA H 4.64 0.02 661 51 GLU HB2 H 1.96 0.02 662 51 GLU HB3 H 1.81 0.02 663 51 GLU HG2 H 2.12 0.02 664 51 GLU HG3 H 2.12 0.02 665 51 GLU C C 176.1 0.6 1 666 51 GLU CA C 55.3 0.6 1 667 51 GLU CB C 31.5 0.6 1 668 51 GLU CG C 36.1 0.6 I
670 51 GLU N N 119.2 0.3 1 671 52 ASN H H 9.57 0.02 672 52 ASN HA H 4.45 0.02 l 673 52 ASN HB2 H 3.14 0.02 674 52 ASN HB3 H 2.64 0.02 675 52 ASN HD21 H 6.99 0.02 676 52 ASN HD22 H 7.71 0.02 l 677 52 ASN C C 176.4 0.6 1 678 52 ASN CA C 54.2 0.6 1 679 52 ASN CB C 37.8 0.6 1 681 52 ASN N N 125.4 0.3 1 682 52 ASN ND2 N 112.8 0.3 1 683 53 ASN H H 9.31 0.02 684 53 ASN HA H 4.64 0.02 685 53 ASN HB2 H 3.25 0.02 686 53 ASN HB3 H 2.31 0.02 687 53 ASN HD21 H 6.95 0.02 l 688 53 ASN HD22 H 6.26 0.02 689 53 ASN C C 176.2 0.6 1 690 53 ASN CA C 54.1 0.6 1 691 53 ASN CB C 39.2 0.6 l 693 53 ASN N N 119.3 0.3 1 694 53 ASN ND2 N 111.6 0.3 1 695 54 GLY H H 7.92 0.02 l 696 54 GLY HA2 H 4.28 0.02 l 697 54 GLY HA3 H 3.67 0.02 698 54 GLY C C 173.0 0.6 1 699 54 GLY CA C 46.3 0.6 l 700 54 GLY N N 106.3 0.3 1 701 55 GLY H H 8.06 0.02 702 55 GLY HA2 H 4.39 0.02 703 55 GLY HA3 H 3.47 0.02 704 55 GLY C C 175.1 0.6 I
705 55 GLY CA C 44.4 0.6 1 706 55 GLY N N 105.3 0.3 1 707 56 CYS H H 7.77 0.02 708 56 CYS HA H 4.39 0.02 709 56 CYS HB2 H 3.12 0.02 710 56 CYS HB3 H 2.81 0.02 l 712 56 CYS C C 175.2 0.6 l 713 56 CYS CA C 53.1 0.6 1 714 56 CYS CB C 36.6 0.6 I
715 56 CYS N N 117.6 0.3 1 716 57 ASP H H 8.37 0.02 717 57 ASP HA H 3.98 0.02 718 57 ASP HB2 H 2.24 0.02 719 57 ASP HB3 H 2.03 0.02 720 57 ASP C C 176.0 0.6 1 721 57 ASP CA C 56.0 0.6 1 722 57 ASP CB C 45.0 0.6 1 724 57 ASP N N 122.3 0.3 1 725 58 ALA H H 8.48 0.02 726 58 ALA HA H 3.98 0.02 727 58 ALA HB H 1.41 0.02 728 58 ALA C C 178.9 0.6 1 729 58 ALA CA C 55.6 0.6 1 730 58 ALA CB C 19.1 0.6 1 731 58 ALA N N 127.2 0.3 1 732 59 ASP H H 9.11 0.02 733 59 ASP HA H 4.90 0.02 734 59 ASP HB2 H 2.44 0.02 73S 59 ASP HB3 H 2.82 0.02 736 59 ASP C C 174.6 0.6 1 737 59 ASP CA C 53.9 0.6 1 738 59 ASP CB C 40.7 0.6 1 740 59 ASP N N 116.7 0.3 1 741 60 ALA H H 7.94 0.02 742 60 ALA HA H 5.13 0.02 743 60 ALA HB H 1.27 0.02 744 60 ALA C C 176.3 0.6 1 745 60 ALA CA C 50.5 0.6 1 746 60 . ALA CB C 21.3 0.6 1 747 60 ALA N N 121.9 0.3 1 748 61 LYS H H 9.06 0.02 749 61 LYS HA H 4.54 0.02 750 61 LYS HB2 H 1.77 0.02 751 61 LYS HB3 H 1.77 0.02 752 61 LYS HG2 H 1.31 0.02 753 61 LYS HG3 H 1.39 0.02 754 61 LYS HD2 H 1.72 0.02 755 61 LYS HD3 H 1.63 0.02 756 61 LYS HE2 H 2.92 0.02 757 61 LYS HE3 H 2.92 0.02 759 61 LYS C C 175.7 0.6 1 760 61 LYS CA C 55.1 0.6 1 761 61 LYS CB C 34.1 0.6 l 762 61 LYS CG C 24.6 0.6 1 763 61 LYS CD C 29.1 0.6 1 764 61 LYS CE C 42.1 0.6 I
76S 61 LYS N N 122.5 0.3 1 767 62 CYS H H 9.19 0.02 768 62 CYS HA H 5.32 0.02 769 62 CYS HB2 H 2.44 0.02 770 62 CYS HB3 H 2.80 0.02 772 62 CYS C C 174.5 0.6 1 773 62 CYS CA C 56.1 0.6 1 774 62 CYS CB C 37.6 0.6 I
775 62 CYS N N 131.5 0.3 I
776 63 THR H H 9.23 0.02 777 63 THR HA H 4.51 0.02 I
778 63 THR HB H 4.01 0.02 780 63 THR HG2 H 1.16 0.02 l 781 63 THR C C 172.2 0.6 1 782 63 THR CA C 62.8 0.6 1 783 63 THR CB C 71.5 0.6 l 784 63 THR CG2 C 22.0 0.6 I
785 63 THR N N 125.9 0.3 1 786 64 GLU H H 8.61 0.02 l 787 64 GLU HA H 5.12 0.02 788 64 GLU HB2 H 1.90 0.02 789 64 GLU HB3 H 1.90 0.02 790 64 GLU HG2 H 2.30 0.02 791 64 GLU HG3 H 2.30 0.02 792 64 GLU C C ? ? ?
793 64 GLU CA C 54.4 0.6 1 794 64 GLU CB C 32.0 0.6 1 795 64 GLU CG C 36.8 0.6 1 797 64 GLU N N 123.0 0.3 1 798 65 GLU H H 8.76 0.02 799 65 GLU HA H 4.60 0.02 800 65 GLU HB2 H 2.01 0.02 801 65 GLU HB3 H 1.86 0.02 802 65 GLU HG2 H 2.15 0.02 803 65 GLU HG3 H 2.15 0.02 l 804 65 GLU C C ? ? ?
805 65 GLU CA C 55.1 0.6 1 806 65 GLU CB C 32.9 0.6 1 807 65 GLU CG C 36.1 0.6 1 809 65 GLU N N 123.0 0.3 1 810 66 ASP H H 8.79 0.02 811 66 ASP HA H 4.80 0.02 812 66 ASP HB2 H 2.80 0.02 813 66 ASP HB3 H 2.58 0.02 814 66 ASP C C 176.4 0.6 1 815 66 ASP CA C 54.8 0.6 1 816 66 ASP CB C 41.2 0.6 1 818 66 ASP N N 123.9 0.3 1 819 67 SER H H 8.38 0.02 820 67 SER HA H 4.55 0.02 821 67 SER HB2 H 3.83 0.02 822 67 SER HB3 H 3.70 0.02 824 67 SER C C 175.4 0.6 1 825 67 SER CA C 58.0 0.6 1 826 67 SER CB C 64.6 0.6 I
827 67 SER N N 119.1 0.3 1 828 68 GLY H H 8.65 0.02 829 68 GLY HA2 H 4.13 0.02 830 68 GLY HA3 H 3.85 0.02 831 68 GLY C C 175.0 0.6 1 832 68 GLY CA C 46.0 0.6 1 833 68 GLY N N 112.2 0.3 1 834 69 SER H H 8.58 0.02 835 69 SER HA H 4.42 0.02 l 836 69 SER HB2 H 3.87 0.02 837 69 SER HB3 H 3.87 0.02 l 839 69 SER C C 174.8 0.6 l 840 69 SER CA C 59.1 0.6 1 841 69 SER CB C 63.4 0.6 1 842 69 SER N N 117.7 0.3 1 843 70 ASN H H 8.39 0.02 844 70 ASN HA H 4.74 0.02 845 70 ASN HB2 H 2.94 0.02 846 70 ASN HB3 H 2.77 0.02 847 70 ASN HD21 H ? ?
848 70 ASN HD22 H ? ?
849 70 ASN C C ? ? ?
850 70 ASN CA C 53.8 0.6 1 851 70 ASN CB C 38.9 0.6 1 853 70 ASN N N 118.4 0.3 1 854 70 ASN ND2 N ? ? ?
855 71 GLY H H 7.88 0.02 856 71 GLY HA2 H 4.07 0.02 857 71 GLY HA3 H 4.07 0.02 858 71 GLY C C 173.7 0.6 1 859 71 GLY CA C 45.0 0.6 1 860 71 GLY N N 108.1 0.3 1 861 72 LYS H H 8.39 0.02 862 72 LYS HA H 4.84 0.02 863 72 LYS HB2 H 1.75 0.02 864 72 LYS HB3 H 1.59 0.02 865 72 LYS HG2 H 1.46 0.02 866 72 LYS HG3 H 1.38 0.02 867 72 LYS HD2 H 1.66 0.02 868 72 LYS HD3 H 1.66 0.02 869 72 LYS HE2 H 2.93 0.02 870 72 LYS HE3 H 2.93 0.02 872 72 LYS C C 173.7 0.6 1 873 72 LYS CA C 55.4 0.6 1 874 72 LYS CB C 35.0 0.6 1 875 72 LYS CG C 24.9 0.6 1 876 72 LYS CD C 28.9 0.6 1 877 72 LYS CE C 42.2 0.6 1 878 72 LYS N N 120.8 0.3 1 880 73 LYS H H 8.81 0.02 881 73 LYS HA H 4.64 0.02 882 73 LYS HB2 H 1.71 0.02 883 73 LYS HB3 H 1.71 0.02 884 73 LYS HG2 H 1.36 0.02 885 73 LYS HG3 H 1.25 0.02 886 73 LYS HD2 H 1.63 0.02 l 887 73 LYS HD3 H 1.63 0.02 888 73 LYS HE2 H 2.89 0.02 889 73 LYS HE3 H 2.89 0.02 891 73 LYS C C 175.3 0.6 1 892 73 LYS CA C 55.0 0.6 1 893 73 LYS CB C 35.4 0.6 1 894 73 LYS CG C 24.6 0.6 1 895 73 LYS CD C ? ? ?
896 73 LYS CE C ? ?
897 73 LYS N N 122.6 0.3 I
899 74 ILE H H 8.54 0.02 l 900 74 ILE HA H 4.83 0.02 l 901 74 ILE HB H 1.91 0.02 l 902 74 ILE HG 12 H 1.50 0.02 903 74 ILE HG13 H 1.50 0.02 904 74 ILE HG2 H 1.00 0.02 905 74 ILE HD1 H 0.57 0.02 906 74 ILE C C 176.2 0.6 I
907 74 ILE CA C 58.4 0.6 I
908 74 ILE CB C 38.4 0.6 I
909 74 ILE CG1 C 27.1 0.6 1 910 74 ILE CG2 C 19.0 0.6 1 911 74 ILE CD1 C 10.3 0.6 1 912 74 ILE N N 126.8 0.3 1 913 75 THR H H 8.88 0.02 I
914 75 THR HA H 4.51 0.02 915 75 THR HB H 4.01 0.02 l 917 75 THR HG2 H 1.15 0.02 918 75 THR C C 172.4 0.6 1 919 75 THR CA C 61.2 0.6 1 920 75 THR CB C 71.5 0.6 1 921 75 THR CG2 C 22.0 0.6 l 922 75 THR N N 120.3 0.3 1 923 76 CYS H H 8.82 0.02 924 76 CYS HA H 5.53 0.02 925 76 CYS HB2 H 3.28 0.02 926 76 CYS HB3 H 2.69 0.02 928 76 CYS C C 174.7 0.6 l 929 76 CYS CA C 52.2 0.6 1 930 76 CYS CB C 40.6 0.6 1 931 76 CYS N N 121.5 0.3 I
932 77 GLU H H 8.64 0.02 l 933 77 GLU HA H 4.74 0.02 934 77 GLU HB2 H 1.94 0.02 935 77 GLU HB3 H 1.94 0.02 t 936 77 GLU HG2 H 1.83 0.02 I
937 77 GLU HG3 H 1.83 0.02 I
938 77 GLU C C 175.7 0.6 1 939 77 GLU CA C 54.7 0.6 I
940 77 GLU CB C 33.1 0.6 I
941 77 GLU CG C 36.1 0.6 1 943 77 GLU N N 123.0 0.3 1 944 78 CYS H H 9.71 0.02 945 78 CYS HA H 4.48 0.02 I
946 78 CYS HB2 H 2.63 0.02 I
947 78 CYS HB3 H 3.30 0.02 949 78 CYS C C 175.8 0.6 1 950 78 CYS CA C 57.4 0.6 1 951 78 CYS CB C 39.2 0.6 1 952 78 CYS N N 129.1 0.3 1 953 79 THR H H 8.20 0.02 l 954 79 THR HA H 4.25 0.02 l 955 79 THR HB H 4.25 0.02 957 79 THR HG2 H 1.25 0.02 I
958 79 THR C C 176.2 0.6 1 959 79 THR CA C 63.4 0.6 I
960 79 THR CB C 70.1 0.6 1 961 79 THR CG2 C 22.2 0.6 1 962 79 THR N N 114.7 0.3 1 963 80 LYS H H 8.56 0.02 964 80 LYS HA H 4.50 0.02 965 80 LYS HB2 H 1.79 0.02 966 80 LYS HB3 H 1.79 0.02 967 80 LYS HG2 H 1.47 0.02 968 80 LYS HG3 H 1.64 0.02 969 80 LYS HD2 H 1.70 0.02 970 80 LYS HD3 H 1.70 0.02 971 80 LYS HE2 H 2.94 0.02 972 80 LYS HE3 H 2.94 0.02 974 80 LYS C C ? ? ?
975 80 LYS CA C 55.4 0.6 1 976 80 LYS CB C 30.9 0.6 1 977 80 LYS CG C 25.6 0.6 1 978 80 LYS CD C 29.1 0.6 1 979 80 LYS CE C 42.1 0.6 1 980 80 LYS N N 124.8 0.3 1 982 81 PRO HA H 4.26 0.02 983 81 PRO HB2 H 2.27 0.02 984 81 PRO HB3 H 1.87 0.02 985 81 PRO HG2 H 2.10 0.02 986 81 PRO HG3 H 2.04 0.02 987 81 PRO HD2 H 3.90 0.02 988 81 PRO HD3 H 3.63 0.02 989 81 PRO C C 176.9 0.6 1 990 81 PRO CA C 64.2 0.6 1 991 81 PRO CB C 31.9 0.6 1 992 81 PRO CG C 27.8 0.6 1 993 81 PRO CD C 50.8 0.6 1 995 82 ASP H H 8.78 0.02 996 82 ASP HA H 4.25 0.02 997 82 ASP HB2 H 2.88 0.02 998 82 ASP HB3 H 2.77 0.02 999 82 ASP C C ? ? ?
1000 82 ASP CA C 5~.1 0.6 1 1001 82 ASP CB C 40.0 0.6 1 003 82 ASP N N 117.9 0.3 1 1004 83 SER H H 7.39 0.02 1005 83 SER HA H 4.47 0.02 1006 83 SER HB2 H 3.55 0.02 1007 83 SER HB3 H 3.50 0.02 1009 83 SER C C 175.4 0.6 1 1010 83 SER CA C 57.4 0.6 1 1011 83 SER CB C 65.9 0.6 1 1012 83 SER N N 112.9 0.3 1 1013 84 TYR H H 8.72 0.02 1014 84 TYR HA H 5.01 0.02 I
1015 84 TYR HB2 H 2.93 0.02 1016 84 TYR HB3 H 2.75 0.02 1017 84 TYR HDl H 6.92 0.02 1018 84 TYR HD2 H 6.92 0.02 1019 84 TYR HE1 H 6.69 0.02 1020 84 TYR HE2 H 6.69 0.02 1022 84 TYR C C ? ? ?
1023 84 TYR CA C 54.6 0.6 I
1024 84 TYR CB C 39.7 0.6 1 1031 84 TYR N N 122.2 0.3 I
1032 85 PRO HA H 5.09 0.02 I
1033 85 PRO HB2 H 2.25 0.02 1034 85 PRO HB3 H 1.72 0.02 1035 85 PRO HG2 H 2.22 0.02 1036 85 PRO HG3 H 2.22 0.02 l 1037 85 PRO HD2 H 3.85 0.02 t 1038 85 PRO HD3 H 3.85 0.02 1039 85 PRO C C 176.9 0.6 1 1040 85 PRO CA C 62.9 0.6 I
1041 85 PRO CB C 32.8 0.6 1 1042 85 PRO CG C 27.3 0.6 1 1043 85 PRO CD C 50.6 0.6 I
1045 86 LEU H H 8.51 0.02 I
1046 86 LEU HA H 4.77 0.02 1047 86 LEU HB2 H 1.76 0.02 1048 86 LEU HB3 H 1.76 0.02 1049 86 LEU HG H 1.85 0.02 1050 86 LEU HD I H 1.00 0.02 1051 86 LEU HD2 H 1.00 0.02 1052 86 LEU C C 177.9 0.6 I
1053 86 LEU CA C 54.5 0.6 1 1054 86 LEU CB C 44.8 0.6 1 1055 86 LEU CG C 29.0 0.6 1 1056 86 LEU CD1 C 25.7 0.6 1 1057 86 LEU CD2 C 25.7 0.6 I
1058 86 LEU N N 120.2 0.3 I
1059 87 PHE H H 9.29 0.02 l 1060 87 PHE HA H 4.16 0.02 1061 87 PHE HB2 H 3.26 0.02 1062 87 PHE HB3 H 3.19 0.02 1063 87 PHE HD1 H 7.31 0.02 1064 87 PHE HD2 H 7.31 0.02 1065 87 PHE HE1 H 7.70 0.02 1066 87 PHE HE2 H 7.70 0.02 1067 87 PHE HZ H 7.67 0.02 1068 87 PHE C C 176.4 0.6 1 1069 87 PHE CA C 59.3 0.6 1 1070 87 PHE CB C 36.9 0.6 1 1077 87 PHE N N 122.6 0.3 1 1078 88 ASP H H 8.93 0.02 1079 88 ASP HA H 4.33 0.02 1080 88 ASP HB2 H 3.11 0.02 1081 88 ASP HB3 H 3.02 0.02 1082 88 ASP C C 175.2 0.6 1 1083 88 ASP CA C 56.3 0.6 1 1084 88 ASP CB C 39.9 0.6 1 1086 88 ASP N N 111.3 0.3 1 1087 89 GLY H H 7.87 0.02 l 1088 89 GLY HA2 H 3.48 0.02 1089 89 GLY HA3 H 4.08 0.02 I
1090 89 GLY C C 174.7 0.6 1 1091 89 GLY CA C 46.0 0.6 1 1092 89 GLY N N 102.0 0.3 1 1093 90 ILE H H 7.17 0.02 I
1094 90 ILE HA H 4.39 0.02 I
1095 90 ILE HB H 1.52 0.02 I
1096 90 ILE HG 12 H 0.65 0.02 1097 90 ILE HG 13 H 0.65 0.02 1098 90 ILE HG2 H I.OS 0.02 l 1099 90 ILE HD1 H O.Sl 0.02 I
1100 90 ILE C C 175.1 0.6 l 1101 90 ILE CA C 64.2 0.6 l 1102 90 ILE CB C 35.9 0.6 l 1 90 ILE CG l C 25.5 0.6 t 1104 90 ILE CG2 C 16.9 0.6 l 1105 90 ILE CDl C 14.9 0.6 l 1106 90 ILE N N 113.3 0.3 l 1107 91 PHE H H 7.43 0.02 l 1108 91 PHE HA H 5.15 0.02 l 1109 91 PHE HB2 H 2.40 0.02 1110 91 PHE HB3 H 2.40 0.02 l 1 91 PHE HD 1 H 7.00 0.02 l 1 1112 91 PHE HD2 H 7.00 0.02 l 1 91 PHE HE 1 H 6.95 0.02 l 1 1114 91 PHE HE2 H 6.95 0.02 1115 91 PHE HZ H 7.06 0.02 1116 91 PHE C C 175.1 0.6 1 1117 91 PHE CA C 56.5 0.6 1 1118 91 PHE CB C 44.3 0.6 1 1125 91 PHE N N 114.0 0.3 l 1126 92 CYS H H 7.86 0.02 I
1127 92 CYS HA H 5.18 0.02 1128 92 CYS HB2 H 2.57 0.02 1129 92 CYS HB3 H 3.08 0.02 1131 92 CYS C C 174.1 0.6 1 1132 92 CYS CA C 54.1 0.6 1 1133 92 CYS CB C 44.7 0.6 l 1134 92 CYS N N 119.0 0.3 1 1135 93 SER H H 9.26 0.02 1136 93 SER HA H 4.23 0.02 l 1137 93 SER HB2 H 3.90 0.02 I
1138 93 SER HB3 H 3.90 0.02 l 1140 93 SER C C ? ? ?
1141 93 SER CA C 60.4 0.6 1 1142 93 SER CB C 63.7 0.6 1 1143 93 SER N N 118.3 0.3 I
1144 94 SER H H 8.04 0.02 I
1145 94 SER HA H 4.59 0.02 1146 94 SER HB2 H 3.91 0.02 1147 94 SER HB3 H 3.91 0.02 1149 94 SER C C ? ? ?
1150 94 SER CA C 58.7 0.6 1 1151 94 SER CB C 64.0 0.6 l 1152 94 SER N N 114.2 0.3 I
l 95 SER H H ? ? ?
l 1154 95 SER HA H 4.71 0.02 l 95 SER HB2 H 4.02 0.02 l 2 SS
1156 95 SER HB3 H 3.94 0.02 1158 95 SER C C ? ? ?
1159 95 SER CA C 58.4 0.6 1 1160 95 SER CB C 64.5 0.6 1 1161 95 SER N N ? ? ?
1162 96 ASN H H ? ? ?
1163 96 ASN HA H 4.61 0.02 1164 96 ASN HB2 H 2.75 0.02 1165 96 ASN HB3 H 2.60 0.02 1166 96 ASN HD21 H ? ? ?
1167 96 ASN HD22 H ? ?
1168 96 ASN C C ? ? ?
1169 96 ASN CA C 54.3 0.6 1 1170 96 ASN CB C 41.8 0.6 1 1172 96 ASN N N ? ? '' 1173 96 ASN ND2 N ? ? ?
stop # The following loop is used to define sets of Atom-shift assignment IDs that represent related ambiguous assignments taken from the above list of assigned chemical shifts. Each element in the set should be separated by a comma, as shown in the example below, and is the assignment ID
for a chemical shift assignment that has been given as ambiguity code of 4 or 5. Each set indicates that the observed chemical shifts are related to the defined atoms, but have not been assigned uniquely to a specific atom in the set.
loop-Atom shift assign-ID ambiguity # Sets of Atom-shift Assignment Ambiguities # __________________.
# Example: 5,4,7 stop- ###
##
## ----REMARKS---- ##
###
##
# # # # # # # # #
# PROTECTED BACKBONE AMIDE GROUPS
# (SLOWLY EXCHANGING IN D20) FOR RESIDUES:
# GLY 17 , PHE l9 , GLU 27 , LYS 29 , LEU 31 , # TYR 34 , LYS 35 , VAL 42 , CYS 56 , ASP 57 , # ALA 60 , LYS 61 , THR 63 , THR 75 , GLU 77 , # LEU 86 , GLY 89 , ILE 90 , PHE 91 # BROAD HN SIGNALS IN [15-N]-HSQC OBSERVED FOR RESIDUES:
# VAL8,LYS9,LYS10,CYS18,ARG20 # TWO BACKBONE HN CROSSPEAKS OBSERVED FOR RESIDUES:
# HIS 5 : 7.78,113.8 I 7.74,113.5 # GLN 6 : 7.44,122.6 / 7.40,122.4 # TWO AVERAGED NH*IHH* SIGNALS OBSERVED FOR RESIDUES:
# ARG 20 , ARG 25 : NOT SPECIFICALLY ASSIGNED
# TO INDIVIDUAL ARGININES
# LYS 29 NZIHZ* SIGNAL: TENTATIVELY ASSIGNED TO
# LYS 29 (BURIED LYSINE SIDE CHAIN) # BASED ON GREATER PROTECTION FROM H20 EXCHANGE
# THAN OTHER LYSINE NZ/HZ* SIGNALS
# ASPARAGINE SIDE CHAIN AMIDE SIGNALS:
# PROBABLE OVERLAPPING CROSSPEAKS ~112 PPM ['SN]
# FOR ASN 1 , ASN 70 , ASN 96 ###
##
# #
###
##
;a a~ ~
N N ~ ~ ~ 0~0 O~O
O
'X y N ~
vW n O O N O
(' C
O
.Y
cG ~ ~
_C_ ~1 r r vi t~ l~ ~ ~ ~n ~ ~n ~O
D ~ ~- O °° a, 00 os a, a, oo d; o, ~ ~ °' ~ ~ ~
°~ ~ N ~t c~i yr O. l~ M l~ M V1 N ~O M M I~ ~ V7 N_ ~
C d' 00 ~ 00 ~ 00 ~ 00 N ~ N ~ N ~ N ~ 00 N ('J o0 N N N ~O N ~O ~O
c~''G .a, 0 0 0 0 0 0 0 0 N ~ ~ N ~ ~ ~ ~n 0 ~ vl ~ vt LL, 'D ~r ~ N ~ N ~ N ~ N ~~ v1 ~n ~ ~1 in v1 N ~~ ~D N ~O N
N
LZ.
~ ~'1 v1 v1 W!1 ~ v'1 v'1 H ~ U N N N N N N N N
C
N
0 ~ ~ ° ~ °
r~ x n x x x o n U
C
N
C _ 4~ -.N.
i O O O O O O O O
O O O O O O O O
..rr. ~rrr ~ ~p ~O V~ ~ ~!1 V1 ~O ~O
T
U
4. ~ _ v N
U ~ ~ ~ ~ ~ ~ ~ ~ ~ V ~Y ~ ~ ~t Wit' O ~ N O N O
l~ I~ I~ I~ I~ t : I~ I~ N t~ I~ N l~ I~ t~ ~, I~ ~ O 0 O
U L.Tr ~O" ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ d' ~1' d' ~ ~ ~ M ~ M
C
O
~ _ 00 O v~ ~l ~n M ~ ~ O~ V' ~O M N ~O M N ~ M ~ ~ ~ l~~
Q H ~ ~n N ~ N ~ M ~n N ~ N l~ ~-~ N t~ N a, ~n v1 N ~1 ~n O
'~ U '~ ~ O O O O O O O O O O O O O O O O O O O O O
~, N ~p N O O O O O O O O O O O O O O O O O ~O O ~O O
,' O O O O O O O O v~ O O ~n O O N O N c~ ~O M v'1 yr 00 00 00 00 \O ~O C~ l~ N l~ I~ N I~ l~ I~ ~ l~ M M M ~
C~
LL _ >3. ~ ~, ~ ~h V V
~ a a a ~ O ~ O ~ O ~' O ~ O N O N O ~ ~O
O ~ ~~ O O v0 O v0 O ~O O v0 00 ~ N oo ~~ ~O ~D c0 c0 V' 00 v1 f~. yr ~ N M N N N M N M ~ v1 M ~ V1 ~ 01 M ~ l~ -~ N
a xx xx xx xx zxx zxx x~x~~z~x _ _ _ _ _ _ _ _ 0 7- can w a x °x °z .~~~.x~~~x~~z~~~~x~~~
aY a ,°z ° x x .,~ z z v 0 0 0 0 ~ ' v z z x x -E-~ w ~ ~ ~ ~ ~ ~ p ~ ~O ~-" --~ O O M ~D ~1' c"" ~ G1 M ~ ~O ~ N o0 '..r by G ~n _ M
C
.
O
~a a.
'~ ~ V1 -- v'1 N M ~W O 00 ~ rr O I~ ~ 00 l~
N o0 00 ~ ~ ~ O~ ~ ~ ~ O ~
~ O~ ~ ~ Oy O~ O~
O "' v1 N N -~ ~ M l~ l~ l~ ~
CG ~ N O M c~1 M
V
N Y .
~ N N
~
O 00 ~O 00 ~O o0 ~O o0 N ~O ~O ~O
N N V 'd' ~O
ca p"~~ N ~ O N V1 N V1 N ~-~ ~n W ~n ~n ~ ~ O ~ O O ~n O
LL ~ ~O - ~O V .-. ~ N ~-~ N N N
-p N o0 N ~n ~ v1 N N N
v1 ~
L
N
L
U ~1 U1 v1 ~ N ~ V1 v1 H c~C ~ N N N N N N N N
C
O
0 ~ 0 ~ 0 T
V
C
a~
N
y s.
O O O O O O O O
- ~r ~O v'1 V1 ~O ~D ~C ~O ~O
T
V
C
N
'~ a" ~ c~O~~ d~et ~~~ ~~~ ~~t~ ~~ ~~ own~n t3, O p ~ f~ I~ I~ N t~ I~ ,-, I~ I~ ,.r l~ l~ ,-, I~ ,~ I~ ~ N N
U CL ø ~' M ~ ~!' ~h ~t ~ ~ ~ ~~ ~ ~ ~ ~' ~ ~~ ~ ~ d' ~ N N
G
O
'~ N ~ ~O ~ ~ M ~O ~ ~ M N M O~
O' ~ m U N V1 ~ ch ~O ~h ~?' M M ~ ~ d' V'1 ~O ~ ~ ~ M ~!1 ~~ \O
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ~ o 0 N -p N ~O O O O O O O O O O O O O O O O O O O ~ O O
x M vo 00 ~ o o v-, v, o ~n o 0 00 0 0 00 0 00 0 0 00 0 yr M M ~ I~ ~O ~D N M I~ N 00 00 ~ 00 00 ~" 00 ~ 00 M t1" e~' _ _ a a E . ° °°
O O ~ ~~ ~t vD V~ ~ O O ~n O N ~t O ~ oo N ~ O M o0 N ~ l~ 0~0 U G. ~ ~ ~!1 ~-~ N ~-~ N M o0 v1 N Q1 v1 N ~~ h 00 ~ l~ ~ M V'1 M
U
a z~xzx xx zxx zxx z~xo,zxaz~ ~xx = x x o ' O
c w E z c c _ z c .~ ~ U Q ~ ~ Z U
a. a~
W rx D D D
.-, 00 V ~ M V1 -~ M
E~ 'ar ~ N ~ ~D N ~1 d' b17 C
' y ~
'r ~O V1 O ~
C_ ._~ ~ O
O O' pn a l~ v1 ~O ~O l~ I~ l~ ~- ~ ~O v1 --~ M ~-~ ~O
x oo a, ~~ O ,~ O ~ ~ ~ p ~ ~ 00 V~ ~ O~
CW r f~ M N N ~ N ~ M I~
a~
N ~
_~
~ 00 00 ~O ~ ~O
N ~ ~t O~ N O~ oo N N N N N c0 c0 N N o0 ~D o0 v0 N
= cYG Op"~ O O O O O O N --~ ~~ ~ ~--~ --~ N N ~ ~ N ~n N ~1 LL 'O ~ N N ~ ~ U1 V'1 N V1 ~ v1 V'1 N ~~ N
V
L~r ~
E-' ~N U N N N N N N N N
C
U
O O O O O o O o x x x x ~ x x x T
U
QJ N
O U N
L
Q, ,n ~ i '~"' O O O O O O O O
~x ~ ~ ~ ~ ~ ° ~ °
U
t, ~ _ N
L O, ~ ~O O O~ Q1 a1 O
M ~l' ~ ~f ~ 'Ch ~ '~ M ~ ~ M ~ V' CL I~ t~ ,~ t~ ,~; t~ ,_ U Ls. ø' et rt ~-- d ~t d' ~- ~ ~ ~ ~ ~t et ~~ ~ ~ ~ ~ --a ~O N M N N V~ ~ 01 V ~Y 00 M
a E-' ~ ~1 N ~ M ~ V1 N ~ ~ V1 \O ~ rl ~ M V ~h I~ U'1 Cf ~' N o0 --~ M ~~ ~~ N ~O N ~ l~ M r-~ v0 ~D .-W O --~ M vD
CL
U a'~.. y ~ O O O O O O O O O O C~ O O O O O O O O ~ O
N 'p ~ N O O O O O O O O O O ~ O O O O O O O O ~ O
~'3,~,x 0O ~o No v,00 ~nov', OooO 0000 00000 00 00 ~ 00 .~ pp N o0 00 V'1 00 V'1 .-. .~ 00 ,~ ,~ 00 ~~ ,~ 00 X _ _ a, Y
v ao o O ~ O O O N ~t o0 ~O N ~ N N
O y0 O vD N O N o0 00 ~ M N o0 ~D ~-~ M ~ N
U ~r ~ M N M ~ ~ ~ M ~~ V'7 .-. ~-~ d' M N V1 ~O N ~ c~1 ~O V1 N
N
xx zx ~x zxx x~~ ~zx ~zx zUx a x °' ~ x o ~- U x ~' x x H ~ '. z x a a o .~°~ozvzv~m~wz °' H ~. ~ ,~ x U v x o ~ o n~ n~ ~ n~
TABLE B
! merozoite surface protein-1 (MSP-1) P. falciparum C-terminal fragment ! X-PLOR format ! 09-11-98 ! --- noes + roes --approximate-- 570 total ! long-range 185 ! medium-range 90 ! sequential 222 ! intraresidue 73 ! hydrogen bonds 10 (20 restraints) !
