BR112015013737B1 - PEPTIDES WITH ALTERATION OF THE MSIE-SPECIFIC READING FRAME (FSP) FOR CANCER PREVENTION AND TREATMENT - Google Patents
PEPTIDES WITH ALTERATION OF THE MSIE-SPECIFIC READING FRAME (FSP) FOR CANCER PREVENTION AND TREATMENT Download PDFInfo
- Publication number
- BR112015013737B1 BR112015013737B1 BR112015013737-7A BR112015013737A BR112015013737B1 BR 112015013737 B1 BR112015013737 B1 BR 112015013737B1 BR 112015013737 A BR112015013737 A BR 112015013737A BR 112015013737 B1 BR112015013737 B1 BR 112015013737B1
- Authority
- BR
- Brazil
- Prior art keywords
- fsp
- vaccine
- cancer
- msi
- virus
- Prior art date
Links
- 206010028980 Neoplasm Diseases 0.000 title claims abstract description 46
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 22
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 10
- 238000011282 treatment Methods 0.000 title claims abstract description 10
- 230000002265 prevention Effects 0.000 title claims abstract description 8
- 230000004075 alteration Effects 0.000 title claims 2
- 201000011510 cancer Diseases 0.000 title abstract description 22
- 229960005486 vaccine Drugs 0.000 claims abstract description 27
- 208000032818 Microsatellite Instability Diseases 0.000 claims abstract description 25
- 208000001333 Colorectal Neoplasms Diseases 0.000 claims abstract description 7
- 108091007433 antigens Proteins 0.000 claims description 21
- 102000036639 antigens Human genes 0.000 claims description 21
- 239000000427 antigen Substances 0.000 claims description 20
- 102000004127 Cytokines Human genes 0.000 claims description 14
- 108090000695 Cytokines Proteins 0.000 claims description 14
- 230000028993 immune response Effects 0.000 claims description 12
- 239000013598 vector Substances 0.000 claims description 10
- 208000017095 Hereditary nonpolyposis colon cancer Diseases 0.000 claims description 8
- 102100034221 Growth-regulated alpha protein Human genes 0.000 claims description 7
- 238000002255 vaccination Methods 0.000 claims description 7
- 108060000255 AIM2 Proteins 0.000 claims description 6
- 241000710929 Alphavirus Species 0.000 claims description 6
- 102000019034 Chemokines Human genes 0.000 claims description 6
- 108010012236 Chemokines Proteins 0.000 claims description 6
- 102100024064 Interferon-inducible protein AIM2 Human genes 0.000 claims description 6
- 230000003308 immunostimulating effect Effects 0.000 claims description 5
- 239000002671 adjuvant Substances 0.000 claims description 4
- 229940023860 canarypox virus HIV vaccine Drugs 0.000 claims description 4
- 230000003449 preventive effect Effects 0.000 claims description 4
- 239000013603 viral vector Substances 0.000 claims description 4
- 241000271566 Aves Species 0.000 claims description 3
- 241000700618 Vaccinia virus Species 0.000 claims description 3
- 241000700605 Viruses Species 0.000 claims description 3
- 150000001875 compounds Chemical class 0.000 claims description 3
- 239000003814 drug Substances 0.000 claims description 3
- 241000178270 Canarypox virus Species 0.000 claims description 2
- 241000702421 Dependoparvovirus Species 0.000 claims description 2
- 241000701161 unidentified adenovirus Species 0.000 claims description 2
- 241001529453 unidentified herpesvirus Species 0.000 claims description 2
- 241001430294 unidentified retrovirus Species 0.000 claims description 2
- 229940079593 drug Drugs 0.000 claims 2
- 241000700663 Avipoxvirus Species 0.000 claims 1
- 239000007764 o/w emulsion Substances 0.000 claims 1
- 239000013600 plasmid vector Substances 0.000 claims 1
- 239000007762 w/o emulsion Substances 0.000 claims 1
- 206010009944 Colon cancer Diseases 0.000 abstract description 9
- 150000007523 nucleic acids Chemical class 0.000 abstract description 7
- 210000004881 tumor cell Anatomy 0.000 abstract description 5
- 108020004707 nucleic acids Proteins 0.000 abstract description 4
- 102000039446 nucleic acids Human genes 0.000 abstract description 4
- 206010014759 Endometrial neoplasm Diseases 0.000 abstract description 3
- 201000003741 Gastrointestinal carcinoma Diseases 0.000 abstract description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 abstract description 3
- 201000002313 intestinal cancer Diseases 0.000 abstract description 3
- 206010014733 Endometrial cancer Diseases 0.000 abstract description 2
- 230000036755 cellular response Effects 0.000 abstract description 2
- 206010017758 gastric cancer Diseases 0.000 abstract description 2
- 230000008348 humoral response Effects 0.000 abstract description 2
- 201000011549 stomach cancer Diseases 0.000 abstract description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 19
- 108020004414 DNA Proteins 0.000 description 13
- 108090000623 proteins and genes Proteins 0.000 description 13
- 210000004027 cell Anatomy 0.000 description 12
- 238000000034 method Methods 0.000 description 11
- 238000006467 substitution reaction Methods 0.000 description 11
- 230000014509 gene expression Effects 0.000 description 9
- 230000035772 mutation Effects 0.000 description 9
- 238000002965 ELISA Methods 0.000 description 8
- 101001023379 Homo sapiens Lysosome-associated membrane glycoprotein 1 Proteins 0.000 description 8
- 102100035133 Lysosome-associated membrane glycoprotein 1 Human genes 0.000 description 8
- 210000000612 antigen-presenting cell Anatomy 0.000 description 8
- 230000003053 immunization Effects 0.000 description 8
- 210000002966 serum Anatomy 0.000 description 8
- 230000005867 T cell response Effects 0.000 description 7
- 102000004060 Transforming Growth Factor-beta Type II Receptor Human genes 0.000 description 7
- 108010082684 Transforming Growth Factor-beta Type II Receptor Proteins 0.000 description 7
- 235000001014 amino acid Nutrition 0.000 description 7
- 208000008051 Hereditary Nonpolyposis Colorectal Neoplasms Diseases 0.000 description 6
- 201000005027 Lynch syndrome Diseases 0.000 description 6
- 238000003556 assay Methods 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 210000000987 immune system Anatomy 0.000 description 6
- 230000006698 induction Effects 0.000 description 6
- 210000005259 peripheral blood Anatomy 0.000 description 6
- 239000011886 peripheral blood Substances 0.000 description 6
- 102000004169 proteins and genes Human genes 0.000 description 6
- 230000004044 response Effects 0.000 description 6
- 230000000638 stimulation Effects 0.000 description 6
- 230000024932 T cell mediated immunity Effects 0.000 description 5
- 210000003719 b-lymphocyte Anatomy 0.000 description 5
- 208000029742 colonic neoplasm Diseases 0.000 description 5
- 238000003114 enzyme-linked immunosorbent spot assay Methods 0.000 description 5
- 239000012634 fragment Substances 0.000 description 5
- 230000037433 frameshift Effects 0.000 description 5
- 238000002649 immunization Methods 0.000 description 5
- 235000018102 proteins Nutrition 0.000 description 5
- 102100037850 Interferon gamma Human genes 0.000 description 4
- 108010074328 Interferon-gamma Proteins 0.000 description 4
- 108091092878 Microsatellite Proteins 0.000 description 4
- 150000001413 amino acids Chemical class 0.000 description 4
- 238000013459 approach Methods 0.000 description 4
- 239000012752 auxiliary agent Substances 0.000 description 4
- 230000028996 humoral immune response Effects 0.000 description 4
- 230000033607 mismatch repair Effects 0.000 description 4
- 201000009030 Carcinoma Diseases 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 108091034117 Oligonucleotide Proteins 0.000 description 3
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 3
- 238000010521 absorption reaction Methods 0.000 description 3
- 125000003275 alpha amino acid group Chemical group 0.000 description 3
- 238000002619 cancer immunotherapy Methods 0.000 description 3
- 231100000433 cytotoxic Toxicity 0.000 description 3
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 3
- 230000001472 cytotoxic effect Effects 0.000 description 3
- 238000001514 detection method Methods 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000002163 immunogen Effects 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 230000001939 inductive effect Effects 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- 239000013612 plasmid Substances 0.000 description 3
- 230000000069 prophylactic effect Effects 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 238000005406 washing Methods 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- 101150013553 CD40 gene Proteins 0.000 description 2
- 108010041986 DNA Vaccines Proteins 0.000 description 2
- 229940021995 DNA vaccine Drugs 0.000 description 2
- 238000011510 Elispot assay Methods 0.000 description 2
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 2
- 102000001398 Granzyme Human genes 0.000 description 2
- 108060005986 Granzyme Proteins 0.000 description 2
- 206010051922 Hereditary non-polyposis colorectal cancer syndrome Diseases 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- 101000837903 Homo sapiens TATA box-binding protein-associated factor RNA polymerase I subunit B Proteins 0.000 description 2
- 108010065805 Interleukin-12 Proteins 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- 108090000978 Interleukin-4 Proteins 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 206010027476 Metastases Diseases 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 102000004503 Perforin Human genes 0.000 description 2
- 108010056995 Perforin Proteins 0.000 description 2
- KHGNFPUMBJSZSM-UHFFFAOYSA-N Perforine Natural products COC1=C2CCC(O)C(CCC(C)(C)O)(OC)C2=NC2=C1C=CO2 KHGNFPUMBJSZSM-UHFFFAOYSA-N 0.000 description 2
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 2
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 2
- 102100038358 Prostate-specific antigen Human genes 0.000 description 2
- 102100028546 TATA box-binding protein-associated factor RNA polymerase I subunit B Human genes 0.000 description 2
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 229940037003 alum Drugs 0.000 description 2
- 230000030741 antigen processing and presentation Effects 0.000 description 2
- 230000005784 autoimmunity Effects 0.000 description 2
- 230000000903 blocking effect Effects 0.000 description 2
- 210000004369 blood Anatomy 0.000 description 2
- 239000008280 blood Substances 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 239000005018 casein Substances 0.000 description 2
- BECPQYXYKAMYBN-UHFFFAOYSA-N casein, tech. Chemical compound NCCCCC(C(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(CC(C)C)N=C(O)C(CCC(O)=O)N=C(O)C(CC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(C(C)O)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=N)N=C(O)C(CCC(O)=O)N=C(O)C(CCC(O)=O)N=C(O)C(COP(O)(O)=O)N=C(O)C(CCC(O)=N)N=C(O)C(N)CC1=CC=CC=C1 BECPQYXYKAMYBN-UHFFFAOYSA-N 0.000 description 2
- 235000021240 caseins Nutrition 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000011248 coating agent Substances 0.000 description 2
- 238000000576 coating method Methods 0.000 description 2
- 230000007402 cytotoxic response Effects 0.000 description 2
