AU6175800A - Interferon tau mutants and methods for making them - Google Patents

Interferon tau mutants and methods for making them

Info

Publication number
AU6175800A
AU6175800A AU61758/00A AU6175800A AU6175800A AU 6175800 A AU6175800 A AU 6175800A AU 61758/00 A AU61758/00 A AU 61758/00A AU 6175800 A AU6175800 A AU 6175800A AU 6175800 A AU6175800 A AU 6175800A
Authority
AU
Australia
Prior art keywords
ifn
protein
tau
cancer
amino acids
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Abandoned
Application number
AU61758/00A
Inventor
Christina Dancz Clark
Carol H. Pontzer
Lynnette H. Shorts
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
University of Maryland at Baltimore
Original Assignee
University of Maryland at Baltimore
University of Maryland at College Park
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by University of Maryland at Baltimore, University of Maryland at College Park filed Critical University of Maryland at Baltimore
Publication of AU6175800A publication Critical patent/AU6175800A/en
Abandoned legal-status Critical Current

Links

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/52—Cytokines; Lymphokines; Interferons
    • C07K14/555—Interferons [IFN]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
    • A61P1/16—Drugs for disorders of the alimentary tract or the digestive system for liver or gallbladder disorders, e.g. hepatoprotective agents, cholagogues, litholytics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P17/00—Drugs for dermatological disorders
    • A61P17/06—Antipsoriatics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P29/00—Non-central analgesic, antipyretic or antiinflammatory agents, e.g. antirheumatic agents; Non-steroidal antiinflammatory drugs [NSAID]
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P3/00—Drugs for disorders of the metabolism
    • A61P3/08—Drugs for disorders of the metabolism for glucose homeostasis
    • A61P3/10—Drugs for disorders of the metabolism for glucose homeostasis for hyperglycaemia, e.g. antidiabetics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/12—Antivirals
    • A61P31/14—Antivirals for RNA viruses
    • A61P31/18—Antivirals for RNA viruses for HIV
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00—Antineoplastic agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P37/00—Drugs for immunological or allergic disorders
    • A61P37/02—Immunomodulators
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides

Description

WO 00/78266 PCT/IB00/01080 Title INTERFERON TAU MUTANTS AND METHODS FOR MAKING THEM 5 Field of the Invention 10 The present invention is directed to the field of animal and human health, and more particularly to pharmacological uses of analogs or mutants of interferon-tau (IFN-T) that differ from native IFN-T because of substitutions of amino acids near the amino terminus of the IFN-T molecule that impart improved biological activity. The IFN-'r mutants described in this disclosure have low toxicity, retain the same or slightly 15 reduced antiviral activity compared with highly effective IFN-alpha, and have enhanced antiproliferative activity compared to native IFN-tau, making them useful in treating viral infections, cancer, and immune system diseases including autoimmune diseases. The present invention is also directed to a method for making novel recombinant proteins, especially interferons, interleukins, and cytokines, polypeptide 20 hormones and other biopharmaceuticals that have improved biological activity over known proteins and/or lower toxicity and/or increased stability. REFERENCES 25 1. Pestka, S., Langer, J. A., Zoon, K. C., and Samuel, C. E. (1987) Ann. Rev. Biochem. 56, 727-777 2. Spencer, T. E., Becker, W. C. George, P., Mirando, M. A., Ogle, T. F., and Bazer, F. W. (1995) Endocrin. 136, 4932-4944 3. Bazer, F. W., Spencer, T. E., and Ott, T. L. (1996) American J. Reprod. 30 Immunol. 35, 297-308 4. Imakawa, K., Anthony, R. V., Kazemi, M., Marotti, K. R., Polites, H. G., and Roberts, R. M. (1987) Nature 330, 377-379 5. Roberts, R. M., Cross, J. S. and Leaman, D. W. (1992) Endocr. Rev. 13, 432-452 35 6. Alexenko, A. P., Leaman, D. W., Li, J., and Roberts, R. M. (1997) J.
I
WO 00/78266 PCT/IB00/01080 Interferon Cytokine Res. 17, 769-799 7. Alexenko, A. P., Ealy, A. D., and Roberts, R. M. (1999) J. Interferon Cytokine Res. 19, 1335-1341 8. Subramaniam, P. S., Khan, S. A., Pontzer, C. H., and Johnson, H. M. (1995) 5 Proc. Natl. Acad. Sci. U. S. A. 92, 12270-12274 9. Pontzer, C. H., Yamamoto, J. K., Bazer, F. W., Ott, T. L., and Johnson, H. M. (1997) J. Immunol. 158, 4351-4357 10. Soos, J. M., Subramaniam, P. S., Hobeika, A. C., Schiffenbauer, J. and Johnson, H. M. (1995) J. Immunol. 155, 2747-2753 10 11. Radhakrishnan, R., Walter, L. J., Hruza, A., Reichert, P., Trotta, P. P., Nagabhushan, T. L., and Walter, M. R. (1996) Structure 4, 1453-1463 12. Senda, T., Saitoh, S.- I., and Mitsui, Y. (1995) J. Mol. BioL. 253, 187-207 13. Karpusas, M., Nolte, M., Benton, C. B., Meier, W., Lipscomp, W. N. and Goetz, S. (1997) Proc. Natl. Acad. Sci. U. S. A. 94, 11813-11818 15 14. Radhakrishnan, R., Walter, L. J., Subramaniam, P. S., Johnson, H. M., and Walter, M. R. (1999) J. Mol. Biol. 286, 151-162 15. Mitsui, Y., Senda, T., Shimazu, T., Matsuda, S., and Utsumi, J. (1993) Pharmacol. Ther. 58, 93-132 16. Runkel, L., Pfeffer, L., Lewerenz, M., Monneron, D., Yang, C. H., Murti, A., 20 Pellegrini, S., Geolz, S., Uz6, G., and Morgensen, K. (1998) J. Biol. Chem. 273, 8003-8008 17. Pontzer, C. H., Ott, T. L., Bazer, F. W., and Johnson, H. M. (1990) Proc. Natl. Acad. Sci. U. S. A. 87, 5945-5949 18. Li, J., and Roberts, R. M. (1994) J. Biol. Chem. 269, 24826-24833 25 19. Van Heeke, G., Ott, T. L., Strauss, A., Ammaturo, D., and Bazer, F. W. (1996) J. Interferon Cytokine Res. 16, 119-126 20. Swann, S. L., Bazer, F. W., Villarete, L. H., Chung, A., and Pontzer, C. H. 2 WO 00/78266 PCT/IB00/01080 (1999) Hybridoma 18, 399-405 21. Li, J., and Roberts, R. M. (1994) J. Biol. Chem. 269, 13544-13550 22. Pontzer, C. H., and Johnson, H. M. (1995) Meth. Neurosci. 24, 3-9 23. Zoon, K. C., Miller, D. M., Bekisz, J., zur Nedden, D., Enterline, J. C. 5 Nguyen, N. Y., and Hu, R-Q. (1992) J. Biol. Chem. 267, 15210-15219 24. Johnson, J. A., Hochkeppel, H-K., and Gangemi, J. D. (1999) J. Interferon Cytokine Res. 19,1107-1116 25. Aguet, M., Grobke, M., and Dreiding, P. (1984) Virol. 132, 211-216 26. Mogensen, K. E., Lewerenz, M., Reboul, J., Lutfalla, G., and Uz6, G. (1999) 10 J. Interferon Cytokine Res. 19, 1069-1098 27. Syed, R. S., Reid, S. W., Li, C., Cheetham, J. C., Aoki, K. H., et al. (1998) Nature 395, 511-516 28. Domanski, P., Nadeau, W. W., Platanias, L. C., Fish, E., Kellum, M., Pitha, P., and Colamonici, O. R. (1998) J. Biol. Chem. 273, 3144-3147 15 29. Harada, H., Taniguchi, T., and Tanaka, N. (1998) Biochimie 80, 641-650 30. Stancato, L. F., Yu, C-R., Petricoin, Ill, E. F., and Larner, A. C. (1998) J. Biol. Chem. 273, 18701-18704 31. Petricoin, II, E. F., Ito, S., Williams, B., Audet, S., Stancato, L. F. et al. (1997) Nature 390, 629-632 20 32. Uddin, S., Fish, E. N., Sher, D. A., Gardziola, C., White, M. F., and Platanias, L. C. (1997) J. Immunol. 158, 2390-2397 33. Barasoain, I., Portoles, A., Aramburu, J. F., and Rojo, J. M. (1989) J. Immunol. 143, 507-512 34. Arora, T., Floyd-Smith, G., Espy, M. J., and Jelinek, D. F. (1999) J. Immunol. 25 162, 3289-3297 35. Waine, G. J., Tymms, M. J., Brandt, E. R., Cheetham, B. F., and Linnane, A. W. (1992) J. Interferon Cytokine Res. 12, 43-48. 3 WO 00/78266 PCT/IB00/01080 INTRODUCTION The term "interferon" generically refers to a group of vertebrate glycoproteins and 5 proteins that are known to have various biological activities, including antiviral, antiproliferative, and immunomodulatory properties at least in the species of animal from which such substances are derived and sometimes the interferons have cross species activity. The following definition of interferon has been accepted by an international committee assembled to devise a system for the orderly nomenclature 10 of interferons: "To qualify as an interferon a factor must be a protein which exerts virus nonspecific, antiviral activity at least in homologous cells through cellular metabolic processes involving synthesis of both RNA and protein." Journal of Interferon Research, 1, pp. vi (1980). "Interferon" as used to describe the present invention shall be deemed to have that definition. The type I interferons (IFN-c, -j3, 15 co, and -- ) are a group of proteins produced by the body to defend cells by inhibiting viral replication and decreasing cell proliferation. IFN-alphas have been shown to inhibit various types of cellular proliferation. IFN.alpha.'s are especially useful against hematologic malignancies such as hairy 20 cell leukemia (Quesada, et al., 1984). Further, these proteins have also shown activity against multiple myeloma, chronic lymphocytic leukemia, low-grade lymphoma, Kaposi's sarcoma, chronic myelogenous leukemia, renal-cell carcinoma, urinary bladder tumors and ovarian cancers (Bonnem, et al., J. Bio. Response Modifiers 3:580(1984); Oldham, Hospital Practice 20:71(1985). The role of 25 interferons and interferon receptors in the pathogenesis of certain autoimmune and inflammatory diseases has also been investigated (Benoit, et al., J. Immunol 150(3):707(1993). IFN-alphas are also useful against various types of viral infections (Finter, et al., 30 Drugs 42(5):749(1991). Alpha interferons have shown activity against human papillomavirus infection, Hepatitis B, and Hepatitis C infections (Finter, et al., 1991; Kashima, et al., (Laryngoscope 98:334(1988); Dusheiko, et al. J. Hematology 3 (suppl.2):S199(1986); Davis, et al., N. EnglandJ. Med. 321:1501(1989). The journal articles listed in this application are all incorporated in their entirety. 35 4 WO 00/78266 PCT/IB00/01080 Interferons of the alpha type (IFN-cas) are FDA-approved for the treatment of several diseases, including chronic hepatitis B and C, genital warts, hairy cell leukemia, and Kaposi's sarcoma. They are in clinical trials for AIDS and cancers, including non Hodgkin's lymphoma and malignant melanoma (Mariano,T.M., Interferons: Principles 5 and Medical Applications, 1992, 129-138(1992), chronic myelogenous leukemia, cutaneous squamous cell carcinoma, and laryngeal papillomatosis (Baron, S., JAMA 10, 1375-83(1991). IFNs are also able to aid the body by acting in an immunomodulatory role. For 10 example, type I IFNs have been shown to increase macrophage phagocytic activity and nitrous oxide mediated killing as well as regulate IFN-y production (Reder, A.. Interferon Therapy of Multiple Sclerosis, 61-64, 485-492(1997). Like other type I interferons, IFN-t production has also been shown to increase natural killer cell activity (Tuo, W., American Joumrnal of Reproductive Immunology, 29, 26-34(1993). 15 However, IFN-ca therapy has its drawbacks, as patients often suffer side effects of the treatment, which may be severe. Side effects are dose-dependent, and low dose side effects include flu-like symptoms which frequently interfere with normal activity, while higher doses may induce nausea, vomiting, anorexia, and rashes (Pontzer, et 20 al., Cancer Res. 51:5304(1991). Extremely high doses appear to cause peripheral neuropathy and thrombocytopenia. It has also been previously demonstrated that in vivo treatment with IFN-3 and IFNa in humans and animals causes toxicity manifested as a number of side effects including fever, lethargy, tachycardia, weight loss, and leukopenia. These side effects often require (i) the interferon dose to be 25 reduced to levels that limit the effectiveness of treatment, or (ii) termination of the treatment. Thus, treatment with alpha interferons is constrained both by patient compliance and the inability to use high doses in a sustained fashion. Adverse effects of IFN-beta are similar to those seen with IFN-alpha. IFN-beta has been used for treatment of multiple sclerosis. 30 A more recently discovered type 1 interferon, interferon-tau (IFN-t), has lower toxicity than IFN-a. while also displaying antiviral and antiproliferative activities. Ovine IFN-r is a major conceptus secretory protein produced by theembryonic trophectoderm during the critical period of maternal recognition in sheep. It is produced and 35 secreted in large amounts for a short time prior to implantation. Its principle role in sheep and other ruminants is to prevent regression of the corpus luteum by inhibiting 5 WO 00/78266 PCT/IB00/01080 estrogen receptor upregulation and blocking the pulsatile secretion of prostaglandin F2 alpha. Relative to other interferons, ovine IFN-tau. shares about 45 to 68% amino acid 5 homology with Interferon-alpha and the greatest sequence similarity with the interferon-omega-s (IFN omega-s) of about 68%. Ovine IFN-T has about 50% sequence homology to interferon a,.with the closest homology in the carboxy terminal region of the molecule. Like IFN-alpha, FN-T also has five helices. The amino acid sequence for human IFN caA is provided as SEQ. ID NO. 1. The amino acid 10 sequence for native ovine IFN r Imod is provided as SEQ. ID NO. 2 and its nucleic acid sequence is SEQ. ID NO. 3. There has been significant interest in finding functionally important sites on Type I IFNs, and in developing novel IFNs with improved biological activity, significant cross 15 species activity and low toxicity for clinical use in treating immune diseases and cancer. SUMARY OF THE INVENTION 20 It is an object of the present invention to provide a method for making a recombinant protein having improved biological activity by changing one or more amino acids in a first protein with a known biological activity, which amino acids differ from corresponding amino acids in a structurally similar second protein having the desired biological activity, to the differing one or more amino acids found in the second 25 protein, in order to produce a compound with an improved biological activity. In a preferred embodiment the differing amino acids are in an area of the molecule with a known biological activity. The recombinant proteins can be any protein, especially interferons, interleukins, cytokines, polypeptide hormones or other biopharmaceuticals. In one embodiment, the first and second proteins are type one 30 interferons, including interferon tau, alpha and beta and omega. In another embodiment, the first protein is interferon-tau and the second protein is interferon alpha. It is a further object of this invention to provide recombinant proteins with enhanced 35 antiviral and/or antiproliferative activity, or lower cytotoxicity. In a further object of the invention, the amino acid substitutions are chosen by 6 WO 00/78266 PCT/IB00/01080 identifying solvent-exposed amino acids in the first and second proteins, and making amino acid substitutions in the first protein by inserting the differing solvent-exposed amino acids that were identified in the second protein. The first and second proteins in the method of the present invention may be from the same or different species, 5 and may be naturally occurring or non-naturally occurring. Another objective of the present invention is to provide novel interferon-tau mutant proteins with low cytotoxicity for use in treating or preventing cancer, immune system diseases including autoimmune diseases such as Type I diabetes mellitus, 10 rheumatoid arthritis, lupus erythematosus and psoriasis; and viral infections, or for any other use that interferons may generally be put to. The novel interferon-tau mutants of the present invention are identified by amino acid SEQ. ID NOs. 4-10, and 18-20. 