! pseudoatom corrections not used -- for R-6 averaging/summation ! AVERAGING:
! class rt6s SUM
! class nsam SUM
! class sing ! class hbnd ! types:
! arom_ aromatic pair ! meth_ methyl ! dgnm_ degenerate methylene ! nsam_ non-stereospecifically-assigned methylene ! sing_ single proton ! _1 long-range (j-i > 4) ! _m medium-range (j-i =2-4) ! _s sequential (j-i = 1) ! _i intraresidue ! hbnd hydrogen bonds ! <residue-atom 1> <residue-atom 2> <dist-minus-plus>
<type>
class rt6s assign (resid 5 and name hb#) (resid 19 and name hd#) 3.6 3.6 0.0 !arom l assign (resid 5 and name hb#) (resid 19 and name he#) 3.6 3.6 0.0 !arom l assign (resid 15 and name ha) (resid 34 and name hd#) 3.6 3.6 0.0 !arom l assign (resid 15 and name ha) (resid 34 and name he#) 3.6 3.6 0.0 !arom l assign (resid 17 and name ha#) (resid 87 and name hd#) 5.5 5.5 0.0 !arom l assign (resid 17 and name ha#) (resid 87 and name he#) 5.5 5.5 0.0 !arom l assign (resid 19 and name hd#) (resid 20 and name hn) 5.5 5.5 0.0 !arom s assign (resid 19 and name hd#) (resid 21 and name hn) 5.5 5.5 0.0 !arom s assign (resid 19 and name hd#) (resid 21 and name hd2) 3.6 3.6 0.0 !arom m assign (resid 19 and name hd#) (resid 22 and name hd#) 3.6 3.6 0.0 !arom m assign (resid 19 and name hd#) (resid 86 and name hg) 5.5 5.5 0.0 !arom l assign (resid 19 and name hd#) (resid 91 and name hb#) 3.6 3.6 0.0 !arom l assign (resid 19 and name hd#) (resid 91 and name hd#) 3.6 3.6 0.0 !arom l assign (resid 19 and name hd#) (resid 91 and name he#) 5.5 5.5 0.0 !arom l assign (resid 19 and name he#) (resid 21 and name hd2) 5.5 5.5 0.0 !arom m assign (resid 19 and name he#) (resid 22 and name hd#) 3.6 3.6 0.0 !arom m assign (resid 19 and name he#) (resid 86 and name hg) 5.5 5.5 0.0 !arom l assign (resid 19 and name he#) (resid 91 and name hb#) 3.6 3.6 0.0 !arom l assign (resid 19 and name he#) (resid 91 and name hd#) 5.5 5.5 0.0 !arom_1 assign (resid 31 and name hn) (resid 34 and name hd#) 3.6 3.6 0.0 !arom m assign (resid 31 and name hg) (resid 34 and name hd#) 5.5 5.5 0.0 !arom m assign (resid 31 and name hd#) (resid 34 and name hd#) 5.5 5.5 0.0 !arom m assign (resid 31 and name hdl#) (resid 34 and name he#) 5.5 5.5 0.0 !arom m assign (resid 31 and name hd2#) (resid 87 and name hd#) 2.8 2.8 0.0 !arom l assign (resid 32 and name hn) (resid 34 and name hd#) 5.5 5.5 0.0 !arom m assign (resid 34 and name hn) (resid 34 and name hd#) 3.6 3.6 0.0 !arom i assign (resid 34 and name ha) (resid 34 and name hd#) 3.6 3.6 0.0 !arom i assign (resid 34 and name hd#) (resid 35 and name hn) 3.6 3.6 0.0 !arom s _71_ assign (resid 34 and name hd#) (resid 42 and name hn) 5.5 5.5 0.0 !arom l assign (resid 34 and name hd#) (resid 42 and name ha) 3.n 3.6 0.0 !arom l assign (resid 34 and name he#) (resid 43 and name hn) 5.5 5.5 0.0 !arom 1 assign (resid 34 and name hd#) (resid 43 and name hb#) 5.5 5.5 0.0 !arom 1 assign (resid 34 and name he#) (resid 42 and name hn) 5.5 5.5 0.0 !arom 1 assign (resid 34 and name he#) (resid 92 and name ha) 5.5 5.5 0.0 !arom 1 assign (resid 34 and name he#) (resid 43 and name hb#) 5.5 5.5 0.0 !arom l assign (resid 34 and name he#) (resid 93 and name hg#) 3.6 3.6 0.0 !arom l assign (resid 83 and name hn) (resid 84 and name hd#) 3.6 3.6 0.0 !arom s assign (resid 86 and name hn) (resid 91 and name hd#) 5.5 5.5 0.0 !arom l assign (resid 86 and name hb#) (resid 87 and name hd#) 2.8 2.8 0.0 !arom s assign (resid 86 and name hb#) (resid 87 and name he#) 3.6 3.6 0.0 !arom s assign (resid 86 and name hd#) (resid 87 and name hd#) 3.6 3.6 0.0 !arom s assign (resid 86 and name hd#) (resid 87 and name he#) 3.6 3.6 0.0 !arom s assign (resid 87 and name ha) (resid 87 and name hd#) 2.8 2.8 0.0 !arom i assign (resid 87 and name hd#) (resid 90 and name hb) 5.5 5.5 0.0 !arom m assign (resid 87 and name hd#) (resid 90 and name hg2#) 5.5 5.5 0.0 !arom m assign (resid 87 and name hd#) (resid 90 and name hd#) 3.6 3.6 0.0 !arom m assign (resid 87 and name hd#) (resid 91 and name hb#) 3.6 3.6 0.0 !arom m assign (resid 87 and name hd#) (resid 91 and name hd#) 2.8 2.8 0.0 !arom m assign (resid 87 and name hd#) (resid 91 and name he#) 3.6 3.6 0.0 !arom m assign (resid 87 and name he#) (resid 91 and name hd#) 5.5 5.5 0.0 !arom m assign (resid 87 and name he#) (resid 91 and name he#) 5.5 5.5 0.0 !arom m assign (resid 91 and name hn) (resid 91 and name hd#) 3.6 3.6 0.0 !arom i assign (resid 91 and name hd#) (resid 92 and name hn) 5.5 5.5 0.0 !arom s assign (resid 2 and name hd#) (resid 86 and name hd#) 5.5 5.5 0.0 !meth 1 assign (resid 5 and name hb#) (resid 86 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 17 and name hn) (resid 90 and name hd#) 4.1 4.1 0.0 !meth 1 assign (resid 17 and name ha#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 29 and name hb#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 29 and name hg#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 29 and name hd#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l' assign (resid 29 and name he#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 31 and name hn) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 31 and name ha) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 31 and name ha) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 32 and name ha) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 32 and name hb#) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth 1 assign (resid 32 and name hg) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 40 and name hn) (resid 40 and name he#) 5.5 5.5 0.0 !meth i assign (resid 47 and name ha) (resid 48 and name hg2#) 5.5 5.5 0.0 !meth s assign (resid 47 and name hbl) (resid 74 and name hd#) 5.5 5.5 0.0 !meth 1 assign (resid 47 and name hg#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 48 and name hn) (resid 48 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 48 and name hn) (resid 74 and name hd#) 5.5 5.5 0.0 !meth 1 assign (resid 48 and name ha) (resid 74 and name hd#) 3.6 3.6 0.0 !meth l assign (resid 48 and name hg2#) (resid 49 and name hn) 5.5 5.5 0.0 !meth s assign (resid 48 and name hg2#) (resid 50 and name hn) 3.6 3.6 0.0 !meth m assign (resid 48 and name hg2#) (resid 50 and name hbl) 5.5 5.5 0.0 !meth m assign (resid 48 and name hg2#) (resid 51 and name hn) 3.1 3.1 0.0 !meth m assign (resid 48 and name hg2#) (resid 51 and name ha) 3.6 3.6 0.0 !meth m assign (resid 48 and name hg2#) (resid 51 and name hb#) 3.6 3.6 0.0 !meth m assign (resid 48 and name hg2#) (resid 51 and name hg#) 5.5 5.5 0.0 !meth m assign (resid 48 and name hg2#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 49 and name hn) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 49 and name ha) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 54 and name hn) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 54 and name ha#) (resid 74 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 59 and name ha#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 56 and name hn) (resid 60 and name hb#) 5.5 5.5 0.0 !meth m assign (resid 56 and name hn) (resid 74 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 56 and name ha) (resid 60 and name hb#) 5.5 5.5 0.0 !meth m assign (resid 56 and name ha) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 56 and name hbl) (resid 60 and name hb#) 3.6 3.6 0.0 !meth m assign (resid 57 and name hn) (resid 60 and name hb#) 3.6 3.6 0.0 !meth m ?_ assign (resid 57 and name ha) (resid 60 and name hb#) 5.5 5.5 0.0 !meth m assign (resid 57 and name hb#) (resid 60 and name hb#) 5.5 5.5 0.0 !meth m assign (resid 58 and name hb#) (resid 59 and name hn) 3.6 3.6 0.0 !meth s assign (resid 58 and name hb#) (resid 60 and name hn) 5.5 5.5 0.0 !meth m assign (resid 59 and name hn) (resid 60 and name hb#) 5.5 5.5 0.0 !meth s assign (resid 60 and name hb#) (resid 61 and name hn) 3.6 3.6 0.0 !meth s assign (resid 60 and name hb#) (resid 76 and name ha) 5.5 5.5 0.0 !meth l assign (resid 60 and name hb#) (resid 76 and name hbl) 5.5 5.5 0.0 !meth l assign (resid 60 and name hb#) (resid 77 and name hn) 3.6 3.6 0.0 !meth l assign (resid 60 and name hb#) (resid 77 and name ha) 5.5 5.5 0.0 !meth l assign (resid 60 and name hb#) (resid 78 and name hn) 5.5 5.5 0.0 !meth l assign (resid 60 and name hb#) (resid 78 and name hb1) 5.5 5.5 0.0 !meth l assign (resid 62 and name ha) (resid 74 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 63 and name hn) (resid 74 and name hg2#) 4.1 4.1 0.0 !meth l assign (resid 63 and name hn) (resid 74 and name hd#) 3.6 3.6 0.0 !meth l assign (resid 63 and name hg2#) (resid 64 and name hn) 3.6 3.6 0.0 !meth s assign (resid 64 and name ha) (resid 74 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 64 and name ha) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 64 and name hb#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 64 and name hg#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 72 and name hn) (resid 72 and name he#) 3.6 3.6 0.0 !meth i assign (resid 72 and name hb#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth m assign (resid 73 and name hn) (resid 74 and name hd#) 5.5 5.5 0.0 !meth s assign (resid 74 and name hn) (resid 74 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 74 and name ha) (resid 74 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 74 and name ha) (resid 74 and name hd#) 3.6 3.6 0.0 !meth i assign (resid 74 and name hg2#) (resid 75 and name ha) 5.5 5.5 0.0 !meth s assign (resid 75 and name hg2#) (resid 76 and name hn) 3.6 3.6 0.0 !meth s assign (resid 79 and name hn) (resid 79 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 79 and name hg2#) (resid 80 and name hn) 3.6 3.6 0.0 !meth s assign (resid 85 and name ha) (resid 86 and name hd#) 5.5 5.5 0.0 !meth s assign (resid 86 and name hd#) (resid 87 and name hn) 5.5 5.5 0.0 !meth s assign (resid 86 and name hd#) (resid 91 and name hb#) 5.5 5.5 0.0 !meth l assign (resid 86 and name hd#) (resid 92 and name ha) 5.5 5.5 0.0 !meth l assign (resid 87 and name ha) (resid 90 and name hd#) 5.5 5.5 0.0 !meth m assign (resid 87 and name hb#) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth m assign (resid 87 and name hb#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth m assign (resid 89 and name hn) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth s assign (resid 90 and name hn) (resid 90 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 90 and name ha) (resid 90 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 90 and name hg2#) (resid 91 and name hn) 5.5 5.5 0.0 !meth s assign (resid 90 and name hd#) (resid 91 and name hn) 5.5 5.5 0.0 !meth s assign (resid 6 and name ha) (resid 6 and name hg#) 2.8 2.8 0.0 !dgnm i assign (resid 10 and name he#) (resid 19 and name hn) 3.6 3.6 0.0 !dgnm 1 assign (resid 10 and name he#) (resid 28 and name hn) 3.6 3.6 0.0 !dgnm 1 assign (resid 14 and name hn) (resid 14 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 14 and name hb#) (resid 15 and name hn) 4.1 4.1 0.0 !dgnm s assign (resid 24 and name hn) (resid 24 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 24 and name ha) (resid 24 and name hg#) 2.8 2.8 0.0 !dgnm i assign (resid 24 and name hg#) (resid 25 and name hn) 5.5 5.5 0.0 !dgnm s assign (resid 25 and name hn) (resid 25 and name hd#) 5.5 5.5 0.0 !dgnm i assign (resid 26 and name hn) (resid 26 and name hb#) 2.8 2.8 0.0 !dgnm i assign (resid 29 and name hb#) (resid 29 and name hd#) 3.6 3.6 0.0 !dgnm i assign (resid 29 and name hb#) (resid 30 and name hn) 3.6 3.6 0.0 !dgnm s assign (resid 33 and name hn) (resid 47 and name hg#) 5.5 5.5 0.0 !dgnm l assign (resid 35 and name hn) (resid 35 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 35 and name ha) (resid 35 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 35 and name hg#) (resid 36 and name hn) 3.6 3.6 0.0 !dgnm s assign (resid 35 and name hg#) (resid 42 and name hn) 5.5 5.5 0.0 !dgnm l assign (resid 35 and name hg#) (resid 44 and name ha) 3.6 3.6 0.0 !dgnm l assign (resid 35 and name hg#) (resid 44 and name hb#) 3.6 3.6 0.0 !dgnm l assign (resid 36 and name hn) (resid 36 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 36 and name ha) (resid 36 and name hg#) 2.8 2.8 0.0 !dgnm i assign (resid 36 and name hb#) (resid 37 and name hn) 5.5 5.5 0.0 !dgnm_s assign (resid 36 and name hg#) (resid 37 and name hn) 3.6 3.6 0.0 !dgnm s _73_ assign(resid36and namehg#)(resid 40andname hn) 5.5 5.50.0 !dgnm m assign(resid37and nameha) (resid 37andname hg#)3.6 3.60.0 !dgnm i assign(resid37and namehg#)(resid 38andname hn) 4.1 4.10.0 !dgnm s assign(resid40and namehn) (resid 40andname hg#)3.6 3.60.0 !dgnm i assign(resid40and namehn) (resid 40andname hd#)5.5 5.50.0 !dgnm i assign(resid44and nameha) (resid 45andname hg#)3.6 3.60.0 !dgnm s assign(resid45and namehg#)(resid 46andname hn) 3.6 3.60.0 !dgnm s assign(resid47and namehg#)(resid 48andname hn) 5.5 5.50.0 !dgnm s assign(resid49and namehn) (resid 51andname hg#)3.6 3.60.0 !dgnm m assign(resid99and namehn) (resid 64andname hb#)5.5 5.50.0 !dgnm l assign(resid49and namehn) (resid 64andname hg#)5.5 5.50.0 !dgnm l assign(resid51and namehn) (resid 51andname hg#)3.6 3.60.0 !dgnm i assign(resid51and namehg#)(resid 52andname hd22)5.5 5.50.0 !dgnm s assign(resid61and namehn) (resid 61andname hb#)2.8 2.80.0 !dgnm i assign(resid61and namehb#)(resid 62andname hn) 3.6 3.60.0 !dgnm s assign(resid64and namehn) (resid 64andname hb#)2.8 2.80.0 !dgnm i assign(resid64and namehn) (resid 64andname hg#)2.8 2.80.0 !dgnm i assign(resid64and namehn) (resid 65andname hg#)2.8 2.80.0 !dgnm s assign(resid64and nameha) (resid 64andname hg#)3.6 3.60.0 !dgnm i assign(resid64and namehb#)(resid 74andname ha) 3.6 3.60.0 !dgnm l assign(resid65and namehn) (resid 65andname hg#)3.6 3.60.0 !dgnm i assign(resid69and namehb#)(resid 70andname hn) 2.8 2.80.0 !dgnm s assign(resid71and nameha#)(resid 72andname hn) 2.6 2.60.0 !dgnm s assign(resid72and namehn) (resid 72andname hd#)3.6 3.60.0 !dgnm i assign(resid73and namehn) (resid 73andname hb#)2.8 2.80.0 !dgnm i assign(resid73and namehb#)(resid 74andname hn) 3.6 3.60.0 !dgnm s assign(resid80and namehn) (resid 80andname hb#)2.8 2.80.0 !dgnm i assign(resid80and namehb#)(resid 81andname hd#)2.8 2.80.0 !dgnm s assign(resid80and namehb#)(resid 83andname hn) 3.6 3.60.0 !dgnm m assign(resid80and namehb#)(resid 83andname hb#)2.8 2.80.0 !dgnm m assign(resid84and nameha) (resid 85andname hg#)3.6 3.60.0 !dgnm s assign(resid84and nameha) (resid 85andname hd#)2.8 2.80.0 !dgnm s assign(resid85and namehg#)(resid 89andname hn) 5.5 5.50.0 !dgnm m assign(resid86and namehb#)(resid 87andname hn) 3.6 3.60.0 !dgnm s assign(resid86and namehb#)(resid 91andname hb#)3.6 3.60.0 !dgnm class nsam assign(resid8 andname ha) (resid8 andname hg#)3.6 3.60.0 !meth i assign(resid8 andname hg#) (resid20andname hd#)5.5 5.50.0 !meth l assign(resid8 andname hg#) (resid20andname he) 5.5 5.50.0 !meth l assign(resid15andname ha) (resid31andname hdl#)3.6 3.60.0 !meth l assign(resid15andname hb#) (resid31andname hdl#)5.5 5.50.0 !meth assign(resid16andname hn) (resid31andname hdl#)5.5 5.50.0 !meth l assign(resid16andname ha) (resid31andname hd#)5.5 5.50.0 !meth assign(resid17andname hn) (resid31andname hd2#)4.1 4.10.0 !meth l assign(resid17andname ha#) (resid31andname hd2#)5.5 5.50.0 !meth l assign(resid19andname hz) (resid22andname hd#)3.6 3.60.0 !meth m assign(resid22andname hd#) (resid23andname hn) 5.5 5.50.0 'meth s assign(resid30andname ha) (resid31andname hd#)5.5 5.50.0 'meth s assign(resid31andname ha) (resid31andname hd2#)3.6 3.60.0 'meth i assign(resid3iandname hd2#)(resid87andname hb#)5.5 5.50.0 'meth l assign(resid31andname hd2#)(resid87andname hz) 3.6 3.60.0 1 ~meth assign(resid31andname hd2#)(resid90andname hg2#)5.5 5.50.0 _ !meth l assign(resid31andname hd2#)(resid90andname hd#)5.5 5.50.0 !meth l assign(resid32andname ha) (resid32andname hd2#)3.6 3.60.0 !meth i assign(resid32andname hd2#)(resid33andname hn) 3.6 3.60.0 !meth s assign(resid32andname hd2#)(resid55andname ha#)5.5 5.50.0 !meth l assign(resid32andname hd2#)(resid56andname hn) 5.5 5.50.0 !meth l assign(resid32andname hd2#)(resid56andname ha) 5.5 5.50.0 !meth l assign(resid32andname hd2#)(resid74andname hb) 5.5 5.50.0 'meth l assign(resid32andname hd2#)(resid74andname hg2#)5.5 5.50.0 'meth l assign(resid32andname hd2#)(resid90andname ha) 5.5 5.50.0 !meth l assign(resid32andname hd2#)(resid90andname hg2#)3.6 3.60.0 !meth assign(resid32andname hdl#)(resid88andname hb#)5.5 5.50.0 !meth _74_ assign (resid 35 and name hn) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 35 and name hb2) (resid 42 and name hgl#) 5.5 5.5 0.0 !mete l assign (resid 35 and name hg#) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hn) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hn) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 37 and name ha) (resid 42 and name hg2#) 5.5 5.5 D.0 !meth i assign (resid 37 and name hb#) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hb#) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hg#) (resid 42 and name hg1#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hg#) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth 1 assign (resid 40 and name hn) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth m assign (resid 40 and name hg#) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth m assign (resid 41 and name ha) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth s assign. (resid 41 and name ha) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth s assign (resid 41 and name hb#) (resid 42 and name hg#) 5.5 5.5 0.0 !meth s assign (resid 42 and name hgl#) (resid 43 and name hn) 3.6 3.6 0.0 !meth s assign (resid 42 and name hg2#) (resid 43 and name hn) 3.6 3.6 0.0 !meth s assign (resid 5 and name ha) (resid 20 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 7 and name ha) (resid 20 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 7 and name ha) (resid 20 and name hd#) 3.6 3.6 0.0 !nsam l assign (resid 10 and name ha) (resid 10 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 12 and name ha) (resid 13 and name hd#) 2.8 2.8 0.0 !nsam s assign (resid 12 and name hb#) (resid 13 and name hd#) 3.6 3.6 0.0 !nsam s assign (resid 12 and name hb#) (resid 28 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 13 and name hb2) (resid 14 and name hn) 3.6 3.6 0.0 !sing s assign (resid 13 and name hg#) (resid 16 and name hb#) 3.6 3.6 0.0 !nsam m assign (resid 13 and name hd#) (resid 28 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 15 and name hb2) (resid 41 and name hb2) 3.6 3.6 0.0 !sing l assign (resid to and name ha) (resid 30 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 16 and name hb#) (resid 30 and name ha) 3.6 3.6 0.0 !nsam l assign (resid 16 and name hb#) (resid 31 and name hn) 3.6 3.6 0.0 !nsam l assign (resid 17 and name ha#) (resid 87 and name hz) 3.6 3.6 0.0 !nsam l assign (resid 20 and name ha) (resid 20 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 20 and name ha) (resid 26 and name hg#) 3.6 3.6 0.0 !nsam l assign (resid 20 and name hb#) (resid 20 and name hd#) 3.6 3.6 0.0 !nsam i assign (resid 20 and name hg#) (resid 21 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 20 and name hg#) (resid 24 and name ha) 3.6 3.6 0.0 !nsam m assign (resid 21 and name hb#) (resid 22 and name hn) 5.5 5.5 0.0 !nsam s assign (resid 21 and name hb#) (resid 23 and name hn) 5.5 5.5 0.0 !nsam m assign (resid 22 and name hb2) (resid 23 and name hn) 3.6 3.6 0.0 !sing s assign (resid 24 and name hb#) (resid 25 and name hn) 5.5 5.5 0.0 !nsam s assign (resid 25 and name hn) (resid 25 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 25 and name hg#) (resid 26 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 26 and name hn) (resid 26 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 26 and name ha) (resid 26 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 27 and name ha) (resid 27 and name hg#) 2.8 2.8 0.0 !nsam i assign (resid 27 and name hb#) (resid 28 and name hn) 2.8 2.8 0.0 !nsam s assign (resid 27 and name hg#) (resid 28 and name hn) 2.8 2.8 0.0 !nsam s assign (resid 28 and name hn) (resid 28 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 29 and name hg#) (resid 30 and name hn) 2.8 2.8 0.0 !nsam s assign (resid 29 and name hd#) (resid 90 and name hb) 3.6 3.6 0.0 !nsam l assign (resid 30 and name hn) (resid 30 and name hb#) 2.8 2.8 0.0 !nsam i assign. (resid 30 and name hbl) (resid 31 and name hn) 3.6 3.6 0.0 !sing s assign (resid 30 and name hb#) (resid 34 and name hn) 5.5 5.5 0.0 !nsam m assign (resid 30 and name hb2) (resid 34 and name hb2) 3.6 3.6 0.0 !sing m assign (resid 30 and name hb#) (resid 35 and name ha) 3.6 3.6 0.0 !nsam l assign (resid 31 and name hn) (resid 31 and name hb#) 3.6 3.6 0.0 !nsam i assign (resid 31 and name hn) (resid 34 and name hb2) 3.6 3.6 0.0 !sing m assign (resid 32 and name hbl) (resid 33 and name hn) 3.6 3.6 0.0 !sing s assign (resid 33 and name ha) (resid 44 and name hb#) 3.6 3.6 0.0 !nsam 1 assign (resid 33 and name ha) (resid 47 and name hbl) 3.6 3.6 0.0 !sing 1 assign (resid 33 and name hb2) (resid 34 and name hn) 5.5 5.5 0.0 !sing s assign (resid 34 and name ha) (resid 44 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 34 and name hbl) (resid 35 and name hn) 4.1 4.1 0.0 !sing s assign (resid 35 and name hb#) (resid 35 and name hd#) 2.8 2.8 0.0 !nsam i _7j_ assign (resid 35 and name hb2) (resid 36 and name hn) 3.6 3.6 0.0 !sing s assign (resid 35 and name hb#) (resid 44 and name hb#) 3.6 3.6 0.0 !nsam 1 assign (resid 35 and name hd#) (resid 49 and name ha) 3.6 3.6 0.0 !nsam 1 assign (resid 37 and name hn) (resid 40 and name hb#) 5.5 5.5 0.0 !nsam m assign (resid 38 and name ha#) (resid 39 and name hn) 3.1 3.1 0.0 !nsam s assign (resid 38 and name ha#) (resid 40 and name hn) 5.5 5.5 0.0 !nsam m assign (resid 39 and name hb#) (resid 40 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 41 and name hbl) (resid 42 and name hn) 3.6 3.6 0.0 !sing s assign (resid 43 and name hn) (resid 43 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 43 and name ha) (resid 43 and name hg#) 2.8 2.8 0.0 !nsam i assign (resid 43 and name hb#) (resid 44 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 43 and name hg#) (resid 44 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 44 and name hn) (resid 45 and name hd#) 5.5 5.5 0.0 ~nsam_s assign (resid 44 and name ha) (resid 45 and name hd#) 2.8 2.8 0.0 !nsam s assign (resid 45 and name hb2) (resid 96 and name hn) 3.6 3.6 0.0 ~sing_s assign (resid 46 and name hn) (resid 46 and name hb#) 3.6 3.6 0.0 ~nsam_i assign (resid 46 and name hn) (resid 47 and name hd#) 3.6 3.6 0.0 !nsam s assign (resid 46 and name ha) (resid 47 and name hd#) 3.6 3.6 0.0 ~nsam_s assign (resid 47 and name hb2) (resid 48 and name hn) 4.1 4.1 0.0 !sing s assign (resid 47 and name hb2) (resid 74 and name hgl#) 3.6 3.6 0.0 !nsam 1 assign (resid 47 and name hg#) (resid 74 and name hgl#) 3.6 3.6 0.0 !nsam 1 assign (resid 48 and name hn) (resid 54 and name ha#) 4.1 4.1 0.0 !nsam l assign (resid 48 and name hn) (resid 74 and name hgl#) 5.5 5.5 0.0 !nsam l assign (resid 49 and name ha) (resid 54 and name ha#) 3.6 3.6 0.0 !nsam l assign (resid 49 and name ha) (resid 62 and name hbl) 5.5 5.5 0.0 !sing l assign (resid 50 and name hbl) (resid 51 and name hn) 3.6 3.6 0.0 !sing s assign (resid 53 and name hb#) (resid 56 and name hn) 5.5 5.5 0.0 !nsam m assign (resid 53 and name hbl) (resid 58 and name ha) 3.6 3.6 0.0 !sing l assign (resid 53 and name hd22) (resid 56 and name hn) 5.5 5.5 0.0 !sing m assign (resid 53 and name hd21) (resid 60 and name hn) 5.5 5.5 0.0 !sing l assign (resid 54 and name ha#) (resid 55 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 54 and name ha#) (resid 56 and name hn) 3.6 3.6 0.0 !nsam m assign (resid 55 and name ha#) (resid 56 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 56 and name hbl) (resid 57 and name hn) 4.1 4.1 0.0 !sing s assign (resid 56 and name hb2) (resid 62 and name hn) 5.5 5.5 0.0 !sing l assign (resid 56 and name hb2) (resid 62 and name ha) 3.6 3.6 0.0 !sing l assign (resid 57 and name hb#) (resid 58 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 57 and name hb#) (resid 59 and name hn) 4.1 4.1 0.0 !nsam m assign (resid 57 and name hb#) (resid 60 and name hn) 4.1 4.1 0.0 !nsam m assign (resid 57 and name hb#) (resid 91 and name ha) 2.8 2.8 0.0 ~nsam_1 assign. (resid 57 and name hb#) (resid 92 and name hn) 5.5 5.5 0.0 !nsam l assign (resid 58 and name hn) (resid 59 and name hb#) 5.5 5.5 0.0 ~nsam_s assign (resid 59 and name hb#) (resid 80 and name hg#) 3.6 3.6 0.0 'nsam l assign (resid 59 and name hb#) (resid 60 and name hn) 3.6 3.6 0.0 ~nsam_s assign (resid 60 and name ha) (resid 78 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 61 and name hn) (resid 61 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 65 and name hn) (resid 65 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 66 and name hn) (resid 66 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 66 and name hb#) (resid 67 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 67 and name hb#) (resid 73 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 68 and name ha#) (resid 69 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 72 and name hn) (resid 72 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 74 and name hn) (resid 74 and name hgl#) 3.6 3.6 0.0 !nsam i assign (resid 74 and name ha) (resid 74 and name hgl#) 3.6 3.6 0.0 !nsam i assign (resid 76 and name hn) (resid 76 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 76 and name hbl) (resid 77 and name hn) 5.5 5.5 0.0 !sing s assign (resid 76 and name hbl) (resid 89 and name ha#) 3.6 3.6 0.0 !nsam l assign (resid 78 and name hbl) (resid 79 and name hn) 5.5 5.5 0.0 !sing s assign (resid 78 and name hb#) (resid 92 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 78 and name hb#) (resid 80 and name hn) 5.5 5.5 0.0 'nsam m assign (resid 78 and name hb#) (resid 83 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 80 and name hn) (resid 80 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 80 and name hn) (resid 81 and name hd#) 5.5 5.5 C.0 !nsam s assign (resid 80 and name hn) (resid 83 and name hb#) 3.6 3.6 0.0 !nsam m assign (resid 80 and name ha) (resid 80 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 80 and name ha) (resid 81 and name hd#) 2.8 2.8 0.0 !nsam s assign (resid 80 and name hg#) (resid 81 and name hd#) 3.6 3.6 0.0 !nsam s assign (resid 81 and name hb2) (resid 82 and name hn) 3.6 3.6 0.0 !sing s assign (resid 81 and name hd#) (resid 82 and name hn) 5.5 5.5 0.0 !nsam s assign (resid 82 and name hb#) (resid 83 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 85 and name ha) (resid 89 and name ha#) 3.6 3.6 0.0 !nsam m assign (resid 85 and name hb#) (resid 88 and name ha) 3.6 3.6 0.0 !nsam m assign (resid 85 and name hb#) (resid 89 and name hn) 3.6 3.6 0.0 !nsam m assign (resid 85 and name hb#) (resid 86 and name hn) 3.6 3.6 0.0 lnsam s assign (resid 86 and name hn) (resid 89 and name ha#) 5.5 5.5 0.0 lnsam m assign (resid 87 and name hb#) (resid 90 and name hn) 3.6 3.6 0.0 !nsam m assign (resid 87 and name hb#) (resid 90 and name hgl#) 5.5 5.5 0.0 !nsam m assign (resid 89 and name ha#) (resid 90 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 90 and name hgl#) (resid 91 and name hn) 4.1 4.1 0.0 !nsam s class sing assign(resid2 and namehn) (resid 3 andname hn) 5.5 5.50.0 ~sing s assign(resid4 and namehn) (resid 5 andname hn) 5.5 5.50.0 _ ~sing s assign(resid5 and namehn) (resid 6 andname hn) 3.6 3.60.0 _ !sing s assign(resid5 and nameha) (resid 20andname hn) 5.5 5.50.0 !sing l assign(resid6 and namehn) (resid 7 andname hn) 5.5 5.50.0 !sing s assign(resid7 and namehn) (resid 8 andname hn) 5.5 5.50.0 !sing s assign(resid8 and namehn) (resid 9 andname hn) 5.5 5.50.0 !sing s assign(resid9 and namehn) (resid 10andname hn) 3.6 3.60.0 !sing s assign(resid13and nameha) (resid 14andname hn) 2.6 2.60.0 !sing s assign(resid14and namehn) (resid 15andname hn) 5.5 5.50.0 !sing s assign(resid14and nameha) (resid 15andname hn) 2.6 2.60.0 !sing m assign.