- 230000007812 deficiency Effects 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 210000003162 effector t lymphocyte Anatomy 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 210000004602 germ cell Anatomy 0.000 description 2
- 239000008187 granular material Substances 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 210000000265 leukocyte Anatomy 0.000 description 2
- 239000011859 microparticle Substances 0.000 description 2
- 210000000056 organ Anatomy 0.000 description 2
- 229930192851 perforin Natural products 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 238000002560 therapeutic procedure Methods 0.000 description 2
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- UAIUNKRWKOVEES-UHFFFAOYSA-N 3,3',5,5'-tetramethylbenzidine Chemical compound CC1=C(N)C(C)=CC(C=2C=C(C)C(N)=C(C)C=2)=C1 UAIUNKRWKOVEES-UHFFFAOYSA-N 0.000 description 1
- QRXMUCSWCMTJGU-UHFFFAOYSA-N 5-bromo-4-chloro-3-indolyl phosphate Chemical compound C1=C(Br)C(Cl)=C2C(OP(O)(=O)O)=CNC2=C1 QRXMUCSWCMTJGU-UHFFFAOYSA-N 0.000 description 1
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 1
- 210000001266 CD8-positive T-lymphocyte Anatomy 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 108010078791 Carrier Proteins Proteins 0.000 description 1
- LZZYPRNAOMGNLH-UHFFFAOYSA-M Cetrimonium bromide Chemical compound [Br-].CCCCCCCCCCCCCCCC[N+](C)(C)C LZZYPRNAOMGNLH-UHFFFAOYSA-M 0.000 description 1
- 208000037051 Chromosomal Instability Diseases 0.000 description 1
- PHEDXBVPIONUQT-UHFFFAOYSA-N Cocarcinogen A1 Natural products CCCCCCCCCCCCCC(=O)OC1C(C)C2(O)C3C=C(C)C(=O)C3(O)CC(CO)=CC2C2C1(OC(C)=O)C2(C)C PHEDXBVPIONUQT-UHFFFAOYSA-N 0.000 description 1
- 108091029430 CpG site Proteins 0.000 description 1
- 102000009508 Cyclin-Dependent Kinase Inhibitor p16 Human genes 0.000 description 1
- 108010009392 Cyclin-Dependent Kinase Inhibitor p16 Proteins 0.000 description 1
- 230000033616 DNA repair Effects 0.000 description 1
- 238000011238 DNA vaccination Methods 0.000 description 1
- 206010011968 Decreased immune responsiveness Diseases 0.000 description 1
- 206010061819 Disease recurrence Diseases 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102000008946 Fibrinogen Human genes 0.000 description 1
- 108010049003 Fibrinogen Proteins 0.000 description 1
- 101000766307 Gallus gallus Ovotransferrin Proteins 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 208000031448 Genomic Instability Diseases 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 1
- 101000959820 Homo sapiens Interferon alpha-1/13 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108090000174 Interleukin-10 Proteins 0.000 description 1
- 108090000176 Interleukin-13 Proteins 0.000 description 1
- 108050003558 Interleukin-17 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 102000043129 MHC class I family Human genes 0.000 description 1
- 108091054437 MHC class I family Proteins 0.000 description 1
- 102000043131 MHC class II family Human genes 0.000 description 1
- 108091054438 MHC class II family Proteins 0.000 description 1
- 206010064912 Malignant transformation Diseases 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 101150044251 OGT gene Proteins 0.000 description 1
- 239000004793 Polystyrene Substances 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 241000710960 Sindbis virus Species 0.000 description 1
- 101000874347 Streptococcus agalactiae IgA FC receptor Proteins 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 1
- 230000006044 T cell activation Effects 0.000 description 1
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 125000001931 aliphatic group Chemical group 0.000 description 1
- 239000013566 allergen Substances 0.000 description 1
- AZDRQVAHHNSJOQ-UHFFFAOYSA-N alumane Chemical class [AlH3] AZDRQVAHHNSJOQ-UHFFFAOYSA-N 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 229940024546 aluminum hydroxide gel Drugs 0.000 description 1
- SMYKVLBUSSNXMV-UHFFFAOYSA-K aluminum;trihydroxide;hydrate Chemical compound O.[OH-].[OH-].[OH-].[Al+3] SMYKVLBUSSNXMV-UHFFFAOYSA-K 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 230000003321 amplification Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 230000033115 angiogenesis Effects 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 125000003118 aryl group Chemical group 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000005540 biological transmission Effects 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 125000002091 cationic group Chemical group 0.000 description 1
- 230000020411 cell activation Effects 0.000 description 1
- 230000012292 cell migration Effects 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 230000000139 costimulatory effect Effects 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 238000002784 cytotoxicity assay Methods 0.000 description 1
- 231100000263 cytotoxicity test Toxicity 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 230000027296 dendritic cell chemotaxis Effects 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 239000012636 effector Substances 0.000 description 1
- 208000023965 endometrium neoplasm Diseases 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 238000006911 enzymatic reaction Methods 0.000 description 1
- 230000017188 evasion or tolerance of host immune response Effects 0.000 description 1
- 239000013604 expression vector Substances 0.000 description 1
- 229940012952 fibrinogen Drugs 0.000 description 1
- 230000002068 genetic effect Effects 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 230000037451 immune surveillance Effects 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000004073 interleukin-2 production Effects 0.000 description 1
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 1
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- 230000011268 leukocyte chemotaxis Effects 0.000 description 1
- 108010026228 mRNA guanylyltransferase Proteins 0.000 description 1
- 230000036212 malign transformation Effects 0.000 description 1
- 230000036210 malignancy Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- OHDXDNUPVVYWOV-UHFFFAOYSA-N n-methyl-1-(2-naphthalen-1-ylsulfanylphenyl)methanamine Chemical compound CNCC1=CC=CC=C1SC1=CC=CC2=CC=CC=C12 OHDXDNUPVVYWOV-UHFFFAOYSA-N 0.000 description 1
- 208000029522 neoplastic syndrome Diseases 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 238000010606 normalization Methods 0.000 description 1
- 238000003199 nucleic acid amplification method Methods 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- PHEDXBVPIONUQT-RGYGYFBISA-N phorbol 13-acetate 12-myristate Chemical compound C([C@]1(O)C(=O)C(C)=C[C@H]1[C@@]1(O)[C@H](C)[C@H]2OC(=O)CCCCCCCCCCCCC)C(CO)=C[C@H]1[C@H]1[C@]2(OC(C)=O)C1(C)C PHEDXBVPIONUQT-RGYGYFBISA-N 0.000 description 1
- 229920001606 poly(lactic acid-co-glycolic acid) Polymers 0.000 description 1
- 229920002627 poly(phosphazenes) Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920002223 polystyrene Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000035755 proliferation Effects 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000008458 response to injury Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 210000000813 small intestine Anatomy 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 230000000087 stabilizing effect Effects 0.000 description 1
- 239000008174 sterile solution Substances 0.000 description 1
- 210000002784 stomach Anatomy 0.000 description 1
- 235000000346 sugar Nutrition 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 125000001493 tyrosinyl group Chemical class [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 230000006648 viral gene expression Effects 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
- 150000003751 zinc Chemical class 0.000 description 1
Images
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/0005—Vertebrate antigens
- A61K39/0011—Cancer antigens
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
Abstract
peptídeos com alteração do quadro de leitura msi-específico (fsp) para prevenção e tratamento de câncer. a presente invenção descreve uma vacina para a prevenção e tratamento de câncer caracterizado por instabilidade de microssatélite (msi). a vacina contém um peptídeo específico msi-frameshift (fsp) gerando respostas humorais e celulares contra células tumorais ou um ácido nucleico que codifica a dita fsp. a vacina da presente invenção é, particularmente, útil para a prevenção / tratamento do câncer colorretal, câncer do endométrio, câncer gástrico ou câncer do intestino delgado.peptides with change in the msi-specific reading frame (fsp) for cancer prevention and treatment. The present invention describes a vaccine for the prevention and treatment of cancer characterized by microsatellite instability (MSI). the vaccine contains a specific msi-frameshift peptide (fsp) generating humoral and cellular responses against tumor cells or a nucleic acid encoding said fsp. the vaccine of the present invention is particularly useful for the prevention/treatment of colorectal cancer, endometrial cancer, gastric cancer or small bowel cancer.
Description
[0001] A presente invenção proporciona uma vacina para a prevenção e tratamento de câncer caracterizado por instabilidade microssatélite (MSI). A vacina contém um peptídio de deslocamento do quadro específico-MSI (FSP) gerando respostas humorais e celulares contra células tumorais ou um ácido nucleico que codifica o dito FSP. ANTECEDENTES DA INVENÇÃO[0001] The present invention provides a vaccine for the prevention and treatment of cancer characterized by microsatellite instability (MSI). The vaccine contains an MSI-specific frameshift peptide (FSP) generating humoral and cellular responses against tumor cells or a nucleic acid encoding said FSP. BACKGROUND OF THE INVENTION
[0002] Tumores humanos desenvolmem-se através de duas principais vias de instabilidade genômica, instabilidade cromossômica e instabilidade de microssatélites (MSI) que resulta de defeitos no sistema de reparo incompatível DNA. MSI é encontrada em 15% dos cânceres colorretal e uma variedade de doenças malignas extracolônicas que mostram um sistema de reparação de emparelhamentos incorretos do DNA deficiente, incluindo cânceres do endométrio, cânceres gástricos, cânceres do intestino delgado e tumores de outros órgãos. Cânceres MSI podem desenvolver esporadicamente ou no contexto de uma síndrome de tumor hereditário, câncer colorretal hereditário não-polipose (HNPCC) ou síndrome de Lynch.[0002] Human tumors develop through two main pathways of genomic instability, chromosomal instability and microsatellite instability (MSI) that results from defects in the incompatible DNA repair system. MSI is found in 15% of colorectal cancers and a variety of extracolonic malignancies that show a defective DNA mismatch repair system, including endometrial cancers, gastric cancers, small bowel cancers, and tumors of other organs. MSI cancers can develop sporadically or in the context of an inherited tumor syndrome, hereditary non-polyposis colorectal cancer (HNPCC), or Lynch syndrome.
