CA2255572A1 - Use of chemokine antagonist molecules for their antiviral activity, particularly against an hiv type retrovirus - Google Patents

Use of chemokine antagonist molecules for their antiviral activity, particularly against an hiv type retrovirus Download PDF

Info

Publication number
CA2255572A1
CA2255572A1 CA 2255572 CA2255572A CA2255572A1 CA 2255572 A1 CA2255572 A1 CA 2255572A1 CA 2255572 CA2255572 CA 2255572 CA 2255572 A CA2255572 A CA 2255572A CA 2255572 A1 CA2255572 A1 CA 2255572A1
Authority
CA
Canada
Prior art keywords
antagonist
polypeptide
amino acid
rantes
use according
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
CA 2255572
Other languages
French (fr)
Inventor
Fernando Arenzana-Seisdedos
Jean-Louis Virelizier
Francoise Bachelerie
Marco Baggiolini
Ian Clark-Lewis
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Individual
Original Assignee
Institut Pasteur de Lille
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Institut Pasteur de Lille filed Critical Institut Pasteur de Lille
Publication of CA2255572A1 publication Critical patent/CA2255572A1/en
Abandoned legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/521—Chemokines
    • C07K14/523—Beta-chemokines, e.g. RANTES, I-309/TCA-3, MIP-1alpha, MIP-1beta/ACT-2/LD78/SCIF, MCP-1/MCAF, MCP-2, MCP-3, LDCF-1, LDCF-2
    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy

Abstract

The invention discloses the use of an antagonist compound (designated "antagonist") of one or several molecules of the chemokine family for preparing a medicine for the prevention or the treatment of a viral infection.

Description

CA 022s~72 1998-11-19 WO 97/4446 CA 022s ~ 72 1998-11-19 WO 97/4446

2 PCT/FR97/00900 UTILISATION DE MOLECULES ANTAGONIST~S DE CHEMOKINES
POUR LEUR ACTIVITE ANTIVIRALE NOTAMMENT CONTRE UN
RETROVIRUS DE TYPE VIH.

La presente demande a pour objet l'utilisation de composés antagonistes de molécules de la famille des chemokines ou des antagonistes des produits dérivés de chemokines ayant conservé toutes les propriétés biologiques des chemokines, lesdits composés étant caractérises en ce qu'ils permettent d'obtenir l'inhibition d'une infection virale ou de ses effets in vitro ou in vivo~ lesdits composés présentant à
titre préférentiel une activité anti-virale vis-à-vis d'infections dues à des rétrovirus provoquant une immunodéficience chez un hôte, et en particulier chez un patient humain, notamment des rétrovirus de type HIV ou VIH
(virus de l'immunodéficience humaine).
s Les chemokines sont des molécules de la famille des cytokines, qui présentent des proprietés d'activation, notamment de cellules de la famille des leucocytes faisant intervenir notamment des proprietés chemoattractives, des propriétés de mobilisation du calcium par augmentation du calcium intracellulaire et des propriétés de relargage d'enzymes (exocytose). Ces chemokines sont connues pour leur rôle eventuel en tant que médiateurs de l'inflammation.
Les chemokines ont été decrites par leur structure par leur affinité
pour un ou plusieurs recepteurs et par leurs proprietés biologiques dans une publication de Baggiolini M. et al (Advances in Immunology (1994), vol. 55, pages 97-179).
Une publication de Wells T.N.C. et al (Journal of Leukocyte Biology, vol. 59, January 1996, 53-60) décrit la structure tri-dimensionnelle de - plusieurs chemokines et leurs recepteurs spécifiques ou non.
De façon génerale, ces chemokines sont caractérisees par la présence dans leur structure primaire, de résidus cystéine conservés (1 à

CA 022~72 1998-11-19 4 résidus notamment) sur la base desquels plusieurs sous-familles ont été
distinguees selon la position des deux premieres cystéines. Ces familles comprennent celles des protéines CXC ou des protéines CC. La présence de ces résidus cystéine induit la formation de ponts disulfure.
s Parmi ces chemokines, différentes molécules ont fait l'objet d'études spécifiques. A cet égard, on citera la molécule RANTES décrite dans la publication de Schall T.J. et al. (The Journal of Immunology, August 1, 1988, vol. 141, 1018-1025, No. 3). La molécule RANTES (abréviation de Regulated upon Activation, Normal T-Express and presumably Secreted) a o été décrite dans cet article, notamment à l'aide de la séquence nucléotidique de son ADN complémentaire et à l'aide de la séquence d'acides aminés de la phase ouverte de lecture. Les proprietés biologiques de RANTES ont eté décrites notamment dans l'article de Baggiolini précité.
Ces récepteurs, spécifiques ou non, ont été identifiés dans la publication de Wells précitée ou dans les articles auxquels elle se réfère.
D'autres chemokines telles que les chemokines MIP (Macrophage Inflammatory Protein) observées, isolées et purifiées à partir de macrophages de souris (WOLPE S.D. et al, J. Ex. Med. (1988), 167-170) ont été décrites du point de vue de leurs propriétés biologiques dans I'article de Baggiolini et al. (1994).
Une autre catégorie de chemokines, appelées MCP (Monocyte Chemotactic Protein) a été identifiée à partir de basophiles. Dans les familles MIP et MCP, on connaît notamment les chemokines MIP1 a, MIP1,B, MCP1, MCP2 et MCP3.
Dans une publication de Cocchi F. et al (Science, 15 Déce~"bre 1995, vol. 270, 1811-1815), les auteurs ont émis l'hypothèse que des molécules telles que RANTES, MlP1a et MIP1~ produites notamment par des Iymphocytes T CD8~, pourraient constituer des facteurs suppresseurs de la réplication des isolats primaires du VIH. Ils ont ainsi émis l'hypothèse CA 022~72 1998-11-19 que les protéines RANTES, MlP1a et MIP1~ produites par des Iymphocytes T exprimant des récepteurs CD8 pourraient participer au contrôie de l'infection par un rétrovirus VIH en tant que facteur suppresseur de la replication. Des anticorps obtenus contre les 5 chemokines RANTES ou MlP1(x ou MIP113 ont selon Cocchi et al., la capacite de bloquer partiellement ou totalement, lorsqu'ils sont utilisés conjointement, I'activité anti-HlV des chemokines.
L'article de Cocchi et al. précité ne contient pas de donnees expérimentales sur le rôle et le stade de l'intervention des chemokines o dans le contrôle de l'infection par un rétrovirus VIH.
Les auteurs de la présente demande se sont intéressés a l'effet que peuvent exercer les chemokines sur la réplication du retrovirus VIH et après avoir vérifié l'effet anti-viral des molécules telles que RANTES, MlP1a et MIP1~ vis-à-vis de HIV, les inventeurs de la présente demande 15 se sont interessés au mécanisme biologique permettant l'interférence de chemokines avec la replication du rétrovirus VIH dans les Iymphocytes T.
De façon surprenante, les inventeurs ont caractérisé des composés, dépourvus des activites biologiques des chemokines et ayant perdu notamment l'activite chemo-attractive des chemokines vis-à-vis des 20 cellules de type leucocytes, en particulier des Iymphocytes ou des monocytes, composés susceptibles néanmoins de jouer un rôle dans le contrôle, voire l'inhibition, des effets d'une infection virale, en particulier d'une infection de cellules par un rétrovirus de type VIH.
Ainsi, les inventeurs ont mis en évidence que des antagonistes de 25 chemokines, par exemple des antagonistes de chemokines de la famille CXC ou de la famille CC, notamment de RANTES et/ou de MIP et/ou de MCP peuvent s'opposer à la réplication d'isolats primaires du rétrovirus VIH dans des Iymphocytes du sang périphérique (PBL) normaux.
L'invention a donc pour objet un composé antagoniste encore 30 appelé ~ antagoniste ~ d'une ou plusieurs molecules de la famille des CA 022~72 1998-11-19 chemokines pour l'utilisation pour le traitement ou la prévention d'une infection due à un virus et plus particulièrement à un rétrovirus du type VIH. Dans le cadre de cette définition, le composé antagoniste est utilisé
notamment pour la préparation d'un médicament pour la prévention ou le traitement de l'infection due à un retrovirus de type VIH.
Dans le cadre de la présente description, le terme ~ antagoniste ~
fait référence à un composé dont la presence chez un hôte et notamment chez un patient humain, est susceptible d'affecter l'activité d'une ou plusieurs chemokines tout en ayant la capacité d'empêcher ou d'inhiber o une infection virale in vivo ou in vitro; en particulier, un tel antagonistepeut bloquer ou déplacer la liaison d'une ou plusieurs chemokines à un ou plusieurs récepteurs de chemokines, sur des cellules, par exemple, des Iymphocytes, des monocytes ou des macrophages, et, donc le cas échéant de façon indirecte, cet antagoniste est susceptible d'affecter les propriétés s biologiques d'activation cellulaire de ces chemokines. Les propriétés recherchées ainsi définies de cet antagoniste peuvent être avantageusement vérifiées grâce à un test effectue in vitro sur des Iymphocytes PBL normaux stimules par un mitogene et infectés par des isolats primaires de rétrovirus VIH.
Selon la présente demande, on entend par l'expression ~ prévention ou traitement d'une infection due à un rétrovirus de type VIH ~ la capacité
du composé antagoniste précité d'intervenir soit sur la replication virale d'isolats primaires de VIH dans des cellules participant à l'immunité de l'hôte, et en particulier dans des Iymphocytes du sang périphérique, par exemple des Iymphocytes T-normaux. Cette expression englobe également la prévention et le traitement des infections telles que les infections dites opportunistes ou des tumeurs précédant et/ou accompagnant le développement de la maladie SIDA et de ce fait, définies comme maladies reliées a l'infection par un rétrovirus VIH.