15 It is another object to provide (a) a method for treating cancer or a tumor, comprising administering to an animal in need of such treatment, a therapeutically effective amount of a recombinant interferon tau protein selected from the group comprising amino acid sequences identified by SEQ. ID NOs. 4-10, and 18-20, sufficient to treat the cancer; including human adenocarcinoma, treat breast cancer, prostate cancer, 20 glioblastomas, melanomas, myelomas, lymphomas, leukemias, lung cancer, skin cancer, bladder cancer, kidney cancer, brain cancer, ovarian cancer, pancreatic cancer, uterine cancer, bone cancer, colorectal cancer, cervical cancer and neuroectodermal cancer, and premalignant conditions, including, without limitation, monoclonal gammapothies, dysplasia, including, without limitation, cervical and oral 25 dysplasia.. (b) a method of treating a viral disease, comprising administering to an animal in need of such treatment, a therapeutically effective amount of a recombinant interferon tau protein selected from the group comprising amino acid sequences identified by SEQ. ID NOs. 4-10, and 18-20, sufficient to treat the viral disease as 30 enumerated in the detailed description of this invention and including RNA and DNA viruses, HIV, and Hepatitis B and C, especially; (d) a method of decreasing tumor cell growth, comprising contacting tumor cells in vivo or in vitro, with a recombinant IFN tau protein selected from the group comprising amino acid sequences identified by SEQ. ID NOs. 4-10, and 18-20, at a concentration effective to decrease growth of 35 the tumor cells. 7 WO 00/78266 PCT/IB00/01080 DETAILED DESCRIPTION OF THE INVENTION DEFINITIONS: 5 Interferon: An interferon is a protein which exerts virus nonspecific, antiviral activity at least in homologous cells through cellular metabolic processes involving synthesis of both RNA and protein. Structural Similarity: For the purpose of the present disclosure, a first protein is 10 considered structurally similar to a second protein if the first and second proteins (1) bind to the same receptor, even though the affinity for the receptor may be different, or (2) if the first and second protein have the same or similar biological activity, or (3) if their X-ray crystallographic structures can be superimposed with a root mean square difference of 3 angstroms or less over any portion of the molecule, or (4) if the 15 two proteins have at least 25% identity as defined herein. Interferon-.tau. (IFN-tau.) refers to any one of a family of interferon proteins having greater than 70% amino acid sequence homology to the ovine IFN-taulmod having. Amino acid homology can be determined using, for example, the LALIGN program 20 with default parameters. This program is found in the FASTA version 1.7 suite of sequence comparison programs (Pearson, et al., 1988; Pearson, 1990; program available from William R. Pearson, Department of Biological Chemistry, Box 440, Jordan Hall, Charlottesville, Va.). Typically, IFN-tau. has at least one characteristic from the following group of characteristics: (a) expressed during embryonic/fetal 25 stages by trophectoderm/placenta, (b) anti-luteolytic properties, (c) anti-viral properties, and (d) anti-cellular proliferation properties. IFN-tau. can be obtained from a number of sources including cows, sheep, ox, and reportedly also in humans. Ovine interferon-.tau. (Ovine IFN-tau.) is a major conceptus secretory protein 30 produced by the embryonic trophectoderm during the critical period of maternal recognition in sheep. One form of interferon-tau is Ovine IFN-taulmod which is 172 amino acids in length (SEQ ID NO:2), and has a nucleic acid sequence as set forth in SEQ. ID.NO. 1. Because of redundancy in the genetic code, the base sequence for interferon tau Imod can be any base sequence that encodes the 172 amino acids of 35 SEQ. ID NO.2. Mutant (i.e., recombinant) interferon tau proteins of the present invention include but are not limited to proteins having one of the amino acid sequences set forth in SEQ 8 WO 00/78266 PCT/IB00/01080 ID NOS. 2, and 4-10. Mutant interferon tau DNA of the present invention is any nucleic acid sequence producing the mutant interferon tau proteins of the present invention, including but 5 not limited to SEQ. ID NOS. 11-17. Percent (%) identity, with respect to two amino acid sequences [or nucleic acid sequences], refers to the % of residues that are identical in the two sequences when the sequences are optimally aligned and no penalty is assigned to "gaps". In other 10 words, if a gap needs to be inserted into a first sequence to optimally align it with a second sequence, the % identity is calculated using only the residues that are paired with a corresponding amino acid residue (i.e., the calculation does not consider residues in the second sequences that are in the "gap" of the first sequence). Optimal alignment is defined as the alignment giving the highest % identity score. 15 Such alignments can be preformed using the "GENEWORKS" program. Alternatively, alignments may be performed using the local alignment program LALIGN with a ktup of 1, default parameters and the default PAM. Treating a disease refers to administering a therapeutic substance effective to reduce 20 the symptoms of the disease and/or lessen the severity of the disease or has other effects beneficial to the patient. DETAILED DESCRIPTION 25 In one preferred embodiment of the present invention, the inventive strategy involves changing amino acids near the amino terminus of mature ovine interferon-tau 1 mod (IFN-t) that are exposed to solvent and differ from the corresponding amino acid found in the same position in an human IFN-ctA (or other interferon alpha analog), to the amino acid found in human IFN-aA, in order to produce a compound with a better 30 ratio of therapeutic activity to toxicity than is found in either human IFN-aA or ovine IFN-r 1 mod. In the specific embodiments described here, ovine IFN-r isoform 1 mod (GenBank accession number P08316) was used, as was human IFN-ac type 2, also known as 35 type A or leukocyte interferon (GenBank accession number IVHUA2). However, changing the solvent-exposed amino acids of any class or isoform of IFN-T to the 9 WO 00/78266 PCT/IB00/01080 corresponding amino acids found in any class or isoform of IFN-a is covered by this invention. Furthermore, the invention covers changing multiple amino acids in an IFN-t to those found in an IFN-(a and all possible combinations of changes and changes in cytokines, polypeptide hormones, and biopharmaceuticals of any type. 5 Cytokines include: Monocyte Chemoattractant Protein- 1, lnterleukin-1 V, Interleukin 13, (IL-1V, IL-13, and IL-1ra), Interleukin-8 (IL-8), Interleukin-9 (IL-9), Interleukin-2 (IL-2), Interleukin-10 (IL-10), Intleukin-3 (IL-3), Interleukin-11 (IL-11), Interleukin-12 (IL-12), Interleukin-4 (IL-4), Interleukin-13 (IL-13), High Molecular Weight B Cell 10 Growth Factor (Interleukin-14), Interleukin-5 (IL-5), Human B Cell Growth Factor 12kDa (BCGF-12kDa), Interleukin-6 (IL-6), CD40 Ligand (CD40L), Tumour Necrosis Factor (TNF), Interleukin-7 (IL-7), Tumour Necrosis Factor-3, The Macrophage Colony-Stimulating Factor (M-CSF), Interferon-Gamma (IFN0, Granulocyte Macrophage Colony-Stimulating Factor (GM-CSF), Leukemia Inhibitory Factor (LIF), 15 Onocostatin M (OSM), Stem Cell Factor (SCF), Hepatocyte Growth Factor, Ciliary Neurotrophic Factor (CNTF),Neurotrophins, The Epidermal Growth Factor (EGF), Neu Differentiration Factor (NDF), Neuregulin (NRG) Family, Neu/ErbB-2 Receptor, Platelet-derived Growth Factor (PDGF), Erythropoietin, Granulocyte Colony Stimulating Factor, Insulin-like Growth Factors (IGFs), Granulocyte Colony 20 Stimulating Factor, Fibroblast Growth Factors (FGFs), Colony-Stimulating Factor-1 (CSF-1), Vascular Endothelial Growth Factor, Transforming Growth Factor-3 (TGF3), Endothelin. Embodiments of this invention include novel mutants of IFN-r that have increased 25 anti-proliferative effects and/or antiviral effects, without increased cellular toxicity compared to native IFN-T. These novel interferon mutants may thus have an improved therapeutic index compared to currently available interferon treatment. While the specific examples in the present invention are directed to mutants of ovine IFN-taulmod, the same substitutions of amino acids from human IFN-a(A or other 30 IFN-alpha, into human IFN tau can be made and are contemplated. Mutations in the human analog of IFN-tau will have the advantage of being potentially less antigenic than mutant ovine IFN-tau. The present invention is not limited to IFN-z. The present methods can be used to 35 improve biological activity of any interferon, interleukin, cytokine, chemokine, hormone, protein or peptide, for which the amino acid sequence is known and for 10 WO 00/78266 PCT/IB00/01080 which there is another structurally similar molecule having the desired biological activity, including naturally occurring or recombinant proteins. The structurally similar molecule can be a related protein or peptide that binds to the same receptor or chemical as the first protein that is to be modified, or that has the same or similar 5 biological activity. The present invention includes a method for making a recombinant protein having improved biological activity comprising: selecting a first protein for which the biological activity is to be improved, and for which the amino acid sequence is known, 10 identifying a second protein that is structurally similar to the first protein, which second protein has the desired biological activity, and for which the amino acid sequence is known; identifying one or more amino acids on the first protein that are different from the corresponding amino acids on the second protein; substituting one or more of the differing amino acids identified in the second protein for the 15 corresponding one or more amino acids in the first protein, to obtain the recombinant protein having improved biological activity. In another embodiment, the present invention includes a method for designing mutants that have improved biological activity by selecting a first protein for which the 20 biological activity is to be improved, and for which the amino acid sequence is known (such as ovine IFN-tau), and identifying a second protein that is structurally similar to the first protein, which second protein has the desired biological activity, and for which the amino acid sequences are known (such as IFN-alpha). It is then necessary to identify those amino acids on the first protein that are different from the 25 corresponding amino acids on the second protein. In a preferred embodiment, these amino acids are in a region of the first and second proteins that is known or suggested to be associated with the desired biological activity (such as the amino terminal region of interferon alpha). Once the differing amino acids have been identified, one or more of the differing amino acids identified in the second protein 30 (such as interferon alpha) are substituted for the corresponding one or more amino acids in the first protein (interferon tau). The amino acid substitutions are made, for example, by making one or more substitutions to the nucleic acid sequence of the first protein thereby making a mutated recombinant nucleic acid sequence including codons for the one or more substituted amino acids. Because of the redundancy of 35 the genetic code, multiple nucleic acid sequences for a given amino acid sequence can be easily identified without undue experimentation. The present invention can 11 WO 00/78266 PCT/IB00/01080 employ any nucleic acid sequence that encodes a desired protein. This recombinant nucleic acid thus encodes the recombinant protein having improved biological activity. The recombinant nucleic acid can then be translated in vivo or in vitro using methods known to those skilled in the art, to obtain the recombinant protein having 5 improved biological activity. The invention covers changing only one amino acid or