(resid15and namehn) (resid 16andname hn) 3.6 3.60.0 !sing s assign(resid15and nameha) (resid 16andname hn) 3.6 3.60.0 !sing s assign(resid15and nameha) (resid 31andname hg) 3.6 3.60.0 !sing assign(resid16and namehn) (resid 17andname hn) 5.5 5.50.0 !sing s assign(resid16and namehn) (resid 31andname hn) 5.5 5.50.0 !sing l assign(resid16and namehn) (resid 31andname hg) 5.5 5.50.0 !sing assign(resid16and nameha) (resid 30andname ha) 2.8 2.80.0 !sing l assign(resid16and nameha) (resid 31andname hn) 3.6 3.60.0 !sing l assign(resid16and nameha) (resid 31andname hg) 3.6 3.60.0 !sing assign(resid17and namehn) (resid 31andname hn) 5.5 5.50.0 !sing l assign(resid18and nameha) (resid 19andname hn) 2.6 2.60.0 !sing s assign(resid18and nameha) (resid 28andname ha) 2.8 2.80.0 !sing l assign(resid19and namehn) (resid 20andname hn) 5.5 5.50.0 !sing s assign(resid19and namehn) (resid 21andname hd2)5.5 5.50.0 !sing m assign(resid19and namehn) (resid 28andname ha) 5.5 5.50.0 !sing l assign(resid19and nameha) (resid 20andname hn) 3.1 3.10.0 !sing s assign(resid19and namehz) (resid 60andname hn) 5.5 5.50.0 !sing l assign(resid20and nameha) (resid 21andname hn) 3.1 3.10.0 !sing s assign(resid20and nameha) (resid 26andname ha) 3.6 3.60.0 !sing l assign(resid21and namehn) (resid 21andname hd2)3.6 3.60.0 !sing i assign(resid21and namehn) (resid 25andname hn) 5.5 5.50.0 !sing m assign(resid21and nameha) (resid 22andname hn) 3.6 3.60.0 !sing s assign(resid21and nameha) (resid 23andname hn) 3.6 3.60.0 !sing m assign(resid22and namehn) (resid 22andname hg) 5.5 5.50.0 !sing i assign.(resid22and namehn) (resid 23andname hn) 5.5 5.50.0 !sing s assign.(resid22and namehn) (resid 25andname hn) 5.5 5.50.0 !sing m assign(resid22and nameha) (resid 23andname hn) 4.1 4.10.0 !sing s assign(resid22and nameha) (resid 24andname hn) 4.1 4.10.0 !sing m assign(resid22and namehg) (resid 23andname hn) 5.5 5.50.0 !sing s assign(resid23and namehn) (resid 24andname hn) 9.1 4.10.0 !sing s assign(resid23and namehn) (resid 24andname ha) 5.5 5.50.0 !sing s assign(resid23and nameha) (resid 24andname hn) 4.1 4.10.0 !sing s assign(resid23and nameha) (resid 25andname hn) 5.5 5.50.0 !sing m assign(resid24and nameha) (resid 25andname hn) 5.5 5.50.0 !sing s assign(resid25and namehn) (resid 26andname hn) 5.5 5.50.0 !sing s assign(resid25and nameha) (resid 26andname hn) 2.6 2.60.0 !sing s assign(resid26and namehn) (resid 27andname hn) 5.5 5.50.0 !sing s _77_ assign(resid26and nameha) (resid 27andname hn) 3.6 3.n0.0 !sing s assign(resid27and nameha) (resid 28andname hn) 2.6 2.60.0 !sing s assign(resid28and nameha) (resid 29andname hn) 3.1 3.10.0 !sing s assign(resid29and nameha) (resid 30andname hn) 2.6 2.60.0 !sing s assign(resid30and namehn) (resid 31andname hn) 5.5 5.50.0 !sing s assign(resid30and nameha) (resid 31andname hn) 3.1 3.10.0 !sing s assign(resid31and namehn) (resid 31andname hg) 3.6 3.60.0 !sing i assign(resid31and namehn) (resid 32andname hn) 5.5 5.50.0 !sing s assign(resid31and nameha) (resid 32andname hn) 3.1 3.10.0 !sing s assign(resid31and nameha) (resid 31andname hg) 3.6 3.60.0 !sing i assign(resid32and nameha) (resid 32andname hg) 3.6 3.60.0 !sing i assign(resid32and nameha) (resid 33andname hn) 2.6 2.60.0 !sing s assign(resid32and nameha) (resid 34andname hn) 3.6 3.60.0 !sing m assign(resid33and namehn) (resid 34andname hn) 3.6 3.60.0 !sing s assign(resid33and nameha) (resid 34andname hn) 3.1 3.10.0 !sing s assign(resid34and namehn) (resid 35andname hn) 5.5 5.50.0 !sing s assign(resid34and namehn) (resid 44andname hn) 5.5 5.50.0 !sing l assign(resid34and nameha) (resid 35andname hn) 3.1 3.10.0 !sing s assign(resid34and nameha) (resid 43andname ha) 2.8 2.80.0 !sing assign(resid34and nameha) (resid 44andname hn) 3.1 3.10.0 !sing l assign(resid35and namehn) (resid 36andname hn) 5.5 5.50.0 !sing s assign(resid35and namehn) (resid 41andname ha) 5.5 5.50.0 !sing l assign(resid35and namehn) (resid 42andname hn) 3.6 3.60.0 !sing l assign(resid35and namehn) (resid 43andname ha) 5.5 5.50.0 !sing l assign(resid35and namehn) (resid 44andname hn) 5.5 5.50.0 !sing l assign(resid35and namehn) (resid 44andname ha) 5.5 5.50.0 !sing l assign(resid35and nameha) (resid 36andname hn) 2.6 2.60.0 !sing s assign(resid36and namehn) (resid 37andname hn) 5.5 5.50.0 !sing s assign(resid36and nameha) (resid 37andname hn) 2.6 2.60.0 !sing s assign(resid36and nameha) (resid 41andname ha) 2.8 2.80.0 !sing assign(resid36and nameha) (resid 42andname hn) 3.6 3.60.0 !sing assign(resid37and namehn) (resid 40andname hn) 3.6 3.60.0 !sing m assign(resid37and namehn) (resid 41andname ha) 3.5 3.60.0 !sing m assign(resid37and namehn) (resid 42andname hn) 5.5 5.50.0 !sing l assign(resid37and nameha) (resid 38andname hn) 2.6 2.60.0 !sing s assign(resid38and namehn) (resid 39andname hn) 5.5 5.50.0 !sing s assign(resid39and namehn) (resid 40andname hn) 3.6 3.60.0 !sing s assign(resid40and namehn) (resid 41andname hn) 5.5 5.50.0 !sing s assign(resid40and nameha) (resid 41andname hn) 2.6 2.60.0 !sing s assign(resid41and namehn) (resid 42andname hn) 5.5 5.50.0 !sing s assign(resid41and nameha) (resid 42andname hn) 2.6 2.60.0 !sing s assign(resid42and nameha) (resid 43andname hn) 2.6 2.60.0 !sing s assign(resid42and namehb) (resid 43andname hn) 3.1 3.10.0 !sing s assign(resid43and namehn) (resid 44andname hn) 5.5 5.50.0 !sing s assign(resid43and nameha) (resid 44andname hn) 2.6 2.60.0 !sing s assign(resid44and nameha) (resid 46andname hn) 3.6 3.60.0 !sing m assign(resid45and nameha) (resid 46andname hn) 3.6 3.60.0 !sing s assign(resid46and nameha) (resid 72andname hn) 5.5 5.50.0 !sing l assign(resid47and nameha) (resid 48andname hn) 2.6 2.60.0 !sing s assign(resid48and namehn) (resid 49andname hn) 5.5 5.50.0 !sing s assign(resid48and namehn) (resid 51andname hn) 5.5 5.50.0 !sing m assign(resid48and nameha) (resid 49andname hn) 3.1 3.10.0 !sing s assign(resid98and nameha) (resid 50andname hn) 5.5 5.50.0 !sing m assign(resid48and namehb) (resid 49andname hn) 3.6 3.60.0 !sing s assign(resid48and namehb) (resid 50andname hn) 5.5 5.50.0 !sing m assign(resid49and namehn) (resid 50andname hn) 3.6 3.60.0 !sing s assign(resid49and namehn) (resid 51andname hn) 5.5 5.50.0 !sing m assign(resid49and nameha) (resid 50andname hn) 3.6 3.60.0 !sing s assign(resid49and nameha) (resid 51andname hn) 4.1 4.10.0 !sing m assign(resid99and nameha) (resid 53andname ha) 3.6 3.60.0 !sing m assign(resid49and nameha) (resid 54andname hn) 3.6 3.60.0 !sing assign(resid50and namehn) (resid 51andname hn) 3.6 3.60.0 !sing s assign(resid51and namehn) (resid 52andname hn) 5.5 5.50.0 !sing s assign(resid51and namehn) (resid 53andname hn) 4.1 4.10.0 !sing m assign(resid51and namehn) (resid 54andname hn) 4.1 4.10.0 !sing m _78_ assign(resid51and nameha) (resid 52and namehn) 3.1 3.10.0 !sing s assign(resid52and namehn) (resid 53and namehn) 3.6 3.60.0 !sing s assign(resid52and nameha) (resid 53and namehn) 3.6 3.60.0 !sing s assign(resid53and namehn) (resid 54and namehn) 4.1 4.10.0 !sing s assign(resid53and nameha) (resid 54and namehn) 3.6 3.60.0 !sing s assign(resid53and nameha) (resid 56and namehn) 2.8 2.80.0 !sing m assign(resid54and namehn) (resid 55and namehn) 3.6 3.60.0 !sing s assign(resid55and namehn) (resid 56and namehn) 3.1 3.10.0 !sing s assign(resid56and namehn) (resid 57and namehn) 5.5 5.50.0 !sing s assign(resid56and namehay (resid 57and namehn) 3.6 3.60.0 !sing s assign(resid57and namehn) (resid 59and namehn) 5.5 5.50.0 !sing m assign(resid57and namehn) (resid 60and namehn) 5.5 5.50.0 !sing m assign(resid57and namehn) (resid 90and namehn) 5.5 5.50.0 !sing l assign(resid57and namehn) (resid 90and nameha) 2.6 2.60.0 !sing l assign(resid57and namehn) (resid 91and nameha) 5.5 5.50.0 !sing l assign(resid57and namehn) (resid 91and namehn) 5.5 5.50.0 !sing l assign(resid57and nameha) (resid 91and nameha) 3.6 3.60.0 !sing l assign(resid58and namehn) (resid 59and namehn) 3.6 3.60.0 !sing s assign(resid58and namehn) (resid 60and namehn) 5.5 5.50.0 !sing m assign(resid58and nameha) (resid 59and namehn) 3.6 3.60.0 !sing s assign(resid59and namehn) (resid 60and namehn) 3.6 3.60.0 !sing_s assign(resid59and nameha) (resid 60and namehn) 3.6 3.60.0 !sing s assign(resid60and namehn) (resid 61and namehn) 5.5 5.50.0 !sing s assign(resid60and namehn) (resid 78and nameha) 5.5 5.50.0 !sing l assign(resid60and nameha) (resid 61and namehn) 2.6 2.60.0 !sing s assign(resid60and nameha) (resid 77and namehn) 5.5 5.50.0 !sing l assign(resid60and nameha) (resid 78and nameha) 2.8 2.80.0 !sing l assign(resid60and nameha) (resid 79and namehn) 3.6 3.60.0 !sing l assign(resid61and namehn) (resid 77and namehn) 3.6 3.60.0 !sing l assign(resid61and namehn) (resid 78and nameha) 3.6 3.60.0 !sing l assign(resid61and namehn) (resid 79and namehn) 5.5 5.50.0 !sing l assign(resid61and nameha) (resid 62and namehn) 2.6 2.60.0 !sing s assign(resid62and nameha) (resid 63and namehn) 2.6 2.60.0 !sing s assign(resid62and nameha) (resid 76and nameha) 2.8 2.80.0 !sing l assign(resid63and namehn) (resid 63and namehb) 3.6 3.60.0 !sing-i assign(resid63and namehn) (resid 64and namehn) 5.5 5.50.0 !sing s assign(resid63and namehn) (resid 75and namehn) 3.6 3.60.0 !sing l assign(resid63and namehn) (resid 76and nameha) 5.5 5.50.0 !sing assign(resid63and nameha) (resid 64and namehn) 2.6 2.60.0 !sing s assign(resid63and namehb) (resid 64and namehn) 3.1 3.10.0 !sing s assign(resid64and nameha) (resid 74and nameha) 2.8 2.80.0 !sing assign(resid65and nameha) (resid 66and namehn) 2.6 2.60.0 !sing s assign(resid66and namehn) (resid 67and namehn) 5.5 5.50.0 !sing s assign(resid67and namehn) (resid 68and namehn) 5.5 5.50.0 !sing s assign(resid67and nameha) (resid 68and namehn) 3.6 3.60.0 !sing s assign(resid70and namehn) (resid 71and namehn) 3.1 3.10.0 !sing s assign(resid70and nameha) (resid 71and namehn) 3.6 3.60.0 !sing s assign(resid71and namehn) (resid 72and namehn) 3.6 3.60.0 !sing s assign(resid72and namehn) (resid 73and namehn) 5.5 5.50.0 !sing s assign(resid72and nameha) (resid 73and namehn) 2.6 2.60.0 !sing s assign(resid73and namehn) (resid 74and namehn) 5.5 5.50.0 !sing s assign(resid73and nameha) (resid 74and namehn) 2.6 2.60.0 !sing s assign(resid74and namehn) (resid 74and namehb) 3.1 3.10.0 !sing i assign(resid74and nameha) (resid 75and namehn) 2.6 2.60.0 !sing s assign(resid75and namehn) (resid 75and namehb) 3.1 3.10.0 !sing i assign(resid75and nameha) (resid 76and namehn) 2.6 2.60.0 !sing s assign(resid75and namehb) (resid 76and namehn) 3.6 3.60.0 !sing s assign(resid76and nameha) (resid 77and namehn) 2.6 2.60.0 !sing s assign(resid77and namehn) (resid 78and namehn) 5.5 5.50.0 !sing s assign(resid77and nameha) (resid 78and namehn) 2.8 2.80.0 !sing s assign(resid78and namehn) (resid 79and namehn) 5.5 5.50.0 !sing s assign(resid78and nameha) (resid 79and namehn) 2.6 2.60.0 !sing s assign(resid79and namehn) (resid 79and namehb) 3.6 3.60.0 !sing i assign(resid79and namehn) (resid 80and namehn) 3.6 3.60.0 !sing s assign(resid79and namehb) (resid 80and namehn) 5.5 5.50.0 !sing s assign(resid81and nameha) (resid 82andname hn) 3.6 3.60.0 !sing s assign(resid81and nameha) (resid 83andname hn) 4.1 4.10.0 !sing m assign(resid82and namehn) (resid 83andname hn) 4.1 4.10.0 !sing s assign(resid82and nameha) (resid 83andname hn) 4.1 4.10.0 !sing s assign(resid83and namehn) (resid 84andname hn) 5.5 5.50.0 !sing s assign(resid83and nameha) (resid 84andname hn) 2.6 2.60.0 !sing s assign(resid84and namehn) (resid 92andname hn) 5.5 5.50.0 !sing l assign(resid84and namehn) (resid 93andname hn) 5.5 5.50.0 !sing assign(resid85and nameha) (resid 86andname hn) 2.6 2.60.0 !sing s assign(resid85and nameha) (resid 92andname ha) 2.8 2.80.0 !sing l assign(resid86and namehn) (resid 86andname hg) 3.6 3.60.0 !sing i assign(resid86and namehn) (resid 87andname hn) 5.5 5.50.0 !sing s assign(resid86and namehn) (resid 89andname hn) 4.1 4.i0.0 !sing m assign(resid86and namehn) (resid 90andname hn) 5.5 5.50.0 !sing m assign(resid86and namehn) (resid 91andname hn) 3.6 3.60.0 !sing l assign(resid86and nameha) (resid 87andname hn) 3.6 3.60.0 !sing s assign(resid87and namehn) (resid 88andname hn) 4.1 4.10.0 !sing s assign(resid87and nameha) (resid 88andname hn) 3.1 3.10.0 !sing s assign(resid88and namehn) (resid 89andname hn) 4.1 4.10.0 !sing s assign(resid88and namehn) (resid 90andname hn) 5.5 5.50.0 !sing m assign(resid88and nameha) (resid 89andname hn) 4.1 4.10.0 !sing s assign(resid89and namehn) (resid 90andname hn) 3.6 3.60.0 !sing s assign(resid90and namehn) (resid 90andname hb) 3.6 3.60.0 !sing i assign(resid90and namehn) (resid 91andname hn) 3.1 3.10.0 !sing s assign(resid90and namehb) (resid 91andname hn) 5.5 5.50.0 !sing s assign(resid91and namehn) (resid 92andname hn) 5.5 5.50.0 !sing s assign(resid91and nameha) (resid 92andname hn) 3.1 3.10.0 !sing s assign(resid92and nameha) (resid 93andname hn) 3.1 3.10.0 !sing s class hbnd assign(resid17and namehn) (resid 29andname o) 2.0 0.30.3 !hbnd assign(resid17and namen) (resid 29andname o) 3.3 0.30.3 !hbnd assign(resid17and nameo) (resid 29andname hn) 2.0 0.30.3 !hbnd assign(resid17and nameo) (resid 29andname n) 3.3 0.30.3 !hbnd assign(resid19and namehn) (resid 27andname o) 2.0 0.30.3 !hbnd assign(resid19and namen) (resid 27andname o) 3.3 0.30.3 !hbnd assign(resid19and nameo) (resid 27andname hn) 2.0 0.30.3 !hbnd assign(resid19and nameo) (resid 27andname n) 3.3 0.30.3 !hbnd assign.(resid35and namehn) (resid 42andname o) 2.0 0.30.3 !hbnd assign(resid35and namen) (resid 42andname o) 3.3 0.30.3 !hbnd assign(resid35and nameo) (resid 42andname hn) 2.0 0.30.3 !hbnd assign(resid35and nameo) (resid 42andname n) 3.3 0.30.3 !hbnd assign(resid61and namehn) (resid 77andname o) 2.0 0.30.3 !hbnd assign(resid61and namen) (resid 77andname o) 3.3 0.30.3 !hbnd assign(resid61and nameo) (resid 77andname hn) 2.0 0.30.3 !hbnd assign(resid61and nameo) (resid 77andname n) 3.3 0.30.3 !hbnd assign(resid63and namehn) (resid 75andname o) 2.0 0.30.3 !hbnd assign(resid63and namen) (resid 75andname o) 3.3 0.30.3 !hbnd assign(resid63and nameo) (resid 75andname hn) 2.0 0.30.3 !hbnd assign(resid63and nameo) (resid 75andname n) 3.3 0.30.3 !hbnd ! dihedral angle restraints X-PLOR format ! chi-1 22 restraints ! phi 25 restraints ! psi 33 restraints ! chi-2 5 restraints !<ENERGY> <ANGLE> <RANGE><EXPONENT>
! chi-1 restraints assign (resid 15 and name n ) (resid 15 and name ca) (resid 15 and name cb) (resid 15 and name cg) 1.0 -60.0 90.0 2 assign (resid 19 and name n ) (resid 19 and name ca) (resid 19 and name cb) (resid 19 and name cg) 1.0 180.0 40.0 2 assign (resid 22 and name n ) (resid 22 and name ca) (resid 22 and name cb) (resid 22 and name cg) 1.0 -60.0 40.0 2 assign (resid 23 and name n ) (resid 23 and name ca) (resid 23 and name cb) (resid 23 and name cg) 1.0 60.0 40.0 2 assign (resid 30 and name n ) (resid 30 and name ca) (resid 30 and name cb) (resid 30 and name sg) 1.0 -60.0 40.0 2 assign (resid 31 and name n ) (resid 31 and name ca) (resid 31 and name cb) (resid 31 and name cg) 1.0 -60.0 40.0 2 assign (resid 32 and name n ) (resid 32 and name ca) (resid 32 and name cb) (resid 32 and name cg) 1.0 -60.0 40.0 2 assign (resid 33 and name n ) (resid 33 and name ca) (resid 33 and name cb) (resid 33 and name cg) 1.0 -60.0 40.0 2 assign (resid 34 and name n ) (resid 34 and name ca) (resid 34 and name cb) (resid 34 and name cg) 1.0 -60.0 40.0 2 assign (resid 35 and name n ) (resid 35 and name ca) (resid 35 and name cb) (resid 35 and name cg) 1.0 60.0 40.0 2 assign (resid 41 and name n ) (resid 41 and name ca) (resid 41 and name cb) (resid 41 and name sg) 1.0 -60.0 40.0 2 assign (resid 42 and name n ) (resid 42 and name ca) (resid 42 and name cb) (resid 42 and name cgl) 1.0 -60.0 40.0 2 assign (resid 49 and name n ) (resid 49 and name ca) (resid 49 and name cb) (resid 49 and name sg) 1.0 -60.0 40.0 2 assign (resid 52 and name n ) (resid 52 and name ca) (resid 52 and name cb) (resid 52 and name cg) 1.0 60.0 40.0 2 assign (resid 53 and name r. ) (resid 53 and name ca) (resid 53 and name cb) (resid 53 and name cg) 1.0 180.0 40.0 2 assign (resid 56 and name r. ) (resid 56 and name ca) (resid 56 and name cb) (resid 56 and name sg) 1.0 -60.0 40.0 2 assign (resid 62 and name n ) (resid 62 and name ca) (resid 62 and name cb) (resid 62 and name sg) 1.0 180.0 40.0 2 assign (resid 74 and name n ) (resid 74 and name ca) (resid 74 and name cb) (resid 74 and name cgl) 1.0 -60.0 40.0 2 assign (resid 76 and name n ) (resid 76 and name ca) (resid 76 and name cb) (resid 76 and name sg) 1.0 -60.0 40.0 2 assign (resid 78 and name n ) (resid 78 and name ca) (resid 78 and name cb) (resid 78 and name sg) 1.0 -60.0 40.0 2 assign (resid 87 and name n ) (resid 87 and name ca) (resid 87 and name cb) (resid 87 and name cg) 1.0 -60.0 40.0 2 assign (resid 92 and name n ) (resid 92 and name ca) (resid 92 and name cb) (resid 92 and name sg) 1.0 -60.0 90.0 2 ! phi restraints assign(resid14 andnamec (resid15andnamen ) ) (resid15 andnameca) (resid15andnamec ) 60.0 50.0 2 !HN(CO)HB
1.0 assign(resid18 andnamec (resid19andnamen ) ) (resid19 andnameca) (resid19andnamec ) -120.05C.0 2 !HNHA 8.9 1.0 Hz assign(resid27 andnamec (resid28andnamen ) ) (resid28 andnameca) (resid28andnamec ) -120.070.0 2 !HNHA 7.6 1.0 Hz assign(resid29 andnamec (resid30andnamen ) ) (resid30 andnameca) (resid30andnamec ) -78.050.0 2 1.0 assign(resid31 andnamec (resid32andnamen ) ) (resid32 andnameca) (resid32andnamec ) -84.050.0 2 1.0 assign(resid32 andnamec (resid33andnamen ) ) (resid33 andnameca) (resid33andnamec ) 60.0 50.0 2 !HN(CO)HB
1.0 assign(resid33 andnamec (resid34andnamen ) ) (resid34 andnameca) (resid39andnamec ) -120.050.0 2 !HNHA 8.2 1.0 Hz assign(resid34 andnamec (resid35andnamen ) ) (resid35 andnameca) (resid35andnamec ) -120.050.0 2 !HNHA 8.45 1.0 Hz assign(resid36 andnamec (resid37andnamen ) ) (resid37 andnameca) (resid37andnamec ) -120.050.0 2 !HNHA 8.6 1.0 Hz assign(resid38 andnamec (resid39andnamen ) ) (resid39 andnameca) (resid39andnamec ) -120.050.0 2 !HNHA 8.6 1.0 Hz assign(resid39 andnamec (resid40andnamen ) ) (resid90 andnameca) (resid40andnamec ) -120.050.0 2 !HNHA 8.3 1.0 Hz assign (resid90 and name (resid and name c ) 41 n ) (resid41 and name (resid and name 1.0 -120.0 2 !HNHA 8.8 ca) 41 c ) 50.0 Hz assign (resid41 and name (resid and name c ) 42 n ) (resid42 and name (resid and name 1.0 -120.0 2 !HNHA 8.5 ca) 42 c ) 50.0 Hz assign (resid49 and name (resid and name c ) 50 n ) (resid50 and name (resid and name 1.0 -75.0 2 ca) 50 c ) 50.0 assign (resid50 and name (resid and name c ) 51 n ) (resid51 and name (resid and name 1.0 -120.0 2 !HNHA 8.5 ca) 51 c ) 50.0 Hz assign (resid52 and name (resid and name c ) 53 n ) (resid53 and name (resid and name 1.0 60.0 50.02 !HN(CO)HB
ca) 53 c ) assign (resid55 and name (resid and name c ) 56 n ) (resid56 and name (resid and name 1.0 -60.0 2 !HNHA 5.0 ca) 56 c ) 50.0 Hz assign (resid58 and name (resid and name c ) 59 n ) (resid59 and name (resid and name 1.0 -120.0 2 !HNHA 8.8 ca) 59 c ) 50.0 Hz assign (resid59 and name (resid and name c ) 60 n ) (resid60 and name (resid and name 1.0 -120.0 2 !HNHA 8.2 ca) 60 c ) 50.0 Hz assign (resid60 and name (resid and name c ) 61 n ) (resid61 and name (resid and name 1.0 -120.0 2 !HNHA 8.1 ca) 61 c ) 50.0 Hz assign (resid61 and name (resid and name c ) 62 n ) (resid62 and name (resid and name 1.0 -150.0 2 !HNHA 7.9 ca) 62 c ) 70.0 Hz assign (resid62 and name (resid and name c ) 63 n ) (resid63 and name (resid and name 1.0 -120.0 2 !HNHA 8.7 ca) 63 c ) 50.0 Hz assign (resid73 and name (resid and name c ) 74 n ) (resid74 and name (resid and name 1.0 -120.0 2 ca) 74 c ) 50.0 assign (resid74 and name (resid and name c ) 75 n ) (resid75 and name (resid and name 1.0 -120.0 2 !HNHA 9.15 ca) 75 c ) 50.0 Hz assign (resid76 and name (resid and name c ) 77 n ) (resid77 and name (resid and name 1.0 -120.0 2 !HNHA 8.2 ca) 77 c ) 50.0 Hz ! psi restraint s assign (resid15 and name ) (resid15 and ca) n name (resid15 and name ) (resid16 and n ) 1.0 50.0 50.02 c name assign (resid19 and name ) (resid19 and ca) n name (resid19 and name ) (resid20 and n ) 1.0 120.075.02 c name assign (resid25 and name ) (resid25 and ca) n name (resid25 and name ) (resid26 and n ) 1.0 120.075.02 c name assign (resid27 and name ) (resid27 and ca) n name (resid27 and name ) (resid28 and n ) 1.0 120.075.02 c name assign (resid28 and name ) (resid28 and ca) n name (resid28 and name ) (resid29 and n ) 1.0 120.075.02 c name assign (resid29 and name ) (resid29 and ca) n name (resid29 and name ) (resid30 and n ) 1.0 120.060.02 c name assign (resid30 and name ) (resid30 and ca) n name (resid30 and name ) (resid31 and n ) 1.0 125.075.02 c name assign (resid31 and name ) (resid31 and ca) n name (resid31 and name ) (resid32 and n ) 1.0 120.075.02 c name assign (resid32 and name ) (resid32 and ca) n name (resid32 and name ) (resid33 and n ) 1.0 174.050.02 c name assign (resid33 and name ) (resid33 and ca) n name (resid33 and name ) (resid34 and n ) 1.0 60.0 50.02 c name assign (resid34 and name ) (resid34 and ca) n name (resid34 and name ) (resid35 and n ) 1.0 159.050.02 c name assign (resid35 and name ) (resid35 and ca) n name (resid35 and name ) (resid36 and n ) 1.0 156.050.02 c name assign (resid36 and name ) (resid36 and ca) n name (resid36 and name ) (resid37 and n ) 1.0 120.060.02 c name assign (resid37 and name ) (resid37 and ca) n name (resid37 and name ) (resid38 and n ) 1.0 120.060.02 c name assign (resid40 and name ) (resid40 and ca) n name (resid40 and name ) (resid41 and n ) 1.0 120.060.02 c name assign (resid41 and name ) (resid41 and ca) n name (resid41 and name ) (resid42 and n ) 1.0 120.060.02 c name assign (resid42 and name ) (resid42 and ca) n name (resid42 and name ) (resid43 and n ) 1.0 120.060.02 c name assign (resid43 and name ) (resid43 and ca) n name (resid43 and name ) (resid44 and n ) 1.0 120.060.02 c name assign (resid45 and name ) (resid45 and ca) n name (resid45 andnamec (resid and name n ) -60.0 50.0 !HNHB
) 46 1.0 2 assign(resid51 andnamen (resid and name ca) ) 51 (resid51 andnamec (resid and name n ) 120.0 75.0 ) 52 1.0 2 assign(resid53 andnamen (resid and name ca) ) 53 (resid53 andnamec (resid and name n ) 50.0 50.0 ) 54 1.0 2 assign(resid58 andnamen (resid and name ca) ) 58 (resid58 andnamec (resid and name n ) -60.0 50.0 !HNHB
) 59 1.0 2 assign(resid59 andnamen (resid and name ca) ) 59 (resid59 andnamec (resid and name n ) 33.0 50.0 ) 60 1.0 2 assign(resid60 andnamen (resid and name ca) ) 60 (resid60 andnamec (resid and name n ) 162.0 50.0 ) 61 1.0 2 assign(resid61 andnamen (resid and name ca) ) 61 (resid61 andnamec (resid and name n ) 120.0 60.0 ) 62 1.0 2 assign(resid62 andnamen (resid and name ca) ) 62 (resid62 andnamec (resid and name n ) 120.0 60.0 ) 63 1.0 2 assign(resid63 andnamen (resid and name ca) ) 63 (resid63 andnamec (resid and name n ) 165.0 50.0 ) 64 1.0 2 assign(resid74 andnamen (resid and name ca) ) 74 (resid74 andnamec (resid and name n ) 120.0 60.0 ) 75 1.0 2 assign(resid75 andnamen (resid and name ca) ) 75 (resid75 andnamec (resid and name n ) 120.0 60.0 ) 76 1.0 2 assign(resid76 andnamen (resid and name ca) ) 76 (resid76 andnamec (resid and name n ) 120.0 60.0 ) 77 1.0 2 assign(resid78 andnamen (resid and name ca) ) 78 (resid78 andnamec (resid and name n ) 120.0 60.0 ) 79 1.0 2 assign(resid83 andnamen (resid and name ca) ) 83 (resid83 andnamec (resid and name n ) 120.0 60.0 ) 84 1.0 2 assign(resid92 andnamen (resid and name ca) ) 92 (resid92 andnamec (resid and name n ) 120.0 75.0 ) 93 1.0 2 ! chi-2restraints assign(resid2 andnameca) (resid 2 and cb) name (resid2 andnamecgl)(resid 2 and cdl) 0 -60.0 40.0 2 !LRCH
name 1.
assign(resid31 andnameca) (resid cb) and name (resid31 andnamecg) (resid cdl) 0 180.0 40.0 2 !LRCH
31 1.
and name assign(resid32 andnameca) (resid cb) and name (resid32 andnamecg) (resid cdl) 0 180.0 40.0 2 !LRCH
32 1.
and name assign(resid74 andnameca) (resid 4 and cb) 7 name (resid74 andnamecgl)(resid 4 and cdl) 0 -60.0 40.0 2 !LRCH
7 name 1.
assign(resid90 andnameca) (resid cb) and name (resid90 andnamecgl)(resid 0 180.0 40.0 2 !LRCH
and name cdl) 1.
References Abseher, R., Horstink, L., Hilbers, C. W. & Nilges, M. (1998). Essential spaces defined by NMR structure ensembles and molecular dynamics simulation show significant overlap. Proteins: Structure, Function and Genetics, 31, 370-382.
Barbato, G., Ikura, M., Kay, L. E., Pastor, R. W. & Bax, A. (1992). Backbone dynamics of calmodulin studied by N-15 relaxation using inverse detected 2-dimensional nmr-spectroscopy - the central helix is flexible. Biochemistry, 31, 5269-5278.
Bersch, B., Hernandez, J-F., Marion, D. & Arland, G. A. (1998). Solution structure of the epidermal growth factor (EGF)-like module of human complement C 1 r, an atypical member of the EGF family. Biochemistry, 37, 1204-1214.
Blackman, M. J. & Holder, A. A. (1992). Secondary processing of the Plasmodium falciparum merozoite surface protein-1 (MSP-1) by a calcium-dependent membrane-bound serine protease: shedding of MSP-133 as a noncovalently associated complex with other fragments of the MSP-1. Mol. Biochem. Parasitol. 50, 307-316.
2o Blackman, M. J., Heidrich, H.-G. Donachie, S., McBride, J. S. & Holder, A.
A. (1990). A
single fragment of a malaria merozoite surface protein remains on the parasite surface during red cell invasion and is the target of invasion-inhibiting antibodies. J. Exp.