CA 022~72 1998-11-19 Le test effectué in vitro sur des Iymphocytes PBL (Iymphocytes du sang périphérique) infectés a l'aide de souches primaires de VIH, est une indication pertinente des propriétés thérapeutiques ou prophylactiques recherchées des antagonistes décrits.
s Le terme ~ VIH ~ comprend les virus et rétrovirus humains ou animaux susceptibles d'induire une immunodeficience, tels que les rétrovirus connus sous les noms de VIH-1 et VIH-2 et notamment les différents isolats caractérisés jusqu'à ce jour, qu'il s'agisse d'isolats primaires ou d'isolats modifiés pour répondre à des contraintes de culture o in vitro. ou des clones HIV infectieux provenant d'isolats primaires.
Les composés antagonistes selon l'invention permettent, dans le cadre du traitement ou de la prévention d'une infection due à un rétrovirus de type VIH, de diminuer la réplication et/ou ia dissémination du rétrovirus dans l'organisme de l'hôte infecte et/ou de corriger le déficit immunitaire résultant de cette infection ou ses manifestations.
~ Selon un premier mode de réalisation de l'invention, I'antagoniste est un compose susceptible d'entrer en competition avec une ou plusieurs chemokines, pour la liaison à un ou plusieurs récepteur(s) cellulaire(s) de cette (ces) dernière(s).
Les molécules appartenant à la famille des chemokines sont connues pour avoir au moins pour certaines d'entre elles, la capacite de lier différents récepteurs cellulaires présents sur les cellules dérivées des lignées Iymphoïde ou myéloïde, et en particulier plusieurs récepteurs présents sur des cellules de type Iymphocytes, monocytes, basophiles, ou eosinophiles.
L'antagoniste utilisable dans le cadre de la présente demande, peut selon un premier mode particulier de réalisation de l'invention, être sélectionné pour sa capacité à interférer avec l'interaction normale entre les chemokines et leur(s) récepteur(s) et en particulier à modifier l'accès, par exemple la reconnaissance conformationnelle d'une ou plusieurs CA 022~72 1998-11-19 chemokines vis-à-vis de son(ses) récepteur(s) ou encore à bloquer la liaison d'une ou plusieurs chemokines avec un ou plusieurs recepteurs cellulaires naturels de ces chemokines.
Avantageusement, cet antagoniste se substitue à une ou plusieurs 5chemokine dans l'activité de liaison à un ou plusieurs recepteurs.
En dépit de l'existence d'une multi-spécificité de liaison des chemokines à des récepteurs celluiaires, I'invention a egalement pour objet selon un autre mode de realisation parti~culier, des composés antagonistes selectionnés pour leur affinité spécifique vis-à-vis d'un orécepteur déterminé ou d'un nombre déterminé de récepteurs de chemokines .
Selon une variante de réalisation de l'invention, I'antagoniste mis en oeuvre est choisi pour sa capacité à deplacer la liaison d'une ou plusieurs chemokines vis-à-vis d'un ou plusieurs recepteurs cellulaires de ces dernieres.
. Selon un mode de réalisation particulierement avantageux de l'invention, I'antagoniste a une activité de compétition avec une ou plusieurs chemokines choisies parmi RANTES, MIP1 a, MIP1~, MCP1, MCP3.
20Des parentés de structures ont été constatées entre les différentes chemokines précitees, en particulier entre les chemokines RANTES et MIP, tant au niveau de la séquence d'acides aminbs formant la structure primaire de ces chemokines que de leurs structures secondaires ou tri-dimensionnelles telles qu'établies par la technique de spectroscopie de 2sRésonnance Magnétique Nucléaire (Wells T.N.C. et al, Journal of Leukocyte ~iology, vol. 59, Janvier 1996, pages 53-60).
Les inventeurs ont constaté que des antagonistes de la molécule RANTES sont par exemple capables de lier les récepteurs de plusieurs chemokines en particulier ceux de RANTES, MCP3 et MCP1. De tels 30antagonistes présentent des propriétés tout-à-fait intéressantes, du fait de CA 022~72 1998-11-19 leur capacité à occuper les sites normalement occupés par RANTES, ladite occupation entralnant une activité anti-virale vérifiable notamment in vitro sur des Iymphocytes normaux infectés par des isolats primaires de ~ VIH.
Un composé antagoniste intéressant dans le cadre de la réalisation de l'invention est par exemple un compose dont la structure est dérivée de la structure d1une chemokine, par exemple d'une chemokine choisie parmi les molécules RANTES, MIP ou MCP définies précédemment.
On peut considerer qu'une structure est dérivée de celle d'une o chemokine lorsque le composé ayant cette structure est différent par exemple dans sa nature, sa composition, sa conformation, par rapport à la chemokine de référence tout en conservant les propriétés de ladite chemokine pour la réalisation de la fonction d'antagoniste définie ci-dessus, par exemple la capacité de se lier à un ou plusieurs récepteurs .
13 De façon particulièrement avantageuse, cet antagoniste est en outre caractérisé en ce qu'il est dépourvu des propriétés biologiques de la chemokine ou des chemokines dont il affecte l'activite.A cet égard, I'invention vise des antagonistes de chemokines dépourvus des propriétés de chemoattraction habituellement reconnues aux chemokines et 20 avantageusement à la molécule RANTES.
D'autres propriétés biologiques peuvent être atténuees voire supprimees dans lesdits antagonistes.
Par exemple, I'antagoniste peut être caractérise en ce qu'il est dépourvu de la capacité de transduction d'un signal dans les cellules 25 auxquelles il est lié par l'intermédiaire d'un ou plusieurs récepteurs déterminés. En d'autres termes, I'antagoniste est caractérisé en ce qu'il ne transduit aucune activité biologique à travers le ou les récepteurs auxquels il est lie. De façon essentielle, cet antagoniste conserve neanmoins l'activité antivirale reconnue a la molécule RANTES, à tout le moins a un CA 022~72 1998-11-19 niveau permettant de réduire la réplication ou la dissémination virale ou leur effet et de façon avantageuse, de l'inhiber.
Outre la diminution, voire la disparition des propriétés chemoattractives dévolues à la molecule native RANTES, un antagoniste selon l'invention peut egalement être caractérisé en ce qu'il est depourvu de la capacite naturelle de la molécule RANTES d'une part à induire la libération ou l'entrée du calcium dans les cellules auxquelles elle est liée par un récepteur et/ou d'autre part, à affecter l'exocytose par relargage d'enzymes à partir de ces cellules.
o Ainsi, I'invention met avantageusement à disposition des molécules ayant des effets anti-viraux d'une ou plusieurs chemokines qui sont néanmoins dépourvues des effets secondaires des chemokines actives.
Un antagoniste interessant selon l'invention peut en outre être caractérisé en ce qu'il s'agit d'un polypeptide dérive d'une chemokine, dont la structure comprend au moins un, voire deux ponts disulfure.
~ Ainsi, selon un mode de realisation préféré de l'invention pour l'utilisation dans le traitement d'une infection due à un rétrovirus ViH, on aura recours à un antagoniste de type polypeptidique, dérivé du polypeptide RANTES répondant à la sequence d'acides aminés représentée à la figure 1, par substitution, addition ou deletion d'au moins un résidu d'acides aminés, ledit antagoniste étant dépourvu des proprietés chemo-attractives des chemokines vis à vis des leucocytes, en particulier des Iymphocytes.
Le terme ~ polypeptide ~ fait référence à une structure d'acides aminés comprenant de 10 à 100, de préference de 10 à 70 acides aminés, laquelle structure peut être utilisee sous forme linéaire ou sous forme conformationnelle. A cet égard, I'invention concerne avantageusement des antagonistes ayant une structure correspondant à la structure conferée par la présence de plusieurs et notamment de deux ponts disulfure telle qu'on CA 022~72 1998-11-19 I'observe dans les cytokines, notamment dans les molécules RANTES, MIP et MCP.
Un polypeptide dérivé du polypeptide RANTES, utilisable dans le cadre de l'invention est par exemple obtenu par delétion de tout ou partie 5 de sa séquence N-terminale et en particulier par délétion de tout ou partie de la séquence comprise entre les residus d'acides aminés 1 et 15 ou entre les acides aminés 1 et 9 ou 1 et 8 (y compris les résidus extrêmes) de la séquence d'acides amines representée a la figure 1 C.
Selon un mode de realisation préféré de l'invention, I'antagoniste o utiiisable pour le traitement ou la prévention d'une infection due a un rétrovirus VIH est un polypeptide répondant à la séquence d'acides aminés suivante (appelée RANTES 9-68 ):

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKKWV
15 REYINSLEMS ou la séquence R8-68suivante, TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKKW
VREYINSLEMS

La suppression de ces résidus diminue les effets de signalisation à
travers les récepteurs de chemokines occupés, tout en gardant i'activite antivirale de cet antagoniste.
Les séquences d'acides aminés sont identifiees par référence au code à une lettre habituellement utilise.
Cet antagoniste peut être utilise sous la forme de sa structure primaire ou sous une forme tri-dimensionnelle par exemple sous une forme reproduisant les caractéristiques essentielles de la structure conformationnelle de la molécule RANTES a tout le moins de la partie de cette molécule impliquée dans la liaison à son ou ses récepteur(s) CA 022~72 1998-11-19 1() cellulaire(s). Cette structure a été rapportée dans l'article de Wells T.N.C.
précité et de Chung C.W. (Biochemistry 34, 9307-9314).
Alternativement ou au contraire selon une caractéristique supplémentaire, I'antagoniste utilisable dans le cadre de l'invention est un polypeptide dérivé du polypeptide RANTES lequel est representé par sa séquence d'acides amines à la figure 1 C, par délétion de tout ou partie de sa séquence C-terminale comprise entre les résidus d'acides aminés 50 et 68, de préférence 60 et 68 de la séquence représentée à la figure 1 C.
Un antagoniste dérivé du polypeptide RANTES par substitution ou o par mutation peut alternativement être caractérise en ce que environ 5% à
environ 10% des résidus d'acides aminés, à l'exception des résidus cystéine impliqués dans la formation de ponts disulfure, sont remplacés.
Les résidus d'acides aminés substitués peuvent l'être par des acides aminés neutres, ou constituant une substitution conservatrice ou 15 choisis le cas échéant en tenant compte de l'encombrement stérique.
A titre d'exemple des residus Iysine peuvent être remplaces par des résidus isoleucine, leucine ou valine.
A titre d'exemple, de tels antagonistes utilisables pour la réalisation de l'invention répondent à l'une des séquences d'acides aminés 20 suivantes:

MPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKKW
VREYINSLEMS

REYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLWV
RQYINSLQMS

CA 022~s~72 1998-11-19 PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLWV
AQYINSLQMS

MTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKK

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPELLW
VREYINSLEMS

o TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VRQYINSLQMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VAQYINSLQMS

Selon une variante de l'invention, I'antagoniste mis en oeuvre est caractérisé en ce qu'il s'agit d'une molécule RANTES dont l'extrémité N-terminale a éte allongée par addition d'au moins un résidu d'acide aminé
ou alternativement d'une molécule RANTES dont les extrémités N- et C-20 terminales ou dont les séquences internes à ces régions N- ou C-terminales ont été allongées par addition d'un ou plusieurs résidus d'acides aminés dans des conditions permettant d'obtenir l'effet antagoniste recherché.
L'invention a egalement pour objet une séquence de nucléotides 25 comprenant une sequence codant pour un polypeptide dérive du polypeptide F~ANTES repondant à la séquence d'acides aminés représentée à la figure 1, par delétion de tout ou partie de la sequence N-terminale de ce dernier.

CA 022~72 1998-11-19 Selon un mode de réalisation avantageux de l'invention, cette séquence code pour un polypeptide antagoniste tel qu'il a été défini dans les pages précédentes.
De façon préférée, la séquence de nucléotides est caractérisée en s ce qu'elle répond à l'enchaînement suivant:

CCCTGCTGCTT TGCCTACATT GCCCGCCCAC TGCCCCGTGC
CCACATCAAG GAGTATTTCT ACACCAGTGG CMGTGCTCC
AACCCAGCAG TCGTCTTTGT CACCCGAAAG MCCGCCAAG

CAACTCTTTG GAGATGAGCT AG
ou à l'enchainement suivant:

ACACCCTGCTGCTT TGCCTACATT GCCCGCCCAC TGCCCCGTGC

AACCCAGCAG TCGTCTTTGT CACCCGAMG MCCGCCMG
TGTGTGCCAA CCCAGAGMG AMTGGGTTC GGGAGTACAT
CAACTCTTTG GAGATGAGCT AG

Une sequence de nucleotides selon l'invention peut le cas echeant comprendre également des séquences exogènes, notamment des sequences de régulation et/ou d'activation capables de contrôler et/ou de réguler l'expression de la séquence codant pour un antagoniste selon 25 I'invention dans une cellule hôte, in vitro ou in vivo.
Elle peut également être recombinee avec une autre séquence codante susceptible d'exprimer dans un hôte cellulaire un polypeptide d'intérêt, notamment dans le but de traiter ou de prevenir une infection due à un retrovirus VIH ou avec une séquence codante pouvant remplir la 30 fonction de molécule porteuse. Par exemple, une séquence de nucléotides de l'invention peut être fusionnée avec tout ou partie d'une séquence codant pour la ,~-galactosidase. Dans ce cas, la séquence codante de la ~-galactosidase contient avant le premier codon correspondant au premier CA 022~72 1998-11-19 acide aminé proline de la molécule R9-68 ou R8-68, une séquence peptidique du type X-glycyl-L-propyl, reconnue spécifiquement par une collagénase, permettant ainsi la réalisation d'une coupure spécifique après le residu glycine du polypeptide formé, libérant l'antagoniste. Cette technique est décrite dans la demande de brevet européen 0115974.
Selon un autre mode de réalisation de l'invention, la séquence de nucléotides est caractérisée en ce qu'elle est inserée dans un vecteur d'expression ou adsorbée sur un support susceptible d'être internalisé
dans une cellule eucaryote ou encore dans une bactérie capable d'entrer o dans des cellules eucaryotes telle que Shigella selon le procédé decrit par Courvalin P. et al. (C.R. Acad. Sci. Paris, 1995, 318:1207-12). Ce vecteur est avantageusement choisi pour permettre l'expression in vitro dans un hôte cellulaire, d'un antagoniste tel que defini précedemment ou pour permettre l'expression in vivo chez un hôte auquel il est administre, notamment chez un patient infecté par un rétrovirus VIH, à des fins d'expression transitoire ou continue d'un antagoniste tel que défini dans les pages qui précedent.
Les séquences de nucléotides ainsi definies dans le cadre de l'invention sont par exemple utilisables dans le cadre d'un protocole de thérapie génique visant à prévenir ou à traiter une infection due a un rétrovirus VIH. A cet égard, on pourra avoir recours à des vecteurs utilisables dans le cadre de ces therapies, tels que ceux décrits dans les demandes de brevet internationales publiées sous les numéros WO
95/14785 et WO 94124298.
Ces séquences de nucléotides peuvent aussi être administrees en faisant appel aux techniques décrites dans le brevet FR 2711670 ou dans la demande de brevet internationale WO 90/11092, pour l'expression in vivo.
De façon genérale, et compte tenu des caractéristiques particulières de l'infection par un rétrovirus VIH, on peut avoir recours à des vecteurs CA 022~72 1998-11-19 permettant l'administration ou le relargage contrôlé voire retardé de ces séquences nucléotidiques ou de leur produit d'expression chez l'hôte traité, afin d'obtenir un effet antiviral continu ou itératif à tout le moins sur une période suffisante pour diminuer voire inhiber l'infection par le 5 rétrovirus ou ses effets. A cet égard, des techniques telles que celles faisant appel à l'utilisation d'un gel de phosphate de calcium peuvent être utilisées pour obtenir un relargage avec effet retard d'un produit actif. De telles techniques sont par exemple décrites dans le brevet français 2 543 439.
Des séquences reconnues par des protéases cellulaires ou extracellulaires peuvent être utilisees pour permettre la production de formes matures des molécules antagonistes de RANTES à partir de ces vecteurs. La forme mature de la proteine RANTES est en effet produite après clivage d'une séquence de 23 acides aminés situés en amont du s premier residu (serine) de la forme active de la protéine.
Les taux sériques à atteindre chez les patients traités seraient de l'ordre de 1 à 100 nM.
L'invention a également pour objet un polypeptide correspondant au produit d'expression dans une cellule hôte, par exemple une cellule 20 bactérienne ou une cellule eucaryote, notamment une cellule de levure, une cellule de mammifère, par exemple CHO, d'une séquence de nucléotides telle que définie précédemment.
Un polypeptide particulier est un polypeptide caractérisé en ce qu'il répond à l'une des séquences d'acides aminés suivantes:
2s MPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANP{~KKW
VREYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPELLWV

CA 022~72 1998-11-19 PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW\/
RQYINSLQMS

5 PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLV\N
AQYINSLQMS

MTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKK
V\NREYINSLEMS

TPCCFAYlARPLPRAHiKEYFYTSGKCSNPAWFVTRKNRQVCANPELLW
VREYINSLEMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VRQYINSLQMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VAQYINSLQMS

Un autre polypeptide antagoniste utilisable dans le cadre de l'invention est par exemple un poiypeptide RANTES modifié par addition d'un ou plusieurs résidus d'acides aminés en amont de son extrémite N-terminale. Par exemple, I'addition d'une méthionine en amont du premier résidu (sérine) de la forme mature de RANTES presenterait l'avantage d'inhiber la capacité chemoattractive de la chemokine tout en conservant sa capacité d'inhibition de l'infection virale, grâce à sa capacité non modifiée à se lier spécifiquement a son recepteur.
La production de molécules modifiees de RANTES ou d'autres polypeptides antagonistes peut être réalisée par synthèse chimique ou par CA 022~72 1998-11-19 recombinaison et expression dans une cellule procaryote ou eucaryote par exemple dans la levure ou chez E coli.
Selon un autre mode de réalisation avantageux de l'invention, le polypeptide est un antagoniste d'une ou plusieurs chemokines choisies 5 parmi RANTES, MIP ou MCP, caractérisé en ce qu'il est dérivé du polypeptide RANTES répondant à la sequence d'acides aminés représentée à la figure 1, par substitution, addition ou déletion d'au moins un résidu d'acides aminés, ledit antagoniste étant dépourvu des propriétés chemoattractives des chemokines par exemple vis-à-vis des leucocytes, en o particulier des Iymphocytes, ledit polypeptide étant sous forme d'un polypeptide de fusion, capable de lier le(les) récepteurs cellulaires de RANTES et/ou MIP etlou MCP.
Les polypeptides de l'invention peuvent être prépares par génie génétique ou par synthèse chimique par exemple sur un appareil (Applied S Biosystems) ou par synthèse sur phase solide décrite par Merrifiel, par exemple selon la technique décrite dans la demande WO 95/09868.
L'invention vise également une composition caractérisée en ce qu'elle comprend pour l'administration séparee ou simultanée un composé
antagoniste d'une ou plusieurs molécules de la famille des chemokines 20 telles que définies précédemment, et un ou plusieurs agents actifs susceptibles d'être utilisés dans le traitement d'une infection par un rétrovirus VIH, par exemple un agent utilisable en chimiothérapie tel qu'un composé anti-transcriptase inverse ou anti-protéase virale ou un composé
tel qu'un antagoniste du récepteur CD4 présent sur des Iymphocytes de 2s patients infectés par un rétrovirus VIH ou encore un composé utilisable en immunothérapie, par exemple une cytokine et notamment l'interleukine 2.
Le cas échéant, ladite composition comprend, outre le composé
antagoniste d'une ou plusieurs chemokines et une ou plusieurs substances actives en chimiothérapie antivirale,ettou un agent de traitement des CA 022~72 1998-11-19 infections opportunistes se développant lors de l'infection par un rétrovirus VIH ou lors de l'évolution de l'infection in vivo.
Les produits définis dans l'invention, qu'il s'agisse des antagonistes ou des séquences de nucleotides codant pour de tels antagonistes, le cas 5 échéant en combinaison avec d'autres éléments, sont utilisables pour le traitement de patients à tous les stades de l'infection par un retrovirus de type VIH et notamment pour le traitement des enfants nes de meres séropositives ou des personnels soignants contamines accidentellement.
Les composés de l'invention peuvent être à cet egard administrés par o injection par voie intraveineuse par exemple par perfusion, par voie intramusculaire ou sous-cutanée. Dans le cas de l'utilisation en thérapie génique des composés décrits dans l'invention, on pourra avoir recours a des cellules du patient, par exemple des fibroblastes, myoblastes ou cellules hématopoïétiques traitées avec des vecteurs appropriés contenant 15 les sequences nucléotidiques de l'invention, ces cellules étant ensuite réimp~antées chez le patient pour l'expression des susdites séquences de nucléotides.
L'efficacité du traitement ainsi effectue peut être evaluée en contrôlant et en suivant la charge virale, plasmatique et cellulaire et en 20 examinant l'évolution du nombre de Iymphocytes porteurs de récepteurs CD4, ainsi que le statut immunologique et inflammatoire du patient.
D'autres caractéristiques et avantages de l'invention apparaîtront dans les exemples et la figure qui suivent.

2s Fiqure 1: Séquence de nucléotides et d'acides aminés de RANTES.
A: Séquence de cDNA comprenant la séquence codante B: Séquence codante de la protéine RANTES mature C: Séquence d'acides aminés de RANTES.

CA 022~72 1998-11-19 WO 97t44462 PCT/FR97/00900 Fiqure 2: Séquence de nucléotides et d'acides aminés des polypeptides R9-68 et R8-68 et de polypeptides substitués.
A: Séquence codante de R9-68 et de R8-68 B: Séquence des polypeptides R9-68 et R8-68 C: (a) (b) (c) Séquence des polypeptides R9-68 et R8-68 substitués dans la partie C-terminale.

EXEMPLES
o Evaluation de l'activite antivirale de l'antagoniste RANTES 9-68 Un antagoniste de la chemokine RANTES a été défini et obtenu sous la forme d'un polypeptide tronqué dont la séquence d'acides aminés correspond aux résidus d'acides aminés 9 à 68 de la sequence d'acides aminés de la molecule RANTES telle que définie à la figure 1.
L'antagoniste RANTES 9-68 a été produit en utilisant la technique décrite dans la publication de Gong JH et al (J B C vol 271 N18, issue of may 3, 1996 p 10521 -10527).
Il a eté utilise à des concentrations variables de 1000 nM à 10 nMet a été
ajouté à des cultures cellulaires après infection par différents isolats de VIH. A cet effetl un clone d'un isolat primaire obtenu a partir du fluide cérébrospinal d'un patient atteint de SIDA (désigné par VIH JR-CSF
Koganagi Y et al Science 236: 819, 1987 et Cann AJ et al, J Virol 64:
4735, 1990) a éte utilisé ainsi qu'un clone PYU2 correspondant a une souche primaire de VIH ayant un tropisme pour ies Iymphocytes T et les monocytes et isolé à partir du cerveau (Li et al, J. Virol., 1992, vol 66-6587). Pour obtenir le clone JR-CSF, I'ADN proviral a ete transfecté dans des cellules COS7 et le surnageant obtenu après trois jours de la culture transfectée contenant les particules infectieuses a été utilisé pour infecter des PBL.