multiple amino acids in the first protein to those found in the second protein, and all possible combinations of changes. Similarly the present invention includes a method for reducing undesirable biological properties by the obverse procedure. For example, replacing a toxic portion of interferon alpha with one or more specific amino 10 acids from interferon-tau. In a preferred embodiment, the site directed mutations are made in a known biologically active region of the first protein to be modified, based on differences between the protein to be modified and the biologically active region of the 15 structurally similar protein. In another embodiment of the present method, the first and second structurally similar proteins are both mutant proteins that have improved biological activity or lower toxicity or improved stability over their respective unmutated analog, and that 20 have different amino acids from each other. These mutants need not have been made according to the present invention described above, but could be, for example, fusion proteins that have improved biological activity over the corresponding native protein. To further improve the desired biological activity of the first mutant protein, biologically targeted nucleic acid substitutions are made to the first mutant protein so 25 that the new codon(s) encode one or more corresponding amino acids in the second mutant protein that are different, to thereby improve the biological activity of the first protein. In another embodiment, either the first or the second protein or both are fusion 30 proteins. In another embodiment, the fusion proteins are human/animal chimeric proteins. Site directed mutagenesis is one method for making the mutations to the native ovine IFN-taulmod DNA to make the desired specific amino acid substitutions in the first 35 protein. Other methods known to those skilled in the art can be used to make the required nucleic acid changes to produce codons that express the desired amino 12 WO 00/78266 PCT/IB00/01080 acids. In addition, the invention also includes synthesizing the desired recombinant protein either by amino acid synthesis, or nucleic acid synthesis followed by in vivo or in vitro translation to obtain the resultant final recombinant protein. These and other objectives will be apparent from the following description of the invention. 5 The resultant final recombinant protein is therefore not a fusion protein. Fusion proteins that combine a desired region of a first protein and a desired region of one or more other proteins have been disclosed in the prior art. One disadvantage of fusion proteins is that one or more of the fused regions may impart an undesirable 10 effect like increased antigenicity or cytotoxicity to the construct, in addition to the desired biological effect being sought. By changing large areas of a molecule at one time, as done in fusion proteins, it is much more likely that the structural integrity of the molecule will be disrupted or lost and that the biological activity will be similarly decreased. 15 One advantage of the present method for making recombinant proteins having improved biological activity is that it provides a much more refined method for making recombinant proteins having improved biological activity, compared to fusion proteins, buy making very specific biologically directed amino acid changes to the 20 first protein. The ovine IFN-r 1mod mutants (also referred to as IFN-tau mutants or IFN-tau recombinant proteins or tau mutants) described in this disclosure retain the low toxicity of native IFN-tau, and have enhanced antiproliferative activity against human 25 cell lines. Therefore in a preferred embodiment, the interferon tau mutants are useful for treating cancer and tumors as is further enumerated in the Utility section of this application. The IFN-tau mutants are also useful in treating any disease that respond to any type I interferon, including interferon alpha, beta, omega and tau, because the mutants of the present invention retain their binding capacity to the type I receptor 30 and have similar activity to the other interferons. These uses are more fully enumerated in the Utility section below, and include immune system diseases generally, and autoimmune diseases particularly. Because of the low toxicity of the interferon tau mutants compared to other interferons, the mutants are the drug of choice. Low toxicity of the interferon tau mutants also means that the mutants can 35 be administered at higher doses than other non-tau interferons, which is an additional advantage of the tau mutants. 13 WO 00/78266 PCT/IB00/01080 The interferon tau mutants were tested in the classic assay for antiviral activity in to Madin Darby Bovine Kidney (MDBK) cells in vitro. All of the mutants displayed some antiviral activity in this assay. They are also effective in treating human viral 5 infections, as all of them retain the low toxicity of native ovine IFN--r 1 mod and they have the same or only slightly reduced anti-viral activity on the bovine cell line. IFN-t, a relatively recent addition to the type I IFN family, appears to be without significant side effects in humans in phase I clinical trials for treatment of multiple 10 sclerosis (J. M. Soos, Harvard Univ., personal communication). IFN-T is therefore a less toxic alternative to IFN-a therapy. Toxicity associated with IFN-a was not seen with IFN-r on a variety of different cell lines including human WISH cells, mouse L929 cells, human peripheral lymphocytes and HIV-infected human peripheral lymphocytes. Furthermore, in vivo studies in mice have shown that IFN-a 15 associated toxicities, including lymphocyte depression and decrease in weight, were not seen with treatment by IFN-r (Reder, 1997). As observed for IFN-alphas, different IFN-tau subtypes exhibit different relative antiviral and antiproliferative activities (6). Several subtypes of ovine IFN-tau have 20 also been shown to have some degree of species cross-reactivity, such as is seen with human IFN-alpha BID (7). Further, the ovine IFN-taulmod subtype has been used at high concentrations in vitro without producing a decrease in Madin Darby bovine kidney (MDBK) or peripheral blood cell viability (8,9). In vivo, ovine IFN taulmod has effectively reduced the incidence and severity of murine experimental 25 allergic encephylomyelitis (EAE) without decreasing animal weight, white blood cell counts or lymphocyte function, complications that are observed with identical antiviral doses of murine IFN-alpha (10). Ovine IFN-taulmod also appears to be without significant side effects in humans in Phase I clinical trials for treatment of multiple sclerosis (J. M. Soos, Harvard Univ. - personal communication). Thus ovine IFN 30 taulmod retains its antiviral activity in humans across potential species barriers without causing cytotoxicity. Ovine IFN-tau 1 mod has also been shown to suppress papillomavirus E7 oncoprotein expression and increase p53 more effectively than did human IFN-alpha A or the hybrid IFN-alpha B/D (24). All of the tau mutants of the present invention can be used to treat the diseases listed above as they retain 35 antiviral activity, antiproliferative activity, low toxicity, and the ability to bind to type I receptor. 14 WO 00/78266 PCT/IB00/01080 Because of its low cytotoxicity, much interest has been generated in the medical community concerning the use of IFN-r in treating human conditions. The use of ovine and bovine IFN-r as antitumor agents is disclosed in US patent 5,958,402. 5 The use of ovine and bovine IFN-r as antiviral agents is disclosed in US patent 5,942,223. Recombinant production of human IFN-r and methods of using it to treat viral conditions and tumors are disclosed in US patents 5,705,363 and 5,738,845. Methods for using human IFN-t to treat autoimmune diseases, including multiple sclerosis are disclosed in US patents 5,906,816 and 6,060,450. The use of 10 interferons for treating fibromyalgia in humans is disclosed in US patent 6,036,949. Additionally, a hybrid IFN-/ IFN-a molecule comprising the amino terminal region of human IFN-t joined to a carboxyl terminal sequence of a non- IFN-r type I interferon is disclosed in US patent 5,939,286. All of these patents are incorporated herein in their entirety. All of the tau mutants of the present invention can be used to treat the 15 diseases listed above as they retain antiviral activity, antiproliferative activity, low toxicity, and the ability to bind to type I receptor. A. STRUCTURE The activity of the type I interferons generally is determined by structure. Although all 20 the type I IFNs share the same general structure, great sequence variation is seen even within the IFN-acs in humans (Lee, 1995). These sequence differences are probably responsible for minor structural differences and thus the variation in activity seen between the different IFNs. The primary amino acid sequence of ovine IFN-Tr shares 45-55% homology with a range of human, bovine, mouse, rat, and pig IFN-us, 25 30% homology with human IFN-P and 70% homology with bovine IFN-o (Roberts, 1991). There are at least 20 different forms of IFN-a (Johnson, 1994) and at least five different isoforms of IFN-t (Imakawa, 1987). There are nineteen amino acid residues conserved across all IFNs -c(x, -P and -o and these amino acids are identical in IFN-T (Roberts, 1992). 30 The structure of IFN-T was predicted to assume a conformation similar to the other type I IFNs, exhibiting a five-helix bundle). Human IFN-alpha (26), murine IFN-0 (Senda, T., EMBO Journal 11, 3193-3201(1992) and ovine IFN-t (14) have now been crystallized and their structures determined. The structure of ovine IFN-T consists of 35 five (a-helices designated Helix A (residues 4-24), B (53-74), C (80-100), D (116-133) 15 WO 00/78266 PCT/IB00/01080 and E (135-172) separated by loop regions AB, BC, CD, and DE, named for the helices they connect. Helices A and B are parallel to each other, but the remaining helices run antiparallel to each adjacent helix (Radhakrishnan, 1999). These designations vary slightly from those of IFN- 13. The greatest divergence between the 5 different IFNs occurs in the loop regions and the amino terminus. Despite the overall structural similarity between the type I IFNs, significant differences also exist. The greatest variations occur at the N-terminus (aa 6-7), helix A and the AB1 loop (aa 23-32), the AB3 loop (aa 49-52), helix B and the BC loop (aa 10 71-77). These regions are located on one face of the molecule and are thought to be directly involved in receptor binding. IFNs must interact with their cell surface receptors in order to elicit a response. There are two types of IFN receptors, one that interacts with the type I IFNs and one 15 that interacts with type II IFNs (Mariano, 1992). Both receptor types are transmembrane proteins in the type II family of cytokine receptors. Not all type I IFNs bind similarly to all cellular receptors. IFN-a binds the type I receptor with a much greater affinity than does IFN-z; this greater binding affinity was associated with maximal receptor occupancy. This increased occupancy has been further associated 20 with increased toxicity. This relationship is one possible explanation for the decreased cytotoxicity seen with IFN- . Previous mutagenesis studies on IFN-tau have focused on the C- terminus (18). Deletion of the C-terminal 11 residues significantly decreased antiviral and 25 antiproliferative activity, but had only a slight negative effect on receptor binding. An 11 amino acid C-terminal truncation and substitution at lysine 160 did not produce large changes in endometrial membrane receptor binding, but eliminate antiviral activity and reduce antiproliferative activity on human cell lines. The same study also showed that replacement of isoleucine with threonine in helix E significantly 30 lowered receptor binding affinity by 95%, reduced antiviral activity by 87%, and abolished antiproliferative activity completely. Li, ,J., The Joumal of Biological Chemistry, 269:40, 24826-24833(1994). Extensive structure function studies have been performed on the type I IFNs, to 35 identify the relationship between the conformation of the molecule and activity. Studies of synthetic peptides revealed that segments spanning amino acids 1-37, 62 16 WO 00/78266 PCT/IB00/01080 92 and 139-172 on the IFN-,r molecule that are important for antiviral activity (Pontzer, C., Joumrnal of Interferon Research 14, 133-41 (1994). This data indicates that the amino and carboxyl termini are both important for receptor binding and corresponds with the 3-dimensional structure of IFN-r, which shows that amino and 5 carboxyl termini are physically in close proximity (14). The potency of various IFNs has been suggested to be related to receptor binding affinity (25). Differential receptor binding may play a significant role in the different biological properties of type I IFNs. Previous structure-function studies on IFN-alpha 10 and IFN-tau support the working hypothesis that these regions are important for interferon activity. Extensive mutagenesis studies have pointed to loop AB as one of the "hot spots" for receptor binding and biological function (15). Mutations of human IFN-beta and IFN 15 alpha at positions 27 and 35, as well as at position 123 have been shown to reduce antiviral activity (16). Studies using peptides corresponding to various regions of IFN-tau have shown that residues 1-37 inhibit the antiviral activity of ovine IFN-tau on MDBK cells, but do not compete with hulFN-alpha2 to inhibit its activity (17). The amino termini of IFN-a and IFN-t show the greatest sequence dissimilarity and the 20 greatest divergence in structure (14); previous structure-function studies on IFN-aC and IFN-03 strongly suggest that these regions are important for interferon activity. It has been suggested that the N-terminus of IFN-r interacts with the type I IFN receptor in a distinct manner and is responsible for some of IFN-r's unique activity (8,17). 