[0003] Cânceres colorretais MSI são caracterizados por uma imunogenicidade elevada que resulta da geração de inúmeros peptídios de deslocamento do quadro (FSP) durante o desenvolvimento de tumores MSI, como resultado direto da deficiência de reparação de emparelhamentos incorretos dando origem a alterações da estrutura de leitura translacional quando microssatélites em regiões que codificam genes são afetados por mutações (Figura 1).[0003] MSI colorectal cancers are characterized by a high immunogenicity that results from the generation of numerous frameshift peptides (FSP) during the development of MSI tumors, as a direct result of the deficiency of mismatch repair giving rise to changes in the structure of translational readout when microsatellites in gene-coding regions are affected by mutations (Figure 1).
[0004] A abundância de antígenos específicos FSP MSI-previsíveis e o fato de que eles resultam diretamente do processo de transformação maligna tornar FSP alvos altamente promissores para a terapia imune. Acredita-se que o sistema imunológico humano é uma fonte potencial para erradicar as células tumorais e que o tratamento eficaz pode ser desenvolvido, se os componentes do sistema imune são adequadamente estimulados para reconhecer e eliminar células cancerosas. Assim, a imunoterapia, a qual compreende as composições e métodos para ativar o sistema imunológico do corpo, ou diretamente ou indiretamente, para reduzir ou eliminar o câncer foi estudado durante muitos anos como um auxiliar à terapia convencional do câncer.[0004] The abundance of MSI-predictable FSP specific antigens and the fact that they result directly from the malignant transformation process make FSP highly promising targets for immune therapy. It is believed that the human immune system is a potential source for eradicating tumor cells and that effective treatment can be developed if immune system components are properly stimulated to recognize and eliminate cancer cells. Thus, immunotherapy, which comprises compositions and methods to activate the body's immune system, either directly or indirectly, to reduce or eliminate cancer, has been studied for many years as an adjunct to conventional cancer therapy.
[0005] É geralmente admitido que o crescimento e metástase de tumores dependam em grande medida da sua capacidade para escapar à vigilância imunológica do hospedeiro. A maioria dos tumores expressam antígenos que podem ser reconhecidos de uma variável medida pelo sistema imunológico do hospedeiro, mas em muitos casos, a resposta imune é inadequada. A falha para induzir uma forte ativação de células T efetoras podem resultar da imunogenicidade fraco de antígenos tumorais ou expressão inapropriada ou ausente de moléculas co-estimuladoras por células tumorais. Para a maioria das células T, a produção de IL-2 e a proliferação de exigir a transmissão simultânea de sinais co-estimuladores com acoplamento TCR, de outra forma, as células T podem entrar em um estado que não respondem funcionalmente, conhecido como anergia clonal.[0005] It is generally assumed that the growth and metastasis of tumors depend to a large extent on their ability to evade host immune surveillance. Most tumors express antigens that can be recognized from a variable measured by the host's immune system, but in many cases, the immune response is inadequate. Failure to induce strong effector T cell activation may result from weak immunogenicity of tumor antigens or inappropriate or absent expression of costimulatory molecules by tumor cells. For most T cells, IL-2 production and proliferation require simultaneous transmission of co-stimulatory signals with TCR coupling, otherwise T cells can enter a functionally unresponsive state known as anergy. clonal.
[0006] Apesar da duração do tempo que essas terapias têm sido investigadas, continua a haver uma necessidade de melhorar as estratégias para aumentar a resposta imunológica contra os antígenos tumorais.[0006] Despite the length of time that these therapies have been investigated, there remains a need to improve strategies to enhance the immune response against tumor antigens.
[0007] No entanto, existe uma necessidade no estado da técnica para composições seguras e eficazes que possam estimular o sistema imune como uma imunoterapia do câncer. SUMÁRIO DA INVENÇÃO[0007] However, there is a need in the prior art for safe and effective compositions that can stimulate the immune system as a cancer immunotherapy. SUMMARY OF THE INVENTION
[0008] De acordo com a invenção, a estimulação segura e eficaz do sistema imunológico como uma imunoterapia do câncer é alcançada pela matéria definida nas reivindicações. Os estudos IN VITRO mostraram que FSP são altamente imunogênicos e podem induzir respostas de células T específicas do FSP pronunciados IN VITRO (Linnebacher et al., 2001, Ripberger et al., 2003, Schwitalle et al., 2004). Em outros estudos que examinam sangue venoso periférico de pacientes com câncer do cólon MSI, uma elevada frequência de respostas FSP específicos de células T foi demonstrada (Schwitalle et al., 2008). Apesar do elevado número de células T específicas FSP-no tumor e no sangue periférico, estes doentes não apresentaram sinais de autoimunidade, sugerindo que as abordagens de vacinação FSP não se espera que tenham efeitos secundários em termos de autoimunidade.[0008] According to the invention, safe and effective stimulation of the immune system as a cancer immunotherapy is achieved by the subject matter defined in the claims. IN VITRO studies have shown that FSP are highly immunogenic and can induce pronounced IN VITRO FSP-specific T cell responses (Linnebacher et al., 2001, Ripberger et al., 2003, Schwitalle et al., 2004). In other studies examining peripheral venous blood from MSI colon cancer patients, a high frequency of T-cell specific FSP responses has been demonstrated (Schwitalle et al., 2008). Despite the high number of FSP-specific T cells in the tumor and peripheral blood, these patients showed no signs of autoimmunity, suggesting that FSP vaccination approaches are not expected to have side effects in terms of autoimmunity.
[0009] Análises imunológicas em indivíduos portadores de uma mutação de linhagem germinal em genes de reparação de emparelhamentos incorretos do DNA de predisposição de câncer colorretal hereditário não-polipose (HNPCC) também foram encontradas para exibir as respostas imunes celulares contra FSP, mesmo na ausência de um tumor clinicamente detectável. Isto sugere que as respostas imunológicas específicas do FSP pode ser protetora em indivíduos HNPCC, sugerindo que a vacinação FSP também pode ser utilizada em um ambiente preventivo como a prevenção de primeira abordagem de uma condição específica em câncer hereditário.[0009] Immunological analyzes in individuals carrying a germline mutation in DNA mismatch repair genes predisposing hereditary non-polyposis colorectal cancer (HNPCC) have also been found to display cellular immune responses against FSP, even in the absence of a clinically detectable tumor. This suggests that FSP-specific immune responses may be protective in HNPCC individuals, suggesting that FSP vaccination may also be used in a preventive setting as the first approach prevention of a specific condition in hereditary cancer.
[0010] Em suma:(a) os peptídios do quadro de leitura (FSP) são MSI- específicos e resultam diretamente da patogênese do tumor MSI; (b) Efeitos colaterais clinicamente relevantes não são esperados;(c) Combinações de FSP são previstas para atingir todos os tumores com MSI;(d) a vacinação FSP foi concebida para a terapia de 15% dos cânceres do cólon e tumores do endométrio, estômago, intestino delgado e outros órgãos;(e) Análise de tumor Molecular pode identificar os pacientes que podem se beneficiar da vacinação FSP (terapia-alvo); e(f) vacinação FSP pode ser utilizada como uma vacina preventiva em grupos de alto risco.[0010] In summary: (a) the reading frame peptides (FSP) are MSI-specific and result directly from the pathogenesis of the MSI tumor; (b) Clinically relevant side effects are not expected; (c) FSP combinations are predicted to target all tumors with MSI; (d) FSP vaccination is designed for the therapy of 15% of colon cancers and endometrial tumors, stomach, small intestine and other organs; (e) Molecular tumor analysis can identify patients who may benefit from FSP (target therapy) vaccination; and (f) FSP vaccination can be used as a preventive vaccine in high-risk groups.
[0011] Figura 1:Ilustração esquemática de codificação de instabilidade de microssatélites de DNA resultante de deficiência de reparo incompatível (Kloor et al., 2010)[0011] Figure 1: Schematic illustration of encoding DNA microsatellite instability resulting from incompatible repair deficiency (Kloor et al., 2010)
[0012] Proteínas truncadas que abrangem sequências de FSP (vermelha) são geradas quando a codificação de mutações microssatélites levam a alterações do quadro de leitura translacional (exemplo: proteína TGFBR2).[0012] Truncated proteins spanning FSP sequences (red) are generated when encoding microsatellite mutations lead to changes in the translational reading frame (example: TGFBR2 protein).
[0013] Figura 2: Exemplos de respostas de células T contra FSPs recém-projetado no sangue periférico de três pacientes com câncer de cólon MSI[0013] Figure 2: Examples of T cell responses against newly engineered FSPs in the peripheral blood of three MSI colon cancer patients
[0014] Figura 3: As respostas imunes humorais contra FSP derivados de AIM2 (-1), HTOOl (-l), TAFlB (-l), e TGFBR2 (-1)[0014] Figure 3: Humoral immune responses against FSP derived from AIM2 (-1), HTOOL (-l), TAFlB (-l), and TGFBR2 (-1)
[0015] O ensaio ELISA revelou respostas de anticorpos específicos FSP-dirigidos contra neopeptídeos derivados de 2 AI (- 1), HTOOl (-l), TAFlB (-l), e TGFBR2 (-1). Especificidade do Peptídio foi demonstrada por pré- absorção de anticorpos séricos respectivos como descritos anteriormente (Reuschenbach et al., 2008).The ELISA assay revealed FSP-specific antibody responses directed against neopeptides derived from AI2(-1), HT01(-1), TAF1B (-1), and TGFBR2 (-1). Peptide specificity was demonstrated by pre-absorption of respective serum antibodies as previously described (Reuschenbach et al., 2008).
[0016] Figura 4: As respostas citotóxicas tal como determinado por expressão de superfície CD107a(A) As respostas específicas do FSP significativas foram observadas em diferentes doadores saudáveis, após a estimulação de células T com o antígeno durante quatro semanas. Respostas só não ocorrem na presença de células apresentadoras de antígeno B e o antígeno PSA. Respostas representativas são apresentadas em gráficos de barras.(B) Análise por FACS de ensaio representativo CD107a por células T incubadas com as células B como as células apresentadoras de antígeno na ausência (painel da esquerda) ou na presença (painel da direita) do antígeno FSP HT001 (1).[0016] Figure 4: Cytotoxic responses as determined by CD107a(A) surface expression Significant FSP-specific responses were observed in different healthy donors after stimulation of T cells with the antigen for four weeks. Responses only do not occur in the presence of B antigen presenting cells and the PSA antigen. Representative responses are shown in bar graphs. (B) FACS analysis of representative CD107a assay by T cells incubated with B cells as antigen-presenting cells in the absence (left panel) or in the presence (right panel) of antigen FSP HT001 (1).