CA 022~72 1998-11-19 La capacité antivirale de R9-68 mise en évidence dans des cellules infectées par HIV pYU2 et HIV JR-CSF était similaire à celle de MlP1a En effet, des niveaux de suppression de la réplication virale supèrieurs ou égaux à 95% des cultures contrôles infectées ont été obtenus à la concentration de 10nM, la plus faible concentration de MlP1a a induire un tel effet suppresseur sur la réplication de HIV-JR-CSF ou HlV-pYU2 o Les propriétés antivirales de l'antagoniste R9-68 ont éte testées en déterminant la capacite de cet antagoniste à bloquer la réplication du virus VIH.
La capacité d'une molécule à bloquer la réplication du virus VIH a pu être testee en utilisant la technique mettant en oeuvre des leucocytes isolés sur un gradient de Ficoll à partir de donneurs sains, lesquels leucocytes ont été infectés in vitro avec des isolats viraux primaires, incapables de se repliquer dans des lignées cellulaires transformées.
~ A cet égard, des cellules de six donneurs difféfents, le plus souvent des blastes induits par un traitement à la phytohémaglutinine (PHA) pendant 48 à 72 heures ont été infectés pendant 2 ou 3 heures avec les isolats de VIH. La quantité d'inoculum viral a été estimee par quantification de la protéine GAG P24 et s'est avéree être comprise entre 150 à 5000 picogrammes pour 10 000 000 de cellules. Après des lavages pour éliminer les particules virales residuelles, les cellules ont éte cultivées sur 2~ des microplaques de 96 puits (2 x 105/200 microlitres) en présence des molécules testées purifiées dans un milieu de culture enrichi en interleukine 2. Les surnageants de culture ont éte collectés périodiquement et les cultures cellulaires ont éte repiquées avec des milieux frais et les molécules testées. Dans certains cas, les blastes traites avec la PHA ont également été ajoutés pour apporter à la culture infectée CA 022~72 1998-ll-l9 des cellules fraîches servant de cible pour VIH. La réplication virale a été
mesurée en utilisant le kit ELISA P24 (Dupont de Nemours) (seuil de détection: 3 pg/ml).
Ainsi, pour un des donneurs les celluJes infectées par pYU2 et traitées avec R9-68 à la concentration de 1000nM ont produit 7 pg/ml de protéine p24 au jour 11 (76 et 24 pg/ml aux jours 6 et 8 respectivement).
La protéine p24 n'a pas été détectée dans les cultures de ce même donneur infectees par JR-CSF en présence de R9-68 au jour 11 (62 et 15 pg/ml ont été détectés aux jours 6 et 8 respectivement). Des cultures o contrôles infectées par pYU2 et JR-CSF mais non traitées par R9-68 ont montré une réplication virale intense qui a généré 7 ng/ml et 113 ng/ml de protéine P24 au jour 11 respectivement. Au contraire de R9-68, I'antagoniste MR-IL8 (1000 nM de la protéine IL8 était dépourvu d'effet antiviral.
Pour approfondir la connaissance des mécanismes d'interférence dans. Ia réplication du VIH, induits par R9-68, des expériences visant l'analyse de l'internalisation de particules infectieuses et la rétrotranscription de l'ARN viral génomique en ADN proviral ont été
realisées.
Après infection par la souche JR-CSF de cellules mononuclées du sang activées par la PHA, en présence ou en l'absence de 100nM de R9-68, des extractions d'ADN ont été pratiquées 3h post-infection, ou d'ADN
20h post-infection. Les cultures infectées en présence de R9-68 ont eté
maintenues en présence de la molécule iusqu'à extraction de l'ARN ou de I'ADN. Par des techniques d'amplification par PCR soit du RNA g~enomique rétrotranscrit in vitro, soit de l'ADN proviral, une légère diminution de l'accumulation de RNA génomique viral intracellulaire a éte mise en evidence dans les cellules traitées par R9-68 par rapport aux contrôles de cellules infectées mais non traitées. En revanche l'analyse de l'ADN
proviral a révélé une profonde diminution du signal spécifique dans les CA 022~72 1998-11-19 cellules infectees en présence de R9-68. La spécificité du signal obtenu de I'ADN proviral était démontrée par son abolition dans des cellules infectées et traitées par l'inhibiteur de la réverse transcriptase virale, 3'-azido-3'deoxythimidine (AZT). Des résultats comparables ont eté obtenus s avec RANTES dans des experiences réalisées en parallèie avec celles ci-dessus décrites.
Ces résultats indiquent que l'interférence de R9~68 et aussi celle de RANTES, dans la réplication de l'isolat primaire HIV-JR-CSF aurait lieu précocément mais de preférence après internalisation du virus.
o Des données similaires concernant l'activité antivirale des chemokines RANTES et MIP1 a ou de l'antagoniste R9-68 ont été
obtenues lorsque des blastes traités avec la PHA provenant d'un autre donneur ont été infectés avec l'isolat JR-CSF ayant subi deux semaines de passage dans des cultures de PBL traitées avec l'IL2.
Dans tous les cas la viabilité des cellules traitées avec R9-68 ou avec RANTES était comparable à celle des cultures controles infectées mais non traitees Les méthodes de mesure ont ét faite en comparaison des thymidines tritiées ou du contage direct du nombre de cellules à la fin des pèriodes de culture. 2 PCT / FR97 / 00900 USE OF ANTAGONIST MOLECULES OF CHEMOKINES
FOR THEIR ANTIVIRAL ACTIVITY, PARTICULARLY AGAINST A
HIV TYPE RETROVIRUSES.

The present application relates to the use of compounds antagonists of molecules of the chemokine family or antagonists of chemokine derivatives having retained all the biological properties of chemokines, said compounds being characterized in that they make it possible to obtain the inhibition of an infection viral or its effects in vitro or in vivo ~ said compounds having preferential titer an anti-viral activity with respect to infections due to retrovirus causing immunodeficiency in a host, and in particular in a human patient, especially HIV or HIV retroviruses (the human immunodeficiency virus).
s Chemokines are molecules of the cytokine family, which have activation properties, especially of family cells leukocytes involving in particular properties chemoattractive, calcium mobilizing properties by increased intracellular calcium and release properties enzymes (exocytosis). These chemokines are known for their role possible as mediators of inflammation.
Chemokines have been described by their structure by their affinity for one or more receptors and by their biological properties in a publication by Baggiolini M. et al (Advances in Immunology (1994), flight. 55, pages 97-179).
A publication by Wells TNC et al (Journal of Leukocyte Biology, flight. 59, January 1996, 53-60) describes the three-dimensional structure of - several chemokines and their specific or non-specific receptors.
Generally, these chemokines are characterized by the presence in their primary structure of conserved cysteine residues (1 to CA 022 ~ 72 1998-11-19 4 residues in particular) on the basis of which several subfamilies were distinguished according to the position of the first two cysteines. These families include those of CXC proteins or CC proteins. The presence of these cysteine residues induces the formation of disulfide bridges.
s Among these chemokines, different molecules have been studied specific. In this regard, mention will be made of the RANTES molecule described in publication of Schall TJ et al. (The Journal of Immunology, August 1, 1988, vol. 141, 1018-1025, No. 3). The RANTES molecule (abbreviation of Regulated upon Activation, Normal T-Express and presumably Secreted) a o was described in this article, in particular using the sequence nucleotide of its complementary DNA and using the sequence amino acids from the open reading phase. Biological properties of RANTES have been described in particular in the article by Baggiolini cited above.
These receptors, specific or not, have been identified in the publication de Wells supra or in the articles to which it refers.
Other chemokines such as MIP chemokines (Macrophage Inflammatory Protein) observed, isolated and purified from mouse macrophages (WOLPE SD et al, J. Ex. Med. (1988), 167-170) have been described in terms of their biological properties in The article by Baggiolini et al. (1994).
Another category of chemokines, called MCP (Monocyte Chemotactic Protein) has been identified from basophils. In the MIP and MCP families, the MIP1 a chemokines are known in particular, MIP1, B, MCP1, MCP2 and MCP3.
In a publication by Cocchi F. et al (Science, 15 Dece ~ "bre 1995, vol. 270, 1811-1815), the authors hypothesized that molecules such as RANTES, MlP1a and MIP1 ~ produced in particular by CD8 ~ T cells could be suppressing factors replication of primary HIV isolates. They thus hypothesized CA 022 ~ 72 1998-11-19 that the RANTES, MlP1a and MIP1 ~ proteins produced by T cells expressing CD8 receptors could participate in control of HIV retrovirus infection as a factor replication suppressor. Antibodies obtained against 5 RANTES or MlP1 chemokines (x or MIP113 have, according to Cocchi et al., The ability to partially or totally block, when used together, the anti-HlV activity of the chemokines.
The article by Cocchi et al. above does not contain data studies on the role and stage of chemokine intervention o in the control of infection by an HIV retrovirus.
The authors of the present request are interested in the effect that can exert chemokines on the replication of the HIV retrovirus and after checking the anti-viral effect of molecules such as RANTES, MlP1a and MIP1 ~ vis-à-vis HIV, the inventors of the present application 15 were interested in the biological mechanism allowing the interference of chemokines with replication of the HIV retrovirus in T lymphocytes Surprisingly, the inventors have characterized compounds, lacking the biological activities of chemokines and having lost notably the chemo-attractive activity of chemokines vis-à-vis 20 leukocyte-like cells, in particular lymphocytes or monocytes, compounds which may nevertheless play a role in control, or even inhibit, the effects of a viral infection, in particular infection of cells with an HIV-type retrovirus.
Thus, the inventors have demonstrated that antagonists of 25 chemokines, e.g. family chemokine antagonists CXC or the CC family, in particular from RANTES and / or MIP and / or MCP can oppose replication of primary retrovirus isolates HIV in normal peripheral blood lymphocytes (PBL).
The subject of the invention is therefore a further antagonistic compound 30 called ~ antagonist ~ of one or more molecules of the family of CA 022 ~ 72 1998-11-19 chemokines for use in the treatment or prevention of infection due to a virus and more particularly to a retrovirus of the type HIV. In the context of this definition, the antagonist compound is used especially for the preparation of a drug for the prevention or treatment of infection due to an HIV retrovirus.
In the context of the present description, the term ~ antagonist ~
refers to a compound whose presence in a host and in particular in a human patient, is likely to affect the activity of one or more multiple chemokines while having the ability to prevent or inhibit o viral infection in vivo or in vitro; in particular, such an antagonist can block or displace the binding of one or more chemokines to one or multiple chemokine receptors, on cells, for example, Iymphocytes, monocytes or macrophages, and, therefore if necessary indirectly, this antagonist is likely to affect the properties s biological cell activation of these chemokines. Properties sought so defined of this antagonist can be advantageously verified by a test carried out in vitro on Normal PBL lymphocytes stimulated by a mitogen and infected with primary HIV retrovirus isolates.
According to the present application, the expression ~ prevention is understood to mean or treatment of HIV retrovirus infection ~ ability of the aforementioned antagonist compound to intervene either on viral replication of primary HIV isolates in cells participating in the immunity of the host, and in particular in peripheral blood lymphocytes, by example of T-normal lymphocytes. This expression also includes prevention and treatment of infections such as so-called infections opportunistic or tumors preceding and / or accompanying AIDS disease development and therefore defined as diseases related to infection with an HIV retrovirus.