25 B. SELECTION AND DESIGN OF THE INTERFERON MUTANTS HAVING IMPROVED BIOLOGICAL ACTIVITY While previous studies showed site directed mutations in the carboxyl terminus had 30 virtually no effect on antiviral or antiproliferative activity (Li, 1994), it has now been discovered that certain carefully selected, single, biologically directed substitutions in the amino-terminal region of ovine IFN-taulmod unexpectedly increased antiproliferative activity of the corresponding mutant proteins on human cells while retaining antiviral activity, without increasing cytotoxicity, as will be discussed below. 35 17 WO 00/78266 PCT/IB00/01080 The examples below focus on six nonconserved residues within the N-terminus. The experimental strategy involved changing particular nonconserved amino acids in the well characterized native ovine IFN- T 1 mod which has AMINO ACID SEQ. ID NO. 2, and NUCLEIC ACID SEQ. ID NO. 1to those in corresponding positions in human 5 interferon alpha A (IFN-aA) which has AMINO ACID SEQ. ID NO.3. Changing the structure of ovine IFN- T 1 mod one amino acid at a time facilitated the assessment of the contribution of individual amino acids to IFN- r activity, as well as a comparison to see if substitution of any of the residues created a mutant interferon tau with increased antiviral or antiproliferative activity more like that of human IFN-aA. 10 Similar observations can be made by substituting more than one amino acid residue at a time to make these comparisons to interferon alpha. Likewise, similar site directed mutations can be made to compare the structure and/or biological activity of other mutants compared to any reference molecule. For example, ovlFN-rl mod can be mutated with reference to structurally similar regions of interferon beta or 15 interferon omega and other alpha interferons. Such mutants have clinically significant therapeutic uses in the treatment of a wide range of cancers and immune diseases including autoimmune diseases, that have been shown in previous studies to respond to treatment by interferon tau, interferon 20 alpha, interferon beta and other interferons having structural similarity to the interferon tau 1 mod mutants of the present invention, because it is clearly preferable to use an interferon that has the desired biological activity without cytotoxicity. Six mutants of IFN-taulmod have been constructed. It was decided to select for 25 substitution, those amino acids in the N terminal region of native ovine IFN-tau that are exposed to solvent AND that differ from the corresponding solvent-exposed amino acid on human Interferon alpha. Those amino acids in the N-terminal region of each molecule that were exposed to solvent were identified based on the structure (predicted or crystallized structure). The amino acids exposed to solvent were 30 compared and the amino acids in this group that were different between interferon tau and alpha were identified. Six mutations were made in interferon tau, one amino acid at a time, chosen from the solvent-exposed amino acids that were different between IFN-tau and IFN-alpha. The mutations were created using site directed mutagenesis to specifically convert one specific amino acid in ovine IFN-.rl mod to 35 the amino at the corresponding position in human IFNIaA by changing the DNA codon. Other methods of making the appropriate DNA for the tau mutants known to 18 WO 00/78266 PCT/IB00/01080 those skilled in the art can be used. Three mutations were at sites within helix A and three within the AB loop where the solvent exposed amino acid sequence of ovine IFN-l mod was shown to differ from to the amino acid at the corresponding position in human IF(NaA. 5 The mutations identified by their amino acid sequences are: THE 13 E:R MUTANT AMMINO ACID SEQ. ID NO.4, NUCLEIC ACID SEQ. ID NO. 11, THE 16 K:M MUTANT, AMMINO ACID SEQ. ID NO. 5, 10 NUCLEIC ACID SEQ. ID NO. 12 THE 19 D:A MUTANT AMMINO ACID SEQ. ID NO. 6, NUCLEIC ACID SEQ. ID NO. 13, THE 24 L:I MUTANT AMINO ACID SEQ. ID NO.7; NUCLEIC ACID SEQ. ID NO. 14 15 THE 26 P:L MUTANT AMINO ACID SEQ. ID NO. 8, NUCLEIC ACID SEQ. ID NO. 15; THE 31 Q:K MUTANT AMINO ACID SEQ. ID NO. 9, NUCLEIC ACID SEQ. ID NO. 16; and THE 34 K:H MUTANT AMINO ACID SEQ. ID NO. 10, 20 NUCLEIC ACID SEQ. ID NO. 17 THE 5 R:Q MUTANT AMINO ACID SEQ. ID NO. 18, THE 6 K:T MUTANT AMINO ACID SEQ. ID NO. 19, THE 20R:Q MUTANT AMINO ACID SEQ. ID NO. 20, 25 It is important to emphasize that due to redundancy in the genetic code, the nucleic acid sequences set forth above are only one of many nucleic acid sequences for each respective mutant. Other IFN-tau mutants that were identified but not made are 5 R:Q which has the same amino acid sequence as native ovine IFN-taulmod in SEQ. ID No. 2, except for having a glycine (GLN) residue instead of an arginine 30 (ARG) at position 5; 6 K:T which has the same amino acid sequence as native ovine IFN-taulmod in SEQ. ID No. 2, except for having a threonine residue instead of a lysine at position 6; and 20 R:Q which has the same amino acid sequence as native ovine IFN-taulmod in SEQ. ID No. 2, except for having a glycine residue instead of an arginine at position 20. The 5, 6 and 20 IFN-tau mutants also come within the 35 present invention. 19 WO 00/78266 PCT/IB00/01080 Specific residues within helix A and the AB loop that affect antiproliferative and/or antiviral activity were identified by testing each mutated IFN-tau. Antiproliferative and/or antiviral activity were not equally affected by the six particular mutations as is discussed below. Changes in antiproliferative activity were cell type specific. Thus 5 this invention includes designing novel proteins to specifically target a type of normal or malignant cell. Normal cells to be targeted include but are not limited to inflammatory cells, sex cells, or any excessively dividing or excessively functioning cells. One mutant, 26P:L, displayed both antiviral and antiproliferative potency equivalent to that of the human IFN-a, while maintaining the lack of in vitro 10 cytotoxicity of ovine IFN-Tl1mod. None of the N-terminal mutants examined had altered cytotoxicity profiles, suggesting that these mutants have superior therapeutic activity. The present invention includes the IFN-tau mutants described above, but further 15 includes any substitutions into the mutant selected from differing amino acids in any region of interferon alpha or other type 1 interferon including interferon beta or omega. The present invention further includes as a region of biological activity, any binding sites and other regions of a molecule that are involved in proper folding or structural integrity of the molecule, or receptor binding or activation. 20 C. RECOMBINANT PRODUCTION OF INTERFERON TAU MUTANTS Recombinant OvinelFNti mod mutant proteins were produced using bacterial and yeast cells. Details are set forth in Example 1. 25 Construction of ovinelFN-taul mod Mutagenesis/Expression vector For construction of the ovlFN-taulmod mutagenesis/expression vector, the gene for ovlFN-l1mod was amplified by PCR using Taq polymerase (Stratagene, La Jolla, CA) and cloned into the E. coli vector pCR2.1 (Stratagene TA cloning kit) before ultimately being cloned into the Kpn I site of the E. coli-yeast shuttle vector pPICZ 30 alpha (Invitrogen). [Example 1]. For expression of recombinant interferon polypeptides, thechimeric coding sequence can be placed in a number of bacterial expression vectors: for example, lambda gtl 1 (Promega, Madison, Wis.); pGEX (Smith, D. B., et al., 1988); pGEMEX (Promega); 35 and pBS (Stratagene, La Jolla, Calif.) vectors. Other bacterial expression vectors containing suitable promoters, such as the T7RNA polymerase promoter or the tac 20 WO 00/78266 PCT/IB00/01080 promoter, may also be used. Cloning of the Ovine IFN-tau. polynucleotide into a modified pIN Ill omp-A expression vector is also possible. Other yeast vectors can be used in the practice of the present invention. They 5 include 2 micron plasmid vectors , yeast integrating plasmids , YEP vectors, yeast centromere plasmids, and the like known to those skilled in the art. The AOX promoter is particularly useful in Pichia pastoris host cells (for example, the AOX promoter is used in pHIL and pPIC vectors included in the Pichia expression kit, available from Invitrogen, San Diego, Calif.). 10 Additional yeast vectors suitable for use with the present invention include, but are not limited to, other vectors with regulatable expression .The yeast transformation host is typically Saccharomyces cerevisiae, however, other yeast suitable for transformation can be used as well (e.g., Schizosaccharomyces pombe, Pichia 15 pastoris and the like. The DNA encoding the IFN-tau. polypeptide can be cloned into any number of commercially available vectors to generate expression of the polypeptide in the appropriate host system. These systems include the following: baculovirus 20 expression; plant cell expression, transgenic plant, and expression in mammalian cells (Clontech, Palo Alto Calif.; Gibco-BRL, Gaithersburg Md.). A number of features can be engineered into the expression vectors, such as leader sequences, which promote the secretion of the expressed sequences into culture medium. The recombinantly produced polypeptides are typically isolated from lysed cells or culture 25 media purification can be carried out by methods known in the art including salt fractionation, ion exchange chromatography, and affinity chromatography. Immunoaffinity chromatography can be employed using antibodies generated based on the IFN-tau. polypeptides. 30 Site-Directed Mutagenesis is one way to introduce the necessary mutations into ovine IFN-taulmod DNA to effect the requisite amino acid substitutions. Other methods are known to those skilled in the art. Six mutations were introduced using the Quickchange Site Directed Mutagenesis kit (Stratagene) following manufacturers instructions. Briefly, primers containing the desired base changes were synthesized 35 by Bioserve (Laurel, MD) or Integrated DNA Technologies (Coralville, IA). They were added to 50-100 ng of pPICZalpha containing the gene for ovIFN-taulmod with Pfu 21 WO 00/78266 PCT/IB00/01080 turbo polymerase (Stratagene) in a 50 micro liters reaction and cycled to incorporate the desired base change(s). Each reaction was optimized for each set of primers. Five micro liters of the PCR reaction was run on a 1% agarose gel to visualize the product. The remaining reaction was digested with Dpn I for 1 hour, purified, and 5 used to transform XL-1 Blue Ultracompetent cells (Stratagene). Transformants were selected on low salt LB in the presence of zeocin (Invitrogen). Plasmid DNA from transformants was extracted with phenol- chloroform and ethanol precipitated. The incorporation of the correct mutations was verified by dideoxy sequencing. 10 Production of Mutant IFN-tau Proteins in P. pastoris-E. coil Mutant IFN-tau proteins were produced in P. pastoris-E. coli carrying the recombinant plasmid. Plasmid DNA was linearized and used to transform P. pastoris. Yeast colonies containing the desired gene were selected and grown. Proteins were secreted into the media and purified by ammonium sulfate precipitation and anion 15 exchange column chromatography. The concentration of IFN-tau and mutant IFN tau proteins was measured using the BCA protein assay (Pierce). The protein can be further purified by standard methods, including size fractionation (column chromatography or preoperative gel electrophoresis) or affinity chromatography (using, for example, anti-ovine IFN-tau. antibodies (solid support available from 20 Pharmacia, Piscataway N.J.). Protein preparations can also be concentrated by, for example, (Amicon, Danvets, Mass.), HPLC, capillary electrophoresis or other protein purification methods known or that may become known may be used. Purified proteins were analyzed using Ovine IFN-taulmod Mutant Protein Immunoblots. All of the immunoblots had a single 19 KD band indicating the production of a 172 amino 25 acid protein. E. TOXICITY OF THE INTERFERON TAU MUTANTS Viability of IFN-tau Mutant-Treated Cells-As has previously been shown with peripheral blood lymphocytes, U937 cells exhibited significantly reduced viability 30 when treated with human IFN-alpha A as compared with ovine IFN-taulmod. All of the IFN-tau mutant proteins exhibited low in vitro cytotoxicity profiles similar to that of the parental ovlFN-taulmod that suggests this region may not be involved in the reduced cytotoxicity of ovine IFN-taulmod. Because all of the mutants showed roughly the same low toxicity profile of unmodified ovlFN-taul mod, and because the 35 point mutations were all in the N-terminal region of the molecule, the results suggest 22 WO 00/78266 PCT/IB00/01080 that this region is probably not involved in the reduced cytotoxicity of ovine IFN taul mod, rather it affects potency. F. ANTIPROLIFERATIVE ACTIVITY OF INTERFERON TAU MUTANTS 5 The ability of IFNs to decrease cell proliferation is an important and well documented phenomenon that has been tested in many human and animal cell lines. The various mutants to ovine IFN-tl1mod in the N-terminal region had cell type-specific effects on antiproliferative activity. Nonetheless, each of the mutants maintained equivalent antiproliferative activity relative to the parental IFN-t on at least one cell line. 10 Antiproliferative activity was measured on two adherent cell lines, MCF-7 (breast adenocarcinoma) and HT-29 (colon adenocarcinoma), and one suspension cell line, Daudi (Burkitt lymphoma). Antiproliferative activity is measured as the percent of cells grown in the presence of IFN divided by the number of cells grown in the absence of IFN. It is understood that testing mutant proteins made according to the 15 present invention involves only routine screening against various known cell lines, or cell lines established for any given patient, using methods known to those skilled in the art. Thirty-three units of ovlFN-l mod (.06 nM) caused a 54% decrease in proliferation of 20 Daudi cells. IFN-a caused an even greater decrease in proliferation of 69%. Four of the mutants were tested on Daudi cells. These are 13 E:R, 16 K:M, 26 P:L, and 34 K:H. Importantly, all four of these tau mutants reduced the cell numbers as well as, or better, than did ovIFN- -t1mod with the 26P:L mutant exhibiting the greatest antiproliferative activity. This mutant caused an 81% decrease in cell number as 25 compared to cells in media alone, an activity profile similar to that of the IFNa without the cytotoxicity, which gives the 26 tau mutant a high therapeutic index for treating cancer and tumors. The 16 K:M and 34K:H mutants also produced statistically significant decreases in 30 tumor cell proliferation indicating that they had statistically significant increases in antiproliferative activity compared to native IFN-tau, making them also clinically useful anticancer and antitumor agents with a high therapeutic index. Both the 16 and 34 mutants were significantly more effective than native IFN T and nearly as effective as IFNa without the toxicity. 