[0017] Assim, a presente invenção fornece uma vacina contendo um peptídio de deslocamento do quadro específico de tumor MSI (FSP), por exemplo, derivados de TAF1B (Acc.No. L39061), HT001 (Acc.No. AF113539), AIM2 (Acc.No. AF024714), ou TGFBR2 (Acc.No. NM_003242) ou um ácido nucleico que codifica o dito FSP em que o referido FSP é capaz de induzir uma resposta imune contra o câncer que mostra MSI.Thus, the present invention provides a vaccine containing an MSI tumor-specific frameshift peptide (FSP), e.g. derivatives of TAF1B (Acc.No. L39061), HT001 (Acc.No. AF113539), AIM2 (Acc.No. AF024714), or TGFBR2 (Acc.No. NM_003242) or a nucleic acid encoding said FSP wherein said FSP is capable of inducing an immune response against cancer that shows MSI.
[0018] Em uma concretização preferida, a vacina da presente invenção contém(A) um FSP compreendendo ou consistindo na seguinte sequência de aminoácidos:NTQIKALNRGLKKKTILKKAGIGCVVSSIFFINKQP (TAFlB (-l));EIFLPKGRSNSKKKGRRNRIPAVLRTEGEPLHTPSVGMRETTGGC (HT001(-1)); HSTIKVIKAKKKHREVKRTNSSQLV (AIM2 (-1)); ouASPKCIMKEKKSLVRLSSCVPVALMSAMTTSSSQKITPAILTCC (TGFBR2 (-1));(B) um equivalente funcional de um FSP de (b); ou(C) uma combinação do FSP de (a) e / ou (b).In a preferred embodiment, the vaccine of the present invention contains (A) an FSP comprising or consisting of the following amino acid sequence:NTQIKALNRGLKKKTILKKAGIGCVVSSIFFINKQP (TAFlB (-l));EIFLPKGRSNSKKKGRRNRIPAVLTEGEPLHTPSVGMRETTGGC (HT001(-1)); HSTIKVIKAKKKHREVKRTNSSQLV (AIM2 (-1)); orASPKCIMKEKKSLVRLSSCVPVALMSAMTTSSQKITPAILTCC (TGFBR2 (-1)); (B) a functional equivalent of an FSP of (b); or (C) a combination of the FSP of (a) and/or (b).
[0019] O termo "equivalente funcional", tal como aqui utilizado se refere a, por exemplo, variantes ou fragmentos da FSP que ainda são capazes de desencadear uma resposta imune contra o câncer, ou seja, são ainda úteis como uma vacina eficaz. Uma resposta imunológica é definida como uma condição que satisfaz pelo menos um dos seguintes critérios: 1. A indução de células T CD8-positivas, como detectável por ensaios de citotoxicidade ou a secreção de gama-IFN ou expressão de perforina ou expressão de granzima B ou outras citocinas que possam ser produzida por células T CD8 positivas, mensuráveis como o fundo acima por ELISPOT ou coloração de citocinas intracelulares ou citocinas ELISA ou outros métodos equivalentes. 2. A indução de células T C4-positivas, como detectável por secreção de citocinas como mensurável acima do fundo por ELISPOT ou coloração de citocinas intracelulares ou citocinas ELISA ou outros métodos equivalentes. As citocinas podem compreender IFN- alfa, IFN-gama, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL- 13, IL-17, TNF-alfa, TGF-beta ou outras citocinas que podem ser produzidas por células T CD4-positivos. 3. A indução de anticorpos, como detectado por Western blot, ELISA e métodos equivalentes ou relacionadas. 4. A indução de qualquer tipo de resposta imune celular não mediada por células T CD8 + ou CD4 +, tal como descrito em 1 e 2.[0019] The term "functional equivalent" as used herein refers to, for example, FSP variants or fragments that are still capable of eliciting an immune response against cancer, that is, are still useful as an effective vaccine. An immune response is defined as a condition that satisfies at least one of the following criteria: 1. Induction of CD8-positive T cells, as detectable by cytotoxicity assays, or secretion of gamma-IFN or perforin expression or granzyme B expression or other cytokines that can be produced by CD8 positive T cells, measurable as above background by ELISPOT or intracellular cytokine staining or cytokine ELISA or other equivalent methods. 2. Induction of C4-positive T cells, as detectable by cytokine secretion as measurable above background by ELISPOT or intracellular cytokine staining or cytokine ELISA or other equivalent methods. Cytokines may comprise IFN-alpha, IFN-gamma, IL-2, IL-4, IL-5, IL-6, IL-10, IL-12, IL-13, IL-17, TNF-alpha, TGF- beta or other cytokines that can be produced by CD4-positive T cells. 3. Antibody induction, as detected by Western blot, ELISA and equivalent or related methods. 4. The induction of any type of cellular immune response not mediated by CD8 + or CD4 + T cells, as described in 1 and 2.
[0020] As variantes são caracterizadqs por deleções, substituições e / ou adições de aminoácidos. De preferência, as diferenças entre aminoácidos são devidos a uma ou mais substituições conservativas de aminoácidos. O termo "substituições conservativas de aminoácidos" envolve a substituição da série alifática ou os aminoácidos hidrofóbicos Ala, Vai, Leu e lie; substituição dos resíduos de hidroxilo Ser e Thr; substituição dos resíduos acídicos Asp e Glu; substituição resíduos de amida Asn e Gln, troca dos resíduos básicos Lys, Arg e His; substituição dos resíduos aromáticos Phe, Tyr e Trp, e substituição dos aminoácidos de pequenos porte Ala, Ser, Thr, Met, e Gly.Variants are characterized by amino acid deletions, substitutions and/or additions. Preferably, amino acid differences are due to one or more conservative amino acid substitutions. The term "conservative amino acid substitutions" involves substitution of the aliphatic series or the hydrophobic amino acids Ala, Val, Leu and Ile; substitution of Ser and Thr hydroxyl residues; substitution of acidic residues Asp and Glu; substitution of amide residues Asn and Gln, substitution of basic residues Lys, Arg and His; substitution of the aromatic residues Phe, Tyr, and Trp; and substitution of the small amino acids Ala, Ser, Thr, Met, and Gly.
[0021] Para a geração de peptídios que mostram um determinado grau de identidade com a FSP, por exemplo, engenharia genética pode ser usada para introduzir alterações de aminoácidos em posições específicas de uma sequência de DNA clonado para identificar regiões críticas para a função do peptídio. Por exemplo, a mutagênese dirigida ou a mutagénese de varrimento de alanina (introdução de mutações únicas de alanina em cada resíduo da molécula) pode ser utilizado (Cunningham e Wells, 1989). As moléculas mutantes resultantes podem então ser testadas quanto à imunogenicidade, utilizando o ensaio do Exemplo 1.[0021] For the generation of peptides that show a certain degree of identity with FSP, for example, genetic engineering can be used to introduce amino acid changes at specific positions in a cloned DNA sequence to identify regions critical for the peptide's function . For example, site-directed mutagenesis or alanine-scanning mutagenesis (introduction of single alanine mutations at each residue of the molecule) can be used (Cunningham and Wells, 1989). The resulting mutant molecules can then be tested for immunogenicity using the assay of Example 1.
[0022] De preferência, as variantes são caracterizadas por não mais de 8 aa, mais preferivelmente, por não mais de 6 aa e, ainda mais de preferência, até um máximo de quatro aa substituições, deleções e / ou adições.[0022] Preferably, variants are characterized by not more than 8 aa, more preferably not more than 6 aa and even more preferably up to a maximum of four aa substitutions, deletions and/or additions.
[0023] No fragmento de um FSP, pelo menos, 5 aa contíguos, preferivelmente, pelo menos 10 aa contíguos, mais preferivelmente, pelo menos, 15 aa contíguos, e ainda mais preferencialmente, pelo menos 20 aa contíguos da sequência de aminoácidos particular, são deixados. O fragmento é ainda capaz de induzir uma resposta imune.In a fragment of an FSP, at least 5 aa contiguous, preferably at least 10 aa contiguous, more preferably at least 15 aa contiguous, and even more preferably at least 20 aa contiguous of the particular amino acid sequence, They are left. The fragment is even capable of inducing an immune response.
[0024] Em uma concretizaçãomais preferida, a vacina da presente invenção compreende, adicionalmente, um adjuvante e / ou citocina ou quimiocina imunoestimuladora.[0024] In a more preferred embodiment, the vaccine of the present invention further comprises an adjuvant and/or immunostimulatory cytokine or chemokine.
[0025] Os adjuvantes adequados incluem um sal de alumínio, tal como o gel de hidróxido de alumínio (alum) ou fosfato de alumínio, mas pode também ser um sal de cálcio, ferro ou zinco, ou pode ser uma suspensão insolúvel de tirosina acilada, ou açúcares acilados, polissacarídeos derivatizados cationicamente ou anionicamente, ou polifosfazenos. Outros adjuvantes conhecidos incluem oligonucleotídeos contendo CpG. Os oligonucleotídeos são caracterizados pelo fato de o dinucleotídeo CpG ser não metilado. Tais oligonucleotídeos são bem conhecidos e são descritos em, por exemplo, no documento WO 96/02555.Suitable adjuvants include an aluminum salt, such as aluminum hydroxide gel (alum) or aluminum phosphate, but it may also be a calcium, iron or zinc salt, or it may be an insoluble suspension of acylated tyrosine , or acylated sugars, cationically or anionically derivatized polysaccharides, or polyphosphazenes. Other known adjuvants include CpG containing oligonucleotides. Oligonucleotides are characterized by the fact that the CpG dinucleotide is unmethylated. Such oligonucleotides are well known and are described in, for example, WO 96/02555.
[0026] A utilização de citocinas imunoestimulantes tornou-se uma abordagem cada vez mais promissora em imunoterapia do câncer. O principal objetivo é a ativação de linfócitos T específicos de tumores capazes de rejeitar as células tumorais de pacientes com baixa carga tumoral ou para proteger os pacientes contra a recorrência da doença. Estratégias que proporcionam níveis elevados de citocinas imunoestimulantes localmente no local do antígeno demonstrou eficácia pré-clínica e clínica. Citoquinas imunoestimulantes preferidas compreendem a IL-2, IL-4, IL- 7, IL-12, IFNs, GM-CSF e FNT-.[0026] The use of immunostimulating cytokines has become an increasingly promising approach in cancer immunotherapy. The main objective is the activation of tumor-specific T lymphocytes capable of rejecting tumor cells from patients with low tumor burden or to protect patients against disease recurrence. Strategies that provide elevated levels of immunostimulating cytokines locally at the antigen site have demonstrated preclinical and clinical efficacy. Preferred immunostimulatory cytokines comprise IL-2, IL-4, IL-7, IL-12, IFNs, GM-CSF and TNF-.