CA 022 ~ 72 1998-11-19 The test carried out in vitro on PBL lymphocytes (lymphocytes of the peripheral blood) infected with primary strains of HIV, is a relevant indication of therapeutic or prophylactic properties sought from the antagonists described.
s The term ~ HIV ~ includes human and retroviruses or animals likely to induce immunodeficiency, such as retroviruses known as HIV-1 and HIV-2 and especially different isolates characterized to date, whether isolates primaries or isolates modified to meet culture constraints o in vitro. or infectious HIV clones from primary isolates.
The antagonistic compounds according to the invention allow, in the framework for the treatment or prevention of infection due to a retrovirus HIV type, decrease replication and / or spread of the retrovirus in the host organism infects and / or correct the immune deficiency resulting from this infection or its manifestations.
~ According to a first embodiment of the invention, the antagonist is a compound likely to compete with one or more chemokines, for binding to one or more cellular receptor (s) this (these) last (s).
The molecules belonging to the chemokine family are known to have at least some of them, the ability to bind different cell receptors present on cells derived from Iymphoid or myeloid lines, and in particular several receptors present on cells such as Iymphocytes, monocytes, basophils, or eosinophils.
The antagonist usable within the framework of the present request, can according to a first particular embodiment of the invention, to be selected for its ability to interfere with the normal interaction between chemokines and their receptor (s) and in particular to modify access, for example the conformational recognition of one or more CA 022 ~ 72 1998-11-19 chemokines vis-à-vis its receiver (s) or to block the link of one or more chemokines with one or more receptors natural cell lines of these chemokines.
Advantageously, this antagonist replaces one or more 5chemokine in the activity of binding to one or more receptors.
Despite the existence of a multi-specificity of binding of chemokines to cell receptors, the invention also relates to object according to another particular embodiment, particularly compounds antagonists selected for their specific affinity for a determined receptor or a determined number of receptors for chemokines.
According to an alternative embodiment of the invention, the antagonist set work is chosen for its ability to move the link of one or more chemokines vis-à-vis one or more cellular receptors of these last.
. According to a particularly advantageous embodiment of the invention, the antagonist has a competitive activity with one or several chemokines chosen from RANTES, MIP1 a, MIP1 ~, MCP1, MCP3.
20Kins of structures have been observed between the different above-mentioned chemokines, in particular between the RANTES chemokines and MIP, both at the level of the amino acid sequence forming the structure primary of these chemokines as their secondary or tri-dimensions as established by the spectroscopy technique of 2s Nuclear Magnetic Resonance (Wells TNC et al, Journal of Leukocyte ~ iology, vol. 59, January 1996, pages 53-60).
The inventors have found that antagonists of the molecule RANTES are for example capable of binding the receptors of several chemokines in particular those of RANTES, MCP3 and MCP1. Such 30 antagonists have quite interesting properties, due to CA 022 ~ 72 1998-11-19 their ability to occupy sites normally occupied by RANTES, said occupation entailing verifiable anti-viral activity in particular in in vitro on normal lymphocytes infected with primary isolates of ~ HIV.
An antagonistic compound interesting in the context of the realization of the invention is for example a compound whose structure is derived from the structure of a chemokine, for example of a chemokine chosen from the RANTES, MIP or MCP molecules defined above.
We can consider that a structure is derived from that of a o chemokine when the compound having this structure is different by example in its nature, its composition, its conformation, compared to the reference chemokine while retaining the properties of said chemokine for performing the antagonist function defined above above, for example the ability to bind to one or more receptors.
13 In a particularly advantageous manner, this antagonist is furthermore characterized in that it lacks the biological properties of the chemokine or chemokines whose activity it affects.
The invention relates to chemokine antagonists lacking properties chemoattraction usually recognized in chemokines and 20 advantageously to the RANTES molecule.
Other biological properties can be reduced or even deleted in said antagonists.
For example, the antagonist can be characterized in that it is lacking the signal transduction capacity in cells 25 to which it is linked via one or more receptors determined. In other words, the antagonist is characterized in that it does not transduces no biological activity through the receptor (s) to which he is linked. Essentially, this antagonist nevertheless retains the antiviral activity recognized by the RANTES molecule, at the very least has a CA 022 ~ 72 1998-11-19 level to reduce viral replication or spread or their effect and advantageously, to inhibit it.
In addition to the decrease or even disappearance of the properties chemoattractives devolved to the native molecule RANTES, an antagonist according to the invention can also be characterized in that it is not provided of the natural capacity of the RANTES molecule on the one hand to induce release or entry of calcium into the cells to which it is linked by a receptor and / or on the other hand, to affect exocytosis by salting out enzymes from these cells.
o Thus, the invention advantageously provides molecules having anti-viral effects from one or more chemokines which are nevertheless devoid of the side effects of active chemokines.
An interesting antagonist according to the invention can also be characterized in that it is a polypeptide derived from a chemokine, of which the structure comprises at least one, or even two disulfide bridges.
~ Thus, according to a preferred embodiment of the invention for use in the treatment of an infection caused by an HIV retrovirus, will use a polypeptide type antagonist, derived from RANTES polypeptide responding to the amino acid sequence shown in Figure 1, by substitution, addition or deletion of at least an amino acid residue, said antagonist being devoid of the properties chemo-attractants of chemokines towards leukocytes, in particular Lymphocytes.
The term ~ polypeptide ~ refers to an acid structure amines comprising from 10 to 100, preferably from 10 to 70 amino acids, which structure can be used in linear form or in form conformational. In this regard, the invention advantageously relates to antagonists having a structure corresponding to the structure conferred by the presence of several and in particular of two disulfide bridges such that CA 022 ~ 72 1998-11-19 Observed in cytokines, especially in RANTES molecules, MIP and MCP.
A polypeptide derived from the RANTES polypeptide, usable in the framework of the invention is for example obtained by deletion of all or part 5 of its N-terminal sequence and in particular by deletion of all or part of the sequence between amino acid residues 1 and 15 or between amino acids 1 and 9 or 1 and 8 (including extreme residues) of the amino acid sequence shown in Figure 1 C.
According to a preferred embodiment of the invention, the antagonist o Usable for the treatment or prevention of an infection due to a HIV retrovirus is a polypeptide responding to the amino acid sequence following (called RANTES 9-68):

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKKWV
15 REYINSLEMS or the following sequence R8-68, TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKKW
VREYINSLEMS

The removal of these residues decreases the signaling effects at through the busy chemokine receptors, while keeping the activity antiviral of this antagonist.
The amino acid sequences are identified by reference to one-letter code usually used.
This antagonist can be used in the form of its structure primary or in a three-dimensional form for example in a form reproducing the essential characteristics of the structure conformational of the RANTES molecule has at the very least the part of this molecule involved in the binding to its receptor (s) CA 022 ~ 72 1998-11-19 1 () cell (s). This structure was reported in the Wells TNC article.
supra and Chung CW (Biochemistry 34, 9307-9314).
Alternatively or on the contrary according to a characteristic additional, the antagonist usable in the context of the invention is a polypeptide derived from the RANTES polypeptide which is represented by its amino acid sequence in FIG. 1C, by deletion of all or part of its C-terminal sequence comprised between the amino acid residues 50 and 68, preferably 60 and 68 of the sequence shown in Figure 1 C.
An antagonist derived from the RANTES polypeptide by substitution or o by mutation can alternatively be characterized in that approximately 5% to approximately 10% of amino acid residues, except for residues cysteine involved in the formation of disulfide bridges, are replaced.
The substituted amino acid residues can be substituted by neutral amino acids, or constituting a conservative substitution or 15 chosen if necessary, taking into account the steric hindrance.
For example, Iysine residues can be replaced by isoleucine, leucine or valine residues.
By way of example, such antagonists usable for the realization of the invention respond to one of the amino acid sequences Following 20:

MPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKKW
VREYINSLEMS

REYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLWV
RQYINSLQMS

CA 022 ~ s ~ 72 1998-11-19 PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLWV
AQYINSLQMS

MTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKK

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPELLW
VREYINSLEMS

o TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VRQYINSLQMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VAQYINSLQMS

According to a variant of the invention, the antagonist used is characterized in that it is a RANTES molecule whose N- end terminal was extended by adding at least one amino acid residue or alternatively of a RANTES molecule whose N- and C- ends 20 terminal or whose sequences internal to these N- or C- regions terminals have been lengthened by adding one or more residues amino acids under conditions allowing the effect to be obtained antagonist sought.
The invention also relates to a nucleotide sequence 25 comprising a sequence coding for a polypeptide derived from F ~ ANTES polypeptide responding to the amino acid sequence represented in figure 1, by deletion of all or part of the sequence N-terminal of the latter.

CA 022 ~ 72 1998-11-19 According to an advantageous embodiment of the invention, this sequence code for an antagonistic polypeptide as defined in the previous pages.
Preferably, the nucleotide sequence is characterized by s what it responds to is the following sequence:

CCCTGCTGCTT TGCCTACATT GCCCGCCCAC TGCCCCGTGC
CCACATCAAG GAGTATTTCT ACACCAGTGG CMGTGCTCC
AACCCAGCAG TCGTCTTTGT CACCCGAAAG MCCGCCAAG

CAACTCTTTG GAGATGAGCT AG
or in the following sequence:

ACACCCTGCTGCTT TGCCTACATT GCCCGCCCAC TGCCCCGTGC

AACCCAGCAG TCGTCTTTGT CACCCGAMG MCCGCCMG
TGTGTGCCAA CCCAGAGMG AMTGGGTTC GGGAGTACAT
CAACTCTTTG GAGATGAGCT AG

A nucleotide sequence according to the invention can if necessary also include exogenous sequences, including regulatory and / or activation sequences capable of controlling and / or regulate the expression of the sequence coding for an antagonist according to 25 the invention in a host cell, in vitro or in vivo.
It can also be recombined with another sequence coding capable of expressing in a cellular host a polypeptide of interest, particularly for the purpose of treating or preventing an infection due to an HIV retrovirus or with a coding sequence capable of fulfilling the 30 carrier molecule function. For example, a nucleotide sequence of the invention can be merged with all or part of a sequence coding for, ~ -galactosidase. In this case, the coding sequence for ~ -galactosidase contains before the first codon corresponding to the first CA 022 ~ 72 1998-11-19 amino acid proline of the molecule R9-68 or R8-68, a sequence peptide of the X-glycyl-L-propyl type, specifically recognized by a collagenase, thus allowing the realization of a specific cut after the glycine residue of the polypeptide formed, releasing the antagonist. This technique is described in European patent application 0115974.
According to another embodiment of the invention, the sequence of nucleotides is characterized in that it is inserted into a vector of expression or adsorbed on a medium capable of being internalized in a eukaryotic cell or in a bacteria capable of entering o in eukaryotic cells such as Shigella according to the method described by Courvalin P. et al. (CR Acad. Sci. Paris, 1995, 318: 1207-12). This vector is advantageously chosen to allow expression in vitro in a cell host, an antagonist as defined above or for allow in vivo expression in a host to which it is administered, especially in a patient infected with an HIV retrovirus, for transient or continuous expression of an antagonist as defined in the preceding pages.
The nucleotide sequences thus defined in the context of the invention can for example be used in the context of a gene therapy to prevent or treat an infection due to a HIV retrovirus. In this regard, we can use vectors usable within the framework of these therapies, such as those described in the international patent applications published under WO numbers 95/14785 and WO 94124298.
These nucleotide sequences can also be administered in using the techniques described in patent FR 2711670 or in international patent application WO 90/11092, for the expression in vivo.
Generally, and taking into account the particular characteristics of HIV retrovirus infection, vectors can be used CA 022 ~ 72 1998-11-19 allowing the administration or the controlled or even delayed release of these nucleotide sequences or their expression product in the host treated, in order to obtain a continuous or iterative antiviral effect at least on sufficient time to decrease or even inhibit infection with 5 retrovirus or its effects. In this regard, techniques such as those involving the use of a calcium phosphate gel can be used to obtain a delayed release of an active product. Of such techniques are for example described in French patent 2,543 439.
Sequences recognized by cellular proteases or extracellular can be used to allow the production of mature forms of the antagonistic molecules of RANTES from these vectors. The mature form of the RANTES protein is indeed produced after cleavage of a sequence of 23 amino acids located upstream of the s first residue (serine) of the active form of the protein.
The serum levels to be achieved in treated patients would be in the range of 1 to 100 nM.
The subject of the invention is also a polypeptide corresponding to the expression product in a host cell, for example a cell 20 bacterial or a eukaryotic cell, in particular a yeast cell, a mammalian cell, for example CHO, of a sequence of nucleotides as defined above.
A particular polypeptide is a polypeptide characterized in that it responds to one of the following amino acid sequences:
2s MPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANP {~ KKW
VREYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPELLWV

CA 022 ~ 72 1998-11-19 PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW \ /
RQYINSLQMS

5 PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLV \ N
AQYINSLQMS

MTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKK
V \ NREYINSLEMS

TPCCFAYlARPLPRAHiKEYFYTSGKCSNPAWFVTRKNRQVCANPELLW
VREYINSLEMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VRQYINSLQMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VAQYINSLQMS