Med 172, 379-382.
Blackman, M. J., J. A. Chappel, S. Shai and A. A. Holder, A. A. (1993). A
conserved parasite serine protease processes the Plasmodium falciparum merozoite surface protein-1 (MSP-1). Mol. Biochem. Parasitol. 62, 103 Blackman, M. J., Scott-Finnigan, T. J., Shai, S. & Holder, A. A. (1994).
Antibodies inhibit 3o the protease-mediated processing of a malaria merozoite surface protein. J.
Exp. Med. 180, 389-393.
Blackman, M.J., Ling, I. T., Nicholls, S.C. & Holder, A.A. (1991). Proteolytic processing of the Plasmodium falciparum merozoite surface protein-1 produces a membrane-bound fragment containing two epidermal growth factor-like domains. Mol. Biochem.
Parasitol.
49, 29-34.
Brandstetter, H., Bauer, M., Huber, R., Lollar, P. & Bode, W. (1995). X-ray structure of clotting factor IXa: active site and module structure related to Xase activity and hemophilia B. Proc. Nat. Acad Sci. USA, 92, 9796-9800.
Burghaus, P. A. & Holder, A. A. (1994). Expression of the 19-kilodalton carboxy-terminal fragment of the Plasmodium falciparum merozoite surface protein-1 in Escherichia coli as a correctly folded protein. Mol. Biochem. Parasitol. 64, 165-169.
Campbell, LD. & Downing, A.K. (1998). NMR of modular proteins. Nat. Struct.
Biol. 5, Supp1496-499.
Clare, J. J. & Romanos, M. A. (1995). Expression of Cloned Genes in the Yeasts Saccharomyces cerevisiae and Pichia pastoris. Methods in Molec. Cell Biol. 5, 319-329.
2o Clore, G. M. & Gronenborn, A. M. (1998). Determining the structures of large proteins and protein complexes by NMR. Trends in Biotechnology, 16, 22-34.
Daly, T. M., Burns, J. M. & Long, C. A. (1992). Comparison of the carboxyl terminal, cysteine-rich domain of the merozoite surface protein-1 from several strains of Plasmodium yoelii. Mol. Biochem. Parasitol. 52, 279-282.
Del Portillo, H. A., Longacre, S., Khouri, E. & David, P. H. (1991). Primary structure of the merozoite surface antigen-1 of Plasmodium vivax reveals sequences conserved between different Plasmodium species. Proc. Natl. Acad Sci. USA 88, 4030-4034.
Diggs, C.L., Ballou, W.R. & Miller, L.H. (1993). The major merozoite surface protein as a malaria vaccine target. Parasitol Today, 9, 300-302.
Doreleijers, J. F., Rullman, J. A. C. & Kaptein, R. (1998). Quality assessment of NMR
structures: a statistical approach. J. Mol. Biol. 281, 149-164.
Downing. A. K., Knott, V., Werner, J. M., Cardy, C. M., Campbell, I. D. &
Handford, P.
A. (1996). Solution structure of a pair of calcium binding epidermal growth factor-like domains: implications for the Marfan syndrome and other genetic disorders.
Cell, 86, 597-605.
to Egan, A., Waterfall, M., Pinder, M., Holder, A. & Riley, E. (1997) Characterization of human T- and B- cell epitopes in the C-terminus of Plasmodium falciparum merozoite surface protein 1: evidence for poor T-cell recognition of polypeptides with numerous disulfide bonds. Infect. Immun. 65, 3024-3031.
Gibson, H.L., Tucker, J. E., Kaslow, D.C., Krettli, A.U., Collins, W. E., Kiefer, M. C., Bathurst, I. C. & Barr, P. J. (1992). Structure and expression of the gene for Pv200, a major blood-stage surface antigen of Plasmodium vivax. Mol. Biochem. Parasitol. 50, 325-334.
Guevara Patino, J. A., Holder, A. A., McBride, J. S. & Blackman, M. J. (1997).
Antibodies 2o that inhibit malaria merozoite surface protein-1 processing and erythrocyte invasion are blocked by naturally acquired human antibodies. J. Exp. Med. 186, 1689-1699.
Holder, A. A., Lockyer, M. J., Odink, K. G., Sandhu, J. S., Riveros-Moreno, V., Nicholls, S.
C., Hillman, Y., Davey, L. S., Tizard, M. L. V., Schwarz, R. T. & Freeman, R.
R. (1985).
Primary structure of the precursor to the three major surface antigens of Plasmodium falciparum merozoites. Nature 317, 270-273.
Holder, A. A., Blackman, M. J., Burghaus, P. A., Chappel, J. A., Ling, I. T., McCallum-Deighton, N. & Shai, S. (1992). A malaria merozoite surface protein (MSP-1) -Structure, processing and function. Mem. Inst. Oswaldo Cruz, 87, Suppl III, 37-42.
Kay, L. E., Torchia, D. A. & Bax, A. ( 1989). Backbone dynamics of proteins as studied by 'SN inverse detected heteronuclear NMR spectroscopy. Application to staphylococcal nuclease. Biochemistry, 28, 8972-8979.
Kraulis, P. J. ( 1991 ). Molscript - a program to produce both detailed and schematic plots of protein structures. J. Appl. Cryst. 24, 946-950.
Laroche, Y., Storme, V., de Meutter, J., Messens, J. & Lauwereys, M. (1994).
High-level secretion and very efficient isotopic labeling of tick anticoagulant peptide (TAP) to expressed in the methylotrophic yeast, Pichia pastoris. BiolTechnology, 12, 1119-1124.
Laskowski, R. A., Rullmann, J. A. C., MacArthur, M. W., Kaptein, R. &
Thornton, J. M.
(1996). AQUA and PROCHECK-NMR: Programs for checking the quality of protein structures solved by NMR. J. Biomol. NMR, 8, 477-486.
McBride, J. S. & Heidrich, H.-G. (1987). Fragments of the polymorphic Mr 185,000 glycoprotein from the surface of isolated Plasmodium falciparum merozoites form an antigenic complex. Mol. Biochem. Parasitol. 23, 71-84.
2o McDonald, I. K. & Thornton, J. M. (1994). Satisfying hydrogen bonding potential in proteins. J. Biol. Chem. 238, 777-793.
Mrema, J. E. K., S. G. Langreth, R. C. Jost, K. H. Rieckmann and H. -G.
Heidrich (1982).
Plasmodium falciparum: isolation and purification of spontaneously released merozoites by nylon sieve membranes. Exp. Parasitol. 54, 285.
Nicholls, A., Sharp, K. A. & Honig, B. (1991). Protein folding and association: insights from the interfacial and thermodynamic properties of hydrocarbons. Proteins, 11, 281-296.
Nilges, M., Kuszewski, J. & Briinger, A. T. ( 1991 ). Sampling properties of simulated annealing and distance geometry in Computational Aspects of the Study of Biological _87_ Macromolecules by NMR . (J. C. Hoch, ed.) NY, Plenum Press.451-455.
Pirson, P. J. & Perkins, M. E. (1985). Characterization with monoclonal antibodies of a surface antigen of Plasmodium falciparum merozoites. J. Immunol. 134, 1946-1951.
Polshakov, V. L, Frenkiel, T. A., Birdsall, B., Soteriou, A. & Feeney, J.
(1995).
Determination of stereospecific assignments torsion-angle constraints and rotamer populations in proteins using the program AngleSearch. J. Magn. Reson. Series B, 108, 31-43.
to Polshakov, V. L, Williams, M., Gargaro, A., Frenkiel, T. A., Westley, B. R., Chadwick, M. P., May, F. E. B. & Feeney, J. (1997). High resolution solution structure of the human breast cancer oestrogen-inducible pNR-2/pS2: a single trefoil domain. J. Mol.
Biol. 267, 418-432.
Perrin, S & Gilliland, G. (1990). Site specific mutagenesis using asymmetric polymerase chain reaction and a single mutant primer. Nucl. Acids Res. 18, 7433-7438 Qari, S.H., Shi, Y. P., Goldman, I. F., Nahlen, B. L., Tibayrenc, M., Lal, A.
A. (1998).
Predicted and observed alleles of Plasmodium falciparum merozoite surface protein 1 (MSP-1), a potential malaria vaccine antigen. Mol. Biochem. Parasitol. 92(2), 241-252.
Richardson, J. S. ( 1981 ). The Anatomy and Taxonomy of Protein structure.
Adv. Prot.
Chem. 34, 167-339.
Ryckaert, J-P., Ciccutti, G. & Berendsen, H. J. C. ( 1977). Numerical-integration of Cartesian equations of motion of a system with constraints - molecular dynamics of N-alkanes. .I. Comput. Phys. 23, 327-351.
3o Stoute, J. A. & Ballou, W.R. (1998). The current status of malaria vaccines. BIODRUGS
10,123-136.
a _88_ SEQUENCE LISTING
SEQ LD. No. I - P. falciparum MSP-I,~ (From SwissProt accession no. P04933) 1o SEQ LD. No. 2 - P. falciparum MSP-142 (From SwissProt accession no. P04933) is AKVLNYTYEK SNUEVKIKEL NYLKTIQDKL ADFKKNNNFV GIADLSTDYN HNNLLTKFLS 237 SEQUENCE LISTING
(1) GENERAL
INFORMATION:
(i) APPLICANT: MEDICAL RESEARCH COUNCIL
(ii) TITLE OF INVENTION: VACCINE
(iii) NUMBER OF SEQUENCES: 2 (iv) CORRESPONDENCE ADDRESS:
(A) ADDRESSEE: SMART & BIGGAR
(B) STREET: P.O. BOX 2999, STATION
D
(C) CITY: OTTAWA
(D) STATE: ONT
(E) COUNTRY: CANADA
(F) ZIP: K1P 5Y6 (v) COMPUTER READABLE FORM:
2 (A) MEDIUM TYPE: Floppy disk (B) COMPUTER: IBM PC compatible (C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: ASCII (text) (vi) CURRENT APPLICATION DATA:
(A) APPLICATION NUMBER: CA 2,271,451 (B) FILING DATE: 25-MAY-1999 (C) CLASSIFICATION:
(vii) PRIOR APPLICATION DATA:
(A) APPLICATION NUMBER: GB 9909072.2 3~ (B) FILING DATE: 20-APR-1999 (viii) ATTORNEY/AGENT INFORMATION:
(A) NAME: SMART & BIGGAR
(B) REGISTRATION NUMBER:
(C) REFERENCE/DOCKET NUMBER: 67551-9 (ix) TELECOMMUNICATION INFORMATION:
(A) TELEPHONE: (613)-232-2486 (B) TELEFAX: (613)-232-8440 (2) INFORMATION FOR SEQ ID N0:1:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 96 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 10 (vi) ORIGINAL SOURCE:
(A) ORGANISM: Plasmodium falciparum (xi) SEQUENCE DESCRIPTION: SEQ ID NO:1:
Asn Ile Ser Gln His Gln Cys Val Lys Lys Gln Cys Pro Gln Asn Ser Gly Cys Phe Arg His Leu Asp Glu Arg Glu Glu Cys Lys Cys Leu Leu 2 0 Asn Tyr Lys Gln Glu Gly Asp Lys Cys Val Glu Asn Pro Asn Pro Thr Cys Asn Glu Asn Asn Gly Gly Cys Asp Ala Asp Ala Lys Cys Thr Glu Glu Asp Ser Gly Ser Asn Gly Lys Lys Ile Thr Cys Glu Cys Thr Lys Pro Asp Ser Tyr Pro Leu Phe Asp Gly Ile Phe Cys Ser Ser Ser Asn (2) INFORMATION FOR SEQ ID N0:2:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 376 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single 4 0 (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (vi) ORIGINAL SOURCE:
(A) ORGANISM: Plasmodium falciparum (xi) SEQUENCE DESCRIPTION: SEQ ID N0:2:
Ala Val Thr Pro Ser Val Ile Asp Asn Ile Leu Ser Lys Ile Glu Asn Glu Tyr Glu Val Leu Tyr Leu Lys Pro Leu Ala Gly Val Tyr Arg Ser Leu Lys Lys Gln Leu Glu Asn Asn Val Met Thr Phe Asn Val Asn Val Lys Asp Ile Leu Asn Ser Arg Phe Asn Lys Arg Glu Asn Phe Lys Asn Val Leu Glu Ser Asp Leu Ile Pro Tyr Lys Asp Leu Thr Ser Ser Asn Tyr Val Val Lys Asp Pro Tyr Lys Phe Leu Asn Lys Glu Lys Arg Asp Lys Phe Leu Ser Ser Tyr Asn Tyr Ile Lys Asp Ser Ile Asp Thr Asp Ile Asn Phe Ala Asn Asp Val Leu Gly Tyr Tyr Lys Ile Leu Ser Glu Lys Tyr Lys Ser Asp Leu Asp Ser Ile Lys Lys Tyr Ile Asn Asp Lys Gln Gly Glu Asn Glu Lys Tyr Leu Pro Phe Leu Asn Asn Ile Glu Thr Leu Tyr Lys Thr Val Asn Asp Lys Ile Asp Leu Phe Val Ile His Leu Glu Ala Lys Val Leu Asn Tyr Thr Tyr Glu Lys Ser Asn Val Glu Val Lys Ile Lys Glu Leu Asn Tyr Leu Lys Thr Ile Gln Asp Lys Leu Ala Asp Phe Lys Lys Asn Asn Asn Phe Val Gly Ile Ala Asp Leu Ser Thr Asp Tyr Asn His Asn Asn Leu Leu Thr Lys Phe Leu Ser Thr Gly Met Val Phe Glu Asn Leu Ala Lys Thr Val Leu Ser Asn Leu Leu Asp Gly Asn Leu Gln Gly Met Leu Asn Ile Ser Gln His Gln Cys Val Lys Lys Gln Cys Pro Gln Asn Ser Gly Cys Phe Arg His Leu Asp Glu Arg Glu Glu Cys Lys Cys Leu Leu Asn Tyr Lys Gln Glu Gly Asp Lys Cys Val Glu Asn Pro Asn Pro Thr Cys Asn Glu Asn Asn Gly Gly Cys Asp Ala Asp Ala Lys Cys Thr Glu Glu Asp Ser Gly Ser Asn Gly Lys Lys Ile Thr Cys Glu Cys Thr Lys Pro Asp Ser Tyr Pro Leu Phe Asp Gly Ile Phe Cys Ser Ser Ser Asn Phe Leu Gly Ile Ser Phe Leu Leu Ile Leu Met Leu Ile Leu Tyr Ser Phe Ile
79 6 GLN CG C 33.8 0.6 1 81 6 GLN N N 122.5 0.3 9 82 6 GLN NE2 N 112.6 0.3 5 83 7 CYS H H 9.18 0.02 84 7 CYS HA H 4.09 0.02 85 7 CYS HB2 H 3.31 0.02 86 7 CYS HB3 H 3.11 0.02 88 7 CYS C C 174.4 0.6 1 89 7 CYS CA C 56.6 0.6 1 90 7 CYS CB C 42.3 0.6 I
91 7 CYS N N 124.5 0.3 1 92 8 VAL H H 10.42 0.02 93 8 VAL HA H 4.33 0.02 l 94 8 VAL HB H 2.15 0.02 95 8 VAL HG1 H 0.84 0.02 96 8 VAL HG2 H 0.82 0.02 97 8 VAL C C 176.6 0.6 1 98 8 VAL CA C 62.5 0.6 1 99 8 VAL CB C 34.4 0.6 I
100 8 VAL CG1 C 21.5 0.6 2 101 8 VAL CG2 C 19.7 0.6 2 102 8 VAL N N 119.1 0.3 1 103 9 LYS H H 9.42 0.02 104 9 LYS HA H 4.51 0.02 105 9 LYS HB2 H 1.81 0.02 106 9 LYS HB3 H 1.81 0.02 I07 9 LYS HG2 H 1.41 0.02 108 9 LYS HG3 H 1.41 0.02 109 9 LYS HD2 H ? ? ?
110 9 LYS HD3 H ? ? ?
I11 9 LYS HE2 H 3.33 0.02 112 9 LYS HE3 H 3.33 0.02 114 9 LYS C C ? ? ?
115 9 LYS CA C 57.7 0.6 1 116 9 LYS CB C ? ? ?
117 9 LYS CG C ? ? ?
118 9 LYS CD C ? ? ?
119 9 LYS CE C ? ? ?
120 9 LYS N N 124.1 0.03 122 10 LYS H H 8.94 0.02 123 10 LYS HA H 4.06 0.02 124 10 LYS HB2 H 1.86 0.02 125 10 LYS HB3 H 1.86 0.02 126 10 LYS HG2 H 1.29 0.02 127 10 LYS HG3 H 1.29 0.02 128 10 LYS HD2 H 1.70 0.02 129 10 LYS HD3 H 1.59 0.02 130 10 LYS HE2 H 3.04 0.02 131 10 LYS HE3 H 3.04 0.02 133 l0 LYS C C ? ? ?
134 l0 LYS CA C 57.1 0.6 1 135 10 LYS CB C 34.3 0.6 1 136 10 LYS CG C 25.6 0.6 1 137 10 LYS CD C 29.6 0.6 1 138 10 LYS CE C 42.4 0.6 1 ~
139 10 LYS N N 122.4 0.3 1 141 11 GLN H H ? ? ?
142 11 GLN HA H 4.47 0.02 143 II GLN HB2 H 2.03 0.02 144 11 GLN HB3 H 1.89 0.02 145 II GLN HG2 H 2.28 0.02 146 Il GLN HG3 H 2.28 0.02 147 11 GLN HE21 H 7.45 0.02 148 11 GLN HE22 H 6.84 0.02 149 11 GLN C C ? ? ?
150 II GLN CA C 54.4 0.6 1 151 II GLN CB C 28.7 0.6 1 152 I1 GLN CG C 33.8 0.6 1 154 I1 GLN N N ? ? ?
155 Il GLN NE2 N 112.9 0.3 1 156 12 CYS H H ? ? ?
157 12 CYS HA H 5.09 0.02 158 12 CYS HB2 H 3.49 0.02 159 12 CYS HB3 H 2.34 0.02 161 12 CYS C C ? ? ?
162 12 CYS CA C 52.4 0.6 1 163 12 CYS CB C 37.2 0.6 I
164 12 CYS N N ? ? ?
165 13 PRO HA H 4.55 0.02 166 13 PRO HB2 H 2.45 0.02 167 l3 PRO HB3 H 1.94 0.02 168 13 PRO HG2 H 1.73 0.02 169 l3 PRO HG3 H 2.04 0.02 170 l3 PRO HD2 H 3.43 0.02 171 13 PRO HD3 H 3.80 0.02 172 13 PRO C C 176.4 0.6 1 173 l3 PRO CA C 62.6 0.6 1 174 13 PRO CB C 33.0 0.6 1 175 13 PRO CG C 27.5 0.6 1 176 13 PRO CD C 50.6 0.6 1 178 14 GLN H H 8.48 0.02 179 14 GLN HA H 4.01 0.02 180 14 GLN HB2 H 1.94 0.02 l 181 14 GLN HB3 H 1.94 0.02 182 14 GLN HG2 H 2.42 0.02 183 14 GLN HG3 H 2.42 0.02 184 14 GLN HE21 H 7.59 0.02 185 14 GLN HE22 H 6.92 0.02 186 14 GLN C C 176.6 0.6 1 187 14 GLN CA C 57.4 0.6 1 188 14 GLN CB C 28.6 0.6 1 189 14 GLN CG C 33.8 0.6 I
191 14 GLN N N 120.5 0.3 1 192 14 GLN NE2 N 112.6 0.3 5 193 15 ASN H H 8.93 0.02 194 15 ASN HA H 3.77 0.02 195 15 ASN HB2 H 2.58 0.02 196 15 ASN HB3 H 1.09 0.02 197 15 ASN HD21 H 6.97 0.02 198 15 ASN HD22 H 7.12 0.02 199 15 ASN C C 171.9 0.6 1 200 l5 ASN CA C 54.6 0.6 1 201 l5 ASN CB C 36.3 0.6 l 203 l5 ASN N N 115.8 0.3 1 204 15 ASN ND2 N 115.4 0.3 1 205 16 SER H H 7.34 0.02 I
206 16 SER HA H 4.93 0.02 207 16 SER HB2 H 3.62 0.02 208 16 SER HB3 H 3.52 0.02 210 16 SER C C 173.5 0.6 l 211 16 SER CA C 57.5 0.6 1 212 16 SER CB C 67.9 0.6 I
213 16 SER N N 109.9 0.3 1 214 17 GLY H H 8.92 0.02 21 17 GLY HA2 H 3.83 0.02 216 17 GLY HA3 H 2.06 0.02 217 17 GLY C C ? ? ?
218 l7 GLY CA C 42.6 0.6 1 219 17 GLY N N 108.5 0.3 1 220 l8 CYS H H 7.01 0.02 221 l8 CYS HA H 5.63 0.02 222 18 CYS HB2 H 3.01 0.02 223 18 CYS HB3 H 3.01 0.02 l 225 18 CYS C C 172.5 0.6 l 226 18 CYS CA C 55.8 0.6 1 227 18 CYS CB C 43.2 0.6 1 228 18 CYS N N 120.5 0.3 1 229 19 PHE H H 9.12 0.02 230 19 PHE HA H 4.43 0.02 l 231 19 PHE HB2 H 1.70 0.02 232 19 PHE HB3 H 0.62 0.02 233 19 PHE HD1 H 6.12 0.02 234 19 PHE HD2 H 6.12 0.02 l 23S 19 PHE HE1 H 6.30 0.02 236 19 PHE HE2 H 6.30 0.02 237 19 PHE HZ H 6.37 0.02 l 238 19 PHE C C 172.3 0.6 1 239 19 PHE CA C 57.0 0.6 1 240 19 PHE CB C 41.7 0.6 I
247 19 PHE N N 132.0 0.6 1 248 20 ARG H H 7.76 0.02 249 20 ARG HA H 4.83 0.02 250 20 ARG HB2 H 1.26 0.02 251 20 ARG HB3 H 0.99 0.02 252 20 ARG HG2 H 1.59 0.02 253 20 ARG HG3 H 1.42 0.02 254 20 ARG HD2 H 3.35 0.02 2SS 20 ARG HD3 H 3.10 0.02 2S6 20 ARG HE H 7.18 0.02 257 20 ARG HH 11 H 6.23 0.02 2S8 20 ARG HH12 H 6.23 0.02 259 20 ARG HH21 H 6.23 0.02 260 20 ARG HH22 H 6.23 0.02 261 20 ARG C C 174.7 0.6 1 262 20 ARG CA C 54.3 0.6 1 263 20 ARG CB C 32.3 0.6 I
264 20 ARG CG C 28.0 0.6 1 265 20 ARG CD C 44.1 0.6 1 267 20 ARG N N 129.4 0.3 1 268 20 ARG NE N 85.0 0.3 1 269 20 ARG NH1 N 70.1 0.3 5 270 20 ARG NH2 N 70.1 0.3 5 271 21 HIS H H 9.30 0.02 272 21 HIS HA H 4.50 0.02 273 21 HIS HB2 H 3.52 0.02 274 21 HIS HB3 H 3.44 0.02 276 21 HIS HD2 H 7.02 0.02 277 21 HIS HE1 H 8.44 0.02 279 21 HIS C C 177.6 0.6 1 280 21 HIS CA C 56.4 0.6 1 281 21 HIS CB C 32.2 0.6 1 285 21 HIS N N 125.9 0.3 1 288 22 LEU H H 9.30 0.02 289 22 LEU HA H 4.11 0.02 I
290 22 LEU HB2 H 1.87 0.02 291 22 LEU HB3 H 1.65 0.02 l 292 22 LEU HG H 1.87 0.02 293 22 LEU HD 1 H 0.77 0.02 294 22 LEU HD2 H 0.98 0.02 295 22 LEU C C 177.7 0.6 1 296 22 LEU CA C 57.7 0.6 I
297 22 LEU CB C 40.8 0.6 l 298 22 LEU CG C 27.6 0.6 l 299 22 LEU CD 1 C 22.6 0.6 2 300 22 LEU CD2 C 25.3 0.6 2 301 22 LEU N N 122.0 0.3 1 302 23 ASP H H 7.86 0.02 303 23 ASP HA H 4.52 0.02 l 304 23 ASP HB2 H 3.10 0.02 305 23 ASP HB3 H 2.53 0.02 306 23 ASP C C 176.8 0.6 1 307 23 ASP CA C 53.6 0.6 1 308 23 ASP CB C 39.7 0.6 1 310 23 ASP N N 116.9 0.3 I
311 24 GLU H H 8.01 0.02 312 24 GLU HA H 3.63 0.02 313 24 GLU HB2 H 2.57 0.02 314 24 GLU HB3 H 2.17 0.02 315 24 GLU HG2 H 2.14 0.02 I
316 24 GLU HG3 H 2.14 0.02 317 24 GLU C C 176.1 0.6 l 318 24 GLU CA C 59.4 0.6 1 319 24 GLU CB C 27.5 0.6 1 320 24 GLU CG C 37.0 0.6 I
322 24 GLU N N 110.3 0.3 1 323 25 ARG H H 8.04 0.02 I
324 25 ARG HA H 4.24 0.02 325 25 ARG HB2 H 1.84 0.02 326 25 ARG HB3 H 1.75 0.02 327 25 ARG HG2 H 1.56 0.02 328 25 ARG HG3 H 1.56 0.02 329 25 ARG HD2 H 3.16 0.02 l 330 25 ARG HD3 H 3.16 0.02 331 25 ARG HE H 8.01 0.02 332 25 ARG HH11 H 6.71 0.02 333 25 ARG HH12 H 6.71 0.02 334 25 ARG HH21 H 6.71 0.02 335 25 ARG HH22 H 6.71 0.02 336 25 ARG C C 175.6 0.6 1 337 25 ARG CA C 57.8 0.6 1 338 25 ARG CB C 31.0 0.6 1 339 25 ARG CG C 28.3 0.6 1 340 25 ARG CD C 43.5 0.6 1 342 25 ARG N N 121.9 0.3 1 343 25 ARG NE N 85.8 0.3 1 344 25 ARG NH1 N 70.3 0.3 5 345 25 ARG NH2 N 70.3 0.3 5 346 26 GLU H H 8.69 0.02 347 26 GLU HA H 5.40 0.02 348 26 GLU HB2 H 1.90 0.02 349 26 GLU HB3 H 1.90 0.02 I
350 26 GLU HG2 H 2.63 0.02 351 26 GLU HG3 H 2.09 0.02 352 26 GLU C C 173.6 0.6 1 353 26 GLU CA C 55.6 0.6 1 354 26 GLU CB C 37.9 0.6 1 355 26 GLU CG C 31.5 0.6 1 357 26 GLU N N 124.3 0.3 1 358 27 GLU H H 9.07 0.02 359 27 GLU HA H 4.84 0.02 360 27 GLU HB2 H 2.15 0.02 361 27 GLU HB3 H 2.27 0.02 362 27 GLU HG2 H 2.48 0.02 363 27 GLU HG3 H 2.32 0.02 364 27 GLU C C 174.5 0.6 1 365 27 GLU CA C 54.6 0.6 l 366 27 GLU CB C 34.8 0.6 I
367 27 GLU CG C 36.5 0.6 1 369 27 GLU N N 123.9 0.3 1 370 28 CYS H H 8.88 0.02 371 28 CYS HA H 5.65 0.02 372 28 CYS HB2 H 3.00 0.02 373 28 CYS HB3 H 2.81 0.02 375 28 CYS C C 175.5 0.6 l 376 28 CYS CA C 53.0 0.6 l 377 28 CYS CB C 40.9 0.6 1 378 28 CYS N N 122.0 0.3 1 379 29 LYS H H 8.76 0.02 380 29 LYS HA H 4.56 0.02 I
381 29 LYS HB2 H 1.40 0.02 I
382 29 LYS HB3 H 1.40 0.02 I
383 29 LYS HG2 H 1.38 0.02 384 29 LYS HG3 H 1.38 0.02 I
385 29 LYS HD2 H 1.13 0.02 386 29 LYS HD3 H 0.92 0.02 387 29 LYS HE2 H 2.86 0.02 388 29 LYS HE3 H 2.86 0.02 389 29 LYS HZ H 7.23 0.02 390 29 LYS C C 174.6 0.6 1 391 29 LYS CA C 56.4 0.6 1 392 29 LYS CB C 38.4 0.6 1 393 29 LYS CG C 25.8 0.6 1 394 29 LYS CD C 29.6 0.6 l 395 29 LYS CE C 42.4 0.6 1 396 29 LYS N N 124.0 0.3 1 397 29 LYS NZ N 33.0 0.3 5 398 30 CYS H H 8.78 0.02 I
399 30 CYS HA H 4.65 0.02 l 2.49 0.02 401 30 CYS HB3 H 3.01 0.02 403 30 CYS C C 173.3 0.6 I
404 30 CYS CA C 54.6 0.6 1 405 30 CYS CB C 35.9 0.6 1 406 30 CYS N N 121.7 0.3 1 407 31 LEU H H 7.81 0.02 I
408 31 LEU HA H 4.23 0.02 409 31 LEU HB2 H 1.39 0.02 410 31 LEU HB3 H 1.73 0.02 411 31 LEU HG H 0.94 0.02 412 3 I LEU HD 1 H 0.68 0.02 413 31 LEU HD2 H 0.77 0.02 414 31 LEU C C 176.2 0.6 1 415 31 LEU CA C 54.8 0.6 1 416 31 LEU CB C 42.5 0.6 1 417 31 LEU CG C 27.1 0.6 1 418 31 LEU CD 1 C 26.0 0.6 1 419 31 LEU CD2 C 21.9 0.6 I
420 31 LEU N N 119.2 0.3 l 421 32 LEU H H 8.91 0.02 l 422 32 LEU HA H 4.26 0.02 423 32 LEU HB2 H 1.75 0.02 l 424 32 LEU HB3 H 1.32 0.02 425 32 LEU HG H 1.77 0.02 l 426 32 LEU HD1 H 0.96 0.02 l 427 32 LEU HD2 H 0.77 0.02 I
428 32 LEU C C 179.0 0.6 l 429 32 LEU CA C 56.4 0.6 1 430 32 LEU CB C 42.1 0.6 1 431 32 LEU CG C 26.9 0.6 l 432 32 LEU CD1 C 26.0 0.6 l 433 32 LEU CD2 C 23.4 0.6 1 434 32 LEU N N 118.4 0.3 1 435 33 ASN H H 8.84 0.02 436 33 ASN HA H 3.90 0.02 437 33 ASN HB2 H 3.26 0.02 l 438 33 ASN HB3 H 2.88 0.02 439 33 ASN HD21 H 6.86 0.02 I
440 33 ASN HD22 H 7.25 0.02 l 441 33 ASN C C 173.8 0.6 I
442 33 ASN CA C 56.9 0.6 1 443 33 ASN CB C 37.3 0.6 1 445 33 ASN N N 110.8 0.3 1 446 33 ASN ND2 N 112.0 0.3 1 447 34 TYR H H 8.61 0.02 448 34 TYR HA H 5.02 0.02 449 34 TYR HB2 H 3.35 0.02 450 34 TYR HB3 H 2.52 0.02 45 34 TYR HD 1 H 6.74 0.02 l 1 452 34 TYR HD2 H 6.74 0.02 453 34 TYR HEI H 6.69 0.02 454 34 TYR HE2 H 6.69 0.02 456 34 TYR C C 174.7 0.6 I
457 34 TYR CA C 57.6 0.6 l 458 34 TYR CB C 41.0 0.6 1 465 34 TYR N N 118.6 0.3 1 466 35 LYS H H 9.99 0.02 467 35 LYS HA H 4.84 0.02 468 35 LYS HB2 H 1.82 0.02 469 35 LYS HB3 H 1.59 0.02 470 35 LYS HG2 H 1.18 0.02 471 35 LYS HG3 H 1.18 0.02 472 35 LYS HD2 H 1.48 0.02 473 35 LYS HD3 H 1.48 0.02 474 35 LYS HE2 H 2.89 0.02 475 35 LYS HE3 H 2.89 0.02 477 35 LYS C C 174.1 0.6 1 478 35 LYS CA C 54.2 0.6 I
479 35 LYS CB C 36.3 0.6 1 480 35 LYS CG C 24.1 0.6 1 481 35 LYS CD C 29.6 0.6 I
482 35 LYS CE C 41.6 0.6 I
483 35 LYS N N 119.7 0.3 1 485 36 GLN H H 8.77 0.02 I
486 36 GLN HA H 4.67 0.02 487 36 GLN HB2 H 2.06 0.02 488 36 GLN HB3 H 2.06 0.02 489 36 GLN HG2 H 2.35 0.02 490 36 GLN HG3 H 2.35 0.02 I
491 36 GLN HE21 H 7.50 0.02 492 36 GLN HE22 H 6.55 0.02 493 36 GLN C C 176.3 0.6 I
494 36 GLN CA C 56.7 0.6 I
495 36 GLN CB C 28.6 0.6 1 496 36 GLN CG C 33.7 0.6 I
498 36 GLN N N 124.9 0.3 1 499 36 GLN NE2 N 110.9 0.3 1 500 37 GLU H H 8.96 0.02 I
501 37 GLU HA H 4.51 0.02 I
502 37 GLU HB2 H 1.96 0.02 503 37 GLU HB3 H 1.80 0.02 504 37 GLU HG2 H 2.11 0.02 505 37 GLU HG3 H 2.11 0.02 506 37 GLU C C 176.2 0.6 I
507 37 GLU CA C 56.0 0.6 1 508 37 GLU CB C 31.9 0.6 1 509 37 GLU CG C 36.6 0.6 1 5ll 37 GLU N N 130.2 0.3 1 512 38 GLY H H 9.20 0.02 513 38 GLY HA2 H 3.69 0.02 514 38 GLY HA3 H 4.05 0.02 515 38 GLY C C 174.7 0.6 1 516 38 GLY CA C 47.4 0.6 l 517 38 GLY N N 118.4 0.3 l 518 39 ASP H H 8.81 0.02 519 39 ASP HA H 4.69 0.02 520 39 ASP HB2 H 2.78 0.02 521 39 ASP HB3 H 2.78 0.02 522 39 ASP C C 175.2 0.6 1 523 39 ASP CA C 54.2 0.6 1 524 39 ASP CB C 41.0 0.6 1 526 39 ASP N N 127.1 0.3 1 527 40 LYS H H 7.86 0.02 528 40 LYS HA H 4.71 0.02 529 40 LYS HB2 H 1.86 0.02 530 40 LYS HB3 H 1.86 0.02 531 40 LYS HG2 H 1.52 0.02 532 40 LYS HG3 H 1.52 0.02 I
533 40 LYS HD2 H 1.69 0.02 534 40 LYS HD3 H 1.69 0.02 535 40 LYS HE2 H 3.02 0.02 536 40 LYS HE3 H 3.02 0.02 538 40 LYS C C 175.4 0.6 I
539 40 LYS CA C 54.8 0.6 1 540 40 LYS CB C 36.3 0.6 1 541 40 LYS CG C 24.9 0.6 1 542 40 LYS CD C 29.0 0.6 1 543 40 LYS CE C 42.0 0.6 1 544 40 LYS N N 118.0 0.3 1 546 41 CYS H H 8.95 0.02 547 41 CYS HA H 5.29 0.02 548 41 CYS HB2 H 3.00 0.02 549 41 CYS HB3 H 2.58 0.02 551 41 CYS C C 174.4 0.6 1 552 41 CYS CA C 55.0 0.6 l 553 4l CYS CB C 41.9 0.6 1 554 4l CYS N N 119.8 0.3 1 555 42 VAL H H 9.35 0.02 556 42 VAL HA H 4.88 0.02 557 42 VAL HB H 2.32 0.02 l 558 42 VAL HG1 H 1.00 0.02 559 42 VAL HG2 H 0.88 0.02 560 42 VAL C C 175.6 0.6 I
561 42 VAL CA C 59.2 0.6 1 562 42 VAL CB C 35.2 0.6 1 563 42 VAL CG 1 C 21.6 0.6 1 564 42 VAL CG2 C 19.3 0.6 1 565 42 VAL N N 118.7 0.3 1 566 43 GLU H H 9.18 0.02 567 43 GLU HA H 3.34 0.02 568 43 GLU HB2 H 1.84 0.02 569 43 GLU HB3 H 1.75 0.02 570 43 GLU HG2 H 2.15 0.02 571 43 GLU HG3 H 2.07 0.02 572 43 GLU C C 175.4 0.6 1 573 43 GLU CA C 59.0 0.6 1 574 43 GLU CB C 29.8 0.6 1 575 43 GLU CG C 36.8 0.6 I
577 43 GLU N N 123.4 0.3 1 578 44 ASN H H 8.25 0.02 l 579 44 ASN HA H 4.95 0.02 580 44 ASN HB2 H 2.72 0.02 581 44 ASN HB3 H 1.97 0.02 582 44 ASN HD21 H 8.07 0.02 583 44 ASN HD22 H 7.24 0.02 584 44 ASN C C ? ? ?