35 23 WO 00/78266 PCT/IB00/01080 Two additional adherent cell lines, HT-29 and MCF-7, were used to test the same property. These cell lines are not as sensitive to type I IFNs and required much higher doses to inhibit cell growth. All but one of the mutants significantly decreased cell number of HT-29 cells compared to control. The 26 P:L mutation significantly 5 increased antiproliferative activity relative to wildtype IFN-r, again without increasing cytotoxicity, suggesting that this position contributes to overall function of IFN-r. All of the mutants inhibited proliferation of MCF-7 cells compared to controls; however, the activity of the mutants did not significantly differ from that of ovine IFN 10 tlmod. As seen previously, the IFN-T 26P:L mutant had the greatest antiproliferative activity. G. BINDING OF THE INTERFERON TAU MUTANTS TO TYPE I RECEPTOR 15 Binding to the Type I IFN Receptor-Binding of 125 I-ovlFN--rlmod to the common type I IFN receptor was most efficiently displaced by human IFNcIaA (Fig. 1). OvIFN T1 mod itself produced only half of the displacement seen with the IFNcX. The majority of the AMINO ACID substitutions introduced to create the IFN-'r mutants decreased the ability of the mutant proteins to displace the labeled ovlFN-Trl1mod; this decrease 20 was statistically significant with the 24L:1 and 34K:H mutants. By contrast, the P:L substitution at residue 26 significantly increased competition of labeled ovlFN-'r1lmod binding, though still not to the same extent as did the human IFNaA. The potency of various IFNs has been suggested to be related to receptor binding 25 affinity (25). The reduced antiproliferative potency and reduced toxicity of ovlFN rlmod relative to human IFNT on MDBK cells has been seen as a reflection of Kd, 3.90 x 10
-
10 and 4.45 X 10 - 1 1 for IFN-Tr and a, respectively (8). Hence, the enhanced receptor binding of the IFN-r 26 P:L mutant relative to the parental IFN-r may be predictive of enhanced biological activity or potency. 30 H. ANTIVIRAL PROPERTIES OF THE INTERFERON TAU MUTANTS The antiviral activity of the six IFN-t mutants was measured using a standard cytopathic effect inhibition assay using MDBK cells and vesicular stomatitis virus 35 (VSV; 22). Antiviral activity was normalized based on the reference IFN-alpha 24 WO 00/78266 PCT/IB00/01080 Gxa01-901-535. One unit of antiviral activity is defined as the amount of protein needed to inhibit the cytopathic effect of VSV by 50%. All the mutants possessed antiviral activity to some extent. The activity of the IFN-t 26P:L mutant was 9.5 x 107 U/mg, which is as great as that of both ovine IFN-taul mod and IFN-alpha. 5 The activity of four other mutants, 16K:M, 19D:A, 24L:1, and 34K:H, exhibited significantly reduced the antiviral activity relative to the parental IFN * controls. The least active mutant was 13E:R, having 3.2 x 104 U/mg. 10 In a preferred embodiment, the IFN-t 26P:L mutant having improved antiviral activity is administered in therapeutically effective amounts to treat viral infections, including, hepatitis B and C, genital warts, cytomegalovirus infections. The present invention is not limited to amino acids substitutions in the first protein 15 that increase antiproliferative or antiviral activity but include any substitutions that improve any measurable biological activity, such as improved receptor binding, decreased toxicity, improved molecular stability, or improved affinity for antibodies. The improved biological activity may be decreased receptor binding in some circumstances. 20 I. UTILITY A. Reproductive Although IFN-tau. bears some similarity to the IFN-alpha. family based on structure and its potent antiviral properties, the IFN-alphas- do not possess the reproductive 25 properties associated with IFN-tau.. For example, recombinant human IFN-alpha. had no effect on interestrous interval compared to IFN-tau., even when administered at twice the dose (Davis, et al., 1992). Therefore, although IFN-tau. has some structural similarities to other interferons, it 30 has very distinctive properties of its own: for example, the capability of significantly influencing the biochemical events of the estrous cycle. The IFN-tau. mutants of the present invention can be used in methods of enhancing fertility and prolonging the life span of the corpus luteum in female mammals as 35 generally described in Hansen, et al., 1991, herein incorporated by reference. Further, the mutants. of the present invention could be used to regulate growth and 25 WO 00/78266 PCT/IB00/01080 development of uterine and/or fetal-placental tissues in animals. Mutants may also be used as contraceptives in animals. B. Antiviral Agent 5 Type I interferons exhibit potent antiviral properties. The antiviral activity of native IFN-tau. has broad therapeutic applications without the toxic effects that are usually associated with IFN-alphas. The IFN-tau mutants of the present invention were found to exert their antiviral activity without adverse toxic effects on human cell lines. This 10 lack of cytotoxicity sets IFN-tau and these mutant IFN-tau proteins apart from most other known antiviral agents and all other known interferons. Formulations comprising the IFN-tau.mutants of the present invention can therefore be used to treat or prevent viral infections, including hepatitis B and C, AIDS, meningitis, TB, hepatitis B and C, HIV , cutaneous viral infections (chickenpox, herpes zoster, 15 measles), respiratory viral infections, viral diseases of the central nervous system, viral diseases of the liver, viral diseases of the salivary glands, infectious mononucleosis, and genital warts. Since interferons increase macrophage activity, they may also be useful in the treatment of additional bacterial, fungal and parasitic diseases. 20 The IFN-tau mutants are especially useful against human papillomavirus infection, Hepatitis B, and Hepatitis C infections where interferon alpha, which binds to the same receptor as IFN-tau, is known to be effective. (Finter, et al., 1991; Kashima, et al., (Laryngoscope 98:334(1988); Dusheiko, et al. J. Hematology 3 25 (suppl.2):S199(1986); Davis, et al., N. England J. Med. 321:1501(1989). The journal articles listed in this application are all incorporated in their entirety. C. Anticellular Proliferation Properties 30 Type I interferons exhibit potent anticellular proliferation activity. The IFN-r mutants described herein can also be used to inhibit cellular growth without the negative side effects associated with other interferons. Formulations comprising the mutant interferon<- compounds of the subject invention can be used to inhibit, prevent, or 35 slow tumor or cancer growth. 26 WO 00/78266 PCT/IB00/01080 The development of certain tumors is mediated by estrogen. Previous studies show that IFN-tau. can suppress estrogen receptor numbers. US 5,939,286. Therefore, IFN-tau mutant.-containing compositions can also be used in the treatment or prevention of estrogen-dependent tumors. 5 The antiproliferative properties of IFN-tau mutants together with its low toxicity make it useful in the treatment of cancer, malignant tumors, and precancerous tumors. As to neoplasia treatment, the compounds of the invention can be used to treat a variety of preneoplastic and neoplastic conditions, including both soft (e.g. hematolymphoid) 10 and solid tumors (e.g. carcinomas and sarcomas). More specifically, the compounds of the invention can be used to treat breast cancer, prostate cancer, glioblastomas, melanomas, myelomas, lymphomas, leukemias, lung cancer, skin cancer, bladder cancer, kidney cancer, brain cancer, ovarian cancer, pancreatic cancer, uterine cancer, bone cancer, colorectal cancer, cervical cancer and neuroectodermal cancer, 15 and premalignant conditions, including, without limitation, monoclonal gammapothies, dysplasia, including, without limitation, cervical and oral dysplasia. Interferons are known to be especially effective in the treatment of hairy-cell leukemia (Quesada, J. R. et al., N. EnglandJ. Med. 310:15 (1984). Further, these proteins have also shown activity against multiple myeloma, chronic lymphocytic leukemia, low-grade 20 lymphoma, chronic myelogenous leukemia, renal-cell carcinoma, urinary bladder tumors, and ovarian cancers. The interferon-tau mutants are especially useful in treating Kaposi's sarcoma, non Hodgkin's lymphoma and malignant melanoma (Mariano,T.M., Interferons: Principles 25 and MedicalApplications, 1992, 129-138(1992), chronic myelogenous leukemia, cutaneous squamous cell carcinoma, and laryngeal papillomatosis. Other cancers that can be treated with the mutants of the present invention include ocular-retinoblastoma, intraocular melanoma, oropharyngeal, paranasl sinus and 30 nasal cancers, hypopharyngeal, laryngeal, salivary gland, occult primaray mesotelioma (Squamous Cell), Non-Small Cell Lung cancer, Small-Cell Lung cancer, Maligant Thymoma, Maligant Mesthelioma, Esophageal cancer , Gastric cancer, Primary Live cancer, Intrahepatic Bile Duct cancer, Extrahepatic Bile Duct cancer, and cancers of the Gallbladder, Pancreatic, Small Intestine, Gastrointestinal 35 Carcinoid, Colon, Rectal, Anal Canal & Anus, Renal Cell, Transitional Cell of Renal Pelvis and Ureter, Bladder, Urethral, Prostate, Penile , Testicular, Extragonadal & 27 WO 00/78266 PCT/IB00/01080 Gonadal Germ Cell Tumors, Ovarian Epithelial, Ovarian Low Malignant Potential Tumor, Ovarian Germ Cell, Endometrial, Uterine Sarcoma, Gestational Trophoblastic, Cervical, Vaginal, Vulvar, Melanoma,Skin,Adult Soft Tissue Sarcoma, Endroctrine including Thyroid, Islet Cell Neoplasia, Adrencortical, Phechromocytoma, 5 Carcinoma of Unknown Primary origin, Hematolgic Neoplasms including Acute Myeliod, Chronic Myelogenous, Hairy Cell, and Hodgkin's. D. Immune System Disorders 10 Diseases which may be treated using methods of the present invention include autoimmune, inflammatory, proliferative and hyperproliferative diseases, as well as cutaneous manifestations of immunologically mediated diseases. In particular, methods of the present invention are advantageous for treating conditions relating to immune system hypersensitivity. There are four types of immune system 15 hypersensitivity .Type I, or immediate/anaphylactic hypersensitivity, is due to mast cell degranulation in response to an allergen (e.g., pollen), and includes asthma, allergic rhinitis (hay fever), urticaria (hives), anaphylactic shock, and other illnesses of an allergic nature. Type II, or autoimmune hypersensitivity, is due to antibodies that are directed against perceived "antigens" on the body's own cells. Type Ill 20 hypersensitivity is due to the formation of antigen/antibody immune complexes which lodge in various tissues and activate further immune responses, and is responsible for conditions such as serum sickness, allergic alveolitis, and the large swellings that sometimes form after booster vaccinations. Type IV hypersensitivity is due to the release of lymphokines from sensitized T-cells, which results in an inflammatory 25 reaction. Examples include contact dermatitis, the rash of measles, and "allergic" reactions to certain drugs. Autoimmune diseases that can be treated with the IFN-t mutants include but are not limited to, multiple sclerosis, systemic lupus erythematosus, and type I diabetes 30 mellitus, alone or in conjunction with other treatments known to be effective in treating auto-immune diseases, including, but not limited to, corticosteroids. Additionally the IFN-t mutants may be used to prevent graft-versus-host reactions, both alone and in combination with other pharmaceutical preparations known to be useful in preventing graft-versus-host reactions, including, but not limited to, 35 cyclosporine and corticosteroids. 28 WO 00/78266 PCT/IB00/01080 Autoimmune disorders may be loosely grouped into those primarily restricted to specific organs or tissues and those that affect the entire body. Examples of organ specific disorders (with the organ affected) include multiple sclerosis (myelin coating on nerve processes), type I diabetes mellitus (pancreas), Hashimotos thyroiditis 5 (thyroid gland), pernicious anemia (stomach), Addison's disease (adrenal glands), myasthenia gravis (acetylcholine receptors at neuromuscular junction), rheumatoid arthritis (joint lining), uveitis (eye), psoriasis (skin), Guillain-Barre Syndrome (nerve cells) and Grave's disease (thyroid). Systemic autoimmune diseases include systemic lupus erythematosus and dermatomyositis. 