[0027] As quimiocinas são pequenas (7-16 kD), segregada, e estruturalmente relacionadas com proteínas solúveis que estão envolvidas na quimiotaxia de leucócitos e de células dendríticas, a desgranulação de PMN, e angiogênese. As quimiocinas são produzidas durante a fase inicial da resposta do hospedeiro a lesão, alergênicos, antígenos, ou os microrganismos invasores. Quimiocinas atraem seletivamente leucócitos para focos inflamatórios, induzindo tanto a migração celular e ativação. As quimiocinas pode aumentar a imunidade inata ou hospedeiro específica contra tumores e, portanto, pode também ser útil em combinação com um FSP.[0027] Chemokines are small (7-16 kD), secreted, and structurally related to soluble proteins that are involved in leukocyte and dendritic cell chemotaxis, PMN degranulation, and angiogenesis. Chemokines are produced during the initial phase of the host's response to injury, allergens, antigens, or invading microorganisms. Chemokines selectively attract leukocytes to inflammatory foci, inducing both cell migration and activation. Chemokines can enhance innate or host-specific immunity against tumors and therefore may also be useful in combination with an FSP.
[0028] A vacina da presente invenção pode também conter um ácido nucleico que codifica o FSP para a imunização de DNA, uma técnica usada para estimular eficientemente respostas imunológicas humorais e celulares a antígenos proteicos. A injeção direta de material genético em um hospedeiro vivo faz com que uma pequena quantidade das suas células a produzir os produtos dos genes introduzidos. Esta expressão do gene inadequado dentro do hospedeiro tem consequências imunológicas importantes, resultando na ativação imunológica específica do hospedeiro contra o antígeno do gene entregue. A injeção direta de DNA plasmídico nu induz fortes respostas imunológicas para o antígeno codificado pela vacina genética. Uma vez que a construção de DNA de plasmídeo é injetado as células hospedeiras tomar-se o DNA estranho, a expressão do gene viral e a produção do FSP no interior da célula. Esta forma de apresentação e processamento do antígeno induz tanto MHC de classe I e de classe II a respostas imunes humoral e celular restritas. As vacinas de DNA são compostas de vetores que contêm normalmente duas unidades: a unidade de expressão do antígeno composto por sequências de promotor / intensificador, seguidos por antígeno (FSP) de codificação e sequências de poliadenilação e da unidade de produção composta por sequências necessárias para a seleção e amplificação do vetor. A construção de vetores de vacina com pastilhas é realizado utilizando tecnologia de DNA recombinante e o técnico versado no assunto conhece os vetores que podem ser usados para esta abordagem. A eficiência de imunização com DNA pode ser melhorada por meio da estabilização do DNA contra a degradação, e aumentando a eficiência de entrega de DNA em células que apresentam antígenos. Isto tem sido demonstrado por revestimento de micropartículas biodegradáveis catiônicas (tais como, poli (lactido-co- glicolido), formulado com brometo de cetiltrimetilamônio) com DNA. Tais micropartículas revestidas com DNA podem ser tão eficaz a aumentar a CTL como vírus vaccinia recombinantes, em particular, quando misturados com alum. Partículas de 300 nm de diâmetro parecem ser mais eficientes para a absorção pelas células apresentadoras de antígenos.The vaccine of the present invention may also contain a nucleic acid encoding FSP for DNA immunization, a technique used to efficiently stimulate humoral and cellular immune responses to protein antigens. Direct injection of genetic material into a living host causes a small amount of its cells to produce the products of the introduced genes. This expression of the inappropriate gene within the host has important immunological consequences, resulting in host-specific immunological activation against the antigen of the delivered gene. Direct injection of naked plasmid DNA induces strong immune responses to the genetic vaccine-encoded antigen. Once the plasmid DNA construct is injected the host cells take over the foreign DNA, viral gene expression and FSP production inside the cell. This form of antigen presentation and processing induces both class I and class II MHC to restricted humoral and cellular immune responses. DNA vaccines are composed of vectors that normally contain two units: the antigen expression unit composed of promoter/enhancer sequences, followed by antigen (FSP) coding and polyadenylation sequences and the production unit composed of sequences necessary for vector selection and amplification. The construction of vaccine vectors with pellets is performed using recombinant DNA technology and the person skilled in the art knows the vectors that can be used for this approach. The efficiency of DNA immunization can be improved by stabilizing DNA against degradation, and increasing the efficiency of DNA delivery in antigen presenting cells. This has been demonstrated by coating biodegradable cationic microparticles (such as poly(lactide-co-glycolide) formulated with cetyltrimethylammonium bromide) with DNA. Such DNA-coated microparticles can be as effective at increasing CTL as recombinant vaccinia viruses, in particular, when mixed with alum. 300 nm diameter particles seem to be more efficient for uptake by antigen presenting cells.
[0029] Uma variedade de vetores de expressão, por exemplo, plasmídeos ou vetores virais pode ser utilizado para conter e expressar sequências de ácidos nucleicos que codificam um FSP da presente invenção.[0029] A variety of expression vectors, for example plasmids or viral vectors can be used to contain and express nucleic acid sequences encoding an FSP of the present invention.
[0030] Um vetor viral preferido é um poxvírus, adenovírus, retrovírus, vírus do herpes ou vírus adeno- associado (AAV). Poxvírus particularmente preferidos são um vírus vaccinia, YVAC, poxvírus aviário, vírus da canarypox, ALVAC, ALVAC (2), vírus da varíola aviária ou TROVAC.A preferred viral vector is a poxvirus, adenovirus, retrovirus, herpes virus or adeno-associated virus (AAV). Particularly preferred poxviruses are a vaccinia virus, YVAC, avian poxvirus, canarypox virus, ALVAC, ALVAC(2), avian pox virus or TROVAC.
[0031] Os vetores à base de alfavírus recombinantestambém têm sido utilizados para melhorar a eficiência davacinação de DNA. O gene que codifica a PSA é inserido noreplicão de alfavírus, em substituição de genesestruturais, mas deixando os genes de replicase nãoestruturais intacto. O vírus Sindbis e vírus Forest Semlikitêm sido usados para construir replicons alfavírusrecombinantes. Ao contrário de vacinas de DNAconvencionais, no entanto, os vetores de alfavírus sãoapenas transitoriamente expressos. Replicons alfavírusaumentam uma resposta imune, devido aos elevados níveis deproteína expressa por este vetor, respostas de citocinasinduzida por replicon, ou replicon induzida por apoptoselevando a aumento da captação de antígeno pelas célulasdendriticas.[0031] Recombinant alphavirus-based vectors have also been used to improve the efficiency of DNA vaccination. The gene encoding PSA is inserted into the alphavirus replicon, replacing structural genes, but leaving the nonstructural replicase genes intact. Sindbis virus and Forest Semliki virus have been used to build recombinant alphavirus replicons. Unlike conventional DNA vaccines, however, alphavirus vectors are only transiently expressed. Alphavirus replicons increase an immune response, due to the high levels of protein expressed by this vector, cytokine responses induced by replicon, or replicon induced by apoptosis, leading to increased antigen uptake by dendritic cells.
[0032] Em uma outra concretização preferida, o FSPcontém uma sequência de marcador, de um modo preferido, noterminal C, que pode ser útil para a purificação de um FSPproduzido de forma recombinante. Uma sequência preferida éuma marcação de His. Um particularmente preferidos His-Tagé composto por 6 resíduos-His.[0032] In another preferred embodiment, the FSP contains a tag sequence, preferably at the C-terminus, which may be useful for the purification of a recombinantly produced FSP. A preferred sequence is a His tag. A particularly preferred His-Tage is composed of 6 His-residues.
[0033] A vacina da presente invenção é administrada em uma quantidade apropriada para a imunização de um indivíduo e, de preferência, contém, adicionalmente, um ou mais agentes auxiliares comuns. O termo "quantidade adequada para a imunização de um indivíduo" utilizado compreende qualquer quantidade de FSP com o qual um indivíduo pode ser imunizado. A quantidade depende do fato de a imunização ser concebida como um tratamento profilático ou terapêutico. Além disso, a idade, sexo e peso do indivíduo desempenham um papel para a determinação da quantidade. Assim, a quantidade adequada para a imunização de um indivíduo se refere a quantidades de ingredientes ativos que sejam suficientes para afetar o curso e a gravidade do tumor, levando à redução ou remissão de tal patologia. Uma "quantidade adequada para a imunização de um indivíduo" pode ser determinada utilizando métodos conhecidos de um técnico versado no assunto (ver, por exemplo, Fingl et al., 1975). O termo "indivíduo" como aqui utilizado compreende um indivíduo de qualquer tipo e ser capaz de ficar doente com carcinoma. Os exemplos de tais indivíduos são seres humanos e animais, assim como células das mesmas.[0033] The vaccine of the present invention is administered in an amount appropriate for the immunization of an individual and preferably additionally contains one or more common auxiliary agents. The term "amount suitable for immunizing a subject" used comprises any amount of FSP with which a subject can be immunized. The amount depends on whether the immunization is intended as a prophylactic or therapeutic treatment. In addition, the individual's age, sex, and weight play a role in determining the amount. Thus, the adequate amount for immunizing an individual refers to amounts of active ingredients that are sufficient to affect the course and severity of the tumor, leading to the reduction or remission of such pathology. An "adequate amount for immunizing an individual" can be determined using methods known to one of ordinary skill in the art (see, for example, Fingl et al., 1975). The term "individual" as used herein comprises an individual of any type and being capable of becoming ill with carcinoma. Examples of such individuals are humans and animals, as well as cells from them.
[0034] A administração da vacina por injeção pode ser feito em vários locais do indivíduo por via intramuscular, por via subcutânea, intradérmica ou em qualquer outra forma de aplicação. Ele também pode ser favorável para realizar um ou mais "injeções de reforço" com cerca de quantidades iguais.[0034] The administration of the vaccine by injection can be done in several places of the individual, intramuscularly, subcutaneously, intradermally or in any other form of application. It may also be favorable to perform one or more "booster shots" with about equal amounts.