585 44 ASN CA C 48.5 0.6 1 586 44 ASN CB C 39.2 0.6 1 588 44 ASN N N 120.2 0.3 589 44 ASN ND2 N 112.1 0.3 l 590 45 PRO HA H 4.40 0.02 l 591 45 PRO HB2 H 2.31 0.02 I
592 45 PRO HB3 H 1.95 0.02 l 593 45 PRO HG2 H 1.97 0.02 l 594 45 PRO HG3 H 1.97 0.02 l 595 45 PRO HD2 H 3.86 0.02 596 45 PRO HD3 H 3.81 0.02 597 45 PRO C C 176.2 0.6 1 598 45 PRO CA C 63.7 0.6 l 599 45 PRO CB C 32.6 0.6 l 600 45 PRO CG C 26.8 0.6 I
601 45 PRO CD C 50.9 0.6 I
603 46 ASN H H 7.47 0.02 604 46 ASN HA H 5.09 0.02 605 46 ASN HB2 H 2.72 0.02 606 46 ASN HB3 H 2.43 0.02 607 46 ASN HD21 H 7.57 0.02 608 46 ASN HD22 H 6.91 0.02 609 46 ASN C C ? ? ?
610 46 ASN CA C 51.6 0.6 1 611 46 ASN CB C 40.1 0.6 1 613 46 ASN N N 114.0 0.3 1 614 46 ASN ND2 N 112.6 0.3 1 615 47 PRO HA H 4.34 0.02 616 47 PRO HB2 H 1.97 0.02 617 47 PRO HB3 H 1.77 0.02 618 47 PRO HG2 H 1.96 0.02 619 47 PRO HG3 H 1.96 0.02 620 47 PRO HD2 H 3.52 0.02 621 47 PRO HD3 H 3.39 0.02 622 47 PRO C C 175.5 0.6 1 623 47 PRO CA C 63.7 0.6 1 624 47 PRO CB C 32.4 0.6 1 625 47 PRO CG C 27.5 0.6 1 626 47 PRO CD C 49.8 0.6 1 628 48 THR H H 8.28 0.02 629 48 THR HA H 4.68 0.02 630 48 THR HB H 4.32 0.02 632 48 THR HG2 H 1.13 0.02 633 48 THR C C 174.5 0.6 1 634 48 THR CA C 59.1 0.6 1 635 48 THR CB C 69.9 0.6 1 636 48 THR CG2 C 19.3 0.6 1 637 48 THR N N 112.4 0.3 1 638 49 CYS H H 9.35 0.02 639 49 CYS HA H 4.44 0.02 l 640 49 CYS HB2 H 2.64 0.02 l 641 49 CYS HB3 H 3.14 0.02 643 49 CYS C C 175.8 0.6 l 644 49 CYS CA C 55.5 0.6 1 645 49 CYS CB C 37.7 0.6 1 646 49 CYS N N 125.3 0.3 1 647 50 ASN H H 8.36 0.02 648 50 ASN HA H 4.60 0.02 649 50 ASN HB2 H 2.88 0.02 I
650 50 ASN HB3 H 2.70 0.02 I
651 50 ASN HD21 H 7.60 0.02 652 50 ASN HD22 H 6.97 0.02 653 50 ASN C C 174.4 0.6 1 654 50 ASN CA C 54.8 0.6 I
655 50 ASN CB C 38.9 0.6 1 657 50 ASN N N 116.4 0.3 1 658 50 ASN ND2 N 113.6 0.3 1 659 51 GLU H H 7.43 0.02 660 5l GLU HA H 4.64 0.02 661 51 GLU HB2 H 1.96 0.02 662 51 GLU HB3 H 1.81 0.02 663 51 GLU HG2 H 2.12 0.02 664 51 GLU HG3 H 2.12 0.02 665 51 GLU C C 176.1 0.6 1 666 51 GLU CA C 55.3 0.6 1 667 51 GLU CB C 31.5 0.6 1 668 51 GLU CG C 36.1 0.6 I
670 51 GLU N N 119.2 0.3 1 671 52 ASN H H 9.57 0.02 672 52 ASN HA H 4.45 0.02 l 673 52 ASN HB2 H 3.14 0.02 674 52 ASN HB3 H 2.64 0.02 675 52 ASN HD21 H 6.99 0.02 676 52 ASN HD22 H 7.71 0.02 l 677 52 ASN C C 176.4 0.6 1 678 52 ASN CA C 54.2 0.6 1 679 52 ASN CB C 37.8 0.6 1 681 52 ASN N N 125.4 0.3 1 682 52 ASN ND2 N 112.8 0.3 1 683 53 ASN H H 9.31 0.02 684 53 ASN HA H 4.64 0.02 685 53 ASN HB2 H 3.25 0.02 686 53 ASN HB3 H 2.31 0.02 687 53 ASN HD21 H 6.95 0.02 l 688 53 ASN HD22 H 6.26 0.02 689 53 ASN C C 176.2 0.6 1 690 53 ASN CA C 54.1 0.6 1 691 53 ASN CB C 39.2 0.6 l 693 53 ASN N N 119.3 0.3 1 694 53 ASN ND2 N 111.6 0.3 1 695 54 GLY H H 7.92 0.02 l 696 54 GLY HA2 H 4.28 0.02 l 697 54 GLY HA3 H 3.67 0.02 698 54 GLY C C 173.0 0.6 1 699 54 GLY CA C 46.3 0.6 l 700 54 GLY N N 106.3 0.3 1 701 55 GLY H H 8.06 0.02 702 55 GLY HA2 H 4.39 0.02 703 55 GLY HA3 H 3.47 0.02 704 55 GLY C C 175.1 0.6 I
705 55 GLY CA C 44.4 0.6 1 706 55 GLY N N 105.3 0.3 1 707 56 CYS H H 7.77 0.02 708 56 CYS HA H 4.39 0.02 709 56 CYS HB2 H 3.12 0.02 710 56 CYS HB3 H 2.81 0.02 l 712 56 CYS C C 175.2 0.6 l 713 56 CYS CA C 53.1 0.6 1 714 56 CYS CB C 36.6 0.6 I
715 56 CYS N N 117.6 0.3 1 716 57 ASP H H 8.37 0.02 717 57 ASP HA H 3.98 0.02 718 57 ASP HB2 H 2.24 0.02 719 57 ASP HB3 H 2.03 0.02 720 57 ASP C C 176.0 0.6 1 721 57 ASP CA C 56.0 0.6 1 722 57 ASP CB C 45.0 0.6 1 724 57 ASP N N 122.3 0.3 1 725 58 ALA H H 8.48 0.02 726 58 ALA HA H 3.98 0.02 727 58 ALA HB H 1.41 0.02 728 58 ALA C C 178.9 0.6 1 729 58 ALA CA C 55.6 0.6 1 730 58 ALA CB C 19.1 0.6 1 731 58 ALA N N 127.2 0.3 1 732 59 ASP H H 9.11 0.02 733 59 ASP HA H 4.90 0.02 734 59 ASP HB2 H 2.44 0.02 73S 59 ASP HB3 H 2.82 0.02 736 59 ASP C C 174.6 0.6 1 737 59 ASP CA C 53.9 0.6 1 738 59 ASP CB C 40.7 0.6 1 740 59 ASP N N 116.7 0.3 1 741 60 ALA H H 7.94 0.02 742 60 ALA HA H 5.13 0.02 743 60 ALA HB H 1.27 0.02 744 60 ALA C C 176.3 0.6 1 745 60 ALA CA C 50.5 0.6 1 746 60 . ALA CB C 21.3 0.6 1 747 60 ALA N N 121.9 0.3 1 748 61 LYS H H 9.06 0.02 749 61 LYS HA H 4.54 0.02 750 61 LYS HB2 H 1.77 0.02 751 61 LYS HB3 H 1.77 0.02 752 61 LYS HG2 H 1.31 0.02 753 61 LYS HG3 H 1.39 0.02 754 61 LYS HD2 H 1.72 0.02 755 61 LYS HD3 H 1.63 0.02 756 61 LYS HE2 H 2.92 0.02 757 61 LYS HE3 H 2.92 0.02 759 61 LYS C C 175.7 0.6 1 760 61 LYS CA C 55.1 0.6 1 761 61 LYS CB C 34.1 0.6 l 762 61 LYS CG C 24.6 0.6 1 763 61 LYS CD C 29.1 0.6 1 764 61 LYS CE C 42.1 0.6 I
76S 61 LYS N N 122.5 0.3 1 767 62 CYS H H 9.19 0.02 768 62 CYS HA H 5.32 0.02 769 62 CYS HB2 H 2.44 0.02 770 62 CYS HB3 H 2.80 0.02 772 62 CYS C C 174.5 0.6 1 773 62 CYS CA C 56.1 0.6 1 774 62 CYS CB C 37.6 0.6 I
775 62 CYS N N 131.5 0.3 I
776 63 THR H H 9.23 0.02 777 63 THR HA H 4.51 0.02 I
778 63 THR HB H 4.01 0.02 780 63 THR HG2 H 1.16 0.02 l 781 63 THR C C 172.2 0.6 1 782 63 THR CA C 62.8 0.6 1 783 63 THR CB C 71.5 0.6 l 784 63 THR CG2 C 22.0 0.6 I
785 63 THR N N 125.9 0.3 1 786 64 GLU H H 8.61 0.02 l 787 64 GLU HA H 5.12 0.02 788 64 GLU HB2 H 1.90 0.02 789 64 GLU HB3 H 1.90 0.02 790 64 GLU HG2 H 2.30 0.02 791 64 GLU HG3 H 2.30 0.02 792 64 GLU C C ? ? ?
793 64 GLU CA C 54.4 0.6 1 794 64 GLU CB C 32.0 0.6 1 795 64 GLU CG C 36.8 0.6 1 797 64 GLU N N 123.0 0.3 1 798 65 GLU H H 8.76 0.02 799 65 GLU HA H 4.60 0.02 800 65 GLU HB2 H 2.01 0.02 801 65 GLU HB3 H 1.86 0.02 802 65 GLU HG2 H 2.15 0.02 803 65 GLU HG3 H 2.15 0.02 l 804 65 GLU C C ? ? ?
805 65 GLU CA C 55.1 0.6 1 806 65 GLU CB C 32.9 0.6 1 807 65 GLU CG C 36.1 0.6 1 809 65 GLU N N 123.0 0.3 1 810 66 ASP H H 8.79 0.02 811 66 ASP HA H 4.80 0.02 812 66 ASP HB2 H 2.80 0.02 813 66 ASP HB3 H 2.58 0.02 814 66 ASP C C 176.4 0.6 1 815 66 ASP CA C 54.8 0.6 1 816 66 ASP CB C 41.2 0.6 1 818 66 ASP N N 123.9 0.3 1 819 67 SER H H 8.38 0.02 820 67 SER HA H 4.55 0.02 821 67 SER HB2 H 3.83 0.02 822 67 SER HB3 H 3.70 0.02 824 67 SER C C 175.4 0.6 1 825 67 SER CA C 58.0 0.6 1 826 67 SER CB C 64.6 0.6 I
827 67 SER N N 119.1 0.3 1 828 68 GLY H H 8.65 0.02 829 68 GLY HA2 H 4.13 0.02 830 68 GLY HA3 H 3.85 0.02 831 68 GLY C C 175.0 0.6 1 832 68 GLY CA C 46.0 0.6 1 833 68 GLY N N 112.2 0.3 1 834 69 SER H H 8.58 0.02 835 69 SER HA H 4.42 0.02 l 836 69 SER HB2 H 3.87 0.02 837 69 SER HB3 H 3.87 0.02 l 839 69 SER C C 174.8 0.6 l 840 69 SER CA C 59.1 0.6 1 841 69 SER CB C 63.4 0.6 1 842 69 SER N N 117.7 0.3 1 843 70 ASN H H 8.39 0.02 844 70 ASN HA H 4.74 0.02 845 70 ASN HB2 H 2.94 0.02 846 70 ASN HB3 H 2.77 0.02 847 70 ASN HD21 H ? ?
848 70 ASN HD22 H ? ?
849 70 ASN C C ? ? ?
850 70 ASN CA C 53.8 0.6 1 851 70 ASN CB C 38.9 0.6 1 853 70 ASN N N 118.4 0.3 1 854 70 ASN ND2 N ? ? ?
855 71 GLY H H 7.88 0.02 856 71 GLY HA2 H 4.07 0.02 857 71 GLY HA3 H 4.07 0.02 858 71 GLY C C 173.7 0.6 1 859 71 GLY CA C 45.0 0.6 1 860 71 GLY N N 108.1 0.3 1 861 72 LYS H H 8.39 0.02 862 72 LYS HA H 4.84 0.02 863 72 LYS HB2 H 1.75 0.02 864 72 LYS HB3 H 1.59 0.02 865 72 LYS HG2 H 1.46 0.02 866 72 LYS HG3 H 1.38 0.02 867 72 LYS HD2 H 1.66 0.02 868 72 LYS HD3 H 1.66 0.02 869 72 LYS HE2 H 2.93 0.02 870 72 LYS HE3 H 2.93 0.02 872 72 LYS C C 173.7 0.6 1 873 72 LYS CA C 55.4 0.6 1 874 72 LYS CB C 35.0 0.6 1 875 72 LYS CG C 24.9 0.6 1 876 72 LYS CD C 28.9 0.6 1 877 72 LYS CE C 42.2 0.6 1 878 72 LYS N N 120.8 0.3 1 880 73 LYS H H 8.81 0.02 881 73 LYS HA H 4.64 0.02 882 73 LYS HB2 H 1.71 0.02 883 73 LYS HB3 H 1.71 0.02 884 73 LYS HG2 H 1.36 0.02 885 73 LYS HG3 H 1.25 0.02 886 73 LYS HD2 H 1.63 0.02 l 887 73 LYS HD3 H 1.63 0.02 888 73 LYS HE2 H 2.89 0.02 889 73 LYS HE3 H 2.89 0.02 891 73 LYS C C 175.3 0.6 1 892 73 LYS CA C 55.0 0.6 1 893 73 LYS CB C 35.4 0.6 1 894 73 LYS CG C 24.6 0.6 1 895 73 LYS CD C ? ? ?
896 73 LYS CE C ? ?
897 73 LYS N N 122.6 0.3 I
899 74 ILE H H 8.54 0.02 l 900 74 ILE HA H 4.83 0.02 l 901 74 ILE HB H 1.91 0.02 l 902 74 ILE HG 12 H 1.50 0.02 903 74 ILE HG13 H 1.50 0.02 904 74 ILE HG2 H 1.00 0.02 905 74 ILE HD1 H 0.57 0.02 906 74 ILE C C 176.2 0.6 I
907 74 ILE CA C 58.4 0.6 I
908 74 ILE CB C 38.4 0.6 I
909 74 ILE CG1 C 27.1 0.6 1 910 74 ILE CG2 C 19.0 0.6 1 911 74 ILE CD1 C 10.3 0.6 1 912 74 ILE N N 126.8 0.3 1 913 75 THR H H 8.88 0.02 I
914 75 THR HA H 4.51 0.02 915 75 THR HB H 4.01 0.02 l 917 75 THR HG2 H 1.15 0.02 918 75 THR C C 172.4 0.6 1 919 75 THR CA C 61.2 0.6 1 920 75 THR CB C 71.5 0.6 1 921 75 THR CG2 C 22.0 0.6 l 922 75 THR N N 120.3 0.3 1 923 76 CYS H H 8.82 0.02 924 76 CYS HA H 5.53 0.02 925 76 CYS HB2 H 3.28 0.02 926 76 CYS HB3 H 2.69 0.02 928 76 CYS C C 174.7 0.6 l 929 76 CYS CA C 52.2 0.6 1 930 76 CYS CB C 40.6 0.6 1 931 76 CYS N N 121.5 0.3 I
932 77 GLU H H 8.64 0.02 l 933 77 GLU HA H 4.74 0.02 934 77 GLU HB2 H 1.94 0.02 935 77 GLU HB3 H 1.94 0.02 t 936 77 GLU HG2 H 1.83 0.02 I
937 77 GLU HG3 H 1.83 0.02 I
938 77 GLU C C 175.7 0.6 1 939 77 GLU CA C 54.7 0.6 I
940 77 GLU CB C 33.1 0.6 I
941 77 GLU CG C 36.1 0.6 1 943 77 GLU N N 123.0 0.3 1 944 78 CYS H H 9.71 0.02 945 78 CYS HA H 4.48 0.02 I
946 78 CYS HB2 H 2.63 0.02 I
947 78 CYS HB3 H 3.30 0.02 949 78 CYS C C 175.8 0.6 1 950 78 CYS CA C 57.4 0.6 1 951 78 CYS CB C 39.2 0.6 1 952 78 CYS N N 129.1 0.3 1 953 79 THR H H 8.20 0.02 l 954 79 THR HA H 4.25 0.02 l 955 79 THR HB H 4.25 0.02 957 79 THR HG2 H 1.25 0.02 I
958 79 THR C C 176.2 0.6 1 959 79 THR CA C 63.4 0.6 I
960 79 THR CB C 70.1 0.6 1 961 79 THR CG2 C 22.2 0.6 1 962 79 THR N N 114.7 0.3 1 963 80 LYS H H 8.56 0.02 964 80 LYS HA H 4.50 0.02 965 80 LYS HB2 H 1.79 0.02 966 80 LYS HB3 H 1.79 0.02 967 80 LYS HG2 H 1.47 0.02 968 80 LYS HG3 H 1.64 0.02 969 80 LYS HD2 H 1.70 0.02 970 80 LYS HD3 H 1.70 0.02 971 80 LYS HE2 H 2.94 0.02 972 80 LYS HE3 H 2.94 0.02 974 80 LYS C C ? ? ?
975 80 LYS CA C 55.4 0.6 1 976 80 LYS CB C 30.9 0.6 1 977 80 LYS CG C 25.6 0.6 1 978 80 LYS CD C 29.1 0.6 1 979 80 LYS CE C 42.1 0.6 1 980 80 LYS N N 124.8 0.3 1 982 81 PRO HA H 4.26 0.02 983 81 PRO HB2 H 2.27 0.02 984 81 PRO HB3 H 1.87 0.02 985 81 PRO HG2 H 2.10 0.02 986 81 PRO HG3 H 2.04 0.02 987 81 PRO HD2 H 3.90 0.02 988 81 PRO HD3 H 3.63 0.02 989 81 PRO C C 176.9 0.6 1 990 81 PRO CA C 64.2 0.6 1 991 81 PRO CB C 31.9 0.6 1 992 81 PRO CG C 27.8 0.6 1 993 81 PRO CD C 50.8 0.6 1 995 82 ASP H H 8.78 0.02 996 82 ASP HA H 4.25 0.02 997 82 ASP HB2 H 2.88 0.02 998 82 ASP HB3 H 2.77 0.02 999 82 ASP C C ? ? ?
1000 82 ASP CA C 5~.1 0.6 1 1001 82 ASP CB C 40.0 0.6 1 003 82 ASP N N 117.9 0.3 1 1004 83 SER H H 7.39 0.02 1005 83 SER HA H 4.47 0.02 1006 83 SER HB2 H 3.55 0.02 1007 83 SER HB3 H 3.50 0.02 1009 83 SER C C 175.4 0.6 1 1010 83 SER CA C 57.4 0.6 1 1011 83 SER CB C 65.9 0.6 1 1012 83 SER N N 112.9 0.3 1 1013 84 TYR H H 8.72 0.02 1014 84 TYR HA H 5.01 0.02 I
1015 84 TYR HB2 H 2.93 0.02 1016 84 TYR HB3 H 2.75 0.02 1017 84 TYR HDl H 6.92 0.02 1018 84 TYR HD2 H 6.92 0.02 1019 84 TYR HE1 H 6.69 0.02 1020 84 TYR HE2 H 6.69 0.02 1022 84 TYR C C ? ? ?
1023 84 TYR CA C 54.6 0.6 I
1024 84 TYR CB C 39.7 0.6 1 1031 84 TYR N N 122.2 0.3 I
1032 85 PRO HA H 5.09 0.02 I
1033 85 PRO HB2 H 2.25 0.02 1034 85 PRO HB3 H 1.72 0.02 1035 85 PRO HG2 H 2.22 0.02 1036 85 PRO HG3 H 2.22 0.02 l 1037 85 PRO HD2 H 3.85 0.02 t 1038 85 PRO HD3 H 3.85 0.02 1039 85 PRO C C 176.9 0.6 1 1040 85 PRO CA C 62.9 0.6 I
1041 85 PRO CB C 32.8 0.6 1 1042 85 PRO CG C 27.3 0.6 1 1043 85 PRO CD C 50.6 0.6 I
1045 86 LEU H H 8.51 0.02 I
1046 86 LEU HA H 4.77 0.02 1047 86 LEU HB2 H 1.76 0.02 1048 86 LEU HB3 H 1.76 0.02 1049 86 LEU HG H 1.85 0.02 1050 86 LEU HD I H 1.00 0.02 1051 86 LEU HD2 H 1.00 0.02 1052 86 LEU C C 177.9 0.6 I
1053 86 LEU CA C 54.5 0.6 1 1054 86 LEU CB C 44.8 0.6 1 1055 86 LEU CG C 29.0 0.6 1 1056 86 LEU CD1 C 25.7 0.6 1 1057 86 LEU CD2 C 25.7 0.6 I
1058 86 LEU N N 120.2 0.3 I
1059 87 PHE H H 9.29 0.02 l 1060 87 PHE HA H 4.16 0.02 1061 87 PHE HB2 H 3.26 0.02 1062 87 PHE HB3 H 3.19 0.02 1063 87 PHE HD1 H 7.31 0.02 1064 87 PHE HD2 H 7.31 0.02 1065 87 PHE HE1 H 7.70 0.02 1066 87 PHE HE2 H 7.70 0.02 1067 87 PHE HZ H 7.67 0.02 1068 87 PHE C C 176.4 0.6 1 1069 87 PHE CA C 59.3 0.6 1 1070 87 PHE CB C 36.9 0.6 1 1077 87 PHE N N 122.6 0.3 1 1078 88 ASP H H 8.93 0.02 1079 88 ASP HA H 4.33 0.02 1080 88 ASP HB2 H 3.11 0.02 1081 88 ASP HB3 H 3.02 0.02 1082 88 ASP C C 175.2 0.6 1 1083 88 ASP CA C 56.3 0.6 1 1084 88 ASP CB C 39.9 0.6 1 1086 88 ASP N N 111.3 0.3 1 1087 89 GLY H H 7.87 0.02 l 1088 89 GLY HA2 H 3.48 0.02 1089 89 GLY HA3 H 4.08 0.02 I
1090 89 GLY C C 174.7 0.6 1 1091 89 GLY CA C 46.0 0.6 1 1092 89 GLY N N 102.0 0.3 1 1093 90 ILE H H 7.17 0.02 I
1094 90 ILE HA H 4.39 0.02 I
1095 90 ILE HB H 1.52 0.02 I
1096 90 ILE HG 12 H 0.65 0.02 1097 90 ILE HG 13 H 0.65 0.02 1098 90 ILE HG2 H I.OS 0.02 l 1099 90 ILE HD1 H O.Sl 0.02 I
1100 90 ILE C C 175.1 0.6 l 1101 90 ILE CA C 64.2 0.6 l 1102 90 ILE CB C 35.9 0.6 l 1 90 ILE CG l C 25.5 0.6 t 1104 90 ILE CG2 C 16.9 0.6 l 1105 90 ILE CDl C 14.9 0.6 l 1106 90 ILE N N 113.3 0.3 l 1107 91 PHE H H 7.43 0.02 l 1108 91 PHE HA H 5.15 0.02 l 1109 91 PHE HB2 H 2.40 0.02 1110 91 PHE HB3 H 2.40 0.02 l 1 91 PHE HD 1 H 7.00 0.02 l 1 1112 91 PHE HD2 H 7.00 0.02 l 1 91 PHE HE 1 H 6.95 0.02 l 1 1114 91 PHE HE2 H 6.95 0.02 1115 91 PHE HZ H 7.06 0.02 1116 91 PHE C C 175.1 0.6 1 1117 91 PHE CA C 56.5 0.6 1 1118 91 PHE CB C 44.3 0.6 1 1125 91 PHE N N 114.0 0.3 l 1126 92 CYS H H 7.86 0.02 I
1127 92 CYS HA H 5.18 0.02 1128 92 CYS HB2 H 2.57 0.02 1129 92 CYS HB3 H 3.08 0.02 1131 92 CYS C C 174.1 0.6 1 1132 92 CYS CA C 54.1 0.6 1 1133 92 CYS CB C 44.7 0.6 l 1134 92 CYS N N 119.0 0.3 1 1135 93 SER H H 9.26 0.02 1136 93 SER HA H 4.23 0.02 l 1137 93 SER HB2 H 3.90 0.02 I
1138 93 SER HB3 H 3.90 0.02 l 1140 93 SER C C ? ? ?
1141 93 SER CA C 60.4 0.6 1 1142 93 SER CB C 63.7 0.6 1 1143 93 SER N N 118.3 0.3 I
1144 94 SER H H 8.04 0.02 I
1145 94 SER HA H 4.59 0.02 1146 94 SER HB2 H 3.91 0.02 1147 94 SER HB3 H 3.91 0.02 1149 94 SER C C ? ? ?
1150 94 SER CA C 58.7 0.6 1 1151 94 SER CB C 64.0 0.6 l 1152 94 SER N N 114.2 0.3 I
l 95 SER H H ? ? ?
l 1154 95 SER HA H 4.71 0.02 l 95 SER HB2 H 4.02 0.02 l 2 SS
1156 95 SER HB3 H 3.94 0.02 1158 95 SER C C ? ? ?
1159 95 SER CA C 58.4 0.6 1 1160 95 SER CB C 64.5 0.6 1 1161 95 SER N N ? ? ?
1162 96 ASN H H ? ? ?
1163 96 ASN HA H 4.61 0.02 1164 96 ASN HB2 H 2.75 0.02 1165 96 ASN HB3 H 2.60 0.02 1166 96 ASN HD21 H ? ? ?
1167 96 ASN HD22 H ? ?
1168 96 ASN C C ? ? ?
1169 96 ASN CA C 54.3 0.6 1 1170 96 ASN CB C 41.8 0.6 1 1172 96 ASN N N ? ? '' 1173 96 ASN ND2 N ? ? ?
stop # The following loop is used to define sets of Atom-shift assignment IDs that represent related ambiguous assignments taken from the above list of assigned chemical shifts. Each element in the set should be separated by a comma, as shown in the example below, and is the assignment ID
for a chemical shift assignment that has been given as ambiguity code of 4 or 5. Each set indicates that the observed chemical shifts are related to the defined atoms, but have not been assigned uniquely to a specific atom in the set.
loop-Atom shift assign-ID ambiguity # Sets of Atom-shift Assignment Ambiguities # __________________.
# Example: 5,4,7 stop-
##
## ----REMARKS---- ##
##
# # # # # # # # #
# PROTECTED BACKBONE AMIDE GROUPS
# (SLOWLY EXCHANGING IN D20) FOR RESIDUES:
# GLY 17 , PHE l9 , GLU 27 , LYS 29 , LEU 31 , # TYR 34 , LYS 35 , VAL 42 , CYS 56 , ASP 57 , # ALA 60 , LYS 61 , THR 63 , THR 75 , GLU 77 , # LEU 86 , GLY 89 , ILE 90 , PHE 91 # BROAD HN SIGNALS IN [15-N]-HSQC OBSERVED FOR RESIDUES:
# VAL8,LYS9,LYS10,CYS18,ARG20 # TWO BACKBONE HN CROSSPEAKS OBSERVED FOR RESIDUES:
# HIS 5 : 7.78,113.8 I 7.74,113.5 # GLN 6 : 7.44,122.6 / 7.40,122.4 # TWO AVERAGED NH*IHH* SIGNALS OBSERVED FOR RESIDUES:
# ARG 20 , ARG 25 : NOT SPECIFICALLY ASSIGNED
# TO INDIVIDUAL ARGININES
# LYS 29 NZIHZ* SIGNAL: TENTATIVELY ASSIGNED TO
# LYS 29 (BURIED LYSINE SIDE CHAIN) # BASED ON GREATER PROTECTION FROM H20 EXCHANGE
# THAN OTHER LYSINE NZ/HZ* SIGNALS
# ASPARAGINE SIDE CHAIN AMIDE SIGNALS:
# PROBABLE OVERLAPPING CROSSPEAKS ~112 PPM ['SN]
# FOR ASN 1 , ASN 70 , ASN 96
##
# #
##
;a a~ ~
N N ~ ~ ~ 0~0 O~O
O
'X y N ~
vW n O O N O
(' C
O
.Y
cG ~ ~
_C_ ~1 r r vi t~ l~ ~ ~ ~n ~ ~n ~O
D ~ ~- O °° a, 00 os a, a, oo d; o, ~ ~ °' ~ ~ ~
°~ ~ N ~t c~i yr O. l~ M l~ M V1 N ~O M M I~ ~ V7 N_ ~
C d' 00 ~ 00 ~ 00 ~ 00 N ~ N ~ N ~ N ~ 00 N ('J o0 N N N ~O N ~O ~O
c~''G .a, 0 0 0 0 0 0 0 0 N ~ ~ N ~ ~ ~ ~n 0 ~ vl ~ vt LL, 'D ~r ~ N ~ N ~ N ~ N ~~ v1 ~n ~ ~1 in v1 N ~~ ~D N ~O N
N
LZ.