10 Other examples of hypersensitivity disorders include asthma, eczema, atopical dermatitis, contact dermatitis, other eczematous dermatitides, seborrheic dermatitis, rhinitis, Lichen planus, Pemplugus, bullous Pemphigoid, Epidermolysis bullosa, uritcaris, angioedemas, vasculitides, erythemas, cutaneous eosinophilias, Alopecia 15 areata, atherosclerosis, primary biliary cirrhosis and nephrotic syndrome. Related diseases include intestinal inflammations, such as Coeliac disease, proctitis, eosinophilia gastroenteritis, mastocytosis, inflammatory bowel disease, Chrohn's disease and ulcerative colitis, as well as food-related allergies. 20 Autoimmune diseases particularly amenable for treatment using the methods of the present invention include multiple sclerosis, type I (insulin dependent) diabetes mellitus, lupus erythematosus, amyotrophic lateral sclerosis, connective tissue diseases, Chrohn's disease, rheumatoid arthritis, stomatitis, asthma, uveitis, allergies and psoriasis. 25 E. Pharmaceutical Compositions. IFN-tau mutant of the present invention may be co-administered with more toxic interferons to reduce the toxicity of the more toxic interferons when used in 30 pharmaceutical formulations or in therapeutic applications. Such IFN-tau mutants would, for example, reduce the toxicity of IFN-alpha. but not interfere with IFN-alpha. antiviral properties. IFN-T mutants may be administered enterally (oral administration) or mucosally (including eye, nose, mouth, vagina and rectum), parentally in suitable pharmaceutical compositions known to those skilled in the art 35 and described in the medical literature. The mutants may be combined with agents to allow dermal or mucosal penetration. 29 WO 00/78266 PCT/IB00/01080 IFN-tau mutant proteins can be formulated according to known methods for preparing pharmaceutically useful compositions. Formulations comprising interferons or interferon-like compounds have been previously described (for example, Martin, 5 1976). In general, the compositions of the subject invention will be formulated such that an effective amount of the IFN-tau. is combined with a suitable carrier in order to facilitate effective administration of the composition. The compositions used in these therapies may also be in a variety of forms. These 10 include, for example, solid, semi-solid, and liquid dosage forms, such as tablets, pills, powders, liquid solutions or suspensions, liposomes, emulsions, microemulsions, suppositories, injectable, and infusible solutions or other methods known or developed to administer proteins. The IFN-tau mutants can also be conjugated with polyethylene glycol or other polymers or agents to reduce toxicity or improve 15 pharmacokinetics or pharmacologic properties. The preferred form depends on the intended mode of administration and therapeutic application. The compositions also preferably include conventional pharmaceutically acceptable carriers and adjuvants which are known to those of skill in the art. Preferably, the compositions of the invention are in the form of a unit dose and will usually be administered to the patient 20 one or more times a day. IFN-tau mutants may be administered to a patient in any pharmaceutically acceptable dosage form, including oral intake, inhalation, intranasal spray, intraperitoneal, intravenous, intramuscular, intralesional, or subcutaneous injection. 25 Specifically, compositions and methods used for other interferon compounds can be used for the delivery of these compounds. One primary advantage of the compounds of the subject invention, however, is the extremely low cytotoxicity of the IFN-tau mutants. Because of this low cytotoxicity, it 30 is possible to administer the IFN-tau mutants. in concentrations which are greater than those which can generally be utilized for other interferon (e.g., IFN-alpha.) compounds. Thus, IFN-tau mutants. can be administered at rates from about 5.times.10.sup.4 to 20.times.10.sup.6 units/day to about 500.times.10.sup.6 units/day or more. In a preferred embodiment, the dosage is about 20.times.10.sup.6 35 units/day. High doses are preferred for systemic administration. It should, of course, be understood that the compositions and methods of this invention may be used in 30 WO 00/78266 PCT/IB00/01080 combination with other therapies. Further, the effective dose varies from disease to disease and patient to patient, and the optimum dose and administration schedule can be determined by methods known to those skilled in the art. 5 Once improvement of a patient's condition has occurred, a maintenance dose is administered if necessary. Subsequently, the dosage or the frequency of administration, or both, may be reduced, as a function of the symptoms, to a level at which the improved condition is retained. When the symptoms have been alleviated to the desired level, treatment may cease if recurrence of symptoms does not occur. 10 Patients may, however, require intermittent treatment on a long-term basis upon any recurrence of disease symptoms. The compositions of the subject invention can be administered through standard procedures to treat a variety of cancers and viral diseases including those for which 15 other interferons have previously shown activity. See, for example, Finter, et al., Drugs 42(5): 749(1991); Dianzani, et al., Interferon Res., Special Issue, 5/92:109(1992); Francis, et al., AIDS Res. And Human Retroviruses 8(2):199(1992) and U.S. Pat. Nos. 4,885,166 and 4,975,276. However, as discussed above, the compositions of the subject invention have unique features and advantages, 20 including their ability to treat these conditions without toxicity. F. Treatment of Skin Disorders. Disorders of the skin can be treated intralesionally using IFN-tau mutants, wherein 25 formulation and dose will depend on the method of administration and on the size and severity of the lesion to be treated. Preferred methods include intradermal and subcutaneous injection or local application in a variety of vehicles. Multiple injections into large lesions may be possible, and several lesions on the skin of a single patient may be treated at one time. The schedule for administration can be determined by a 30 person skilled in the art. Formulations designed for sustained release can reduce the frequency of administration. G. Systemic Treatment. 35 Multiple intravenous, subcutaneous and/or intramuscular doses are possible, and in the case of implantable methods for treatment, formulations designed for sustained 31 WO 00/78266 PCT/IB00/01080 release are particularly useful. Patients may also be treated using implantable subcutaneous portals, reservoirs, or pumps. H. Regional Treatment. 5 Regional treatment with the IFN-tau mutants of the present invention are useful for treatment of cancers in specific organs. Treatment can be accomplished by intraarterial infusion. A catheter can be surgically or angiographically implanted to direct treatment to the affected organ. A subcutaneous portal, connected to the 10 catheter, can be used for chronic treatment, or an implantable, refillable pump may also be employed. I. Veterinary Diseases The IFN-tau mutants can be used in veterinary applications wherever other 15 interferons are used, including, but not limited to, the treatment of the following viral diseases: feline leukemia virus, ovine progressive pneumonia virus, ovine lentivirus, equine infectious anemia virus, bovine immunodeficiency virus, visnamaedi virus, and caprine arthritis encephalitis. 20 Various aspects of the present invention are described in greater detail in the non limiting Examples that follow. EXAMPLE I Materials & Methods 25 Bacterial and Yeast Strains The Escherichia coil strains used were DH5c and XL-1 (Stratagene) and INVcaF (Stratagene). Pichia pastoris strain SMD1168 was used. The IFN-r gene was amplified from a Pichia pastoris construct in strain GS115. 30 Media Bacterial media was LB (10Og bacto-tryptone (Difco), 5 g bacto-yeast extract (Difco) and 10 g NaCI (Sigma) in 950 mL of water, supplemented with 15g agar (Fisher) for plates) or low-salt LB (same as LB but with 5g NaCI instead of 10 g). Antibiotics were added at a concentration of 60 pig/mL for ampicillin (Sigma), 50g/mL for kanamycin (Sigma) or 50ig/mL for zeocin (Invitrogen). 35 32 WO 00/78266 PCT/IB00/01080 Yeast media was YPD (1% yeast extract, 2% peptone (Difco), 2% dextrose (J.T. Baker), supplemented with 2% agar for plates), BMGY (1% yeast extract, 2% peptone, 100mM potassium phosphate, pH 6.0 (Fisher), 1.34% Yeast Nitrogen Base (Difco), 4x10-s% Biotin (Sigma), 1% glycerol (Fisher), supplemented with 2% agar for plates), 5 BMMY (same as BMGY but with 0.5% methanol (Fisher) instead of glycerol). Zeocin was added to yeast media at a concentration of 100p.g/mL. Cell Lines- MDBK cells were cultured in minimal essential media (MEM) with 10% fetal bovine serum (FBS) and antibiotics. All the human tumor cell lines were obtained from ATCC (Rockville, MD). MCF-7 cells were grown in Eagle's MEM with 10 1 mM sodium pyruvate, L-glutamine, antibiotics and 10% FBS. HT-29 cells were grown in Eagle's MEM supplemented with 0.1 mM non-essential amino acids, 1 mM sodium pyruvate, 10 pg/ml bovine insulin, L-glutamine, antibiotics and 10% FBS. Daudi cells were grown in RPMI 1640 containing 20% FBS. Interferons-The gene encoding ovlFN-taulmod has been cloned into the 15 methyltropic yeast Pichia pastoris (Invitrogen, San Diego, CA) under the control of the alcohol oxidase promoter (19). Upon induction with methanol, ovlFN-taulmod is produced as a secreted protein. It was purified by ammonium sulfate precipitation followed by anion exchange chromatography using diethylaminoethyl cellulose (Sigma, St. Louis, MO). The specific activity of the purified protein was 1 X 108 20 units/mg. Recombinant human IFN-alphaA was purchased from Intergen (Purchase, NY) and PBL (New Brunswick, NJ) with specific activities of 3 X 108 units/mg and 1 X 108 units/mg, respectively. Construction of ovine IFN-7 Imod Mutagenesis/Expression vectoFFor construction 25 of the ovlFN-tau 1 mod mutagenesis/expression vector, the gene for ovlFN-tau 1 mod was amplified by PCR using Taq polymerase (Stratagene, La Jolla, CA) and cloned into the E. coil vector pCR2.1 (Stratagene TA cloning kit) before ultimately being cloned into the Kpn I site of the E. coli-yeast shuttle vector pPICZalpha (Invitrogen). 30 Amplification of the Gene for lFN-r from Yeast The IFN-r 1 mod gene was amplified directly from the yeast genome of Pichia pastors. The genomic DNA was prepared directly for PCR from a colony, following a protocol in Biotechniques (Ward, 1996). 33 WO 00/78266 PCT/IB00/01080 Amplification of the gene was accomplished by PCR. New restriction sites were added to the primers because the original gene in yeast has no restriction sites due to their loss during a double recombination event (Ott, 1991). 5 Use of pPICZa vector Another vector was also used, the pPICZa vector from Invitrogen. Different primers were required. The primers were: Primer 1 (identical to the 5'-end of coding strand with a Kpnl (GGTACC) and (TACGTA) sites added, indicated by underlining) 10 5'-TAGGTACCAC GCGTGCTACCTGTCG-3' Primer 2 (identical to the 3'-end of non-coding strand with overlapping Kpnl (GGTACC) and M (CCGCGG) sites added, indicated by underlining) 5'-TAGGTAIIACGGAGAATTCAGG-3' 15 Genomic DNA can be used as template for the PCR reaction with the high fidelity polymerase, PFU (Stratagene). Another method to accomplish taking the mutant tau gene taken out of the yeast gene and putting it into a vector, involves taking the genomic DNA, amplifying it with PCR and then putting the amplified gene into the 20 PCR2.1 E. colvector, and from PCR2.1 into pPICZ alpha vector. PCR2.1 uses a different set of primers. The PCR product was visualized on agarose gel electrophoresis and purified using GENECLEAN®. The PCR product was then digested with Kpnl (Promega), as was 25 the vector pPICZc. Double digested vector was visualized on agarose gel electrophoresis, cut out and purified using GENECLEAN® and dephosphorylated using alkaline phosphatase (as above). The insert and vector were ligated as per directions from the Rapid DNA Ligation Kit. Half the ligation mix was transformed into 1301tL of XL-1 Blue Ultracompetent E. coli. Transformants were selected for on 30 low salt LB plates with zeocin (Invitrogen). Clones were identified by size and then by digestion with Hindll (Promega) to check for orientation. The constructs in pPICZ(x contained DNA encoding seven extra amino acids at the 5'-end of inserted gene. These amino acids were deleted by digesting first with Pml (New England Biolabs) at 370C overnight. The Pmil digests were then visualized on an agarose 35 gel, excised, and purified using GENECLEAN®. The purified DNA sample was then digested with SnaBl. The blunt ends were then ligated together to recircularize the 34 WO 00/78266 PCT/IB00/01080 plasmid using the Rapid DNA Ligation Kit, per the supplied protocol. Half of the ligation mix (10L) was then transformed into 75pL of XL-1 Blue Ultracompetent cells as per manufacturers directions. Transformants were screened by resistance to digestion with Pmll. The deletion was verified by dideoxy chain terminator 5 sequencing using an internal IFN-r primer identical to bases 312-335 of the non coding strand. Once the mutations were verified by sequencing, the plasmid DNA was transformed into Pichia pastoris. Successful transformations were obtained with four of the 10 mutants: 13E- R yielded 4 transformants, 16K-M yielded 5 transformants, 26P-*L yielded 3 transformants, and 34K-->H yielded 9 transformants. Site Directed Mutagenesis -Six nucleic acid mutations were introduced into ovine IFN-taulmod DNA using the 15 Quickchange Site Directed Mutagenesis kit (Stratagene) following manufacturers instructions. Briefly, primers containing the desired base changes were synthesized by Bioserve (Laurel, MD) or Integrated DNA Technologies (Coralville, IA). They were added to 50-100 ng of pPICZc containing the gene for ovlFN- I mod with Pfu turbo polymerase (Stratagene) in a 50 pl reaction and cycled to incorporate the 20 desired base change(s). Each reaction was optimized for each set of primers. Five pl of the PCR reaction was run on a 1% agarose gel to visualize the product. The remaining reaction was digested with Dpn I for 1 hour, purified, and used to transform XL-1 Blue Ultracompetent cells (Stratagene). Transforments were selected on low salt LB in the presence of zeocin (Invitrogen). Plasmid DNA from transformants was 25 extracted with phenol- chloroform and ethanol precipitated. The incorporation of the correct mutations was verified by dideoxy sequencing. 