[0035] O termo utilizado "agentes auxiliares comuns" compreende quaisquer agentes auxiliares adequados para uma vacina para imunizar um indivíduo. Estes agentes auxiliares são, por exemplo, soluções salinas tamponadas comum, água, emulsões, tais como emulsões óleo / água, agentes molhantes, soluções estéreis, etc.The term used "common auxiliary agents" comprises any auxiliary agents suitable for a vaccine to immunize an individual. These auxiliary agents are, for example, common buffered saline solutions, water, emulsions such as oil/water emulsions, wetting agents, sterile solutions, etc.
[0036] Um FSP, sequência de ácido nucleico ou vetor da presente invenção pode estar presente na vacina como tal ou em combinação com veículos. É favorável para os transportadores em que o indivíduo não seja imunogênico. Tais transportadores podem ser proteínas individuais próprias ou proteínas estranhas ou seus fragmentos. Os transportadores, tais como albumina do soro, transferrina ou fibrinogênio ou um seu fragmento, são preferidos.An FSP, nucleic acid sequence or vector of the present invention may be present in the vaccine as such or in combination with carriers. It is favorable for carriers where the individual is not immunogenic. Such transporters can be individual self proteins or foreign proteins or fragments thereof. Carriers such as serum albumin, transferrin or fibrinogen or a fragment thereof are preferred.
[0037] A vacina da presente invenção pode ser terapêutica, isto é, os compostos são administrados para o tratamento de um câncer existente ou para prevenir a recorrência de um câncer, ou profilático, isto é, os compostos são administrados para prevenir ou retardar o desenvolvimento de câncer. Se as composições são usadas terapeuticamente são administradas a doentes com câncer e se destinam a induzir uma resposta imune para estabilizar um tumor, impedindo ou retardando o crescimento do câncer existentes, para impedir a propagação de um tumor ou de metástases, para reduzir o tamanho do tumor, para prevenir a recorrência de câncer tratados, ou para eliminar as células cancerosas não mortos por tratamentos anteriores. A vacina utilizada como um tratamento profiláctico é administrada a indivíduos que não têm câncer, e são concebidas para produzir uma resposta imune às células alvo potenciais cancerosas.[0037] The vaccine of the present invention can be therapeutic, i.e., the compounds are administered for the treatment of an existing cancer or to prevent the recurrence of a cancer, or prophylactic, i.e., the compounds are administered to prevent or delay the cancer development. If the compositions are used therapeutically they are administered to cancer patients and are intended to induce an immune response to stabilize a tumor, preventing or slowing the growth of existing cancer, to prevent the spread of a tumor or metastases, to reduce the size of the tumor, to prevent the recurrence of treated cancer, or to eliminate cancer cells not killed by previous treatments. Vaccine used as a prophylactic treatment is administered to individuals who do not have cancer, and are designed to produce an immune response to potential cancer target cells.
[0038] A presente invenção também se relaciona coma utilização de um equivalente funcional ou FSP, sequênciade ácido nucleico ou vetor como acima definido para aprodução de uma vacina para a prevenção de um carcinoma,por exemplo, a vacinação preventiva de um grupo de altorisco, ou o tratamento de um carcinoma. Por exemplo, estespodem ser um câncer colorretal, de um modo preferido, umcâncer colorretal hereditário não polipose (HNPCC), umcâncer do endométrio, o câncer gástrico ou um câncer dointestino delgado.[0038] The present invention also relates to the use of a functional equivalent or FSP, nucleic acid sequence or vector as defined above for the production of a vaccine for the prevention of a carcinoma, for example, the preventive vaccination of a high-risk group, or treating a carcinoma. For example, these may be colorectal cancer, preferably hereditary non-polyposis colorectal cancer (HNPCC), endometrial cancer, gastric cancer, or small bowel cancer.
[0039] Por meio da presente invenção é possívelimunizar indivíduos, em particular, seres humanos eanimais. A imunização realiza-se por tanto a indução deanticorpos e a estimulação de células T CD8+. Assim, épossível tomar medidas profiláticas e terapêuticas contracarcinomas.[0039] By means of the present invention it is possible to immunize individuals, in particular, humans and animals. Immunization therefore involves the induction of antibodies and the stimulation of CD8+ T cells. Thus, it is possible to take prophylactic and therapeutic measures against cancer.
[0040] Os exemplos abaixo explicam a invenção em mais detalhes.Exemplo 1Detecção de células T específicas-FSP no sangue periférico de pacientes com câncer do cólon MSI e portadores da mutação HNPCC saudáveis[0040] The examples below explain the invention in more detail.Example 1 Detection of FSP-specific T cells in the peripheral blood of MSI colon cancer patients and healthy HNPCC mutation carriers
[0041] Frequências de células T periféricas FSP-específicas (PTC) foram quantificadas através da determinação do número de IFN-gama-específico secretoras Tc contra FSPs recém-concebidos derivados de 3 cms contendo genes candidatos usando a análise de ELISpot. Ensaios ELISPOT foram realizados utilizando placas de nitrocelulose de 96 poços (Multiscreen; Millipore, Bedford, MA) revestidas durante a noite com anticorpos monoclonais de camundongos anti-IFN-gama humanos (mAb) (Mabtech, Nacka, Suécia) e bloquearam-se com meio contendo soro. PTC (dia 0, l x l05 / poço) foram plaqueadas 6 vezes com células B ativadas por CD40 autólogas (4 x l04 / poço, TIBC ou PBC, respectivamente) como soro AB humano em células 200 l IMDM com 10% apresentadoras de antígeno. Os peptídeos foram adicionados a uma concentração final de 10 μg / mL. Como um controle positivo, pTc foram tratados com 20 nmol / L de forbol-12-miristato-13-acetato em combinação 350 nmol / L ionomicina. Após incubação durante 24 horas a 37° C, as placas foram lavadas exaustivamente, incubadas com mAb de IFN-gama de coelho biotinilado anti-humano de durante 4 horas, lavou-se novamente, e incubados com estreptavidina- fosfatase alcalina durante 2 horas, seguido por um passo final de lavagem. Os pontos foram detectados por incubação com NBT / BCIP (Sigma-Aldrich) durante 1 hora, a reacção foi parada com água, e, após a secagem, manchas foram contadas microscopicamente. Os métodos foram descritos em detalhe em Schwitalle et al., 2008.[0041] Frequencies of FSP-specific peripheral T cells (PTC) were quantified by determining the number of IFN-gamma-specific secretory Tc against newly designed FSPs derived from 3 cms containing candidate genes using ELISpot analysis. ELISPOT assays were performed using 96-well nitrocellulose plates (Multiscreen; Millipore, Bedford, MA) coated overnight with mouse monoclonal anti-human IFN-gamma (mAb) antibodies (Mabtech, Nacka, Sweden) and blocked with medium containing serum. PTC (day 0, l x 105 /well) were plated 6 times with autologous CD40-activated B cells (4 x 104 /well, TIBC or PBC, respectively) as human AB serum on 200 l IMDM cells with 10% antigen-presenting. Peptides were added to a final concentration of 10 μg/mL. As a positive control, pTc were treated with 20 nmol/L phorbol-12-myristate-13-acetate in 350 nmol/L ionomycin combination. After incubation for 24 hours at 37°C, plates were thoroughly washed, incubated with biotinylated rabbit anti-human IFN-gamma mAb for 4 hours, washed again, and incubated with streptavidin-alkaline phosphatase for 2 hours. followed by a final wash step. Spots were detected by incubation with NBT / BCIP (Sigma-Aldrich) for 1 hour, the reaction was stopped with water, and, after drying, spots were counted microscopically. The methods were described in detail in Schwitalle et al., 2008.
[0042] Para examinar se as respostas de células T específicas do FSP eram detectáveis no sangue periférico de pacientes de CRC MSI-H, foi realizada análise de ELISpot. pBc autólogo, o qual mostrou alta expressão de MHC de classe I e II, e co-estimuladores (CD40, CD80, e CD86), assim como antígenos específicos célula B (CD19 e CD23) foram usadas como células apresentadoras de antígeno.To examine whether FSP-specific T cell responses were detectable in the peripheral blood of CRC MSI-H patients, ELISpot analysis was performed. Autologous pBc, which showed high MHC class I and II expression, and co-stimulators (CD40, CD80, and CD86) as well as B cell specific antigens (CD19 and CD23) were used as antigen-presenting cells.