~ ~'1 v1 v1 W!1 ~ v'1 v'1 H ~ U N N N N N N N N
C
N
0 ~ ~ ° ~ °
r~ x n x x x o n U
C
N
C _ 4~ -.N.
i O O O O O O O O
O O O O O O O O
..rr. ~rrr ~ ~p ~O V~ ~ ~!1 V1 ~O ~O
T
U
4. ~ _ v N
U ~ ~ ~ ~ ~ ~ ~ ~ ~ V ~Y ~ ~ ~t Wit' O ~ N O N O
l~ I~ I~ I~ I~ t : I~ I~ N t~ I~ N l~ I~ t~ ~, I~ ~ O 0 O
U L.Tr ~O" ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ ~ d' ~1' d' ~ ~ ~ M ~ M
C
O
~ _ 00 O v~ ~l ~n M ~ ~ O~ V' ~O M N ~O M N ~ M ~ ~ ~ l~~
Q H ~ ~n N ~ N ~ M ~n N ~ N l~ ~-~ N t~ N a, ~n v1 N ~1 ~n O
'~ U '~ ~ O O O O O O O O O O O O O O O O O O O O O
~, N ~p N O O O O O O O O O O O O O O O O O ~O O ~O O
,' O O O O O O O O v~ O O ~n O O N O N c~ ~O M v'1 yr 00 00 00 00 \O ~O C~ l~ N l~ I~ N I~ l~ I~ ~ l~ M M M ~
C~
LL _ >3. ~ ~, ~ ~h V V
~ a a a ~ O ~ O ~ O ~' O ~ O N O N O ~ ~O
O ~ ~~ O O v0 O v0 O ~O O v0 00 ~ N oo ~~ ~O ~D c0 c0 V' 00 v1 f~. yr ~ N M N N N M N M ~ v1 M ~ V1 ~ 01 M ~ l~ -~ N
a xx xx xx xx zxx zxx x~x~~z~x _ _ _ _ _ _ _ _ 0 7- can w a x °x °z .~~~.x~~~x~~z~~~~x~~~
aY a ,°z ° x x .,~ z z v 0 0 0 0 ~ ' v z z x x -E-~ w ~ ~ ~ ~ ~ ~ p ~ ~O ~-" --~ O O M ~D ~1' c"" ~ G1 M ~ ~O ~ N o0 '..r by G ~n _ M
C
.
O
~a a.
'~ ~ V1 -- v'1 N M ~W O 00 ~ rr O I~ ~ 00 l~
N o0 00 ~ ~ ~ O~ ~ ~ ~ O ~
~ O~ ~ ~ Oy O~ O~
O "' v1 N N -~ ~ M l~ l~ l~ ~
CG ~ N O M c~1 M
V
N Y .
~ N N
~
O 00 ~O 00 ~O o0 ~O o0 N ~O ~O ~O
N N V 'd' ~O
ca p"~~ N ~ O N V1 N V1 N ~-~ ~n W ~n ~n ~ ~ O ~ O O ~n O
LL ~ ~O - ~O V .-. ~ N ~-~ N N N
-p N o0 N ~n ~ v1 N N N
v1 ~
L
N
L
U ~1 U1 v1 ~ N ~ V1 v1 H c~C ~ N N N N N N N N
C
O
0 ~ 0 ~ 0 T
V
C
a~
N
y s.
O O O O O O O O
- ~r ~O v'1 V1 ~O ~D ~C ~O ~O
T
V
C
N
'~ a" ~ c~O~~ d~et ~~~ ~~~ ~~t~ ~~ ~~ own~n t3, O p ~ f~ I~ I~ N t~ I~ ,-, I~ I~ ,.r l~ l~ ,-, I~ ,~ I~ ~ N N
U CL ø ~' M ~ ~!' ~h ~t ~ ~ ~ ~~ ~ ~ ~ ~' ~ ~~ ~ ~ d' ~ N N
G
O
'~ N ~ ~O ~ ~ M ~O ~ ~ M N M O~
O' ~ m U N V1 ~ ch ~O ~h ~?' M M ~ ~ d' V'1 ~O ~ ~ ~ M ~!1 ~~ \O
0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 0 ~ o 0 N -p N ~O O O O O O O O O O O O O O O O O O O ~ O O
x M vo 00 ~ o o v-, v, o ~n o 0 00 0 0 00 0 00 0 0 00 0 yr M M ~ I~ ~O ~D N M I~ N 00 00 ~ 00 00 ~" 00 ~ 00 M t1" e~' _ _ a a E . ° °°
O O ~ ~~ ~t vD V~ ~ O O ~n O N ~t O ~ oo N ~ O M o0 N ~ l~ 0~0 U G. ~ ~ ~!1 ~-~ N ~-~ N M o0 v1 N Q1 v1 N ~~ h 00 ~ l~ ~ M V'1 M
U
a z~xzx xx zxx zxx z~xo,zxaz~ ~xx = x x o ' O
c w E z c c _ z c .~ ~ U Q ~ ~ Z U
a. a~
W rx D D D
.-, 00 V ~ M V1 -~ M
E~ 'ar ~ N ~ ~D N ~1 d' b17 C
' y ~
'r ~O V1 O ~
C_ ._~ ~ O
O O' pn a l~ v1 ~O ~O l~ I~ l~ ~- ~ ~O v1 --~ M ~-~ ~O
x oo a, ~~ O ,~ O ~ ~ ~ p ~ ~ 00 V~ ~ O~
CW r f~ M N N ~ N ~ M I~
a~
N ~
_~
~ 00 00 ~O ~ ~O
N ~ ~t O~ N O~ oo N N N N N c0 c0 N N o0 ~D o0 v0 N
= cYG Op"~ O O O O O O N --~ ~~ ~ ~--~ --~ N N ~ ~ N ~n N ~1 LL 'O ~ N N ~ ~ U1 V'1 N V1 ~ v1 V'1 N ~~ N
V
L~r ~
E-' ~N U N N N N N N N N
C
U
O O O O O o O o x x x x ~ x x x T
U
QJ N
O U N
L
Q, ,n ~ i '~"' O O O O O O O O
~x ~ ~ ~ ~ ~ ° ~ °
U
t, ~ _ N
L O, ~ ~O O O~ Q1 a1 O
M ~l' ~ ~f ~ 'Ch ~ '~ M ~ ~ M ~ V' CL I~ t~ ,~ t~ ,~; t~ ,_ U Ls. ø' et rt ~-- d ~t d' ~- ~ ~ ~ ~ ~t et ~~ ~ ~ ~ ~ --a ~O N M N N V~ ~ 01 V ~Y 00 M
a E-' ~ ~1 N ~ M ~ V1 N ~ ~ V1 \O ~ rl ~ M V ~h I~ U'1 Cf ~' N o0 --~ M ~~ ~~ N ~O N ~ l~ M r-~ v0 ~D .-W O --~ M vD
CL
U a'~.. y ~ O O O O O O O O O O C~ O O O O O O O O ~ O
N 'p ~ N O O O O O O O O O O ~ O O O O O O O O ~ O
~'3,~,x 0O ~o No v,00 ~nov', OooO 0000 00000 00 00 ~ 00 .~ pp N o0 00 V'1 00 V'1 .-. .~ 00 ,~ ,~ 00 ~~ ,~ 00 X _ _ a, Y
v ao o O ~ O O O N ~t o0 ~O N ~ N N
O y0 O vD N O N o0 00 ~ M N o0 ~D ~-~ M ~ N
U ~r ~ M N M ~ ~ ~ M ~~ V'7 .-. ~-~ d' M N V1 ~O N ~ c~1 ~O V1 N
N
xx zx ~x zxx x~~ ~zx ~zx zUx a x °' ~ x o ~- U x ~' x x H ~ '. z x a a o .~°~ozvzv~m~wz °' H ~. ~ ,~ x U v x o ~ o n~ n~ ~ n~
TABLE B
! merozoite surface protein-1 (MSP-1) P. falciparum C-terminal fragment ! X-PLOR format ! 09-11-98 ! --- noes + roes --approximate-- 570 total ! long-range 185 ! medium-range 90 ! sequential 222 ! intraresidue 73 ! hydrogen bonds 10 (20 restraints) !
! pseudoatom corrections not used -- for R-6 averaging/summation ! AVERAGING:
! class rt6s SUM
! class nsam SUM
! class sing ! class hbnd ! types:
! arom_ aromatic pair ! meth_ methyl ! dgnm_ degenerate methylene ! nsam_ non-stereospecifically-assigned methylene ! sing_ single proton ! _1 long-range (j-i > 4) ! _m medium-range (j-i =2-4) ! _s sequential (j-i = 1) ! _i intraresidue ! hbnd hydrogen bonds ! <residue-atom 1> <residue-atom 2> <dist-minus-plus>
<type>
class rt6s assign (resid 5 and name hb#) (resid 19 and name hd#) 3.6 3.6 0.0 !arom l assign (resid 5 and name hb#) (resid 19 and name he#) 3.6 3.6 0.0 !arom l assign (resid 15 and name ha) (resid 34 and name hd#) 3.6 3.6 0.0 !arom l assign (resid 15 and name ha) (resid 34 and name he#) 3.6 3.6 0.0 !arom l assign (resid 17 and name ha#) (resid 87 and name hd#) 5.5 5.5 0.0 !arom l assign (resid 17 and name ha#) (resid 87 and name he#) 5.5 5.5 0.0 !arom l assign (resid 19 and name hd#) (resid 20 and name hn) 5.5 5.5 0.0 !arom s assign (resid 19 and name hd#) (resid 21 and name hn) 5.5 5.5 0.0 !arom s assign (resid 19 and name hd#) (resid 21 and name hd2) 3.6 3.6 0.0 !arom m assign (resid 19 and name hd#) (resid 22 and name hd#) 3.6 3.6 0.0 !arom m assign (resid 19 and name hd#) (resid 86 and name hg) 5.5 5.5 0.0 !arom l assign (resid 19 and name hd#) (resid 91 and name hb#) 3.6 3.6 0.0 !arom l assign (resid 19 and name hd#) (resid 91 and name hd#) 3.6 3.6 0.0 !arom l assign (resid 19 and name hd#) (resid 91 and name he#) 5.5 5.5 0.0 !arom l assign (resid 19 and name he#) (resid 21 and name hd2) 5.5 5.5 0.0 !arom m assign (resid 19 and name he#) (resid 22 and name hd#) 3.6 3.6 0.0 !arom m assign (resid 19 and name he#) (resid 86 and name hg) 5.5 5.5 0.0 !arom l assign (resid 19 and name he#) (resid 91 and name hb#) 3.6 3.6 0.0 !arom l assign (resid 19 and name he#) (resid 91 and name hd#) 5.5 5.5 0.0 !arom_1 assign (resid 31 and name hn) (resid 34 and name hd#) 3.6 3.6 0.0 !arom m assign (resid 31 and name hg) (resid 34 and name hd#) 5.5 5.5 0.0 !arom m assign (resid 31 and name hd#) (resid 34 and name hd#) 5.5 5.5 0.0 !arom m assign (resid 31 and name hdl#) (resid 34 and name he#) 5.5 5.5 0.0 !arom m assign (resid 31 and name hd2#) (resid 87 and name hd#) 2.8 2.8 0.0 !arom l assign (resid 32 and name hn) (resid 34 and name hd#) 5.5 5.5 0.0 !arom m assign (resid 34 and name hn) (resid 34 and name hd#) 3.6 3.6 0.0 !arom i assign (resid 34 and name ha) (resid 34 and name hd#) 3.6 3.6 0.0 !arom i assign (resid 34 and name hd#) (resid 35 and name hn) 3.6 3.6 0.0 !arom s _71_ assign (resid 34 and name hd#) (resid 42 and name hn) 5.5 5.5 0.0 !arom l assign (resid 34 and name hd#) (resid 42 and name ha) 3.n 3.6 0.0 !arom l assign (resid 34 and name he#) (resid 43 and name hn) 5.5 5.5 0.0 !arom 1 assign (resid 34 and name hd#) (resid 43 and name hb#) 5.5 5.5 0.0 !arom 1 assign (resid 34 and name he#) (resid 42 and name hn) 5.5 5.5 0.0 !arom 1 assign (resid 34 and name he#) (resid 92 and name ha) 5.5 5.5 0.0 !arom 1 assign (resid 34 and name he#) (resid 43 and name hb#) 5.5 5.5 0.0 !arom l assign (resid 34 and name he#) (resid 93 and name hg#) 3.6 3.6 0.0 !arom l assign (resid 83 and name hn) (resid 84 and name hd#) 3.6 3.6 0.0 !arom s assign (resid 86 and name hn) (resid 91 and name hd#) 5.5 5.5 0.0 !arom l assign (resid 86 and name hb#) (resid 87 and name hd#) 2.8 2.8 0.0 !arom s assign (resid 86 and name hb#) (resid 87 and name he#) 3.6 3.6 0.0 !arom s assign (resid 86 and name hd#) (resid 87 and name hd#) 3.6 3.6 0.0 !arom s assign (resid 86 and name hd#) (resid 87 and name he#) 3.6 3.6 0.0 !arom s assign (resid 87 and name ha) (resid 87 and name hd#) 2.8 2.8 0.0 !arom i assign (resid 87 and name hd#) (resid 90 and name hb) 5.5 5.5 0.0 !arom m assign (resid 87 and name hd#) (resid 90 and name hg2#) 5.5 5.5 0.0 !arom m assign (resid 87 and name hd#) (resid 90 and name hd#) 3.6 3.6 0.0 !arom m assign (resid 87 and name hd#) (resid 91 and name hb#) 3.6 3.6 0.0 !arom m assign (resid 87 and name hd#) (resid 91 and name hd#) 2.8 2.8 0.0 !arom m assign (resid 87 and name hd#) (resid 91 and name he#) 3.6 3.6 0.0 !arom m assign (resid 87 and name he#) (resid 91 and name hd#) 5.5 5.5 0.0 !arom m assign (resid 87 and name he#) (resid 91 and name he#) 5.5 5.5 0.0 !arom m assign (resid 91 and name hn) (resid 91 and name hd#) 3.6 3.6 0.0 !arom i assign (resid 91 and name hd#) (resid 92 and name hn) 5.5 5.5 0.0 !arom s assign (resid 2 and name hd#) (resid 86 and name hd#) 5.5 5.5 0.0 !meth 1 assign (resid 5 and name hb#) (resid 86 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 17 and name hn) (resid 90 and name hd#) 4.1 4.1 0.0 !meth 1 assign (resid 17 and name ha#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 29 and name hb#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 29 and name hg#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 29 and name hd#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l' assign (resid 29 and name he#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 31 and name hn) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 31 and name ha) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 31 and name ha) (resid 90 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 32 and name ha) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 32 and name hb#) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth 1 assign (resid 32 and name hg) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 40 and name hn) (resid 40 and name he#) 5.5 5.5 0.0 !meth i assign (resid 47 and name ha) (resid 48 and name hg2#) 5.5 5.5 0.0 !meth s assign (resid 47 and name hbl) (resid 74 and name hd#) 5.5 5.5 0.0 !meth 1 assign (resid 47 and name hg#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 48 and name hn) (resid 48 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 48 and name hn) (resid 74 and name hd#) 5.5 5.5 0.0 !meth 1 assign (resid 48 and name ha) (resid 74 and name hd#) 3.6 3.6 0.0 !meth l assign (resid 48 and name hg2#) (resid 49 and name hn) 5.5 5.5 0.0 !meth s assign (resid 48 and name hg2#) (resid 50 and name hn) 3.6 3.6 0.0 !meth m assign (resid 48 and name hg2#) (resid 50 and name hbl) 5.5 5.5 0.0 !meth m assign (resid 48 and name hg2#) (resid 51 and name hn) 3.1 3.1 0.0 !meth m assign (resid 48 and name hg2#) (resid 51 and name ha) 3.6 3.6 0.0 !meth m assign (resid 48 and name hg2#) (resid 51 and name hb#) 3.6 3.6 0.0 !meth m assign (resid 48 and name hg2#) (resid 51 and name hg#) 5.5 5.5 0.0 !meth m assign (resid 48 and name hg2#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 49 and name hn) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 49 and name ha) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 54 and name hn) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 54 and name ha#) (resid 74 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 59 and name ha#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 56 and name hn) (resid 60 and name hb#) 5.5 5.5 0.0 !meth m assign (resid 56 and name hn) (resid 74 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 56 and name ha) (resid 60 and name hb#) 5.5 5.5 0.0 !meth m assign (resid 56 and name ha) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 56 and name hbl) (resid 60 and name hb#) 3.6 3.6 0.0 !meth m assign (resid 57 and name hn) (resid 60 and name hb#) 3.6 3.6 0.0 !meth m ?_ assign (resid 57 and name ha) (resid 60 and name hb#) 5.5 5.5 0.0 !meth m assign (resid 57 and name hb#) (resid 60 and name hb#) 5.5 5.5 0.0 !meth m assign (resid 58 and name hb#) (resid 59 and name hn) 3.6 3.6 0.0 !meth s assign (resid 58 and name hb#) (resid 60 and name hn) 5.5 5.5 0.0 !meth m assign (resid 59 and name hn) (resid 60 and name hb#) 5.5 5.5 0.0 !meth s assign (resid 60 and name hb#) (resid 61 and name hn) 3.6 3.6 0.0 !meth s assign (resid 60 and name hb#) (resid 76 and name ha) 5.5 5.5 0.0 !meth l assign (resid 60 and name hb#) (resid 76 and name hbl) 5.5 5.5 0.0 !meth l assign (resid 60 and name hb#) (resid 77 and name hn) 3.6 3.6 0.0 !meth l assign (resid 60 and name hb#) (resid 77 and name ha) 5.5 5.5 0.0 !meth l assign (resid 60 and name hb#) (resid 78 and name hn) 5.5 5.5 0.0 !meth l assign (resid 60 and name hb#) (resid 78 and name hb1) 5.5 5.5 0.0 !meth l assign (resid 62 and name ha) (resid 74 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 63 and name hn) (resid 74 and name hg2#) 4.1 4.1 0.0 !meth l assign (resid 63 and name hn) (resid 74 and name hd#) 3.6 3.6 0.0 !meth l assign (resid 63 and name hg2#) (resid 64 and name hn) 3.6 3.6 0.0 !meth s assign (resid 64 and name ha) (resid 74 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 64 and name ha) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 64 and name hb#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 64 and name hg#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth l assign (resid 72 and name hn) (resid 72 and name he#) 3.6 3.6 0.0 !meth i assign (resid 72 and name hb#) (resid 74 and name hd#) 5.5 5.5 0.0 !meth m assign (resid 73 and name hn) (resid 74 and name hd#) 5.5 5.5 0.0 !meth s assign (resid 74 and name hn) (resid 74 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 74 and name ha) (resid 74 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 74 and name ha) (resid 74 and name hd#) 3.6 3.6 0.0 !meth i assign (resid 74 and name hg2#) (resid 75 and name ha) 5.5 5.5 0.0 !meth s assign (resid 75 and name hg2#) (resid 76 and name hn) 3.6 3.6 0.0 !meth s assign (resid 79 and name hn) (resid 79 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 79 and name hg2#) (resid 80 and name hn) 3.6 3.6 0.0 !meth s assign (resid 85 and name ha) (resid 86 and name hd#) 5.5 5.5 0.0 !meth s assign (resid 86 and name hd#) (resid 87 and name hn) 5.5 5.5 0.0 !meth s assign (resid 86 and name hd#) (resid 91 and name hb#) 5.5 5.5 0.0 !meth l assign (resid 86 and name hd#) (resid 92 and name ha) 5.5 5.5 0.0 !meth l assign (resid 87 and name ha) (resid 90 and name hd#) 5.5 5.5 0.0 !meth m assign (resid 87 and name hb#) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth m assign (resid 87 and name hb#) (resid 90 and name hd#) 5.5 5.5 0.0 !meth m assign (resid 89 and name hn) (resid 90 and name hg2#) 5.5 5.5 0.0 !meth s assign (resid 90 and name hn) (resid 90 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 90 and name ha) (resid 90 and name hg2#) 3.6 3.6 0.0 !meth i assign (resid 90 and name hg2#) (resid 91 and name hn) 5.5 5.5 0.0 !meth s assign (resid 90 and name hd#) (resid 91 and name hn) 5.5 5.5 0.0 !meth s assign (resid 6 and name ha) (resid 6 and name hg#) 2.8 2.8 0.0 !dgnm i assign (resid 10 and name he#) (resid 19 and name hn) 3.6 3.6 0.0 !dgnm 1 assign (resid 10 and name he#) (resid 28 and name hn) 3.6 3.6 0.0 !dgnm 1 assign (resid 14 and name hn) (resid 14 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 14 and name hb#) (resid 15 and name hn) 4.1 4.1 0.0 !dgnm s assign (resid 24 and name hn) (resid 24 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 24 and name ha) (resid 24 and name hg#) 2.8 2.8 0.0 !dgnm i assign (resid 24 and name hg#) (resid 25 and name hn) 5.5 5.5 0.0 !dgnm s assign (resid 25 and name hn) (resid 25 and name hd#) 5.5 5.5 0.0 !dgnm i assign (resid 26 and name hn) (resid 26 and name hb#) 2.8 2.8 0.0 !dgnm i assign (resid 29 and name hb#) (resid 29 and name hd#) 3.6 3.6 0.0 !dgnm i assign (resid 29 and name hb#) (resid 30 and name hn) 3.6 3.6 0.0 !dgnm s assign (resid 33 and name hn) (resid 47 and name hg#) 5.5 5.5 0.0 !dgnm l assign (resid 35 and name hn) (resid 35 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 35 and name ha) (resid 35 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 35 and name hg#) (resid 36 and name hn) 3.6 3.6 0.0 !dgnm s assign (resid 35 and name hg#) (resid 42 and name hn) 5.5 5.5 0.0 !dgnm l assign (resid 35 and name hg#) (resid 44 and name ha) 3.6 3.6 0.0 !dgnm l assign (resid 35 and name hg#) (resid 44 and name hb#) 3.6 3.6 0.0 !dgnm l assign (resid 36 and name hn) (resid 36 and name hg#) 3.6 3.6 0.0 !dgnm i assign (resid 36 and name ha) (resid 36 and name hg#) 2.8 2.8 0.0 !dgnm i assign (resid 36 and name hb#) (resid 37 and name hn) 5.5 5.5 0.0 !dgnm_s assign (resid 36 and name hg#) (resid 37 and name hn) 3.6 3.6 0.0 !dgnm s _73_ assign(resid36and namehg#)(resid 40andname hn) 5.5 5.50.0 !dgnm m assign(resid37and nameha) (resid 37andname hg#)3.6 3.60.0 !dgnm i assign(resid37and namehg#)(resid 38andname hn) 4.1 4.10.0 !dgnm s assign(resid40and namehn) (resid 40andname hg#)3.6 3.60.0 !dgnm i assign(resid40and namehn) (resid 40andname hd#)5.5 5.50.0 !dgnm i assign(resid44and nameha) (resid 45andname hg#)3.6 3.60.0 !dgnm s assign(resid45and namehg#)(resid 46andname hn) 3.6 3.60.0 !dgnm s assign(resid47and namehg#)(resid 48andname hn) 5.5 5.50.0 !dgnm s assign(resid49and namehn) (resid 51andname hg#)3.6 3.60.0 !dgnm m assign(resid99and namehn) (resid 64andname hb#)5.5 5.50.0 !dgnm l assign(resid49and namehn) (resid 64andname hg#)5.5 5.50.0 !dgnm l assign(resid51and namehn) (resid 51andname hg#)3.6 3.60.0 !dgnm i assign(resid51and namehg#)(resid 52andname hd22)5.5 5.50.0 !dgnm s assign(resid61and namehn) (resid 61andname hb#)2.8 2.80.0 !dgnm i assign(resid61and namehb#)(resid 62andname hn) 3.6 3.60.0 !dgnm s assign(resid64and namehn) (resid 64andname hb#)2.8 2.80.0 !dgnm i assign(resid64and namehn) (resid 64andname hg#)2.8 2.80.0 !dgnm i assign(resid64and namehn) (resid 65andname hg#)2.8 2.80.0 !dgnm s assign(resid64and nameha) (resid 64andname hg#)3.6 3.60.0 !dgnm i assign(resid64and namehb#)(resid 74andname ha) 3.6 3.60.0 !dgnm l assign(resid65and namehn) (resid 65andname hg#)3.6 3.60.0 !dgnm i assign(resid69and namehb#)(resid 70andname hn) 2.8 2.80.0 !dgnm s assign(resid71and nameha#)(resid 72andname hn) 2.6 2.60.0 !dgnm s assign(resid72and namehn) (resid 72andname hd#)3.6 3.60.0 !dgnm i assign(resid73and namehn) (resid 73andname hb#)2.8 2.80.0 !dgnm i assign(resid73and namehb#)(resid 74andname hn) 3.6 3.60.0 !dgnm s assign(resid80and namehn) (resid 80andname hb#)2.8 2.80.0 !dgnm i assign(resid80and namehb#)(resid 81andname hd#)2.8 2.80.0 !dgnm s assign(resid80and namehb#)(resid 83andname hn) 3.6 3.60.0 !dgnm m assign(resid80and namehb#)(resid 83andname hb#)2.8 2.80.0 !dgnm m assign(resid84and nameha) (resid 85andname hg#)3.6 3.60.0 !dgnm s assign(resid84and nameha) (resid 85andname hd#)2.8 2.80.0 !dgnm s assign(resid85and namehg#)(resid 89andname hn) 5.5 5.50.0 !dgnm m assign(resid86and namehb#)(resid 87andname hn) 3.6 3.60.0 !dgnm s assign(resid86and namehb#)(resid 91andname hb#)3.6 3.60.0 !dgnm class nsam assign(resid8 andname ha) (resid8 andname hg#)3.6 3.60.0 !meth i assign(resid8 andname hg#) (resid20andname hd#)5.5 5.50.0 !meth l assign(resid8 andname hg#) (resid20andname he) 5.5 5.50.0 !meth l assign(resid15andname ha) (resid31andname hdl#)3.6 3.60.0 !meth l assign(resid15andname hb#) (resid31andname hdl#)5.5 5.50.0 !meth assign(resid16andname hn) (resid31andname hdl#)5.5 5.50.0 !meth l assign(resid16andname ha) (resid31andname hd#)5.5 5.50.0 !meth assign(resid17andname hn) (resid31andname hd2#)4.1 4.10.0 !meth l assign(resid17andname ha#) (resid31andname hd2#)5.5 5.50.0 !meth l assign(resid19andname hz) (resid22andname hd#)3.6 3.60.0 !meth m assign(resid22andname hd#) (resid23andname hn) 5.5 5.50.0 'meth s assign(resid30andname ha) (resid31andname hd#)5.5 5.50.0 'meth s assign(resid31andname ha) (resid31andname hd2#)3.6 3.60.0 'meth i assign(resid3iandname hd2#)(resid87andname hb#)5.5 5.50.0 'meth l assign(resid31andname hd2#)(resid87andname hz) 3.6 3.60.0 1 ~meth assign(resid31andname hd2#)(resid90andname hg2#)5.5 5.50.0 _ !meth l assign(resid31andname hd2#)(resid90andname hd#)5.5 5.50.0 !meth l assign(resid32andname ha) (resid32andname hd2#)3.6 3.60.0 !meth i assign(resid32andname hd2#)(resid33andname hn) 3.6 3.60.0 !meth s assign(resid32andname hd2#)(resid55andname ha#)5.5 5.50.0 !meth l assign(resid32andname hd2#)(resid56andname hn) 5.5 5.50.0 !meth l assign(resid32andname hd2#)(resid56andname ha) 5.5 5.50.0 !meth l assign(resid32andname hd2#)(resid74andname hb) 5.5 5.50.0 'meth l assign(resid32andname hd2#)(resid74andname hg2#)5.5 5.50.0 'meth l assign(resid32andname hd2#)(resid90andname ha) 5.5 5.50.0 !meth l assign(resid32andname hd2#)(resid90andname hg2#)3.6 3.60.0 !meth assign(resid32andname hdl#)(resid88andname hb#)5.5 5.50.0 !meth _74_ assign (resid 35 and name hn) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 35 and name hb2) (resid 42 and name hgl#) 5.5 5.5 0.0 !mete l assign (resid 35 and name hg#) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hn) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hn) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 37 and name ha) (resid 42 and name hg2#) 5.5 5.5 D.0 !meth i assign (resid 37 and name hb#) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hb#) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hg#) (resid 42 and name hg1#) 5.5 5.5 0.0 !meth l assign (resid 37 and name hg#) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth 1 assign (resid 40 and name hn) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth m assign (resid 40 and name hg#) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth m assign (resid 41 and name ha) (resid 42 and name hgl#) 5.5 5.5 0.0 !meth s assign. (resid 41 and name ha) (resid 42 and name hg2#) 5.5 5.5 0.0 !meth s assign (resid 41 and name hb#) (resid 42 and name hg#) 5.5 5.5 0.0 !meth s assign (resid 42 and name hgl#) (resid 43 and name hn) 3.6 3.6 0.0 !meth s assign (resid 42 and name hg2#) (resid 43 and name hn) 3.6 3.6 0.0 !meth s assign (resid 5 and name ha) (resid 20 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 7 and name ha) (resid 20 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 7 and name ha) (resid 20 and name hd#) 3.6 3.6 0.0 !nsam l assign (resid 10 and name ha) (resid 10 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 12 and name ha) (resid 13 and name hd#) 2.8 2.8 0.0 !nsam s assign (resid 12 and name hb#) (resid 13 and name hd#) 3.6 3.6 0.0 !nsam s assign (resid 12 and name hb#) (resid 28 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 13 and name hb2) (resid 14 and name hn) 3.6 3.6 0.0 !sing s assign (resid 13 and name hg#) (resid 16 and name hb#) 3.6 3.6 0.0 !nsam m assign (resid 13 and name hd#) (resid 28 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 15 and name hb2) (resid 41 and name hb2) 3.6 3.6 0.0 !sing l assign (resid to and name ha) (resid 30 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 16 and name hb#) (resid 30 and name ha) 3.6 3.6 0.0 !nsam l assign (resid 16 and name hb#) (resid 31 and name hn) 3.6 3.6 0.0 !nsam l assign (resid 17 and name ha#) (resid 87 and name hz) 3.6 3.6 0.0 !nsam l assign (resid 20 and name ha) (resid 20 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 20 and name ha) (resid 26 and name hg#) 3.6 3.6 0.0 !nsam l assign (resid 20 and name hb#) (resid 20 and name hd#) 3.6 3.6 0.0 !nsam i assign (resid 20 and name hg#) (resid 21 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 20 and name hg#) (resid 24 and name ha) 3.6 3.6 0.0 !nsam m assign (resid 21 and name hb#) (resid 22 and name hn) 5.5 5.5 0.0 !nsam s assign (resid 21 and name hb#) (resid 23 and name hn) 5.5 5.5 0.0 !nsam m assign (resid 22 and name hb2) (resid 23 and name hn) 3.6 3.6 0.0 !sing s assign (resid 24 and name hb#) (resid 25 and name hn) 5.5 5.5 0.0 !nsam s assign (resid 25 and name hn) (resid 25 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 25 and name hg#) (resid 26 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 26 and name hn) (resid 26 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 26 and name ha) (resid 26 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 27 and name ha) (resid 27 and name hg#) 2.8 2.8 0.0 !nsam i assign (resid 27 and name hb#) (resid 28 and name hn) 2.8 2.8 0.0 !nsam s assign (resid 27 and name hg#) (resid 28 and name hn) 2.8 2.8 0.0 !nsam s assign (resid 28 and name hn) (resid 28 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 29 and name hg#) (resid 30 and name hn) 2.8 2.8 0.0 !nsam s assign (resid 29 and name hd#) (resid 90 and name hb) 3.6 3.6 0.0 !nsam l assign (resid 30 and name hn) (resid 30 and name hb#) 2.8 2.8 0.0 !nsam i assign. (resid 30 and name hbl) (resid 31 and name hn) 3.6 3.6 0.0 !sing s assign (resid 30 and name hb#) (resid 34 and name hn) 5.5 5.5 0.0 !nsam m assign (resid 30 and name hb2) (resid 34 and name hb2) 3.6 3.6 0.0 !sing m assign (resid 30 and name hb#) (resid 35 and name ha) 3.6 3.6 0.0 !nsam l assign (resid 31 and name hn) (resid 31 and name hb#) 3.6 3.6 0.0 !nsam i assign (resid 31 and name hn) (resid 34 and name hb2) 3.6 3.6 0.0 !sing m assign (resid 32 and name hbl) (resid 33 and name hn) 3.6 3.6 0.0 !sing s assign (resid 33 and name ha) (resid 44 and name hb#) 3.6 3.6 0.0 !nsam 1 assign (resid 33 and name ha) (resid 47 and name hbl) 3.6 3.6 0.0 !sing 1 assign (resid 33 and name hb2) (resid 34 and name hn) 5.5 5.5 0.0 !sing s assign (resid 34 and name ha) (resid 44 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 34 and name hbl) (resid 35 and name hn) 4.1 4.1 0.0 !sing s assign (resid 35 and name hb#) (resid 35 and name hd#) 2.8 2.8 0.0 !nsam i _7j_ assign (resid 35 and name hb2) (resid 36 and name hn) 3.6 3.6 0.0 !sing s assign (resid 35 and name hb#) (resid 44 and name hb#) 3.6 3.6 0.0 !nsam 1 assign (resid 35 and name hd#) (resid 49 and name ha) 3.6 3.6 0.0 !nsam 1 assign (resid 37 and name hn) (resid 40 and name hb#) 5.5 5.5 0.0 !nsam m assign (resid 38 and name ha#) (resid 39 and name hn) 3.1 3.1 0.0 !nsam s assign (resid 38 and name ha#) (resid 40 and name hn) 5.5 5.5 0.0 !nsam m assign (resid 39 and name hb#) (resid 40 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 41 and name hbl) (resid 42 and name hn) 3.6 3.6 0.0 !sing s assign (resid 43 and name hn) (resid 43 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 43 and name ha) (resid 43 and name hg#) 2.8 2.8 0.0 !nsam i assign (resid 43 and name hb#) (resid 44 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 43 and name hg#) (resid 44 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 44 and name hn) (resid 45 and name hd#) 5.5 5.5 0.0 ~nsam_s assign (resid 44 and name ha) (resid 45 and name hd#) 2.8 2.8 0.0 !nsam s assign (resid 45 and name hb2) (resid 96 and name hn) 3.6 3.6 0.0 ~sing_s assign (resid 46 and name hn) (resid 46 and name hb#) 3.6 3.6 0.0 ~nsam_i assign (resid 46 and name hn) (resid 47 and name hd#) 3.6 3.6 0.0 !nsam s assign (resid 46 and name ha) (resid 47 and name hd#) 3.6 3.6 0.0 ~nsam_s assign (resid 47 and name hb2) (resid 48 and name hn) 4.1 4.1 0.0 !sing s assign (resid 47 and name hb2) (resid 74 and name hgl#) 3.6 3.6 0.0 !nsam 1 assign (resid 47 and name hg#) (resid 74 and name hgl#) 3.6 3.6 0.0 !nsam 1 assign (resid 48 and name hn) (resid 54 and name ha#) 4.1 4.1 0.0 !nsam l assign (resid 48 and name hn) (resid 74 and name hgl#) 5.5 5.5 0.0 !nsam l assign (resid 49 and name ha) (resid 54 and name ha#) 3.6 3.6 0.0 !nsam l assign (resid 49 and name ha) (resid 62 and name hbl) 5.5 5.5 0.0 !sing l assign (resid 50 and name hbl) (resid 51 and name hn) 3.6 3.6 0.0 !sing s assign (resid 53 and name hb#) (resid 56 and name hn) 5.5 5.5 0.0 !nsam m assign (resid 53 and name hbl) (resid 58 and name ha) 3.6 3.6 0.0 !sing l assign (resid 53 and name hd22) (resid 56 and name hn) 5.5 5.5 0.0 !sing m assign (resid 53 and name hd21) (resid 60 and name hn) 5.5 5.5 0.0 !sing l assign (resid 54 and name ha#) (resid 55 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 54 and name ha#) (resid 56 and name hn) 3.6 3.6 0.0 !nsam m assign (resid 55 and name ha#) (resid 56 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 56 and name hbl) (resid 57 and name hn) 4.1 4.1 0.0 !sing s assign (resid 56 and name hb2) (resid 62 and name hn) 5.5 5.5 0.0 !sing l assign (resid 56 and name hb2) (resid 62 and name ha) 3.6 3.6 0.0 !sing l assign (resid 57 and name hb#) (resid 58 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 57 and name hb#) (resid 59 and name hn) 4.1 4.1 0.0 !nsam m assign (resid 57 and name hb#) (resid 60 and name hn) 4.1 4.1 0.0 !nsam m assign (resid 57 and name hb#) (resid 91 and name ha) 2.8 2.8 0.0 ~nsam_1 assign. (resid 57 and name hb#) (resid 92 and name hn) 5.5 5.5 0.0 !nsam l assign (resid 58 and name hn) (resid 59 and name hb#) 5.5 5.5 0.0 ~nsam_s assign (resid 59 and name hb#) (resid 80 and name hg#) 3.6 3.6 0.0 'nsam l assign (resid 59 and name hb#) (resid 60 and name hn) 3.6 3.6 0.0 ~nsam_s assign (resid 60 and name ha) (resid 78 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 61 and name hn) (resid 61 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 65 and name hn) (resid 65 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 66 and name hn) (resid 66 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 66 and name hb#) (resid 67 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 67 and name hb#) (resid 73 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 68 and name ha#) (resid 69 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 72 and name hn) (resid 72 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 74 and name hn) (resid 74 and name hgl#) 3.6 3.6 0.0 !nsam i assign (resid 74 and name ha) (resid 74 and name hgl#) 3.6 3.6 0.0 !nsam i assign (resid 76 and name hn) (resid 76 and name hb#) 2.8 2.8 0.0 !nsam i assign (resid 76 and name hbl) (resid 77 and name hn) 5.5 5.5 0.0 !sing s assign (resid 76 and name hbl) (resid 89 and name ha#) 3.6 3.6 0.0 !nsam l assign (resid 78 and name hbl) (resid 79 and name hn) 5.5 5.5 0.0 !sing s assign (resid 78 and name hb#) (resid 92 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 78 and name hb#) (resid 80 and name hn) 5.5 5.5 0.0 'nsam m assign (resid 78 and name hb#) (resid 83 and name hb#) 3.6 3.6 0.0 !nsam l assign (resid 80 and name hn) (resid 80 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 80 and name hn) (resid 81 and name hd#) 5.5 5.5 C.0 !nsam s assign (resid 80 and name hn) (resid 83 and name hb#) 3.6 3.6 0.0 !nsam m assign (resid 80 and name ha) (resid 80 and name hg#) 3.6 3.6 0.0 !nsam i assign (resid 80 and name ha) (resid 81 and name hd#) 2.8 2.8 0.0 !nsam s assign (resid 80 and name hg#) (resid 81 and name hd#) 3.6 3.6 0.0 !nsam s assign (resid 81 and name hb2) (resid 82 and name hn) 3.6 3.6 0.0 !sing s assign (resid 81 and name hd#) (resid 82 and name hn) 5.5 5.5 0.0 !nsam s assign (resid 82 and name hb#) (resid 83 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 85 and name ha) (resid 89 and name ha#) 3.6 3.6 0.0 !nsam m assign (resid 85 and name hb#) (resid 88 and name ha) 3.6 3.6 0.0 !nsam m assign (resid 85 and name hb#) (resid 89 and name hn) 3.6 3.6 0.0 !nsam m assign (resid 85 and name hb#) (resid 86 and name hn) 3.6 3.6 0.0 lnsam s assign (resid 86 and name hn) (resid 89 and name ha#) 5.5 5.5 0.0 lnsam m assign (resid 87 and name hb#) (resid 90 and name hn) 3.6 3.6 0.0 !nsam m assign (resid 87 and name hb#) (resid 90 and name hgl#) 5.5 5.5 0.0 !nsam m assign (resid 89 and name ha#) (resid 90 and name hn) 3.6 3.6 0.0 !nsam s assign (resid 90 and name hgl#) (resid 91 and name hn) 4.1 4.1 0.0 !nsam s class sing assign(resid2 and namehn) (resid 3 andname hn) 5.5 5.50.0 ~sing s assign(resid4 and namehn) (resid 5 andname hn) 5.5 5.50.0 _ ~sing s assign(resid5 and namehn) (resid 6 andname hn) 3.6 3.60.0 _ !sing s assign(resid5 and nameha) (resid 20andname hn) 5.5 5.50.0 !sing l assign(resid6 and namehn) (resid 7 andname hn) 5.5 5.50.0 !sing s assign(resid7 and namehn) (resid 8 andname hn) 5.5 5.50.0 !sing s assign(resid8 and namehn) (resid 9 andname hn) 5.5 5.50.0 !sing s assign(resid9 and namehn) (resid 10andname hn) 3.6 3.60.0 !sing s assign(resid13and nameha) (resid 14andname hn) 2.6 2.60.0 !sing s assign(resid14and namehn) (resid 15andname hn) 5.5 5.50.0 !sing s assign(resid14and nameha) (resid 15andname hn) 2.6 2.60.0 !sing m assign.