35 WO 00/78266 PCT/IB00/01080 Details: The primers used were as follows: Table 1 Sample Coding Strand Non-Coding Strand 13E->R 5'- 5' GCGACTGATGCTGGACG CGGTCCAGCAGTTTTAAATTACG CTCGACGTAATTTAAAAC TCGAGCGTCCAGCATCAGTCGC TGCTGGACCG-3' 3' 16K->M 5'- 5' GCTGGACGCTCGAGAAA CGATTCATACGGTCCAGCAGCAT ATTTAATGCTGCTGGACC TAAATTTTCTCGAGCGTCCAGC-3' GTATGAATCG-3' 19D-)A 5'- 5' CGAGAAAATTTAAAACTG GTGCGGAGACAATCGATTCATAC CTGGCCCGTATGAATCG GGGCCAGCAGTTTTAAATTTTCT ATTGTCTCCGCAC-3' CG-3' 24L4I 5'- 5' CTGCTGGACCGTATGAAT GCAGGCAGCTGTGCGGAGAAAT CGAATTTCTCCGCACAGC TCGATTCATACGGTCCAGCAG-3' TGCCTGC-3' 26P-4L 5'- 5' CCGTATGAATCGATTGTC CCGGTCTTGCAGGCAGCTGTGC TCTGCACAGCTGCCTGC AGAGACAATCGATTCATACGG-3' AAGACCGG-3' 34K-H 5'- 5' CTGCCTGCAAGACCGGC CGGCAGACCGAAGTCGTGCCGG ACGACTTCGGTCTGCCG- TCTTGCAGGCAG-3' 3' 5 Mutations are indicated by underlining The PCR reaction was optimized for each pair of primers. For example, the optimal reaction conditions for each set of primers are summarized below. 10 Table 2 Sample Tern- Primer dNTP Anneal Anneal Exten- Exten plate (each) Temp. Time sion sion Temp Time (min) 13E - R 200ng .25ng 10mM 65 0 C 45s 72 0 C 8.5 16K-+ M 400ng .25ng 10mM 65 0 C 45s 72 0 C 8.5 19D - A - - - - - - 20R - Q* 100ng .25ng 10mM 55 0 C 45s 68 0 C 10 24L-- I 400ng .25ng 10mM 65 0 C 45s 72 0 C 8.5 26P - L 250ng .25ng 10mM 72 0 C 45s 72 0 C 8.5 34K - H 400ng .25ng 10mM 65 0 C 45s 72 0 C 8.5 These reactions were repeated for a total of 25 cycles. The strand dissociation 15 temperature was 94 0 C for 30 seconds, after cycling, each reaction was kept at 4 0 C. 36 WO 00/78266 PCT/IB00/01080 Part (5gL) of the PCR reaction was analyzed by agarose gel electrophoresis and if product was visualized, it was then digested with 12 units of Dpnl for a minimum of 2 hours. The digestion was purified using GENECLEAN® and resuspended in 61L of 5 TE, all of which was transformed into XL-1 Blue Ultracompetent cells (75gL). Transformants were selected on low salt LB plates containing zeocin. Plasmid DNA was prepared on a "miniprep" scale and was phenol-chloroform purified (Maniatis) for sequencing. The sequencing primer was the alpha factor primer (Invitrogen), which is complementary to part of the non-coding strand of the sequence directly upstream 10 of the IFN-t gene in pPICZa. The sequencing primer has the following nucleic acid sequence: 5'-TACTATTGCCAGCATTGCTGC-3' Production of Mutant IFN-r Proteins in P. pastoris-E coli carrying the 15 recombinant plasmid was cultured overnight in low salt LB with zeocin and the plasmid DNA extracted. Plasmid DNA was linearized by digestion with Sac I overnight, purified, and resuspended in 5-10 gl of water. This DNA was used to transform P. pastoris either by electroporation or chemically by using the Pichia EasyComp kit (Invitrogen). 100 pil of the yeast transformation mix was 20 plated on YPD (1% yeast extract, 2% peptone, 2% dextrose) plates containing zeocin and incubated at 300C for 3 days to allow selection of yeast containing the desired gene. Individual colonies were selected and grown in 25 ml of BMGY media (1% yeast extract, 2% peptone, 100 mM potassium phosphate, pH 6.0, 1.34 % yeast nitrogen base, 4x10- 5 % biotin, 1% glycerol). For 25 production of mutant proteins, cultures were shaken vigorously at 300C in the presence of light to an OD 600 of 2- 6. They were harvested by centrifugation at 2500 x g for 5 min, the pellet resuspended in BMMY media (1% yeast extract, 2% peptone, 100 mM potassium phosphate, pH 6.0, 1.34% yeast nitrogen base, 4x10 5 % biotin, 1% methanol) and again shaken vigorously at 30 300C for 1-2 days to induce the expression of the proteins. Proteins were secreted into the media and purified by ammonium sulfate precipitation and anion exchange column chromatography. The concentration of IFN-r and mutant IFN-T proteins was measured using the BCA protein assay (Pierce). 37 WO 00/78266 PCT/IB00/01080 The protocol was optimized for low concentrations of protein using an incubation period of 600C for 30 min. Details: 5 Transformation into yeast: Once the mutation had been verified by sequencing, plasmid DNA was prepared on a miniprep scale using Matrix (Biol01), three minipreps for each sample. The plasmid was linearized using Sacl (Stratagene). Over 60 units of enzyme was needed to cut approximately 5pg of DNA in 270pL. This reaction was allowed to 10 proceed overnight. About 10 L of the reaction was then analyzed by agarose gel electrophoresis to ensure the digestion was successful. The rest of the reaction was purified by GENECLEAN®, resulting in a decrease in volume to 10pL. All 10 L were added to electrocompetent Pichia pastons. Yeast were made competent by a modified protocol from Invitrogen; specifically, the OD6oo was allowed to reach 2-3 15 instead of 1.3-1.5 and the cells were allowed to recover without antibiotic selection for 6 hours before plating on YPD plates with sorbitol and zeocin (Pichia expression kit, Invitrogen). The electroporation was performed using an E. coli pulser (Biorad). The cells were pulsed with 180kV for 10 milliseconds in a 0.2cm cuvette. Ice-cold (1 mL, 1M) sorbitol was added to the cells as they recovered before plating. 20 Screening for Mutant IFN Production Individual cultures of each of the transformants were grown in BMGY media (25 mL). After 2 days of growth with vigorous shaking at 300C in the presence of light, the cultures were centrifuged at 2500xg for 5 minutes. The pellet was resuspended in 25 BMMY medium (25mL) to induce IFN production. IFN-r is secreted by yeast strain Pichia pastoris. After 1 to 3 days, a sample of the media was analyzed on a 15% non-denaturing polyacrylamide gel to look for the presence of a 19kD protein. If such a protein was present, a chemiluminescent western blot was performed (Amersham). The blot was visualized using rabbit anti-IFN antibodies (HL-98) as the primary 30 antibody and mouse anti-rabbit linked to alkaline phosphatase as the secondary antibody. Detection was sensitive to 50ng of protein. If mutant IFN was found to be present, the culture was centrifuged at 10,000xg for 5 minutes and the supernatant was removed. 38 WO 00/78266 PCT/IB00/01080 Purification of Mutant IFN The media containing mutant IFN was then stirred overnight at 40C in an equal volume of saturated ammonium sulfate (Harlowe, 1988) to precipitate proteins. The ammonium sulfate-IFN mixture was then centrifuged at 2500xg for 30 minutes. The 5 pellet was then resuspended in 10mM Tris pH 7.5. The protein was then loaded onto a DEAE (Whatman) ion exchange column. A gradient was made from 10mM Tris pH 7.5 with no salt to 500mM NaCI in 600mL. As the salt concentration increased, the protein was eluted, and eluant was collected in 3mL aliquots. Each aliquot was then tested by spectrophotometry for absorbance at 280nm. The fractions with high 10 absorbances were pooled and concentrated. The concentrated protein solution was then visualized on a 15% non-denaturing polyacrylamide gel to gauge purity. If it was deemed pure, the protein was sterile filtered and frozen in 200AL aliquots at 800C. One aliquot was kept at -200C for assay purposes. 15 The protein can be purified by standard methods, including size fractionation (column chromatography or preoperative gel electrophoresis) or affinity chromatography (using, for example, anti-Ovine IFN-tau. antibodies (solid support available from Pharmacia, Piscataway N.J.). Protein preparations can also be concentrated by, for example, filtration (Amicon, Danvers, Mass.). The amount of r 20 IFN-tau. can be quantified using standard assays known in the art including radioimmunoassay and Elisa, and bioassays known to those skilled in the art. Protein Assay The concentration of IFN was measured by the BCA protein assay kit (Pierce). The 25 absorbance was read at 560nM and compared to a bovine serum albumin (BSA) standards ranging from 20ptg/mL to 120pg/mL. The protocol was optimized for low concentrations of protein using an incubation period of 30 minutes at 600C. Structural Determinations-Circular Dichroism (CD) of the IFN-Tr mutants was 30 determined at room temperature with a JASCO 500C spectropolarimeter. Scans were done with a 0.1 mm pathlength cell at a sensitivity of 2 and a time constant of 8 sec. The wavelength range measured was from 250 nm to 184-188 nm at a scan rate of 20 nm/min. Scans were carried out on IFN-tr mutants in water at 0.16-0.5 mg/ml. The CD spectra were expressed in terms of ellipticity, 9, related to the means 35 residue molecular weight for each IFN-tr mutant. The following formula was used to 39 WO 00/78266 PCT/IB00/01080 generate 9(Yang): Mean residue ellipticity [0] = 100 X [O0observed /c X I, where observedd is expressed in degrees, c equals the mean residue concentration in mol/liter, and I is the pathlength of the cell in cm. 5 Ovine IFN-r mod Mutant Protein Immunoblots-Purified proteins were run on a 15% polyacrylamide gel and transferred to Hybond membrane (Amersham, Piscataway, NJ). Membranes were incubated with a 1:500 dilution of the monoclonal antibody HL-98 made against a C-terminal region peptide of ovlFN- T1mod. Recognition of both native and denatured ovIFN-rimod by this antibody is not dependent on a 10 conformational determinant (20). The secondary antibody was peroxidase conjugated sheep anti-mouse antibody. The proteins were detected using ECL according to the manufacturers instructions (Amersham). A single band at 19 KD was visualized in each lane. One mutant IFN-tau protein was run in each lane. Therefore this result confirms that the molecular weight of the tau mutants is exactly 15 the same as native ovine IFN-tau. Competitive Binding of ovine IFN-1 to Receptors on MDBK CellsOvlFN-taul mod was labeled with the Bolton-Hunter reagent (mono [125 I] iodo derivative, 2,000 Ci/mmol, Amersham; 1Ci = 37 GBq) as previously described (8). Specific activity of 20 the labeled protein was ~20 pCi/g. The labeled ovIFN-taulmod retained complete antiviral activity on MDBK cells. For binding, 3 nM of 1251- ovlFN-taulmod were incubated with 7.5 X 105 MDBK cells in the absence or presence of 300 nM unlabeled ovlFN-taulmod, IFN-alphaA or IFN-tau mutants in 500 microlitersl of MEM/10% FBS at 4 0 C for 12-14 h (21). The cells were layered over 10% (w/v) 25 sucrose in PBS (2.5 ml), centrifuged at 12,000 x g for 30 min at 40C, and the pellets counted. Specific binding was defined as total binding minus nonspecific binding in the presence of a 100 fold molar excess of unlabeled IFN-alpha A. Antiviral Assay Antiviral activity is measured using a standard cytopathic effect 30 inhibition assay using MDBK cells and vesicular stomatitis virus (VSV; 22). Antiviral activity was normalized based on the reference IFN-alpha Gxa01-901-535. 40 WO 00/78266 PCT/IB00/01080 Details: Madin Darby Bovine Kidney (MDBK) cells (ATCC). MDBK cells were plated on a polystyrene coated 96-well plate at a concentration of 6x10 5 cells/mL and grown overnight at 370C in 5% CO2 / 95% air. The cells were then visualized under 40x 5 magnification to ensure confluency. The media was removed and the replaced with MEM supplemented with 2% FBS and serial dilutions of IFN. Each IFN was assayed in duplicate. The lowest dilution was 1:10 and the rest of the plate consisted of 1:3 serial dilutions. One column received only medium, as a control. The first assay for each IFN was performed as described above. If the IFN had a high activity or a high 10 concentration of protein, it was diluted 1:100 for the initial dilution. The serial dilutions were always 1:3. The cells were incubated with IFN for 24 hours at 370C in 5% CO2 / 95% air. The cells were then challenged with a 1:500 dilution of Vesicular Stomatitis Virus 15 (VSV) in MEM, supplemented with 2% FBS. Four of the control wells received only medium and four of the control wells received medium plus virus. Each of the IFN treated wells received medium plus virus. The cells were incubated with virus for another 24 hours at 370C in 5% CO2 / 95% air. The cells were then stained with crystal violet (100iL; 0.5% in 30% methanol; Sigma) for 5 minutes and washed with 20 distilled water. One antiviral unit was defined as the concentration of IFN at which 50% destruction of the monolayer was observed. Antiproliferative activity Antiproliferative activity was measured on two adherent cell lines, MCF-7 (breast 25 adenocarcinoma) and HT-29 (colon adenocarcinoma), and one suspension cell line, Daudi (Burkitt lymphoma). For the adherent cell lines, 1000 cells/ml were plated in a 24 well polysterene plate. 