[0043] Reações pronunciadas foram observadas contra FSPs recém-concebidos derivados de AIM2 (-1), HTOOl (-l), TAFlB (-l), e TGFBR2 (-1): TAFlB (-l) NTQIALNRGLKKKTILKKAGIGMCVKVSSIFFINKQKPHTOOl (-l) EIFLPKGRSNSKKKGRRNRIPAVLRTEGEPLHTPSVGMRETTGLGCAIM2 (-1) HSTIKVIKAKKKHREVKRTNSSQLVTGFBR2 (-1) ASPKCIMKEKKSLVRLSSCVPVALMSAMTTSSSQKNITPAILTCC (Sequências neopeptídica estão sublinhadas)Pronounced reactions have been observed against newly designed FSPs derived from AIM2 (-1), HTOOL (-l), TAFlB (-l), and TGFBR2 (-1): TAFlB (-l) NTQIALNRGLKKKTILKKAGIGMCVKVSSIFFINKQKPHTOOl (RNPLGLTRISKEIFLPK) (-1) HSTIKVIKAKKKHREVKRTNSSQLVTGFBR2 (-1) ASPKCIMKEKKSLVRLSSCVPVALMSAMTTSSSQKNITPAILTCC (Neopeptide sequences are underlined)
[0044] Os resultados obtidos a partir de doentes (n= 8) encontram-se resumidos na Tabela 1. Os resultados representativos ELISpot são mostrados na Figura 2.Tabela 1As respostas das células T específicas de FSP contra FSP
[0045] A média de números de ponto a partir de análises replicadas são dadas para cada peptídio, e testados individualmente. MSI01-MSI07 - pacientes com MSI-H CRC, MC01-MC06 - portador da mutação linhagem germica HNPCCsaudável. Exemplo 2Detecção de respostas imunológicas humorais específicas FSP-no sangue periférico de pacientes com câncer do cólon MSI e portadores da mutação HNPCC saudáveis(A) Métodos (ELISA)[0045] Mean point numbers from replicate analyzes are given for each peptide, and tested individually. MSI01-MSI07 - patients with MSI-H CRC, MC01-MC06 - carrier of the germline mutation HNPCC healthy. Example 2 Detection of FSP-specific humoral immune responses in peripheral blood of MSI colon cancer patients and healthy HNPCC mutation carriers(A) Methods (ELISA)
[0046] Para ensaio imunoenzimático (ELISA) ligado a enzima, os peptídios foram revestidos com placas de microtitulação de poliestireno "Maxisorp" de 96 poços (Nunc, Roskilde, Dinamarca) em uma concentração de 40 μg / ml em PBS durante a noite a 4 ° C. Após o revestimento, as placas foram lavadas 4 vezes com PBS (0,05% Tween) e bloqueadas durante 1 h com 0,5% de caseína em PBS. Peptídio ligando-se a placas de microtitulação e a concentração de saturação do peptídio ideal foram avaliadas utilizando um ensaio de competição de fosfatase alcalina-peptídio. Para monitorar o indivíduo reactividade de cada soro, um peptídio de controle de proteína derivado P16 INK4a (pl6_76- 105) foi utilizado, em relação ao qual não foi encontrada reatividade do anticorpo em um grande grupo de indivíduos (Reuschenbach et al., 2008). Cada soro foi diluído 1:100 em tampão (0,5% de caseína em PBS) de bloqueio e testado em duplicata quanto à presença de anticorpos contra todos os FSP e o peptídio de controle. Como referência para a variância inter-placa, um soro de controle foi incluído em cada placa, e ODs específicas de peptídeos de soro de controle foram utilizados para a normalização. Os soros diluídos (50 l / poço) foram incubadas durante 1 h, e depois de uma etapa de lavagem de placas foram incubados com anticorpo de coelho marcado com HRP anti-humano-IgG (Jackson Immunoresearch, West Grove, PA; 1: 1,0, 000 em tampão de bloqueio) durante 1 h. Após a lavagem, 50 l / poço de substrato de TMB (Sigma, Deisenhofen, Alemanha) foi adicionado e a reação enzimática foi parada após 30 minutos por adição de 50 l / poço de 1N de H2SO4. A absorção foi medida a 450 nm (comprimento de onda de referência 595 nm). Pré-absorção de anticorpos do soro de controle para a especificidade foi feito de acordo com o método descrito em detalhe em Reuschenbach et al., 2008.(b) ResultadosFor enzyme-linked immunosorbent assay (ELISA), peptides were coated with 96-well polystyrene microtiter plates "Maxisorp" (Nunc, Roskilde, Denmark) at a concentration of 40 μg/ml in PBS overnight at 4 °C. After coating, plates were washed 4 times with PBS (0.05% Tween) and blocked for 1 h with 0.5% casein in PBS. Peptide binding to microtiter plates and the optimal peptide saturation concentration were evaluated using a peptide-alkaline phosphatase competition assay. To monitor the individual reactivity of each serum, a P16-derived INK4a protein control peptide (p16_76-105) was used, for which no antibody reactivity was found in a large group of individuals (Reuschenbach et al., 2008) . Each serum was diluted 1:100 in blocking buffer (0.5% casein in PBS) and tested in duplicate for the presence of antibodies against all FSP and the control peptide. As a reference for inter-plate variance, a control serum was included in each plate, and peptide-specific ODs from control serum were used for normalization. Diluted sera (50 μl/well) were incubated for 1 h, and after a plate washing step were incubated with HRP-labeled rabbit antibody anti-human-IgG (Jackson Immunoresearch, West Grove, PA; 1:1 0.000 in blocking buffer) for 1 h. After washing, 50 l/well of TMB substrate (Sigma, Deisenhofen, Germany) was added and the enzyme reaction was stopped after 30 minutes by adding 50 l/well of 1N H2SO4. Absorption was measured at 450 nm (reference wavelength 595 nm). Pre-absorption of control serum antibodies for specificity was done according to the method described in detail in Reuschenbach et al., 2008.(b) Results
[0047] Para examinar se os anticorpos específicos do FSP eram detectáveis no sangue periférico de pacientes de CRC MSI-H, portadores saudáveis da mutação síndrome Lynch, e controles saudáveis. Análises ELISA foram realizadas. Reatividades pronunciadas foram observadas contra FSP recentemente concebidos derivados de AIM2 (-1), HTOOl (-l), TAFlB (-l), e TGFBR2 (-1). Os resultados de ELISA são apresentados na Figura 3.Exemplo 3Detecção de respostas de células T citotóxicas específicas de FSPTo examine whether FSP-specific antibodies were detectable in the peripheral blood of CRC MSI-H patients, healthy carriers of the Lynch syndrome mutation, and healthy controls. ELISA analyzes were performed. Pronounced reactivities were observed against newly designed FSP derivatives of AIM2(-1), HTO01 (-1), TAFlB (-1), and TGFBR2 (-1). ELISA results are shown in Figure 3.Example 3 Detection of FSP-specific cytotoxic T cell responses
[0048] A expressão de superfície CD107a em células efetoras T após estimulação com antígenos FSP clínicos foi medido. Ensaios CD107a são usados para demonstrar a secreção de granula citotóxico contendo perforina / granzima B a partir de células efectoras. Moléculas CD107a são expressas na superfície de granula citotóxico e se tornam detectáveis na superfície da célula, se granula são liberados no contexto de uma resposta citotóxica de células T.[0048] The surface expression of CD107a on effector T cells after stimulation with clinical FSP antigens was measured. CD107a assays are used to demonstrate the secretion of cytotoxic granula containing perforin/granzyme B from effector cells. CD107a molecules are expressed on the surface of cytotoxic granules and become detectable on the cell surface if granules are released in the context of a cytotoxic T cell response.
[0049] Para determinar o potencial dos peptídios FSP para induzir uma resposta imunológica celular citotóxica, o sangue foi colhido a partir de doadores saudáveis e as células T foram estimuladas com os FSP utilizando células dendríticas como células apresentadoras de antígeno. A estimulação foi repetida semanalmente e durante um intervalo de tempo de quatro semanas. Após quatro semanas, as células T foram colhidas e coincubadas com células alvo e ensaio FSP CD107a foi usada para analisar a indução específica do peptídio de uma resposta citotóxica de células T.To determine the potential of the FSP peptides to induce a cytotoxic cellular immune response, blood was collected from healthy donors and T cells were stimulated with the FSP using dendritic cells as antigen presenting cells. Stimulation was repeated weekly and over a period of four weeks. After four weeks, T cells were harvested and co-incubated with target cells and FSP CD107a assay was used to analyze peptide-specific induction of a cytotoxic T cell response.
[0050] Foram observadas respostas citotóxicas, tal como determinado por expressão CD107a na superfície das células T com as células B coincubadas como células apresentadoras de antígeno, na presença do antígeno FSP (Figura 4A). Respostas significativas foram observadas em diferentes doadores saudáveis, após a estimulação de células T com o antígeno durante quatro semanas. Respostas representativos são apresentados em gráficos de barras. A Figura 4B mostra a análise FACS do ensaio representativo CD107a por células T incubadas com as células B como as células apresentadoras de antígeno na ausência (painel da esquerda) ou na presença (painel da direita) do FSP antígeno HT001 (-1).[0050] Cytotoxic responses as determined by CD107a expression on the surface of T cells with B cells coincubated as antigen presenting cells were observed in the presence of FSP antigen (Figure 4A). Significant responses were observed in different healthy donors after stimulation of T cells with the antigen for four weeks. Representative answers are presented in bar graphs. Figure 4B shows FACS analysis of the representative CD107a assay by T cells incubated with B cells as antigen presenting cells in the absence (left panel) or in the presence (right panel) of FSP antigen HT001 (-1).
[0051] Cunningham and Wells, Science 244 (1989), 1081-1085.[0051] Cunningham and Wells, Science 244 (1989), 1081-1085.
[0052] Fingl et al., The Pharmocological Basis of Therapeutics, Goodman and Gilman, eds. acmillan Publishing Co., New York, pp. 1-46 (1975).[0052] Fingl et al., The Pharmocological Basis of Therapeutics, Goodman and Gilman, eds. acmillan Publishing Co., New York, pp. 1-46 (1975).
[0053] Kloor M, Michel S, von Knebel Doeberitz M.[0053] Kloor M, Michel S, von Knebel Doeberitz M.
[0054] Immune evasion of microsatellite unstable colorectal cancers.[0054] Immune evasion of microsatellite unstable colorectal cancers.
[0055] Int J Cancer. 2010 Mar 2. [Epub ahead ofprint][0055] Int J Cancer. 2010 Mar 2. [Epub ahead ofprint]
[0056] Linnebacher M, Gebert J, Rudy W, Woerner S,Yuan YP, Bork P, von Knebel Doeberitz M. Deslocamento doquadro peptide-derived T-cell epitopes: a source of noveltumor-specific antigens. Int J Cancer. 2001 Jul 1; 93 (1):6-11.Linnebacher M, Gebert J, Rudy W, Woerner S, Yuan YP, Bork P, von Knebel Doeberitz M. Peptide-derived T-cell epitopes frame shift: a source of noveltumor-specific antigens. Int J Cancer. 2001
[0057] Reuschenbach M, Waterboer T, Wallin KL,Einenkel J, Dillner J, Hamsikova E, Eschenbach D, Zimmer H,Heilig B, Kopitz J, Pawlita M, von Knebel Doeberitz M,Wentzensen N.Reuschenbach M, Waterboer T, Wallin KL, Einenkel J, Dillner J, Hamsikova E, Eschenbach D, Zimmer H, Heilig B, Kopitz J, Pawlita M, von Knebel Doeberitz M, Wentzensen N.
[0058] Characterization of humoral immune responses against pl6, p53, HPV16 E6 and HPV16 E7 in patients with HPV-associated cancers.[0058] Characterization of humoral immune responses against p16, p53, HPV16 E6 and HPV16 E7 in patients with HPV-associated cancers.
[0059] Int J Cancer. 2008 Dec 1; 123 (11) : 262631.[0059] Int J Cancer. 2008
[0060] Reuschenbach M, Kloor M, Morak M, Wentzensen N, Germann A, Garbe Y, Tariverdian M, Findeisen P, Neumaier M, Holinski-Feder E, von Knebel Doeberitz M.Reuschenbach M, Kloor M, Morak M, Wentzensen N, Germann A, Garbe Y, Tariverdian M, Findeisen P, Neumaier M, Holinski-Feder E, von Knebel Doeberitz M.
[0061] Serum antibodies against deslocamento do quadro peptides in microsatellite unstable colorectal cancer patients with Lynch syndrome.Serum antibodies against frame shift peptides in unstable microsatellite colorectal cancer patients with Lynch syndrome.