(resid15and namehn) (resid 16andname hn) 3.6 3.60.0 !sing s assign(resid15and nameha) (resid 16andname hn) 3.6 3.60.0 !sing s assign(resid15and nameha) (resid 31andname hg) 3.6 3.60.0 !sing assign(resid16and namehn) (resid 17andname hn) 5.5 5.50.0 !sing s assign(resid16and namehn) (resid 31andname hn) 5.5 5.50.0 !sing l assign(resid16and namehn) (resid 31andname hg) 5.5 5.50.0 !sing assign(resid16and nameha) (resid 30andname ha) 2.8 2.80.0 !sing l assign(resid16and nameha) (resid 31andname hn) 3.6 3.60.0 !sing l assign(resid16and nameha) (resid 31andname hg) 3.6 3.60.0 !sing assign(resid17and namehn) (resid 31andname hn) 5.5 5.50.0 !sing l assign(resid18and nameha) (resid 19andname hn) 2.6 2.60.0 !sing s assign(resid18and nameha) (resid 28andname ha) 2.8 2.80.0 !sing l assign(resid19and namehn) (resid 20andname hn) 5.5 5.50.0 !sing s assign(resid19and namehn) (resid 21andname hd2)5.5 5.50.0 !sing m assign(resid19and namehn) (resid 28andname ha) 5.5 5.50.0 !sing l assign(resid19and nameha) (resid 20andname hn) 3.1 3.10.0 !sing s assign(resid19and namehz) (resid 60andname hn) 5.5 5.50.0 !sing l assign(resid20and nameha) (resid 21andname hn) 3.1 3.10.0 !sing s assign(resid20and nameha) (resid 26andname ha) 3.6 3.60.0 !sing l assign(resid21and namehn) (resid 21andname hd2)3.6 3.60.0 !sing i assign(resid21and namehn) (resid 25andname hn) 5.5 5.50.0 !sing m assign(resid21and nameha) (resid 22andname hn) 3.6 3.60.0 !sing s assign(resid21and nameha) (resid 23andname hn) 3.6 3.60.0 !sing m assign(resid22and namehn) (resid 22andname hg) 5.5 5.50.0 !sing i assign.(resid22and namehn) (resid 23andname hn) 5.5 5.50.0 !sing s assign.(resid22and namehn) (resid 25andname hn) 5.5 5.50.0 !sing m assign(resid22and nameha) (resid 23andname hn) 4.1 4.10.0 !sing s assign(resid22and nameha) (resid 24andname hn) 4.1 4.10.0 !sing m assign(resid22and namehg) (resid 23andname hn) 5.5 5.50.0 !sing s assign(resid23and namehn) (resid 24andname hn) 9.1 4.10.0 !sing s assign(resid23and namehn) (resid 24andname ha) 5.5 5.50.0 !sing s assign(resid23and nameha) (resid 24andname hn) 4.1 4.10.0 !sing s assign(resid23and nameha) (resid 25andname hn) 5.5 5.50.0 !sing m assign(resid24and nameha) (resid 25andname hn) 5.5 5.50.0 !sing s assign(resid25and namehn) (resid 26andname hn) 5.5 5.50.0 !sing s assign(resid25and nameha) (resid 26andname hn) 2.6 2.60.0 !sing s assign(resid26and namehn) (resid 27andname hn) 5.5 5.50.0 !sing s _77_ assign(resid26and nameha) (resid 27andname hn) 3.6 3.n0.0 !sing s assign(resid27and nameha) (resid 28andname hn) 2.6 2.60.0 !sing s assign(resid28and nameha) (resid 29andname hn) 3.1 3.10.0 !sing s assign(resid29and nameha) (resid 30andname hn) 2.6 2.60.0 !sing s assign(resid30and namehn) (resid 31andname hn) 5.5 5.50.0 !sing s assign(resid30and nameha) (resid 31andname hn) 3.1 3.10.0 !sing s assign(resid31and namehn) (resid 31andname hg) 3.6 3.60.0 !sing i assign(resid31and namehn) (resid 32andname hn) 5.5 5.50.0 !sing s assign(resid31and nameha) (resid 32andname hn) 3.1 3.10.0 !sing s assign(resid31and nameha) (resid 31andname hg) 3.6 3.60.0 !sing i assign(resid32and nameha) (resid 32andname hg) 3.6 3.60.0 !sing i assign(resid32and nameha) (resid 33andname hn) 2.6 2.60.0 !sing s assign(resid32and nameha) (resid 34andname hn) 3.6 3.60.0 !sing m assign(resid33and namehn) (resid 34andname hn) 3.6 3.60.0 !sing s assign(resid33and nameha) (resid 34andname hn) 3.1 3.10.0 !sing s assign(resid34and namehn) (resid 35andname hn) 5.5 5.50.0 !sing s assign(resid34and namehn) (resid 44andname hn) 5.5 5.50.0 !sing l assign(resid34and nameha) (resid 35andname hn) 3.1 3.10.0 !sing s assign(resid34and nameha) (resid 43andname ha) 2.8 2.80.0 !sing assign(resid34and nameha) (resid 44andname hn) 3.1 3.10.0 !sing l assign(resid35and namehn) (resid 36andname hn) 5.5 5.50.0 !sing s assign(resid35and namehn) (resid 41andname ha) 5.5 5.50.0 !sing l assign(resid35and namehn) (resid 42andname hn) 3.6 3.60.0 !sing l assign(resid35and namehn) (resid 43andname ha) 5.5 5.50.0 !sing l assign(resid35and namehn) (resid 44andname hn) 5.5 5.50.0 !sing l assign(resid35and namehn) (resid 44andname ha) 5.5 5.50.0 !sing l assign(resid35and nameha) (resid 36andname hn) 2.6 2.60.0 !sing s assign(resid36and namehn) (resid 37andname hn) 5.5 5.50.0 !sing s assign(resid36and nameha) (resid 37andname hn) 2.6 2.60.0 !sing s assign(resid36and nameha) (resid 41andname ha) 2.8 2.80.0 !sing assign(resid36and nameha) (resid 42andname hn) 3.6 3.60.0 !sing assign(resid37and namehn) (resid 40andname hn) 3.6 3.60.0 !sing m assign(resid37and namehn) (resid 41andname ha) 3.5 3.60.0 !sing m assign(resid37and namehn) (resid 42andname hn) 5.5 5.50.0 !sing l assign(resid37and nameha) (resid 38andname hn) 2.6 2.60.0 !sing s assign(resid38and namehn) (resid 39andname hn) 5.5 5.50.0 !sing s assign(resid39and namehn) (resid 40andname hn) 3.6 3.60.0 !sing s assign(resid40and namehn) (resid 41andname hn) 5.5 5.50.0 !sing s assign(resid40and nameha) (resid 41andname hn) 2.6 2.60.0 !sing s assign(resid41and namehn) (resid 42andname hn) 5.5 5.50.0 !sing s assign(resid41and nameha) (resid 42andname hn) 2.6 2.60.0 !sing s assign(resid42and nameha) (resid 43andname hn) 2.6 2.60.0 !sing s assign(resid42and namehb) (resid 43andname hn) 3.1 3.10.0 !sing s assign(resid43and namehn) (resid 44andname hn) 5.5 5.50.0 !sing s assign(resid43and nameha) (resid 44andname hn) 2.6 2.60.0 !sing s assign(resid44and nameha) (resid 46andname hn) 3.6 3.60.0 !sing m assign(resid45and nameha) (resid 46andname hn) 3.6 3.60.0 !sing s assign(resid46and nameha) (resid 72andname hn) 5.5 5.50.0 !sing l assign(resid47and nameha) (resid 48andname hn) 2.6 2.60.0 !sing s assign(resid48and namehn) (resid 49andname hn) 5.5 5.50.0 !sing s assign(resid48and namehn) (resid 51andname hn) 5.5 5.50.0 !sing m assign(resid48and nameha) (resid 49andname hn) 3.1 3.10.0 !sing s assign(resid98and nameha) (resid 50andname hn) 5.5 5.50.0 !sing m assign(resid48and namehb) (resid 49andname hn) 3.6 3.60.0 !sing s assign(resid48and namehb) (resid 50andname hn) 5.5 5.50.0 !sing m assign(resid49and namehn) (resid 50andname hn) 3.6 3.60.0 !sing s assign(resid49and namehn) (resid 51andname hn) 5.5 5.50.0 !sing m assign(resid49and nameha) (resid 50andname hn) 3.6 3.60.0 !sing s assign(resid49and nameha) (resid 51andname hn) 4.1 4.10.0 !sing m assign(resid99and nameha) (resid 53andname ha) 3.6 3.60.0 !sing m assign(resid49and nameha) (resid 54andname hn) 3.6 3.60.0 !sing assign(resid50and namehn) (resid 51andname hn) 3.6 3.60.0 !sing s assign(resid51and namehn) (resid 52andname hn) 5.5 5.50.0 !sing s assign(resid51and namehn) (resid 53andname hn) 4.1 4.10.0 !sing m assign(resid51and namehn) (resid 54andname hn) 4.1 4.10.0 !sing m _78_ assign(resid51and nameha) (resid 52and namehn) 3.1 3.10.0 !sing s assign(resid52and namehn) (resid 53and namehn) 3.6 3.60.0 !sing s assign(resid52and nameha) (resid 53and namehn) 3.6 3.60.0 !sing s assign(resid53and namehn) (resid 54and namehn) 4.1 4.10.0 !sing s assign(resid53and nameha) (resid 54and namehn) 3.6 3.60.0 !sing s assign(resid53and nameha) (resid 56and namehn) 2.8 2.80.0 !sing m assign(resid54and namehn) (resid 55and namehn) 3.6 3.60.0 !sing s assign(resid55and namehn) (resid 56and namehn) 3.1 3.10.0 !sing s assign(resid56and namehn) (resid 57and namehn) 5.5 5.50.0 !sing s assign(resid56and namehay (resid 57and namehn) 3.6 3.60.0 !sing s assign(resid57and namehn) (resid 59and namehn) 5.5 5.50.0 !sing m assign(resid57and namehn) (resid 60and namehn) 5.5 5.50.0 !sing m assign(resid57and namehn) (resid 90and namehn) 5.5 5.50.0 !sing l assign(resid57and namehn) (resid 90and nameha) 2.6 2.60.0 !sing l assign(resid57and namehn) (resid 91and nameha) 5.5 5.50.0 !sing l assign(resid57and namehn) (resid 91and namehn) 5.5 5.50.0 !sing l assign(resid57and nameha) (resid 91and nameha) 3.6 3.60.0 !sing l assign(resid58and namehn) (resid 59and namehn) 3.6 3.60.0 !sing s assign(resid58and namehn) (resid 60and namehn) 5.5 5.50.0 !sing m assign(resid58and nameha) (resid 59and namehn) 3.6 3.60.0 !sing s assign(resid59and namehn) (resid 60and namehn) 3.6 3.60.0 !sing_s assign(resid59and nameha) (resid 60and namehn) 3.6 3.60.0 !sing s assign(resid60and namehn) (resid 61and namehn) 5.5 5.50.0 !sing s assign(resid60and namehn) (resid 78and nameha) 5.5 5.50.0 !sing l assign(resid60and nameha) (resid 61and namehn) 2.6 2.60.0 !sing s assign(resid60and nameha) (resid 77and namehn) 5.5 5.50.0 !sing l assign(resid60and nameha) (resid 78and nameha) 2.8 2.80.0 !sing l assign(resid60and nameha) (resid 79and namehn) 3.6 3.60.0 !sing l assign(resid61and namehn) (resid 77and namehn) 3.6 3.60.0 !sing l assign(resid61and namehn) (resid 78and nameha) 3.6 3.60.0 !sing l assign(resid61and namehn) (resid 79and namehn) 5.5 5.50.0 !sing l assign(resid61and nameha) (resid 62and namehn) 2.6 2.60.0 !sing s assign(resid62and nameha) (resid 63and namehn) 2.6 2.60.0 !sing s assign(resid62and nameha) (resid 76and nameha) 2.8 2.80.0 !sing l assign(resid63and namehn) (resid 63and namehb) 3.6 3.60.0 !sing-i assign(resid63and namehn) (resid 64and namehn) 5.5 5.50.0 !sing s assign(resid63and namehn) (resid 75and namehn) 3.6 3.60.0 !sing l assign(resid63and namehn) (resid 76and nameha) 5.5 5.50.0 !sing assign(resid63and nameha) (resid 64and namehn) 2.6 2.60.0 !sing s assign(resid63and namehb) (resid 64and namehn) 3.1 3.10.0 !sing s assign(resid64and nameha) (resid 74and nameha) 2.8 2.80.0 !sing assign(resid65and nameha) (resid 66and namehn) 2.6 2.60.0 !sing s assign(resid66and namehn) (resid 67and namehn) 5.5 5.50.0 !sing s assign(resid67and namehn) (resid 68and namehn) 5.5 5.50.0 !sing s assign(resid67and nameha) (resid 68and namehn) 3.6 3.60.0 !sing s assign(resid70and namehn) (resid 71and namehn) 3.1 3.10.0 !sing s assign(resid70and nameha) (resid 71and namehn) 3.6 3.60.0 !sing s assign(resid71and namehn) (resid 72and namehn) 3.6 3.60.0 !sing s assign(resid72and namehn) (resid 73and namehn) 5.5 5.50.0 !sing s assign(resid72and nameha) (resid 73and namehn) 2.6 2.60.0 !sing s assign(resid73and namehn) (resid 74and namehn) 5.5 5.50.0 !sing s assign(resid73and nameha) (resid 74and namehn) 2.6 2.60.0 !sing s assign(resid74and namehn) (resid 74and namehb) 3.1 3.10.0 !sing i assign(resid74and nameha) (resid 75and namehn) 2.6 2.60.0 !sing s assign(resid75and namehn) (resid 75and namehb) 3.1 3.10.0 !sing i assign(resid75and nameha) (resid 76and namehn) 2.6 2.60.0 !sing s assign(resid75and namehb) (resid 76and namehn) 3.6 3.60.0 !sing s assign(resid76and nameha) (resid 77and namehn) 2.6 2.60.0 !sing s assign(resid77and namehn) (resid 78and namehn) 5.5 5.50.0 !sing s assign(resid77and nameha) (resid 78and namehn) 2.8 2.80.0 !sing s assign(resid78and namehn) (resid 79and namehn) 5.5 5.50.0 !sing s assign(resid78and nameha) (resid 79and namehn) 2.6 2.60.0 !sing s assign(resid79and namehn) (resid 79and namehb) 3.6 3.60.0 !sing i assign(resid79and namehn) (resid 80and namehn) 3.6 3.60.0 !sing s assign(resid79and namehb) (resid 80and namehn) 5.5 5.50.0 !sing s assign(resid81and nameha) (resid 82andname hn) 3.6 3.60.0 !sing s assign(resid81and nameha) (resid 83andname hn) 4.1 4.10.0 !sing m assign(resid82and namehn) (resid 83andname hn) 4.1 4.10.0 !sing s assign(resid82and nameha) (resid 83andname hn) 4.1 4.10.0 !sing s assign(resid83and namehn) (resid 84andname hn) 5.5 5.50.0 !sing s assign(resid83and nameha) (resid 84andname hn) 2.6 2.60.0 !sing s assign(resid84and namehn) (resid 92andname hn) 5.5 5.50.0 !sing l assign(resid84and namehn) (resid 93andname hn) 5.5 5.50.0 !sing assign(resid85and nameha) (resid 86andname hn) 2.6 2.60.0 !sing s assign(resid85and nameha) (resid 92andname ha) 2.8 2.80.0 !sing l assign(resid86and namehn) (resid 86andname hg) 3.6 3.60.0 !sing i assign(resid86and namehn) (resid 87andname hn) 5.5 5.50.0 !sing s assign(resid86and namehn) (resid 89andname hn) 4.1 4.i0.0 !sing m assign(resid86and namehn) (resid 90andname hn) 5.5 5.50.0 !sing m assign(resid86and namehn) (resid 91andname hn) 3.6 3.60.0 !sing l assign(resid86and nameha) (resid 87andname hn) 3.6 3.60.0 !sing s assign(resid87and namehn) (resid 88andname hn) 4.1 4.10.0 !sing s assign(resid87and nameha) (resid 88andname hn) 3.1 3.10.0 !sing s assign(resid88and namehn) (resid 89andname hn) 4.1 4.10.0 !sing s assign(resid88and namehn) (resid 90andname hn) 5.5 5.50.0 !sing m assign(resid88and nameha) (resid 89andname hn) 4.1 4.10.0 !sing s assign(resid89and namehn) (resid 90andname hn) 3.6 3.60.0 !sing s assign(resid90and namehn) (resid 90andname hb) 3.6 3.60.0 !sing i assign(resid90and namehn) (resid 91andname hn) 3.1 3.10.0 !sing s assign(resid90and namehb) (resid 91andname hn) 5.5 5.50.0 !sing s assign(resid91and namehn) (resid 92andname hn) 5.5 5.50.0 !sing s assign(resid91and nameha) (resid 92andname hn) 3.1 3.10.0 !sing s assign(resid92and nameha) (resid 93andname hn) 3.1 3.10.0 !sing s class hbnd assign(resid17and namehn) (resid 29andname o) 2.0 0.30.3 !hbnd assign(resid17and namen) (resid 29andname o) 3.3 0.30.3 !hbnd assign(resid17and nameo) (resid 29andname hn) 2.0 0.30.3 !hbnd assign(resid17and nameo) (resid 29andname n) 3.3 0.30.3 !hbnd assign(resid19and namehn) (resid 27andname o) 2.0 0.30.3 !hbnd assign(resid19and namen) (resid 27andname o) 3.3 0.30.3 !hbnd assign(resid19and nameo) (resid 27andname hn) 2.0 0.30.3 !hbnd assign(resid19and nameo) (resid 27andname n) 3.3 0.30.3 !hbnd assign.(resid35and namehn) (resid 42andname o) 2.0 0.30.3 !hbnd assign(resid35and namen) (resid 42andname o) 3.3 0.30.3 !hbnd assign(resid35and nameo) (resid 42andname hn) 2.0 0.30.3 !hbnd assign(resid35and nameo) (resid 42andname n) 3.3 0.30.3 !hbnd assign(resid61and namehn) (resid 77andname o) 2.0 0.30.3 !hbnd assign(resid61and namen) (resid 77andname o) 3.3 0.30.3 !hbnd assign(resid61and nameo) (resid 77andname hn) 2.0 0.30.3 !hbnd assign(resid61and nameo) (resid 77andname n) 3.3 0.30.3 !hbnd assign(resid63and namehn) (resid 75andname o) 2.0 0.30.3 !hbnd assign(resid63and namen) (resid 75andname o) 3.3 0.30.3 !hbnd assign(resid63and nameo) (resid 75andname hn) 2.0 0.30.3 !hbnd assign(resid63and nameo) (resid 75andname n) 3.3 0.30.3 !hbnd ! dihedral angle restraints X-PLOR format ! chi-1 22 restraints ! phi 25 restraints ! psi 33 restraints ! chi-2 5 restraints !<ENERGY> <ANGLE> <RANGE><EXPONENT>
! chi-1 restraints assign (resid 15 and name n ) (resid 15 and name ca) (resid 15 and name cb) (resid 15 and name cg) 1.0 -60.0 90.0 2 assign (resid 19 and name n ) (resid 19 and name ca) (resid 19 and name cb) (resid 19 and name cg) 1.0 180.0 40.0 2 assign (resid 22 and name n ) (resid 22 and name ca) (resid 22 and name cb) (resid 22 and name cg) 1.0 -60.0 40.0 2 assign (resid 23 and name n ) (resid 23 and name ca) (resid 23 and name cb) (resid 23 and name cg) 1.0 60.0 40.0 2 assign (resid 30 and name n ) (resid 30 and name ca) (resid 30 and name cb) (resid 30 and name sg) 1.0 -60.0 40.0 2 assign (resid 31 and name n ) (resid 31 and name ca) (resid 31 and name cb) (resid 31 and name cg) 1.0 -60.0 40.0 2 assign (resid 32 and name n ) (resid 32 and name ca) (resid 32 and name cb) (resid 32 and name cg) 1.0 -60.0 40.0 2 assign (resid 33 and name n ) (resid 33 and name ca) (resid 33 and name cb) (resid 33 and name cg) 1.0 -60.0 40.0 2 assign (resid 34 and name n ) (resid 34 and name ca) (resid 34 and name cb) (resid 34 and name cg) 1.0 -60.0 40.0 2 assign (resid 35 and name n ) (resid 35 and name ca) (resid 35 and name cb) (resid 35 and name cg) 1.0 60.0 40.0 2 assign (resid 41 and name n ) (resid 41 and name ca) (resid 41 and name cb) (resid 41 and name sg) 1.0 -60.0 40.0 2 assign (resid 42 and name n ) (resid 42 and name ca) (resid 42 and name cb) (resid 42 and name cgl) 1.0 -60.0 40.0 2 assign (resid 49 and name n ) (resid 49 and name ca) (resid 49 and name cb) (resid 49 and name sg) 1.0 -60.0 40.0 2 assign (resid 52 and name n ) (resid 52 and name ca) (resid 52 and name cb) (resid 52 and name cg) 1.0 60.0 40.0 2 assign (resid 53 and name r. ) (resid 53 and name ca) (resid 53 and name cb) (resid 53 and name cg) 1.0 180.0 40.0 2 assign (resid 56 and name r. ) (resid 56 and name ca) (resid 56 and name cb) (resid 56 and name sg) 1.0 -60.0 40.0 2 assign (resid 62 and name n ) (resid 62 and name ca) (resid 62 and name cb) (resid 62 and name sg) 1.0 180.0 40.0 2 assign (resid 74 and name n ) (resid 74 and name ca) (resid 74 and name cb) (resid 74 and name cgl) 1.0 -60.0 40.0 2 assign (resid 76 and name n ) (resid 76 and name ca) (resid 76 and name cb) (resid 76 and name sg) 1.0 -60.0 40.0 2 assign (resid 78 and name n ) (resid 78 and name ca) (resid 78 and name cb) (resid 78 and name sg) 1.0 -60.0 40.0 2 assign (resid 87 and name n ) (resid 87 and name ca) (resid 87 and name cb) (resid 87 and name cg) 1.0 -60.0 40.0 2 assign (resid 92 and name n ) (resid 92 and name ca) (resid 92 and name cb) (resid 92 and name sg) 1.0 -60.0 90.0 2 ! phi restraints assign(resid14 andnamec (resid15andnamen ) ) (resid15 andnameca) (resid15andnamec ) 60.0 50.0 2 !HN(CO)HB
1.0 assign(resid18 andnamec (resid19andnamen ) ) (resid19 andnameca) (resid19andnamec ) -120.05C.0 2 !HNHA 8.9 1.0 Hz assign(resid27 andnamec (resid28andnamen ) ) (resid28 andnameca) (resid28andnamec ) -120.070.0 2 !HNHA 7.6 1.0 Hz assign(resid29 andnamec (resid30andnamen ) ) (resid30 andnameca) (resid30andnamec ) -78.050.0 2 1.0 assign(resid31 andnamec (resid32andnamen ) ) (resid32 andnameca) (resid32andnamec ) -84.050.0 2 1.0 assign(resid32 andnamec (resid33andnamen ) ) (resid33 andnameca) (resid33andnamec ) 60.0 50.0 2 !HN(CO)HB
1.0 assign(resid33 andnamec (resid34andnamen ) ) (resid34 andnameca) (resid39andnamec ) -120.050.0 2 !HNHA 8.2 1.0 Hz assign(resid34 andnamec (resid35andnamen ) ) (resid35 andnameca) (resid35andnamec ) -120.050.0 2 !HNHA 8.45 1.0 Hz assign(resid36 andnamec (resid37andnamen ) ) (resid37 andnameca) (resid37andnamec ) -120.050.0 2 !HNHA 8.6 1.0 Hz assign(resid38 andnamec (resid39andnamen ) ) (resid39 andnameca) (resid39andnamec ) -120.050.0 2 !HNHA 8.6 1.0 Hz assign(resid39 andnamec (resid40andnamen ) ) (resid90 andnameca) (resid40andnamec ) -120.050.0 2 !HNHA 8.3 1.0 Hz assign (resid90 and name (resid and name c ) 41 n ) (resid41 and name (resid and name 1.0 -120.0 2 !HNHA 8.8 ca) 41 c ) 50.0 Hz assign (resid41 and name (resid and name c ) 42 n ) (resid42 and name (resid and name 1.0 -120.0 2 !HNHA 8.5 ca) 42 c ) 50.0 Hz assign (resid49 and name (resid and name c ) 50 n ) (resid50 and name (resid and name 1.0 -75.0 2 ca) 50 c ) 50.0 assign (resid50 and name (resid and name c ) 51 n ) (resid51 and name (resid and name 1.0 -120.0 2 !HNHA 8.5 ca) 51 c ) 50.0 Hz assign (resid52 and name (resid and name c ) 53 n ) (resid53 and name (resid and name 1.0 60.0 50.02 !HN(CO)HB
ca) 53 c ) assign (resid55 and name (resid and name c ) 56 n ) (resid56 and name (resid and name 1.0 -60.0 2 !HNHA 5.0 ca) 56 c ) 50.0 Hz assign (resid58 and name (resid and name c ) 59 n ) (resid59 and name (resid and name 1.0 -120.0 2 !HNHA 8.8 ca) 59 c ) 50.0 Hz assign (resid59 and name (resid and name c ) 60 n ) (resid60 and name (resid and name 1.0 -120.0 2 !HNHA 8.2 ca) 60 c ) 50.0 Hz assign (resid60 and name (resid and name c ) 61 n ) (resid61 and name (resid and name 1.0 -120.0 2 !HNHA 8.1 ca) 61 c ) 50.0 Hz assign (resid61 and name (resid and name c ) 62 n ) (resid62 and name (resid and name 1.0 -150.0 2 !HNHA 7.9 ca) 62 c ) 70.0 Hz assign (resid62 and name (resid and name c ) 63 n ) (resid63 and name (resid and name 1.0 -120.0 2 !HNHA 8.7 ca) 63 c ) 50.0 Hz assign (resid73 and name (resid and name c ) 74 n ) (resid74 and name (resid and name 1.0 -120.0 2 ca) 74 c ) 50.0 assign (resid74 and name (resid and name c ) 75 n ) (resid75 and name (resid and name 1.0 -120.0 2 !HNHA 9.15 ca) 75 c ) 50.0 Hz assign (resid76 and name (resid and name c ) 77 n ) (resid77 and name (resid and name 1.0 -120.0 2 !HNHA 8.2 ca) 77 c ) 50.0 Hz ! psi restraint s assign (resid15 and name ) (resid15 and ca) n name (resid15 and name ) (resid16 and n ) 1.0 50.0 50.02 c name assign (resid19 and name ) (resid19 and ca) n name (resid19 and name ) (resid20 and n ) 1.0 120.075.02 c name assign (resid25 and name ) (resid25 and ca) n name (resid25 and name ) (resid26 and n ) 1.0 120.075.02 c name assign (resid27 and name ) (resid27 and ca) n name (resid27 and name ) (resid28 and n ) 1.0 120.075.02 c name assign (resid28 and name ) (resid28 and ca) n name (resid28 and name ) (resid29 and n ) 1.0 120.075.02 c name assign (resid29 and name ) (resid29 and ca) n name (resid29 and name ) (resid30 and n ) 1.0 120.060.02 c name assign (resid30 and name ) (resid30 and ca) n name (resid30 and name ) (resid31 and n ) 1.0 125.075.02 c name assign (resid31 and name ) (resid31 and ca) n name (resid31 and name ) (resid32 and n ) 1.0 120.075.02 c name assign (resid32 and name ) (resid32 and ca) n name (resid32 and name ) (resid33 and n ) 1.0 174.050.02 c name assign (resid33 and name ) (resid33 and ca) n name (resid33 and name ) (resid34 and n ) 1.0 60.0 50.02 c name assign (resid34 and name ) (resid34 and ca) n name (resid34 and name ) (resid35 and n ) 1.0 159.050.02 c name assign (resid35 and name ) (resid35 and ca) n name (resid35 and name ) (resid36 and n ) 1.0 156.050.02 c name assign (resid36 and name ) (resid36 and ca) n name (resid36 and name ) (resid37 and n ) 1.0 120.060.02 c name assign (resid37 and name ) (resid37 and ca) n name (resid37 and name ) (resid38 and n ) 1.0 120.060.02 c name assign (resid40 and name ) (resid40 and ca) n name (resid40 and name ) (resid41 and n ) 1.0 120.060.02 c name assign (resid41 and name ) (resid41 and ca) n name (resid41 and name ) (resid42 and n ) 1.0 120.060.02 c name assign (resid42 and name ) (resid42 and ca) n name (resid42 and name ) (resid43 and n ) 1.0 120.060.02 c name assign (resid43 and name ) (resid43 and ca) n name (resid43 and name ) (resid44 and n ) 1.0 120.060.02 c name assign (resid45 and name ) (resid45 and ca) n name (resid45 andnamec (resid and name n ) -60.0 50.0 !HNHB
) 46 1.0 2 assign(resid51 andnamen (resid and name ca) ) 51 (resid51 andnamec (resid and name n ) 120.0 75.0 ) 52 1.0 2 assign(resid53 andnamen (resid and name ca) ) 53 (resid53 andnamec (resid and name n ) 50.0 50.0 ) 54 1.0 2 assign(resid58 andnamen (resid and name ca) ) 58 (resid58 andnamec (resid and name n ) -60.0 50.0 !HNHB
) 59 1.0 2 assign(resid59 andnamen (resid and name ca) ) 59 (resid59 andnamec (resid and name n ) 33.0 50.0 ) 60 1.0 2 assign(resid60 andnamen (resid and name ca) ) 60 (resid60 andnamec (resid and name n ) 162.0 50.0 ) 61 1.0 2 assign(resid61 andnamen (resid and name ca) ) 61 (resid61 andnamec (resid and name n ) 120.0 60.0 ) 62 1.0 2 assign(resid62 andnamen (resid and name ca) ) 62 (resid62 andnamec (resid and name n ) 120.0 60.0 ) 63 1.0 2 assign(resid63 andnamen (resid and name ca) ) 63 (resid63 andnamec (resid and name n ) 165.0 50.0 ) 64 1.0 2 assign(resid74 andnamen (resid and name ca) ) 74 (resid74 andnamec (resid and name n ) 120.0 60.0 ) 75 1.0 2 assign(resid75 andnamen (resid and name ca) ) 75 (resid75 andnamec (resid and name n ) 120.0 60.0 ) 76 1.0 2 assign(resid76 andnamen (resid and name ca) ) 76 (resid76 andnamec (resid and name n ) 120.0 60.0 ) 77 1.0 2 assign(resid78 andnamen (resid and name ca) ) 78 (resid78 andnamec (resid and name n ) 120.0 60.0 ) 79 1.0 2 assign(resid83 andnamen (resid and name ca) ) 83 (resid83 andnamec (resid and name n ) 120.0 60.0 ) 84 1.0 2 assign(resid92 andnamen (resid and name ca) ) 92 (resid92 andnamec (resid and name n ) 120.0 75.0 ) 93 1.0 2 ! chi-2restraints assign(resid2 andnameca) (resid 2 and cb) name (resid2 andnamecgl)(resid 2 and cdl) 0 -60.0 40.0 2 !LRCH
name 1.