Another antagonist polypeptide which can be used in the context of the invention is for example a RANTES poiypeptide modified by addition one or more amino acid residues upstream of its N- extremity terminal. For example, the addition of a methionine upstream of the first residue (serine) of the mature form of RANTES would have the advantage to inhibit the chemoattractive capacity of chemokine while retaining its ability to inhibit viral infection, thanks to its ability not modified to specifically bind to its receptor.
The production of modified molecules from RANTES or others Antagonistic polypeptides can be produced by chemical synthesis or by CA 022 ~ 72 1998-11-19 recombination and expression in a prokaryotic or eukaryotic cell by example in yeast or in E coli.
According to another advantageous embodiment of the invention, the polypeptide is an antagonist of one or more selected chemokines 5 among RANTES, MIP or MCP, characterized in that it is derived from RANTES polypeptide responding to the amino acid sequence shown in Figure 1, by substitution, addition or deletion of at least an amino acid residue, said antagonist having no properties chemoattractive chemokines for example against leukocytes, in o particular of lymphocytes, said polypeptide being in the form of a fusion polypeptide, capable of binding the cellular receptor (s) of RANTES and / or MIP etlou MCP.
The polypeptides of the invention can be engineered genetic or by chemical synthesis for example on a device (Applied S Biosystems) or by synthesis on solid phase described by Merrifiel, by example according to the technique described in application WO 95/09868.
The invention also relates to a composition characterized in that that it comprises for separate or simultaneous administration a compound antagonist of one or more molecules of the chemokine family 20 as defined above, and one or more active agents likely to be used to treat infection with a HIV retrovirus, for example an agent usable in chemotherapy such as anti-reverse transcriptase or anti-viral protease compound or a compound such as a CD4 receptor antagonist present on lymphocytes of 2s patients infected with an HIV retrovirus or a compound usable in immunotherapy, for example a cytokine and in particular interleukin 2.
Where appropriate, said composition comprises, in addition to the compound antagonist of one or more chemokines and one or more substances active in antiviral chemotherapy, and a treatment agent for CA 022 ~ 72 1998-11-19 opportunistic infections that develop during infection with a retrovirus HIV or during the course of infection in vivo.
The products defined in the invention, whether they are antagonists or nucleotide sequences encoding such antagonists, if applicable 5 if necessary in combination with other elements, can be used for treatment of patients at all stages of infection with a retrovirus type HIV and in particular for the treatment of children born to mothers HIV positive or accidentally contaminated caregivers.
In this regard, the compounds of the invention can be administered by o intravenous injection, for example by infusion, by intramuscular or subcutaneous. In the case of use in therapy genes of the compounds described in the invention, recourse may be had to patient cells, e.g. fibroblasts, myoblasts or hematopoietic cells treated with appropriate vectors containing 15 the nucleotide sequences of the invention, these cells then being reprimped in the patient for the expression of the above sequences of nucleotides.
The effectiveness of the treatment thus carried out can be evaluated by controlling and monitoring the viral, plasma and cellular load and by 20 examining the evolution of the number of lymphocytes carrying receptors CD4, as well as the patient's immunological and inflammatory status.
Other characteristics and advantages of the invention will appear in the examples and figure below.

2s Figure 1: Sequence of nucleotides and amino acids of RANTES.
A: cDNA sequence including the coding sequence B: Coding sequence of the mature RANTES protein C: RANTES amino acid sequence.

CA 022 ~ 72 1998-11-19 WO 97t44462 PCT / FR97 / 00900 Figure 2: Nucleotide and amino acid sequence of polypeptides R9-68 and R8-68 and substituted polypeptides.
A: Coding sequence of R9-68 and R8-68 B: Sequence of the R9-68 and R8-68 polypeptides C: (a) (b) (c) Sequence of the R9-68 and R8-68 polypeptides substituted in the C-terminal part.

EXAMPLES
o Evaluation of the antiviral activity of the antagonist RANTES 9-68 A RANTES chemokine antagonist has been defined and obtained in the form of a truncated polypeptide whose amino acid sequence corresponds to amino acid residues 9 to 68 of the acid sequence amines of the RANTES molecule as defined in Figure 1.
The antagonist RANTES 9-68 was produced using the technique described in the publication by Gong JH et al (JBC vol 271 N18, issue of may 3, 1996 p 10521 -10527).
It has been used at varying concentrations from 1000 nM to 10 nM and has been added to cell cultures after infection with different isolates of HIV. For this purpose a clone of a primary isolate obtained from the fluid cerebrospinal of an AIDS patient (designated by HIV JR-CSF
Koganagi Y et al Science 236: 819, 1987 and Cann AJ et al, J Virol 64:
4735, 1990) was used as well as a PYU2 clone corresponding to a primary strain of HIV with a tropism for T cells and monocytes and isolated from the brain (Li et al, J. Virol., 1992, vol 66-6587). To obtain the JR-CSF clone, the proviral DNA was transfected into COS7 cells and the supernatant obtained after three days of culture transfected containing infectious particles was used to infect PBL.

CA 022 ~ 72 1998-11-19 The antiviral capacity of R9-68 demonstrated in cells infected with HIV pYU2 and HIV JR-CSF was similar to that of MlP1a En effect, higher suppression levels of viral replication or equal to 95% of the infected control cultures were obtained at the 10nM concentration, the lowest concentration of MlP1a to induce such a suppressing effect on the replication of HIV-JR-CSF or HlV-pYU2 o The antiviral properties of the antagonist R9-68 have been tested in determining the ability of this antagonist to block replication of the virus HIV.
The ability of a molecule to block the replication of the HIV virus a could be tested using the technique using leukocytes isolated on a Ficoll gradient from healthy donors, which leukocytes were infected in vitro with primary viral isolates, unable to replicate in transformed cell lines.
~ In this regard, cells from six different donors, most often blasts induced by phytohemaglutinin (PHA) treatment for 48 to 72 hours have been infected for 2 or 3 hours with HIV isolates. The quantity of viral inoculum was estimated by quantification of the GAG P24 protein and has been found to be between 150 to 5000 picograms for 10,000,000 cells. After washes for remove residual viral particles, cells were grown on 2 ~ 96-well microplates (2 x 105/200 microliters) in the presence of tested molecules purified in a culture medium enriched with interleukin 2. Culture supernatants were collected periodically and cell cultures were transplanted with fresh media and the molecules tested. In some cases, the blasts milked with PHA were also added to bring to the infected culture CA 022 ~ 72 1998-ll-l9 fresh cells serving as a target for HIV. Viral replication has been measured using the ELISA P24 kit (Dupont de Nemours) (threshold of detection: 3 pg / ml).
Thus, for one of the donors, the cells infected with pYU2 and treated with R9-68 at a concentration of 1000nM produced 7 pg / ml of protein p24 on day 11 (76 and 24 pg / ml on days 6 and 8 respectively).
The p24 protein was not detected in cultures of this same donor infected with JR-CSF in the presence of R9-68 on day 11 (62 and 15 pg / ml were detected on days 6 and 8 respectively). Cultures o controls infected with pYU2 and JR-CSF but not treated with R9-68 have showed intense viral replication which generated 7 ng / ml and 113 ng / ml of P24 protein on day 11 respectively. Unlike R9-68, The antagonist MR-IL8 (1000 nM of the IL8 protein had no effect antiviral.
To deepen knowledge of interference mechanisms in. HIV replication, induced by R9-68, experiments aimed at the analysis of the internalization of infectious particles and the reverse transcription of genomic viral RNA into proviral DNA have been realized.
After infection with the JR-CSF strain of mononuclear cells of the PHA activated blood in the presence or absence of 100nM R9-68, DNA extractions were performed 3h post-infection, or DNA
20h post-infection. Cultures infected in the presence of R9-68 were maintained in the presence of the molecule until extraction of RNA or DNA. By PCR amplification techniques of either genomic RNA
retrotranscribed in vitro, i.e. proviral DNA, a slight decrease in the accumulation of intracellular viral genomic RNA was put in evidence in cells treated with R9-68 compared to controls for infected but untreated cells. However, DNA analysis proviral revealed a profound decrease in the specific signal in CA 022 ~ 72 1998-11-19 infected cells in the presence of R9-68. The specificity of the signal obtained from Proviral DNA was demonstrated by its abolition in cells infected and treated with the reverse viral transcriptase inhibitor, 3'-azido-3'deoxythimidine (AZT). Comparable results have been obtained s with RANTES in experiments carried out in parallel with those described above.
These results indicate that the interference of R9 ~ 68 and also that of RANTES, in the replication of the primary isolate HIV-JR-CSF would take place early but preferably after internalization of the virus.
o Similar data regarding the antiviral activity of RANTES and MIP1 a chemokines or the antagonist R9-68 were obtained when PHA-treated blasts from another donor were infected with the JR-CSF isolate that had undergone two weeks of passage through PBL cultures treated with IL2.
In all cases, the viability of cells treated with R9-68 or with RANTES was comparable to that of infected control cultures but not treated The measurement methods were made in comparison with tritiated thymidines or direct counting of the number of cells at the end of cultivation periods.

Claims (32)

REVENDICATIONS 1. Utilisation d'un composé antagoniste (appelé ~ antagoniste ~) d'une ou plusieurs molécules de la famille des chemokines, pour la préparation d'un médicament pour la prévention ou le traitement d'une infection virale. 1. Use of an antagonist compound (called ~antagonist~) one or more molecules of the chemokine family, for the preparation of a medicament for the prevention or treatment of a viral infection. 2. utilisation selon la revendication 1, caractérisée en ce que l'infection est due à un rétrovirus de type VIH. 2. use according to claim 1, characterized in that the infection is due to an HIV-type retrovirus. 3. Utilisation selon la revendication 1 ou la revendication 2, caractérisée en ce que l'antagoniste est un composé ayant une activité de compétition avec une ou plusieurs chemokines, pour la liaison à un ou plusieurs récepteur(s) cellulaire(s) de cette (ces) dernière(s) ou ayant une activité de blocage de l'accès de la (des) chemokine(s) audit (auxdits) récepteur(s). 3. Use according to claim 1 or claim 2, characterized in that the antagonist is a compound having an activity of competition with one or more chemokines, for binding to one or several cellular receptor(s) of this (these) latter(s) or having a access blocking activity of audit chemokine(s) receiver(s). 4. Utilisation selon l'une quelconque des revendications 1 à 3, caractérisée en ce que l'antagoniste déplace la liaison d'une ou plusieurs chemokine(s) vis à vis d'un ou plusieurs récepteur(s) cellulaire(s) de cette (ces) dernières. 4. Use according to any one of claims 1 to 3, characterized in that the antagonist displaces the binding of one or more chemokine(s) with respect to one or more cellular receptor(s) of this (these last. 5. Utilisation selon l'une quelconque des revendications 1 a 4, caractérisée en ce que l'antagoniste a une activité de compétition avec les chemokines RANTES et/ou MIP1.alpha. et/ou MIP1.beta. et/ou MCP1 et/ou MCP3 ou une activité de blocage de l'accès d'une ou plusieurs de ces chemokines à leur(s) récepteur(s) cellulaire(s). 5. Use according to any one of claims 1 to 4, characterized in that the antagonist has a competitive activity with the RANTES and/or MIP1.alpha chemokines. and/or MIP1.beta. and/or MCP1 and/or MCP3 or activity blocking access to one or more of these chemokines to their cellular receptor(s). 6. Utilisation selon l'une quelconque des revendications 1 à 5, caractérisée en ce que l'antagoniste est un composé dont la structure est dérivée de la structure d'une chemokine. 6. Use according to any one of claims 1 to 5, characterized in that the antagonist is a compound whose structure is derived from the structure of a chemokine. 7. Utilisation selon la revendication 6, caractérisée en ce que la chemokine appartient à la famille des chemokines de type CC. 7. Use according to claim 6, characterized in that the chemokine belongs to the family of CC-type chemokines. 8. Utilisation selon l'une quelconque des revendications 1 à 7, caractérisée en ce que l'antagoniste est un composé dépourvu des propriétés chemoattractives de la (des) chemokine(s) vis-à-vis des leucocytes, en particulier des lymphocytes. 8. Use according to any one of claims 1 to 7, characterized in that the antagonist is a compound lacking the chemoattractive properties of the chemokine(s) with respect to leukocytes, especially lymphocytes. 9. Utilisation selon l'une quelconque des revendications 1 à 7, caractérisée en ce que l'antagoniste est dépourvu des propriétés biologiques essentielles de la (des) chemokines, en particulier est dépourvu de la capacité de transduction de signal à partir d'un ou plusieurs récepteurs. 9. Use according to any one of claims 1 to 7, characterized in that the antagonist lacks the properties biological essentials of the chemokine(s), in particular is lacking the ability to transduce signals from one or multiple receivers. 10. Utilisation selon la revendication 7, caractérisée en ce que l'antagoniste est un polypeptide dérivé d'une chemokine, dont la structure comprend au moins un, voire deux ponts disulfure. 10. Use according to claim 7, characterized in that the antagonist is a polypeptide derived from a chemokine, the structure of which comprises at least one, or even two disulphide bridges. 11. Utilisation selon l'une quelconque des revendications 1 à 10, caractérisée en ce que l'antagoniste est un polypeptide dérivé du polypeptide RANTES répondant à la séquence d'acides amines représentée à la figure 1, par substitution, addition ou délétion d'au moins un résidu d'acides aminés, ledit antagoniste étant dépourvu des propriétés chemoattractives de chemokines vis à vis des leucocytes, en particulier des lymphocytes et étant capable de lier un ou plusieurs récepteur(s) de chemokines . 11. Use according to any one of claims 1 to 10, characterized in that the antagonist is a polypeptide derived from RANTES polypeptide corresponding to the amino acid sequence shown in Figure 1, by substitution, addition or deletion of at least an amino acid residue, said antagonist being devoid of the properties chemoattractants of chemokines with respect to leukocytes, in particular lymphocytes and being capable of binding one or more receptor(s) of chemokines. 12. Utilisation selon la revendication 11 , caractérisée en ce que l'antagoniste est un polypeptide dérive du polypeptide RANTES répondant à la séquence d'acides amines représentée à la figure 1, par délétion de tout ou partie de sa séquence N-terminale comprise entre les résidus d'acides aminés 1 et 15 de la séquence représentée à la figure 1. 12. Use according to claim 11, characterized in that the antagonist is a polypeptide derived from the RANTES polypeptide responding to the amino acid sequence shown in Figure 1, by deletion of all or part of its N-terminal sequence between the residues of amino acids 1 and 15 of the sequence shown in Figure 1. 13. Utilisation selon la revendication 11, caractérisée en ce que l'antagoniste est un polypeptide répondant à l'une des séquences d'acides aminés suivantes:
PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPELLWV
REYINSLEMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPELLVVV
VREYINSLEMS

MPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKVVV
VREYINSLEMS

MTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKK
VVVREYINSLEMS 13. Use according to claim 11, characterized in that the antagonist is a polypeptide corresponding to one of the acid sequences following amines:
PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTKRKNRQVCANPELLWV
REYINSLEMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPELLVVV
VREYINSLEMS

MPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTKRKNRQVCANPEKKVVV
VREYINSLEMS

MTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKK
VVVREYINSLEMS 14. Utilisation selon la revendication 11, caractérisée en ce que l'antagoniste est un polypeptide comprenant la séquence d'acides aminés R9-68 modifiée en position N-terminale par l'addition d'un résidu Glycine et de tout ou partie de la séquence d'acides aminés de la .beta.-galactosidase. 14. Use according to claim 11, characterized in that the antagonist is a polypeptide comprising the amino acid sequence R9-68 modified in the N-terminal position by the addition of a Glycine residue and of all or part of the amino acid sequence of .beta.-galactosidase. 15. Utilisation selon la revendication 11, caractérisée en ce que l'antagoniste est un polypeptide dérivé du polypeptide RANTES répondant à la séquence d'acides aminés représentée à la figure 1, par délétion de tout ou partie de sa séquence C-terminale comprise entre les résidus d'acides aminés 50 et 68. de préférence 60 et 68 de la séquence représentée à la figure 1 15. Use according to claim 11, characterized in that the antagonist is a polypeptide derived from the RANTES polypeptide responding to the amino acid sequence shown in Figure 1, by deletion of all or part of its C-terminal sequence between the residues of amino acids 50 and 68, preferably 60 and 68 of the sequence shown in figure 1 16. Utilisation selon la revendication 11, caractérisée en ce que l'antagoniste est un polypeptide dérivé du polypeptide RANTES répondant à la séquence d'acides aminés représentée à la figure 1, par délétion de tout ou partie de sa séquence N-terminale comprise entre les résidus d'acides aminés 1 et 8 et de tout ou partie de sa séquence C-terminale comprise entre les résidus d'acides aminés 50 et 68, de préférence 60 et 68 de la séquence représentée à la figure 1. 16. Use according to claim 11, characterized in that the antagonist is a polypeptide derived from the RANTES polypeptide responding to the amino acid sequence shown in Figure 1, by deletion of all or part of its N-terminal sequence between the residues of amino acids 1 and 8 and of all or part of its C-terminal sequence between amino acid residues 50 and 68, preferably 60 and 68 of the sequence shown in Figure 1. 17. Utilisation selon l'une quelconque des revendications 11 à 16, caractérisée en ce que l'antagoniste est un dérivé du polypeptide RANTES
répondant à la séquence d'acides aminés représentée à la figure 1, comprenant la substitution ou la mutation d'environ 5% à environ 10% des résidus d'acides aminés à l'exception des résidus cystéine conservés impliqués dans la formation de ponts disulfure. 17. Use according to any one of claims 11 to 16, characterized in that the antagonist is a derivative of the RANTES polypeptide corresponding to the amino acid sequence shown in Figure 1, comprising the substitution or mutation of about 5% to about 10% of the amino acid residues except conserved cysteine residues involved in the formation of disulfide bridges. 18. Utilisation selon la revendication 11, caractérisée en ce que l'antagoniste est un polypeptide dérivé du polypeptide RANTES répondant à la séquence d'acides aminés représentée à la figure 1, par délétion de tout ou partie de sa séquence N-terminale comprise entre les résidus d'acides aminés 1 et 8 et de tout ou partie de sa séquence C-terminale comprise entre les résidus d'acides aminés 50 et 68, de préférence 60 et 68 de la séquence représentée à la figure 1, ledit polypeptide étant en outre modifié par rapport au polypeptide RANTES par substitution d'au moins un résidu d'acide aminé. 18. Use according to claim 11, characterized in that the antagonist is a polypeptide derived from the RANTES polypeptide responding to the amino acid sequence shown in Figure 1, by deletion of all or part of its N-terminal sequence between the residues of amino acids 1 and 8 and of all or part of its C-terminal sequence between amino acid residues 50 and 68, preferably 60 and 68 of the sequence shown in Figure 1, said polypeptide being in further modified with respect to the RANTES polypeptide by substitution of at least one amino acid residue. 19. Utilisation selon la revendication 17, caractérisée en ce que l'antagoniste répond à l'une des séquences d'acides aminés suivantes:
PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPELLWV
REYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPQLLWV
RQYINSLQMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPQLLWV
AQYINSLQMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPELLW
VREYINSLEMS
TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPQLLW
VRQYINSLQMS
TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPQLLW
VAQYINSLQMS 19. Use according to claim 17, characterized in that the antagonist responds to one of the following amino acid sequences:
PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTKRKNRQVCANPELLWV
REYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTKRKNRQVCANPQLLWV
RQYINSLQMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTKRKNRQVCANPQLLWV
AQYINSLQMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPELLW
VREYINSLEMS
TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPQLLW
VRQYINSLQMS
TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPQLLW
VAQYINSLQMS 20. Séquence de nucléotides comprenant une séquence codant pour un polypeptide dérivé du polypeptide RANTES répondant à la séquence d'acides aminés représentée à la figure 1, par délétion de tout ou partie de sa séquence N-terminale, par exemple par délétion des nucléotides codant pour les acides aminés en position 1 à 8 de la séquence du susdit polypeptide RANTES. 20. Nucleotide sequence comprising a coding sequence for a polypeptide derived from the RANTES polypeptide corresponding to the amino acid sequence shown in Figure 1, by deletion of any or part of its N-terminal sequence, for example by deletion of nucleotides coding for the amino acids in position 1 to 8 of the sequence of said RANTES polypeptide. 21. Séquence de nucléotides selon la revendication 20, caractérisée en ce qu'elle code pour un polypeptide antagoniste selon l'une quelconque des revendications 11 à 19. 21. Nucleotide sequence according to claim 20, characterized in that it codes for an antagonist polypeptide according to any of claims 11 to 19. 22. Séquence de nucléotides selon l'une quelconque des revendications 20 ou 21, caractérisée en ce qu'elle répond à l'un des enchaînements suivants:

CCCTGCTGCTT TGCCTACATT GCCCGCCCAC TGCCCCGTGC
CCACATAAG GAGTATTTCT ACACCAGTGG CAAGTGCTCC
AACCAGCAG TCGTCTTTGT CACCCGAAAG AACCGCCAAG
TGTGTGCCAA CCCAGAGAAG AAATGGGTTC GGGAGTACAT
CAACTCTTTG GAGATGAGCT AG

ACACCCTGCTGCTT TGCCTACATT GCCCGCCCAC TGCCCCGTGC
CCACATCAAG GAGTATTTCT ACACCAGTGG CAAGTGCTCC
AACCCAGCAG TCGTCTTTGT CACCCGAAAG AACCGCCAAG
TGTGTGCCAA CCCAGAGAAG AAATGGGTTC GGGAGTACAT
CAACTCTTTG GAGATGAGCT AG 22. Nucleotide sequence according to any of claims 20 or 21, characterized in that it responds to one of the following sequences:

CCCTGCTGCTT TGCCTACATT GCCCGCCCAC TGCCCCGTGC
CCACATAAG GAGTATTTCT ACACCAGTGG CAAGTGCTCC
AACCAGCAG TCGTCTTTGT CACCCGAAAG AACCGCCAAG
TGTGTGCCAA CCCAGAGAAG AAATGGGTTC GGGAGTACAT
CAACTCTTTG GAGATGAGCT AG

ACACCCTGCTGCTT TGCCTACATT GCCCGCCCAC TGCCCCGTGC
CCACATCAAG GAGTATTTCT ACACCAGTGG CAAGTGCTCC
AACCCAGCAG TCGTCTTTGT CACCCGAAAG AACCGCCAAG
TGTGTGCCAA CCCAGAGAAG AAATGGGTTC GGGAGTACAT
CAACTCTTTG GAGATGAGCT AG 23. Séquence de nucléotides selon l'une quelconque des revendications 20 à 22, caractérisée en ce qu'elle est insérée dans un vecteur d'expression. 23. Nucleotide sequence according to any of claims 20 to 22, characterized in that it is inserted in a expression vector. 24. Séquence de nucléotides selon la revendication 23, caractérisée en ce que le vecteur d'expression est susceptible d'être administré chez un patient humain. 24. Nucleotide sequence according to claim 23, characterized in that the expression vector is capable of being administered to a human patient. 25. Utilisation d'une séquence de nucléotides selon l'une quelconque des revendications 20 à 22 pour la préparation d'un médicament pour le traitement d'une infection virale. 25. Use of a nucleotide sequence according to one any one of claims 20 to 22 for the preparation of a medicine for the treatment of a viral infection. 26. Utilisation selon la revendication 25, caractérisée en ce que l'infection est due à un rétrovirus de type VIH. 26. Use according to claim 25, characterized in that the infection is due to an HIV-type retrovirus. 27. Utilisation d'une séquence de nucléotides comprenant une séquence codant pour un polypeptide dérivé du polypeptide RANTES
répondant à la séquence d'acides aminés est représentée à la figure 1, par délétion de tout ou partie de sa séquence N-terminale pour la préparation d'un médicament pour le traitement d'une infection due à un rétrovirus de type VIH. 27. Use of a nucleotide sequence comprising a sequence encoding a polypeptide derived from the RANTES polypeptide corresponding to the amino acid sequence is shown in Figure 1, by deletion of all or part of its N-terminal sequence for the preparation of a medicament for the treatment of an infection due to a retrovirus of HIV type. 28. Polypeptide caractérisé en ce qu'il s'agit du produit d'expression dans une cellule hôte, d'une séquence de nucléotides selon l'une quelconque des revendications 20 à 22. 28. Polypeptide characterized in that it is the expression product in a host cell, of a sequence of nucleotides according to one any of claims 20 to 22. 29. Polypeptide caracterisé en ce qu'il répond à l'une des séquences d'acides aminés suivantes:

MPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKKW
VREYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPELLWV
RFYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLWV
RQYINSLQMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLWV
AQYINSLQMS

MTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKK
WVREYINSLEMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPELLW
VREYINSLEMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VRQYINSLQMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VAQYINSLQMS 29. Polypeptide characterized in that it responds to one of the following amino acid sequences:

MPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKKW
VREYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPELLWV
RFYINSLEMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLWV
RQYINSLQMS

PCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLWV
AQYINSLQMS

MTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPEKK
WVREYINSLEMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPELLW
VREYINSLEMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VRQYINSLQMS

TPCCFAYIARPLPRAHIKEYFYTSGKCSNPAWFVTRKNRQVCANPQLLW
VAQYINSLQMS 30. Polypeptide antagoniste d'une ou plusieurs chemokines choisies parmi RANTES, MIP ou MCP, caractérisé en ce qu'il est dérive du polypeptide RANTES répondant à la séquence d'acides aminés représentée à la figure 1, par substitution, addition ou déletion d'au moins un résidu d'acides aminés, ledit antagoniste étant dépourvu des propriétés chemo-attractives des chemokines vis à vis des leucocytes, en particulier des lymphocytes, ledit polypeptide étant sous forme d'un polypeptide de fusion, capable de lier le(les) récepteurs cellulaires de RANTES et/ou MIP
et/ou MCP. 30. Polypeptide antagonist of one or more selected chemokines among RANTES, MIP or MCP, characterized in that it is derived from RANTES polypeptide corresponding to the amino acid sequence shown in Figure 1, by substitution, addition or deletion of at least an amino acid residue, said antagonist being devoid of the properties chemo-attractants of chemokines with respect to leukocytes, in particular lymphocytes, said polypeptide being in the form of a polypeptide of fusion, capable of binding cellular receptor(s) of RANTES and/or MIP
and/or MCP. 31. Composition caractérisée en ce qu'elle comprend, pour l'administration separée ou simultanée, un composé antagoniste d'une ou plusieurs molécules de la famille des chemokines tel que défini dans l'une quelconque des revendications 1 à 19, et un agent actif dans le traitement ou la prévention d'une infection due à un rétrovirus VIH choisi parmi les composés ayant une activité anti-transcriptase inverse, ou anti-protéase virale ou une activité antagoniste vis-a-vis du récepteur CD4 présent sur des lymphocytes infectés par un rétrovirus de type VIH, ou un composé
actif en immunothérapie, ou un composé actif spécifiquement contre une ou plusieurs infections opportunistes associees à la présence du rétrovirus VIH chez un patient. 31. Composition characterized in that it comprises, for separate or simultaneous administration, an antagonist compound of one or several molecules of the chemokine family as defined in one any of claims 1 to 19, and an agent active in the treatment or the prevention of an infection due to an HIV retrovirus chosen from the compounds having anti-reverse transcriptase, or anti-protease activity viral or an antagonistic activity towards the CD4 receptor present on lymphocytes infected with an HIV-type retrovirus, or a compound active in immunotherapy, or a compound specifically active against a or more opportunistic infections associated with the presence of the retrovirus HIV in a patient. 32. Composition selon la revendication 31 ou séquence de nucléotides selon l'une quelconque des revendications 20 à 24 ou polypeptide selon l'une quelconque des revendications 28 à 30, caractérisés en ce qu'elle(il) est formulé(e) pour être libéré(e) avec un effet retard chez un patient auquel il est administré. 32. Composition according to claim 31 or sequence of nucleotides according to any one of claims 20 to 24 or polypeptide according to any one of claims 28 to 30, characterized in that it is formulated to be released with an effect delay in a patient to whom it is administered.
CA 2255572 1996-05-22 1997-05-22 Use of chemokine antagonist molecules for their antiviral activity, particularly against an hiv type retrovirus Abandoned CA2255572A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
FR96/06368 1996-05-22
FR9606368A FR2748938B1 (en) 1996-05-22 1996-05-22 USE OF ANTAGONIST MOLECULES OF CHEMOKINES FOR THEIR ANTIVIRAL ACTIVITY IN PARTICULAR AGAINST HIV-TYPE RETROVIRUSES

Publications (1)

Publication Number Publication Date
CA2255572A1 true CA2255572A1 (en) 1997-11-27

Family

ID=9492361

Family Applications (1)

Application Number Title Priority Date Filing Date
CA 2255572 Abandoned CA2255572A1 (en) 1996-05-22 1997-05-22 Use of chemokine antagonist molecules for their antiviral activity, particularly against an hiv type retrovirus

Country Status (5)

Country Link
EP (1) EP0953051A1 (en)
AU (1) AU3036997A (en)
CA (1) CA2255572A1 (en)
FR (1) FR2748938B1 (en)
WO (1) WO1997044462A1 (en)

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6498015B1 (en) 1995-06-07 2002-12-24 Icos Corporation Methods of identifying agents that modulate the binding between MDC and an MDC receptor
US7018627B1 (en) 1995-06-07 2006-03-28 Icos Corporation Macrophage derived chemokine (MDC), MDC analogs, MDC inhibitor substances, and uses thereof
US6737513B1 (en) 1996-06-07 2004-05-18 Icos Corporation Macrophage derived chemokine (MDC) and chemokine analogs and assay to identify modulators of MDC activity, and therapeutic uses for same
US7858298B1 (en) 1996-04-01 2010-12-28 Progenics Pharmaceuticals Inc. Methods of inhibiting human immunodeficiency virus type 1 (HIV-1) infection through the administration of CCR5 chemokine receptor antagonists
EP0915969A4 (en) * 1996-04-02 2002-04-17 Progenics Pharm Inc Method for preventing hiv-1 infection of cd4+ cells
IT1291353B1 (en) * 1997-05-12 1999-01-07 San Raffaele Centro Fond PEPTIDES WITH ANTIVIRAL ACTIVITY
US7067117B1 (en) 1997-09-11 2006-06-27 Cambridge University Technical Services, Ltd. Compounds and methods to inhibit or augment an inflammatory response
EP0906954A1 (en) * 1997-09-29 1999-04-07 Applied Research Systems ARS Holding N.V. Amino-terminal truncated c-c chemokines as chemokine antagonist
FR2771423A1 (en) * 1997-11-21 1999-05-28 Transgene Sa Recombinant viral vector expressing polypeptide that inhibits viral binding
WO1999028474A2 (en) * 1997-12-01 1999-06-10 The Government Of The United States Of America, Represented By The Secretary Of Health And Human Services Chemokine variants and methods of use
DE69832216T2 (en) * 1997-12-23 2006-05-24 Fondazione Centro San Raffaele Del Monte Tabor RANTES mutants and therapeutic applications thereof
MX2008000984A (en) 2005-07-22 2008-04-04 Progenics Pharm Inc Methods for reducing viral load in hiv-1-infected patients.
GB0614755D0 (en) * 2006-07-25 2006-09-06 Univ Geneve Cytokine derivatives

Family Cites Families (5)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US5739103A (en) * 1993-11-12 1998-04-14 Dana-Farber Cancer Institute Chemokine N-terminal deletion mutations
EP0735818B1 (en) * 1993-12-22 2004-03-31 Human Genome Sciences, Inc. MACROPHAGE INFLAMMATORY PROTEINS MIP-3, MIP-4 AND MIP-1gamma
WO1996001318A1 (en) * 1994-07-05 1996-01-18 Steeno Research Group A/S Immunomodulators
EP0796330A1 (en) * 1994-12-08 1997-09-24 Glaxo Group Limited Rantes peptide and fragments and compositions comprising it for treatment of inflammation
GB9501683D0 (en) * 1995-01-27 1995-03-15 Glaxo Group Ltd Substances and their uses

Also Published As

Publication number Publication date
FR2748938A1 (en) 1997-11-28
AU3036997A (en) 1997-12-09
WO1997044462A1 (en) 1997-11-27
FR2748938B1 (en) 1998-07-31
EP0953051A1 (en) 1999-11-03

Similar Documents

Publication Publication Date Title
Yamashita et al. TNF-α coordinates hematopoietic stem cell survival and myeloid regeneration
Pinsky et al. The lethal effects of cytokine-induced nitric oxide on cardiac myocytes are blocked by nitric oxide synthase antagonism or transforming growth factor beta.
US10953071B2 (en) Compositions and methods for treatment of intracellular damage and bacterial infection
JP5547221B2 (en) Stem cells suitable for transplantation, their preparation and pharmaceutical compositions containing them
CA2255572A1 (en) Use of chemokine antagonist molecules for their antiviral activity, particularly against an hiv type retrovirus
US20020077278A1 (en) Use of glatiramer acetate (copolymer 1) in the treatment of central nervous system disorders
AU2008210988B2 (en) Potentiation of stem cell homing and treatment of organ dysfunction or organ failure
JPH11505417A (en) Human chemokine beta-8, chemokine beta-1, and macrophage inflammatory protein-4
US20120009152A1 (en) Nitric oxide donors for treatment of disease and injury
RU2180850C2 (en) Pharmaceutical composition containing c-kit-ligand and hemopoietic factor, method of enhancement of peripheral blood stem cell levels, antagonist of c-kit-ligand, antisense molecule of nucleic acid, method of enhancement of peripheral blood cell levels ex-vivo
JP2003535118A (en) Use of glatiramer acetate (copolymer 1) in the treatment of central nervous system disorders
Ngo Nyekel et al. Mast cell degranulation exacerbates skin rejection by enhancing neutrophil recruitment
Okiji et al. Structural and functional association between substance P-and calcitonin gene-related peptide-immunoreactive nerves and accessory cells in the rat dental pulp
EP0917575A1 (en) Use of a lestr/fusin/cxcr4 receptor ligand chemokine (sdf-1) for treating or preventing hiv-type viral infection
JPH07504437A (en) Use of interleukin-10 to suppress graft-versus-host disease
CN102341407A (en) Modified omci as complement inhibitor
CZ2003947A3 (en) Shortened and mutated human chemokine
Van Belleghem et al. Phage interaction with the mammalian immune system
US20220370556A1 (en) Method of Treatment
RU2130317C1 (en) Linear or cyclic peptides, their using and method of patient treatment
Maier Inhibition of Phosphodiesterase 4 (PDE4) Reduces Experimental Fibrosis by Interfering with the Release of Interleukin-6 from M2 Macrophages
US20070244037A1 (en) Human Chemokine HCC-1 Polypeptides To Improve Stem Cell Transplantation
Dittel Mechanisms of T cell receptor antagonism: implications in the treatment of disease
Tuchscheerer The ligands of CXCR4 in vascularization
Simard Nef pathogenesis in transgenic mice

Legal Events

Date Code Title Description
FZDE Dead