[0062] Fam Cancer. 2009 Dec 2. [Epub ahead of print][0062] Fam Cancer. 2009 Dec 2. [Epub ahead of print]
[0063] Ripberger E, Linnebacher M, Schwitalle Y, Gebert J, von Knebel Doeberitz M. Identification of an HLA- A0201-restricted CTL epitope generated by a tumor-specific deslocamento do quadro mutation in a coding microsatellite of the OGT gene. J Clin Immunol. 2003 Sep; 23 (5): 415-23.[0063] Ripberger E, Linnebacher M, Schwitalle Y, Gebert J, Knebel Doeberitz M. Identification of an HLA-A0201-restricted CTL epitope generated by a tumor-specific mutation frame shift in a microsatellite coding of the OGT gene. J Clin Immunol. 2003 Sep; 23 (5): 415-23.
[0064] Schwitalle Y, Kloor M, Eiermann S, Linnebacher M, Kienle P, Knaebel HP, Tariverdian M, Benner A, von Knebel Doeberitz M. Immune response against deslocamento do quadro-induced neopeptides in HNPCC patients and healthy HNPCC mutation carriers. Gastroenterology. 2008 Apr; 134 (4): 988-97.Schwitalle Y, Kloor M, Eiermann S, Linnebacher M, Kienle P, Knaebel HP, Tariverdian M, Benner A, von Knebel Doeberitz M. Immune response against frame-induced neopeptides in HNPCC patients and healthy HNPCC mutation carriers. Gastroenterology. 2008 Apr; 134 (4): 988-97.
[0065] Schwitalle Y, Linnebacher M, Ripberger E, Gebert J, von Knebel Doeberitz M. Immunogenic peptides generated by deslocamento do quadro mutations in DNA mismatch repair-deficient cancer cells. Cancer Immun. 2004 Nov 25; 4:14.[0065] Schwitalle Y, Linnebacher M, Ripberger E, Gebert J, Knebel Doeberitz M. Immunogenic peptides generated by frame shift mutations in DNA mismatch repair-deficient cancer cells. Cancer Immun. 2004 Nov 25; 4:14.
Claims (10)
Applications Claiming Priority (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| PCT/EP2012/005154 WO2014090265A1 (en) | 2012-12-13 | 2012-12-13 | Msi-specific frameshift peptides (fsp) for prevention and treatment of cancer |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| BR112015013737A2 BR112015013737A2 (en) | 2017-07-11 |
| BR112015013737B1 true BR112015013737B1 (en) | 2021-07-27 |
Family
ID=47552936
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| BR112015013737-7A BR112015013737B1 (en) | 2012-12-13 | 2012-12-13 | PEPTIDES WITH ALTERATION OF THE MSIE-SPECIFIC READING FRAME (FSP) FOR CANCER PREVENTION AND TREATMENT |
Country Status (5)
| Country | Link |
|---|---|
| KR (1) | KR101810840B1 (en) |
| CN (1) | CN104853764B (en) |
| BR (1) | BR112015013737B1 (en) |
| RU (1) | RU2644677C2 (en) |
| WO (1) | WO2014090265A1 (en) |
Families Citing this family (6)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP3630152A4 (en) * | 2017-06-02 | 2021-07-28 | Arizona Board of Regents on behalf of Arizona State University | Universal cancer vaccines and methods of making and using same |
| SG11202000250PA (en) * | 2017-07-12 | 2020-02-27 | Nouscom Ag | A universal vaccine based on shared tumor neoantigens for prevention and treatment of micro satellite instable (msi) cancers |
| US20200209241A1 (en) | 2017-09-15 | 2020-07-02 | Arizona Board Of Regents On Behalf Of Arizona State University | Methods of classifying response to immunotherapy for cancer |
| EP4038222A4 (en) | 2019-10-02 | 2023-10-18 | Arizona Board of Regents on behalf of Arizona State University | Methods and compositions for identifying neoantigens for use in treating and preventing cancer |
| AU2021279327A1 (en) | 2020-05-28 | 2022-12-22 | Hubro Therapeutics As | A peptide cocktail |
| EP4052716A1 (en) | 2021-03-04 | 2022-09-07 | Deutsches Krebsforschungszentrum - Stiftung des öffentlichen Rechts / Universität Heidelberg | Cancer therapy involving car-engineered t-cells and parvovirus h-1 |
Family Cites Families (4)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| EP0772619B2 (en) | 1994-07-15 | 2010-12-08 | The University of Iowa Research Foundation | Immunomodulatory oligonucleotides |
| AU2003232485A1 (en) * | 2002-04-18 | 2003-10-27 | Mtm Laboratories Ag | Neopeptides and methods useful for detection and treatment of cancer |
| JP4394724B2 (en) * | 2005-11-30 | 2010-01-06 | 株式会社癌免疫研究所 | Novel peptide compounds |
| ES2548391T3 (en) * | 2011-09-21 | 2015-10-16 | Ruprecht-Karls-Universität Heidelberg | MSI specific framework change peptides (FSP) for cancer prevention and treatment |
-
2012
- 2012-12-13 CN CN201280077683.XA patent/CN104853764B/en active Active
- 2012-12-13 WO PCT/EP2012/005154 patent/WO2014090265A1/en active Application Filing
- 2012-12-13 KR KR1020157015802A patent/KR101810840B1/en active IP Right Grant
- 2012-12-13 BR BR112015013737-7A patent/BR112015013737B1/en active IP Right Grant
- 2012-12-13 RU RU2015115785A patent/RU2644677C2/en active
Also Published As
| Publication number | Publication date |
|---|---|
| KR101810840B1 (en) | 2017-12-20 |
| WO2014090265A1 (en) | 2014-06-19 |
| RU2015115785A (en) | 2017-01-16 |
| BR112015013737A2 (en) | 2017-07-11 |
| CN104853764A (en) | 2015-08-19 |
| KR20150084060A (en) | 2015-07-21 |
| CN104853764B (en) | 2018-06-22 |
| RU2644677C2 (en) | 2018-02-13 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US10682402B2 (en) | MSI-specific frameshift peptides (FSP) for prevention and treatment of cancer | |
| RU2526510C2 (en) | Composition for treating lung cancer, first non-small cells lung cancer (nsclc) | |
| JP2020189866A (en) | Combination therapy with neoantigen vaccine | |
| BR112015013737B1 (en) | PEPTIDES WITH ALTERATION OF THE MSIE-SPECIFIC READING FRAME (FSP) FOR CANCER PREVENTION AND TREATMENT | |
| BR112020025764A2 (en) | neoantigens and their uses | |
| HUE030000T2 (en) | Composition of tumor-associated peptides and related anti-cancer vaccine for the treatment of gastric cancer and other cancers | |
| IL184273A (en) | Use of entraining and amplifying compositions in the manufacture of a medicament for immunization and a set of immunogenic compositions for inducing an immune response in a mammal | |
| EP2572725B1 (en) | MSI-specific frameshift peptides (FSP) for prevention and treatment of cancer | |
| JP2021038225A (en) | Cancer vaccine for cat | |
| JP2011506497A5 (en) | ||
| US9808504B2 (en) | Immunogenic epitopes as targets for universal cancer vaccines | |
| KR101665410B1 (en) | p16INK4a DERIVED PEPTIDES FOR PROPHYLAXIS AND THERAPY OF HPV-ASSOCIATED TUMORS AND OTHER p16INK4a EXPRESSING TUMORS | |
| JP5890769B2 (en) | MSI-specific frameshift peptides (FSP) for cancer prevention and treatment | |
| JP2016028025A (en) | Msi-specific frameshift peptides (fsp) for prevention and treatment of cancer | |
| AU2016201986B2 (en) | MSI-specific Frameshift Peptides (FSP) for Prevention and Treatment of Cancer | |
| CA2799803C (en) | Msi-specific frameshift peptides (fsp) for prevention and treatment of cancer | |
| US9566319B2 (en) | p16INK4a derived peptides for prophylaxis and therapy of HPV-associated tumors and other p16INK4a expressing tumors | |
| WO2018058490A1 (en) | Col14a1-derived tumour antigen polypeptide and use thereof | |
| RU2805196C2 (en) | Neoantigens and their application | |
| US20070232558A1 (en) | Methods and compositions for treating prostate cancer using dna vaccines directed to cancer testis antigen | |
| JP2024518616A (en) | Vaccines, their uses, and cancer vaccine mixtures | |
| Class et al. | Patent application title: COMPOSITION OF TUMOR-ASSOCIATED PEPTIDES AND RELATED ANTI-CANCER VACCINE FOR THE TREATMENT OF GASTRIC CANCER AND OTHER CANCERS Inventors: Jens Fritsche (Tuebingen, DE) Jens Fritsche (Tuebingen, DE) Toni Weinschenk (Aichwald, DE) Steffen Walter (Reutlingen, DE) Steffen Walter (Reutlingen, DE) Peter Lewandrowski (Tuebingen-Hirschau, DE) Peter Lewandrowski (Tuebingen-Hirschau, DE) Harpeet Singh (Tuebingen, DE) Assignees: IMMATICS BIOTECHNOLOGIES GMBH | |
| BRPI0400755A2 (en) | use of polypeptides and / or oligonucleotides, and vaccine composition |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| B08F | Application dismissed because of non-payment of annual fees [chapter 8.6 patent gazette] | ||
| B08G | Application fees: restoration [chapter 8.7 patent gazette] | ||
| B07D | Technical examination (opinion) related to article 229 of industrial property law [chapter 7.4 patent gazette] | ||
| B06F | Objections, documents and/or translations needed after an examination request according [chapter 6.6 patent gazette] | ||
| B07E | Notification of approval relating to section 229 industrial property law [chapter 7.5 patent gazette] |
Free format text: NOTIFICACAO DE ANUENCIA RELACIONADA COM O ART 229 DA LPI |
|
| B06U | Preliminary requirement: requests with searches performed by other patent offices: procedure suspended [chapter 6.21 patent gazette] | ||
| B07A | Application suspended after technical examination (opinion) [chapter 7.1 patent gazette] | ||
| B09A | Decision: intention to grant [chapter 9.1 patent gazette] | ||
| B16A | Patent or certificate of addition of invention granted [chapter 16.1 patent gazette] |
Free format text: PRAZO DE VALIDADE: 20 (VINTE) ANOS CONTADOS A PARTIR DE 13/12/2012, OBSERVADAS AS CONDICOES LEGAIS. |