assign(resid31 andnameca) (resid cb) and name (resid31 andnamecg) (resid cdl) 0 180.0 40.0 2 !LRCH
31 1.
and name assign(resid32 andnameca) (resid cb) and name (resid32 andnamecg) (resid cdl) 0 180.0 40.0 2 !LRCH
32 1.
and name assign(resid74 andnameca) (resid 4 and cb) 7 name (resid74 andnamecgl)(resid 4 and cdl) 0 -60.0 40.0 2 !LRCH
7 name 1.
assign(resid90 andnameca) (resid cb) and name (resid90 andnamecgl)(resid 0 180.0 40.0 2 !LRCH
and name cdl) 1.
References Abseher, R., Horstink, L., Hilbers, C. W. & Nilges, M. (1998). Essential spaces defined by NMR structure ensembles and molecular dynamics simulation show significant overlap. Proteins: Structure, Function and Genetics, 31, 370-382.
Barbato, G., Ikura, M., Kay, L. E., Pastor, R. W. & Bax, A. (1992). Backbone dynamics of calmodulin studied by N-15 relaxation using inverse detected 2-dimensional nmr-spectroscopy - the central helix is flexible. Biochemistry, 31, 5269-5278.
Bersch, B., Hernandez, J-F., Marion, D. & Arland, G. A. (1998). Solution structure of the epidermal growth factor (EGF)-like module of human complement C 1 r, an atypical member of the EGF family. Biochemistry, 37, 1204-1214.
Blackman, M. J. & Holder, A. A. (1992). Secondary processing of the Plasmodium falciparum merozoite surface protein-1 (MSP-1) by a calcium-dependent membrane-bound serine protease: shedding of MSP-133 as a noncovalently associated complex with other fragments of the MSP-1. Mol. Biochem. Parasitol. 50, 307-316.
2o Blackman, M. J., Heidrich, H.-G. Donachie, S., McBride, J. S. & Holder, A.
A. (1990). A
single fragment of a malaria merozoite surface protein remains on the parasite surface during red cell invasion and is the target of invasion-inhibiting antibodies. J. Exp.
Med 172, 379-382.
Blackman, M. J., J. A. Chappel, S. Shai and A. A. Holder, A. A. (1993). A
conserved parasite serine protease processes the Plasmodium falciparum merozoite surface protein-1 (MSP-1). Mol. Biochem. Parasitol. 62, 103 Blackman, M. J., Scott-Finnigan, T. J., Shai, S. & Holder, A. A. (1994).
Antibodies inhibit 3o the protease-mediated processing of a malaria merozoite surface protein. J.
Exp. Med. 180, 389-393.
Blackman, M.J., Ling, I. T., Nicholls, S.C. & Holder, A.A. (1991). Proteolytic processing of the Plasmodium falciparum merozoite surface protein-1 produces a membrane-bound fragment containing two epidermal growth factor-like domains. Mol. Biochem.
Parasitol.
49, 29-34.
Brandstetter, H., Bauer, M., Huber, R., Lollar, P. & Bode, W. (1995). X-ray structure of clotting factor IXa: active site and module structure related to Xase activity and hemophilia B. Proc. Nat. Acad Sci. USA, 92, 9796-9800.
Burghaus, P. A. & Holder, A. A. (1994). Expression of the 19-kilodalton carboxy-terminal fragment of the Plasmodium falciparum merozoite surface protein-1 in Escherichia coli as a correctly folded protein. Mol. Biochem. Parasitol. 64, 165-169.
Campbell, LD. & Downing, A.K. (1998). NMR of modular proteins. Nat. Struct.
Biol. 5, Supp1496-499.
Clare, J. J. & Romanos, M. A. (1995). Expression of Cloned Genes in the Yeasts Saccharomyces cerevisiae and Pichia pastoris. Methods in Molec. Cell Biol. 5, 319-329.
2o Clore, G. M. & Gronenborn, A. M. (1998). Determining the structures of large proteins and protein complexes by NMR. Trends in Biotechnology, 16, 22-34.
Daly, T. M., Burns, J. M. & Long, C. A. (1992). Comparison of the carboxyl terminal, cysteine-rich domain of the merozoite surface protein-1 from several strains of Plasmodium yoelii. Mol. Biochem. Parasitol. 52, 279-282.
Del Portillo, H. A., Longacre, S., Khouri, E. & David, P. H. (1991). Primary structure of the merozoite surface antigen-1 of Plasmodium vivax reveals sequences conserved between different Plasmodium species. Proc. Natl. Acad Sci. USA 88, 4030-4034.
Diggs, C.L., Ballou, W.R. & Miller, L.H. (1993). The major merozoite surface protein as a malaria vaccine target. Parasitol Today, 9, 300-302.
Doreleijers, J. F., Rullman, J. A. C. & Kaptein, R. (1998). Quality assessment of NMR
structures: a statistical approach. J. Mol. Biol. 281, 149-164.
Downing. A. K., Knott, V., Werner, J. M., Cardy, C. M., Campbell, I. D. &
Handford, P.
A. (1996). Solution structure of a pair of calcium binding epidermal growth factor-like domains: implications for the Marfan syndrome and other genetic disorders.
Cell, 86, 597-605.
to Egan, A., Waterfall, M., Pinder, M., Holder, A. & Riley, E. (1997) Characterization of human T- and B- cell epitopes in the C-terminus of Plasmodium falciparum merozoite surface protein 1: evidence for poor T-cell recognition of polypeptides with numerous disulfide bonds. Infect. Immun. 65, 3024-3031.
Gibson, H.L., Tucker, J. E., Kaslow, D.C., Krettli, A.U., Collins, W. E., Kiefer, M. C., Bathurst, I. C. & Barr, P. J. (1992). Structure and expression of the gene for Pv200, a major blood-stage surface antigen of Plasmodium vivax. Mol. Biochem. Parasitol. 50, 325-334.
Guevara Patino, J. A., Holder, A. A., McBride, J. S. & Blackman, M. J. (1997).
Antibodies 2o that inhibit malaria merozoite surface protein-1 processing and erythrocyte invasion are blocked by naturally acquired human antibodies. J. Exp. Med. 186, 1689-1699.
Holder, A. A., Lockyer, M. J., Odink, K. G., Sandhu, J. S., Riveros-Moreno, V., Nicholls, S.
C., Hillman, Y., Davey, L. S., Tizard, M. L. V., Schwarz, R. T. & Freeman, R.
R. (1985).
Primary structure of the precursor to the three major surface antigens of Plasmodium falciparum merozoites. Nature 317, 270-273.
Holder, A. A., Blackman, M. J., Burghaus, P. A., Chappel, J. A., Ling, I. T., McCallum-Deighton, N. & Shai, S. (1992). A malaria merozoite surface protein (MSP-1) -Structure, processing and function. Mem. Inst. Oswaldo Cruz, 87, Suppl III, 37-42.
Kay, L. E., Torchia, D. A. & Bax, A. ( 1989). Backbone dynamics of proteins as studied by 'SN inverse detected heteronuclear NMR spectroscopy. Application to staphylococcal nuclease. Biochemistry, 28, 8972-8979.
Kraulis, P. J. ( 1991 ). Molscript - a program to produce both detailed and schematic plots of protein structures. J. Appl. Cryst. 24, 946-950.
Laroche, Y., Storme, V., de Meutter, J., Messens, J. & Lauwereys, M. (1994).
High-level secretion and very efficient isotopic labeling of tick anticoagulant peptide (TAP) to expressed in the methylotrophic yeast, Pichia pastoris. BiolTechnology, 12, 1119-1124.
Laskowski, R. A., Rullmann, J. A. C., MacArthur, M. W., Kaptein, R. &
Thornton, J. M.
(1996). AQUA and PROCHECK-NMR: Programs for checking the quality of protein structures solved by NMR. J. Biomol. NMR, 8, 477-486.
McBride, J. S. & Heidrich, H.-G. (1987). Fragments of the polymorphic Mr 185,000 glycoprotein from the surface of isolated Plasmodium falciparum merozoites form an antigenic complex. Mol. Biochem. Parasitol. 23, 71-84.
2o McDonald, I. K. & Thornton, J. M. (1994). Satisfying hydrogen bonding potential in proteins. J. Biol. Chem. 238, 777-793.
Mrema, J. E. K., S. G. Langreth, R. C. Jost, K. H. Rieckmann and H. -G.
Heidrich (1982).
Plasmodium falciparum: isolation and purification of spontaneously released merozoites by nylon sieve membranes. Exp. Parasitol. 54, 285.
Nicholls, A., Sharp, K. A. & Honig, B. (1991). Protein folding and association: insights from the interfacial and thermodynamic properties of hydrocarbons. Proteins, 11, 281-296.
Nilges, M., Kuszewski, J. & Briinger, A. T. ( 1991 ). Sampling properties of simulated annealing and distance geometry in Computational Aspects of the Study of Biological _87_ Macromolecules by NMR . (J. C. Hoch, ed.) NY, Plenum Press.451-455.
Pirson, P. J. & Perkins, M. E. (1985). Characterization with monoclonal antibodies of a surface antigen of Plasmodium falciparum merozoites. J. Immunol. 134, 1946-1951.
Polshakov, V. L, Frenkiel, T. A., Birdsall, B., Soteriou, A. & Feeney, J.
(1995).
Determination of stereospecific assignments torsion-angle constraints and rotamer populations in proteins using the program AngleSearch. J. Magn. Reson. Series B, 108, 31-43.
to Polshakov, V. L, Williams, M., Gargaro, A., Frenkiel, T. A., Westley, B. R., Chadwick, M. P., May, F. E. B. & Feeney, J. (1997). High resolution solution structure of the human breast cancer oestrogen-inducible pNR-2/pS2: a single trefoil domain. J. Mol.
Biol. 267, 418-432.
Perrin, S & Gilliland, G. (1990). Site specific mutagenesis using asymmetric polymerase chain reaction and a single mutant primer. Nucl. Acids Res. 18, 7433-7438 Qari, S.H., Shi, Y. P., Goldman, I. F., Nahlen, B. L., Tibayrenc, M., Lal, A.
A. (1998).
Predicted and observed alleles of Plasmodium falciparum merozoite surface protein 1 (MSP-1), a potential malaria vaccine antigen. Mol. Biochem. Parasitol. 92(2), 241-252.
Richardson, J. S. ( 1981 ). The Anatomy and Taxonomy of Protein structure.
Adv. Prot.
Chem. 34, 167-339.
Ryckaert, J-P., Ciccutti, G. & Berendsen, H. J. C. ( 1977). Numerical-integration of Cartesian equations of motion of a system with constraints - molecular dynamics of N-alkanes. .I. Comput. Phys. 23, 327-351.
3o Stoute, J. A. & Ballou, W.R. (1998). The current status of malaria vaccines. BIODRUGS
10,123-136.
a _88_ SEQUENCE LISTING
SEQ LD. No. I - P. falciparum MSP-I,~ (From SwissProt accession no. P04933) 1o SEQ LD. No. 2 - P. falciparum MSP-142 (From SwissProt accession no. P04933) is AKVLNYTYEK SNUEVKIKEL NYLKTIQDKL ADFKKNNNFV GIADLSTDYN HNNLLTKFLS 237 SEQUENCE LISTING
(1) GENERAL
INFORMATION:
(i) APPLICANT: MEDICAL RESEARCH COUNCIL
(ii) TITLE OF INVENTION: VACCINE
(iii) NUMBER OF SEQUENCES: 2 (iv) CORRESPONDENCE ADDRESS:
(A) ADDRESSEE: SMART & BIGGAR
(B) STREET: P.O. BOX 2999, STATION
D
(C) CITY: OTTAWA
(D) STATE: ONT
(E) COUNTRY: CANADA
(F) ZIP: K1P 5Y6 (v) COMPUTER READABLE FORM:
2 (A) MEDIUM TYPE: Floppy disk (B) COMPUTER: IBM PC compatible (C) OPERATING SYSTEM: PC-DOS/MS-DOS
(D) SOFTWARE: ASCII (text) (vi) CURRENT APPLICATION DATA:
(A) APPLICATION NUMBER: CA 2,271,451 (B) FILING DATE: 25-MAY-1999 (C) CLASSIFICATION:
(vii) PRIOR APPLICATION DATA:
(A) APPLICATION NUMBER: GB 9909072.2 3~ (B) FILING DATE: 20-APR-1999 (viii) ATTORNEY/AGENT INFORMATION:
(A) NAME: SMART & BIGGAR
(B) REGISTRATION NUMBER:
(C) REFERENCE/DOCKET NUMBER: 67551-9 (ix) TELECOMMUNICATION INFORMATION:
(A) TELEPHONE: (613)-232-2486 (B) TELEFAX: (613)-232-8440 (2) INFORMATION FOR SEQ ID N0:1:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 96 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide 10 (vi) ORIGINAL SOURCE:
(A) ORGANISM: Plasmodium falciparum (xi) SEQUENCE DESCRIPTION: SEQ ID NO:1:
Asn Ile Ser Gln His Gln Cys Val Lys Lys Gln Cys Pro Gln Asn Ser Gly Cys Phe Arg His Leu Asp Glu Arg Glu Glu Cys Lys Cys Leu Leu 2 0 Asn Tyr Lys Gln Glu Gly Asp Lys Cys Val Glu Asn Pro Asn Pro Thr Cys Asn Glu Asn Asn Gly Gly Cys Asp Ala Asp Ala Lys Cys Thr Glu Glu Asp Ser Gly Ser Asn Gly Lys Lys Ile Thr Cys Glu Cys Thr Lys Pro Asp Ser Tyr Pro Leu Phe Asp Gly Ile Phe Cys Ser Ser Ser Asn (2) INFORMATION FOR SEQ ID N0:2:
(i) SEQUENCE CHARACTERISTICS:
(A) LENGTH: 376 amino acids (B) TYPE: amino acid (C) STRANDEDNESS: single 4 0 (D) TOPOLOGY: linear (ii) MOLECULE TYPE: peptide (vi) ORIGINAL SOURCE:
(A) ORGANISM: Plasmodium falciparum (xi) SEQUENCE DESCRIPTION: SEQ ID N0:2:
Ala Val Thr Pro Ser Val Ile Asp Asn Ile Leu Ser Lys Ile Glu Asn Glu Tyr Glu Val Leu Tyr Leu Lys Pro Leu Ala Gly Val Tyr Arg Ser Leu Lys Lys Gln Leu Glu Asn Asn Val Met Thr Phe Asn Val Asn Val Lys Asp Ile Leu Asn Ser Arg Phe Asn Lys Arg Glu Asn Phe Lys Asn Val Leu Glu Ser Asp Leu Ile Pro Tyr Lys Asp Leu Thr Ser Ser Asn Tyr Val Val Lys Asp Pro Tyr Lys Phe Leu Asn Lys Glu Lys Arg Asp Lys Phe Leu Ser Ser Tyr Asn Tyr Ile Lys Asp Ser Ile Asp Thr Asp Ile Asn Phe Ala Asn Asp Val Leu Gly Tyr Tyr Lys Ile Leu Ser Glu Lys Tyr Lys Ser Asp Leu Asp Ser Ile Lys Lys Tyr Ile Asn Asp Lys Gln Gly Glu Asn Glu Lys Tyr Leu Pro Phe Leu Asn Asn Ile Glu Thr Leu Tyr Lys Thr Val Asn Asp Lys Ile Asp Leu Phe Val Ile His Leu Glu Ala Lys Val Leu Asn Tyr Thr Tyr Glu Lys Ser Asn Val Glu Val Lys Ile Lys Glu Leu Asn Tyr Leu Lys Thr Ile Gln Asp Lys Leu Ala Asp Phe Lys Lys Asn Asn Asn Phe Val Gly Ile Ala Asp Leu Ser Thr Asp Tyr Asn His Asn Asn Leu Leu Thr Lys Phe Leu Ser Thr Gly Met Val Phe Glu Asn Leu Ala Lys Thr Val Leu Ser Asn Leu Leu Asp Gly Asn Leu Gln Gly Met Leu Asn Ile Ser Gln His Gln Cys Val Lys Lys Gln Cys Pro Gln Asn Ser Gly Cys Phe Arg His Leu Asp Glu Arg Glu Glu Cys Lys Cys Leu Leu Asn Tyr Lys Gln Glu Gly Asp Lys Cys Val Glu Asn Pro Asn Pro Thr Cys Asn Glu Asn Asn Gly Gly Cys Asp Ala Asp Ala Lys Cys Thr Glu Glu Asp Ser Gly Ser Asn Gly Lys Lys Ile Thr Cys Glu Cys Thr Lys Pro Asp Ser Tyr Pro Leu Phe Asp Gly Ile Phe Cys Ser Ser Ser Asn Phe Leu Gly Ile Ser Phe Leu Leu Ile Leu Met Leu Ile Leu Tyr Ser Phe Ile
Claims (24)
1. A non-naturally occurring variant of a C-terminal fragment of a Plasmodium merozoite surface protein-1 (MSP-1) wherein said variant has (i) a reduced affinity.
compared with a naturally occurring Plasmodium MSP-1 19, for at least one first antibody capable of blocking the binding of a second antibody, which second antibody inhibits the proteolytic cleavage of Plasmodium MSP-1 42 and (ii) substantially the same affinity for at least one third antibody compared with said naturally occurring Plasmodium MSP-1 19.
which third antibody inhibits the proteolytic cleavage of Plasmodium MSP-1 42.
compared with a naturally occurring Plasmodium MSP-1 19, for at least one first antibody capable of blocking the binding of a second antibody, which second antibody inhibits the proteolytic cleavage of Plasmodium MSP-1 42 and (ii) substantially the same affinity for at least one third antibody compared with said naturally occurring Plasmodium MSP-1 19.
which third antibody inhibits the proteolytic cleavage of Plasmodium MSP-1 42.
2. A variant according to claim 1 wherein said Plasmodium MSP-1 19 and MSP-1 42 are Plasmodium falciparum MSP-1 19 and MSP-1 42.
3. A variant according to claim 1 or 2 wherein the first antibody is selected from mAbs 2.2, 7.5 and 111.4.
4. A variant according to claim 1 or 2 wherein the second and/or third antibody is selected from mAbs 12.8. 12.10 and 5BI.
5. A non-naturally occurring variant of a C-terminal fragment of a Plasmodium merozoite surface protein-1 (MSP-1) comprising an amino acid modification at any one of amino acid residues 15, 27, 31, 34 and 43 of the Plasmodium falciparum MSP-1 19 amino acid sequence shown as SEQ I.D. No. 1 or their equivalent positions in other Plasmodium MSP-1 19 polypeptides.
6. A variant according to claim 5 wherein said modifications are selected from Asn15->Arg, Glu27->Tyr, Leu31->Arg, Tyr34->Ser, Tyr34->Gly and Glu43->Leu and their equivalents in other Plasmodium MSP-1 19 polypeptides.
7. A variant according to claim 6 wherein said substitutions are selected from, [Glu27->Tyr, Leu31->Arg and Glu43->Leu], [Glu27->Tyr, Leu31->Arg, Tyr34->Ser and Glu43->Leu], [Asn15->Arg, Glu27->Tyr, Leu31->Arg and Glu43->Leu] and their equivalents in other Plasmodium MSP-1 19 polypeptides.
8. A variant according to any one of claims 5 to 7 further comprising a mutation at CYs12 andlor Cys28 of the Plasmodium falciparum MSP-1,9 amino acid sequence shown as SEQ LD. No. 1.
9. A method for producing a Plasmodium MSP-1 variant for use in preparing a vaccine composition which method comprises modifying one or more amino acid residues of a Plasmodium MSP-1 C-terminal fragment such that the resulting derivative has (i) a reduced affinity, compared with a naturally occurring Plasmodium MSP-1,9, for at least one first antibody capable of blocking the binding of a second antibody, which second antibody inhibits the proteolytic cleavage of Plasmodizrm MSP-11Z and (ii) substantially the same affinity for at least one third antibody compared with said naturally occurring Plasmodium YISP-1,9, which third antibody inhibits the proteolytic cleavage of Plasmodium MSP-1;2.
10. A non-naturally occurring Plasmodium ivISP-1 variant obtained by the method of claim 9.
11. A polynucleotide encoding a variant according to any one of claims 1 to 8 or 10 operably linked to a regulatory sequence capable of directing the expression of said nucleotide in a host cell.
12. A nucleic acid vector comprising a polynucleotide according to claim 11.
13. A host cell comprising a vector according to claim 12.
1=I. A pharmaceutical composition comprising a variant according to any one of claims 1 to 8 or 10, a polynucleotide according to claim 11 or a vector according to claim 12 together with a pharmaceutically acceptable carrier or diluent.
15. A composition according to claim 14 further comprising an immunogenic Plasmodizrm polypeptide or fragment or derivative thereof.
16. A method for producing anti-MSP-1 antibodies which method comprises administering a polypeptide according to any one of claims 1 to 8 or 10, a polynucleotide according to claim 11 or a vector according to claim 12 to a mammal.
17. A method for producing polyclonal anti-MSP-1 antibodies which method comprises administering a polypeptide according to any one of claims 1 to 8 or 10, a polynucleotide according to claim 11 or a vector according to claim 12 to a mammal and extracting the serum from said mammal.
18. An antibody produced by the method of claim 16 or 17.
19. A method of inducing immunity against malaria induced by Plasmodium falciparum which comprises administering to a person in need of such immunity an effective amount of the variant of claim l, the polynucleotide of claim 11 or the vector of claim 12.
20. A method of immunizing a mammal, said method comprising administering an effective amount the polypeptide of claim 1, the polynucleotide of claim 11 or the vector of claim 12.
21. The method of claim 20, wherein said mammal is immunized against malaria.
22. A method of treating a malaria infection in a human patient which comprises administering to the patient an effective amount of the pharmaceutical composition of claim 14 or 1 ~.
23. A variant according to any one of claims 1 to 8 or 10, a polvnucleotide according to claim 11 or a vector according to claim 12 for use in therapy.
24. A computer readable medium having stored thereon a model of the MSP-1 19 NMR
structure.
structure.
Priority Applications (9)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP00920918A EP1180120A2 (en) | 1999-04-20 | 2000-04-20 | Variant of the plasmodium merozoite surface protein (msp-1) and vaccine comprising said variant |
AU41330/00A AU779662B2 (en) | 1999-04-20 | 2000-04-20 | Vaccine |
CN00809259A CN1372568A (en) | 1999-04-20 | 2000-04-20 | Vaccin |
JP2000612331A JP2002543774A (en) | 1999-04-20 | 2000-04-20 | vaccine |
PCT/GB2000/001558 WO2000063245A2 (en) | 1999-04-20 | 2000-04-20 | Variant of the plasmodium merozoite surface protein (msp-1) and vaccine comprising said variant |
BR0009823-0A BR0009823A (en) | 1999-04-20 | 2000-04-20 | Variant of the merozoite plasmodium (msp-1) surface protein and vaccine comprising the variant |
MXPA01010701A MXPA01010701A (en) | 1999-04-20 | 2000-04-20 | Vaccine. |
US09/978,756 US7078043B2 (en) | 1999-04-20 | 2001-10-16 | Malaria vaccine |
HK02104693.0A HK1043135A1 (en) | 1999-04-20 | 2002-06-24 | Variant of the plasmodium merozoite surface protein (msp-1) and vaccine comprising said variant |
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB9909072.2 | 1999-04-20 | ||
GBGB9909072.2A GB9909072D0 (en) | 1999-04-20 | 1999-04-20 | Vaccine |
Publications (1)
Publication Number | Publication Date |
---|---|
CA2271451A1 true CA2271451A1 (en) | 2000-10-20 |
Family
ID=10851919
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
CA002271451A Abandoned CA2271451A1 (en) | 1999-04-20 | 1999-05-25 | Variant c-terminal fragment of plasmodium falciparum msp-1 |
Country Status (2)
Country | Link |
---|---|
CA (1) | CA2271451A1 (en) |
GB (1) | GB9909072D0 (en) |
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015056244A1 (en) * | 2013-10-18 | 2015-04-23 | Universidade Federal De Minas Gerais - Ufmg | Kit and immunodiagnostic method for detecting anaemia caused by vivax malaria, synthetic peptides and uses |
-
1999
- 1999-04-20 GB GBGB9909072.2A patent/GB9909072D0/en not_active Ceased
- 1999-05-25 CA CA002271451A patent/CA2271451A1/en not_active Abandoned
Cited By (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2015056244A1 (en) * | 2013-10-18 | 2015-04-23 | Universidade Federal De Minas Gerais - Ufmg | Kit and immunodiagnostic method for detecting anaemia caused by vivax malaria, synthetic peptides and uses |
Also Published As
Publication number | Publication date |
---|---|
GB9909072D0 (en) | 1999-06-16 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Goundis et al. | Properdin, the terminal complement components, thrombospondin and the circumsporozoite protein of malaria parasites contain similar sequence motifs | |
US20070036818A1 (en) | Recombinant protein containing a C-terminal fragment of Plasmodium MSP-1 | |
Wang et al. | Structural and antigenic properties of merozoite surface protein 4 of Plasmodium falciparum | |
US7303751B2 (en) | Anti-plasmodium compositions and methods of use | |
Fox et al. | Plasmodium falciparum: an epitope within a highly conserved region of the 47-kDa amino-terminal domain of the serine repeat antigen is a target of parasite-inhibitory antibodies | |
US20070098738A1 (en) | MSP-3-like family of genes | |
EP1141305B1 (en) | Chimeric gene encoding the antigenic determinants of four proteins of l. infantum | |
AU779662B2 (en) | Vaccine | |
JP2000506381A (en) | Recombinant protein containing the C-terminal fragment of malaria parasite MSP-1 | |
US9683024B2 (en) | Recombinantly expressed plasmodium CelTOS antigen and methods of use thereof | |
EP3016678B1 (en) | Vaccine comprising ama1 and ron2 | |
US7078043B2 (en) | Malaria vaccine | |
CA2271451A1 (en) | Variant c-terminal fragment of plasmodium falciparum msp-1 | |
US20040202667A1 (en) | Antigens and their use as diagnostics and vaccines against species of plasmodium | |
WO2005063805A1 (en) | Antibodies against the amino terminus region of circumsporozoite protein prevent the onset of malaria infection | |
Lozano et al. | Redefining an epitope of a malaria vaccine candidate, with antibodies against the N-terminal MSA-2 antigen of Plasmodium harboring non-natural peptide bonds | |
US20240141028A1 (en) | ANTIBODIES TO PfGARP KILL PLASMODIUM FALCIPARUM MALARIA PARASITES AND PROTECT AGAINST INFECTION AND SEVERE DISEASE | |
WO1992017204A1 (en) | Circumsporozoite protein of plasmodium reichenowi and vaccine for human malaria | |
AU646662B2 (en) | Antigenic proteins of plasmodium | |
AU646662C (en) | Antigenic proteins of plasmodium | |
WO2024026301A1 (en) | Method of immmunofocusing an immune response | |
EP0433378A1 (en) | ALLELIC VARIANTS OF -i(PLASMODIUM FALCIPARUM) MEROZOITE SURFACE ANTIGEN. | |
WO2024138204A1 (en) | Stabilized pfs48/45 proteins and uses thereof | |
AU638216C (en) | Allelic variants of plasmodium falciparum merozoite surface antigen | |
EP1624063A2 (en) | Chimeric gene encoding the antigenic determinants of four proteins of L. infantum |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
EEER | Examination request | ||
FZDE | Dead |