10,000 units of ovine IFN-taulmod was added, or the equivalent molar concentration (17 nM) of IFN-alphaA (32,000 U/ml - 10,000 U/ml was used in a set of 3 replicate experiments with no difference in effect), or IFN-tau 30 mutants. Cells were incubated at 370C in 5%CO2 for 9 days. Cells were detached with .25% trypsin and counted using a hemocytometer. Viability was determined by trypan blue staining. For Daudi cells, 1000 cells/ml were incubated with 33 units of IFN-tau or the equivalent concentration (.06 nM) of IFNalphal, or IFN-tau mutants in 5 ml polypropylene tubes. Cells were incubated at 370C in CO2 for 3-4 days, 41 WO 00/78266 PCT/IB00/01080 centrifuged for 5 minutes at 300 x g, and the pellet resuspended in 1% trypan blue in phosphate buffered saline and counted. Cytotoxicity Assay- -80,000 U/ml of either ovine IFN-taulmod, IFN-alphaA or IFN 5 tau mutants were added to 2x10 5 U937 cells in polypropylene tubes in triplicate and incubated for 72 hours. Control cells were treated with medium alone. Cells were counted with a hemocytometer after the addition of trypan blue. Statistical Analysis-Statistically significant differences (p < 0.05) between 10 experimental means were determined by analysis of variance followed by Least Significant Difference. EXAMPLE II -IDENTIFICATION OF SIX INTERFERON TAU 1MOD MUTANTS 15 Six mutants of IFN-taulmod have been constructed. It was decided to select for substitution, those amino acids in the N terminal region of native ovine IFN-tau that are exposed to solvent AND that differ from the corresponding solvent-exposed amino acid on human Interferon alpha. Those amino acids in the N-terminal region of each molecule that are exposed to solvent were identified based on IFN-tau's 20 crystallographic structure. If the crystal structure is unknown, the solvent-exposed amino acids could be predicted from the molecular data about the protein. The amino acids exposed to solvent were compared and the amino acids in this group that were different between interferon tau and alpha were identified. Six mutations were made in interferon tau, one amino acid at a time, chosen from the solvent 25 exposed amino acids that were different between IFN-tau and IFN-alpha. The mutations were created using site directed mutagenesis to specifically convert one specific amino acid in ovine IFN-T1 mod to the amino at the corresponding position in human IFN-alphaA by changing the DNA codon. Other methods of making the appropriate DNA for the tau mutants known to those skilled in the art can be used. 30 Three mutations were at sites within helix A and three within the AB loop where the solvent exposed amino acid sequence of ovine IFN-r 1mod was shown to differ from to the amino acid at the corresponding position in human IFN-alphaA These six solvent-exposed amino acids in IFN-t were substituted with the 35 corresponding differing amino acid found in IFN-ax. The nine amino acids that are different between IFN-ac and IFN-T and are exposed to solvent are indicated below by 42 WO 00/78266 PCT/IB00/01080 bold and underlining. Even though Residue 34 was not exposed to solvent, this residue is recognized in the art as being significant for biological activity therefore the 34 K:H substitution indicated below was made. Six of these differing amino acids were targeted for mutation. 5 1 10 20 30 IFN-t CYLSRKLMLDARENLRLLDRMNRLSPHSCLQDRKDF IFN-a CDLPQTHSLGSRRTLMLLAQMRKISLFSCLKDRHDF 10 Differences between -t and -a are in bold. Solvent-exposed residues are underlined. The six mutations are as follows: 15 Table 3 Sample Residue Old New Old New Region # A.A. A.A. Codon Codon 5R-Q 5 Arg GIn CGA Not N done terminus 6K-+T 6 Lys Thr AAA Not " done 13E--R 13 Glu Arg GAA CGT " 16K--M 16 Lys Met AAA ATG " 19D-+A 19 Asp Ala GAC GCC " 20R->Q 20 Arg Gin CGT Not " done 24L- l 24 Leu lie TTG ATT AB Loop 26P-+L 26 Pro Leu CCG CTG " 31Q--+K 31 Gin Lys CAA AAG " 34K--H 34 Lys His AAA CAC " The mutations identified by their amino acid sequence, and one possible nucleic acid sequence are: The mutations identified by their amino acid sequences are: 20 THE 13 E:R MUTANT AMMINO ACID SEQ. ID NO.4, NUCLEIC ACID SEQ. ID NO. 11, THE 16 K:M MUTANT, AMMINO ACID SEQ. ID NO. 5, NUCLEIC ACID SEQ. ID NO. 12 THE 19 D:A MUTANT AMMINO ACID SEQ. ID NO. 6, 25 NUCLEIC ACID SEQ. ID NO. 13, 43 WO 00/78266 PCT/IB00/01080 THE 24 L:I MUTANT AMINO ACID SEQ. ID NO.7; NUCLEIC ACID SEQ. ID NO. 14 THE 26 P:L MUTANT AMINO ACID SEQ. ID NO. 8, NUCLEIC ACID SEQ. ID NO. 15; 5 THE 31 Q:K MUTANT AMINO ACID SEQ. ID NO. 9, NUCLEIC ACID SEQ. ID NO. 16; THE 34 K:H MUTANT AMINO ACID SEQ. ID NO. 10, NUCLEIC ACID SEQ. ID NO. 17 THE 5 R:Q MUTANT AMINO ACID SEQ. ID NO. 18, 10 THE 6 K:T MUTANT AMINO ACID SEQ. ID NO. 19, and THE 20R:Q MUTANT AMINO ACID SEQ. ID NO. 20. It is important to emphasize that due to redundancy in the genetic code, the nucleic acid sequences set forth above are only one of many nucleic acid sequences for 15 each respective mutant. Other IFN-tau mutants that were identified but not made are 5 R:Q which has the same amino acid sequence as native ovine IFN-taulmod in SEQ. ID No. 2, except for having a glycine (GLN) residue instead of an arginine (ARG) at position 5; 6 K:T which has the same amino acid sequence as native ovine IFN-taulmod in SEQ. ID No. 2, except for having a threonine residue instead of a 20 lysine at position 6; and 20 R:Q which has the same amino acid sequence as native ovine IFN-taulmod in SEQ. ID No. 2, except for having a glycine residue instead of an arginine at position 20. The 5, 6 and 20 IFN-tau mutants also come within the present invention. 25 The recombinant IFN-t containing each mutation was expressed and purified AS DESCRIBED ABOVE. All mutant IFN-tau proteins were recognized by an anti C terminal monoclonal antibody against IFN-tau Imod in immunoblots. Only the 13 E:R mutation decreased alpha-helical content as assessed by Circular Dichroism (data not shown). 30 EXAMPLE III Binding of the Mutant Interferon Tau proteins to the Type I IFN Receptor-Binding of 125 I-ovIFN-rlmod to the common type I IFN receptor 35 Binding of the mutant interferon tau proteins to the Type I IFN Receptor-Binding of 125 I-ovIFN-clmod to the common type I IFN receptor was most efficiently displaced 44 WO 00/78266 PCT/IB00/01080 by human IFN-alphaA (Fig. 1). OvIFN-Tl1mod itself produced only half of the displacement seen with the IFlsT. The majority of the amino acid substitutions introduced decreased the ability of the mutant proteins to displace the labeled ovlFN T mod from the receptor; however, this decrease was significant with the 24L:I and 5 34K:H mutants. However, the P:L substitution at residue 26 significantly increased competition of labeled ovIFN-r1mod binding, though still not to the same extent as did the human IFN-alphaA. The potency of various IFNs has been suggested to be related to receptor 10 binding affinity (25). The reduced antiproliferative potency and reduced toxicity of ovlFN-rlmod relative to human IFN-T on MDBK cells has been seen as a reflection of Kd, 3.90 x 10-10 and 4.45 X 10-11 for IFN- T and ac, respectively (8). Hence, the enhanced receptor binding of the IFN-r 26 P:L mutant relative to the parental IFN-T can be predictive of enhanced BIOLOGICAL ACTIVITY OR potency. 15 EXAMPLE IV ANTIPROLIFERATIV ACTIVITY OF INTERFERON TAU MUTANTS The ability of IFNs to decrease cell proliferation is a well documented phenomenon. The results set forth below show that the N-terminal substitutions had cell type specific effects on antiproliferative activity, but each of the mutants maintained 20 equivalent antiproliferative activity relative to the parental IFN-T on at least one cell line. Antiproliferative activity was measured on two adherent cell lines, MCF-7 (breast adenocarcinoma) and HT-29 (colon adenocarcinoma), and one suspension cell line, Daudi (Burkitt lymphoma). Antiproliferative activity is measured as the percent of cells grown in the presence of IFN divided by the number of cells grown in 25 the absence of IFN. Daudi cells (Burkitt lymphoma). We first evaluated the antiproliferative activities of the various IFN-T mutants on Daudi cells at a concentration equivalent to that which caused marked inhibition of 30 cells when treated with IFN-r. Thirty-three units of ovlFN--r1mod (.06 nM) caused a 54 % decrease in Daudi cell proliferation (Table 4). The same concentration of human IFN-alphaA caused an even greater decrease in proliferation of 69%. All of the mutants tested reduced the cell numbers as well as, or better, than ovlFN Trl mod. The 26P:L mutant exhibited the greatest antiproliferative activity against 35 Daudi cells. This mutant caused an 81% decrease in cell number as compared to 45 WO 00/78266 PCT/IB00/01080 cells in media alone, an activity profile better than human IFN-alphaA. Thus, the 26P:L mutant has both the highest level of antiviral activity, and the highest activity at inhibiting proliferation of Daudi cells. 5 16 K:M and 34K:H mutants are also clinically significant as antiproliferative agents in the treatment of cancer, because both were nearly as effective as IFNo without the toxicity, and both were more effective than interferon-tau. This means that the 26, 16, and 34 mutants described above all have significantly better therapeutic indices than human IFN-alpha A and native ovine IFN-tau for treating cancer and tumors. 10 MCF-7 (breast adenocarcinoma) and HT-29 (colon adenocarcinoma) HT-29 and MCF-7 were also used to test the antiproliferative activity of the interferon tau mutants. These cell lines are not as sensitive to type I IFNs as are Daudi cells and they therefore required much higher doses to inhibit cell growth. 10,000 units 15 (17nM) of ovlFN-taulmod added to HT-29 cells caused a 44% decrease in cell number compared to control (1.61 x 106 c/ml versus 2.85 x 106 c/ml). 10,000 units (17nM) of ovlFN-taulmod added to MCF-7 cells caused a 54% decrease in cell number compared to controls. 20 Five of the six IFN-tau mutants significantly decreased cell number of both HT-29 and MCF-7 cells compared to control when given at 17Nm. For HT-29 cells, only the 24 L:l mutant failed to show an increase in antiproliferative activity, despite the fact that this mutation is conservative. The 26 P:L mutation had significantly increased antiproliferative activity (cell growth decreased 63% relative to controls) while 25 wildtype IFN- showed less antiproliferative activity (cell growth decreased. 44% relative to controls). All of the mutants inhibited proliferation of MCF-7 cells compared to controls when used at 17nM; however, the antiproliferative activity of the mutants (62-90%) did not 30 significantly differ from that of ovine IFN--l mod (86%). Again the IFN-r 26P:L mutant had the greatest antiproliferative activity (90%), although it was not significantly different from either parental ovine IFN- mod or human IFN-ctA. 46 WO 00/78266 PCT/IB00/01080 Table 4. Antiproliferative Activity of IFN-tau N-terminal mutants.* Treatment HT-29 Daudi MCF-7 Cells Cells Cells 5 Control 285 ± 19 34.1 ± 2.1 130 ± 17 IFN-aA 62 ± 4(78%) 10.6 ± 0.2(69%) 2 ± 2(99%) Ovine IFN-Tl mod 161 ± 6(44%) 15.9 ± 1.2(54%) 8 ± 8(86%) IFN-T 13 E:R 175 ± 27(39%) 14.8 ± 1.3(57%) 38 ± 7(71%) 10 IFN-- 16 K:M 117 ± 27(39%) 9.4 ± 0.5(72%)t 50 ± 9(62%) IFN-t 19 D:A 141 ± 32(51%) ND 25 ± 6(80%) IFN- 24 L:I 237 ± 86(17%) ND 39 ± 6(70%) IFN-t 26 P:L 104 ± 13(63)t 6.2 ± 0.4(81%)t 13 ± 7(90%) IFN-t 34 K:H 137 ± 35(52%) 10.7 ± 1.1(69%)t 37 ± 8(72%) 15 *17 nM of each IFN was added to 1000 MCF-7 or HT-29 cells and incubated for 9 days. 0.06 nM of each IFN was added to 1000 Daudi cells and incubated for 3 days. Control cultures received no IFN. Results are expressed as the mean cell number X 20 104 ± SE of three replicate experiments. Percent inhibition is indicated in parentheses. ND indicates not done. A "t" indicates a significant increase in growth inhibition by the IFN-t mutants relative to that of ovine IFN-t 1 mod. EXAMPLE V TOXICITY OF THE INTERFERON TAU MUTANTS 25 Viability of IFN-tau Mutant-Treated Cells 80,000 U/ml of either ovine IFN-taulmod, IFN-alphaA or IFN-tau mutants was added to 2x105 U937 cells in polypropylene tubes in triplicate and incubated for 72 hours. Control cells were treated with medium alone. Cells were counted with a hemocytometer after the addition of trypan blue. 30 As with peripheral blood lymphocytes, U937 cells exhibit significantly reduced viability when treated with human IFN-alphaA: viability in controls is about 97.5% and in IFN-alphaA treated cells it is about 83%. By contrast viability in cells treated with native ovine IFN-tau 1mod is about 96%. All of the IFN-tau mutant proteins 35 showed very high viability and essentially no cytotoxicity. In a first viability study, 47 WO 00/78266 PCT/IB00/01080 percent viability was: 94.75% for the 13 E:R mutant; 97.25% for the 16 K:M mutant; 95.75% for the 26 P:L mutant; and 95.5% for the 34 K:H mutant. See Table 5. In a second viability study which also included the 19D:A mutant and the 24 L:I mutant, % viability was: control 98.9%; native IFN-tau 97%; human IFN-alpha 80.25%; 96% for 5 the 13 E:R mutant; 97% for the 16 K:M mutant; 97% for the 19D:A mutant; and 96.5% for the 24L:1 mutant. See Table 6. 48 WO 00/78266 PCT/IB00/01080 TABLE 5. VIABILITY OF U937 CELLS Source: df: Sum of SCaures: Mean Scuare: F-test: P value: Between subjects 3 21.632 7.21! .205 .892zz Within subjects 24 845.696 135.237 1 treatments 6 1634.03, 1105.672 8.986 .0001 residual 18 , 211.665 11.759 Total I27 867.328 Reliability Estimates for- All treatments: -3.887 Single Treatment: -. 1 28 One Factor ANOVA-Repeated Measures for X 1 ... X 7 Group: Count: Mean: Std. Dev.: Stc. Error: media 4 97.562 1.638 1.819 ifnt 4 95.75 2.5 1.25 ifna 4 82.75 7.194 .597 13E:R 4 94.75 .872 1.436 1 6K:M 4 97.25 1.5 .75 S One Factor ANOVA-Repeated Measures for X1 ... X7 Group: Count: Mean: Std. Dev.: Std. Error: 26P:L 4 9S.75 2.217 1.109 34K:H 4 95.5 1.291 .645 49 WO 00/78266 PCT/IBOO/01080 TABLE 6. VIABILITY OF U937 CELLS Source: df: Sum~ of Souares: Mean Square: F-test: P value: Between Subjects 1 14.535 14.535 1.312 S8541 Within subjets 1 4 6SZ.586 46.61 3 _____ treatments 7 499.965 71 .424 3.276 .070, residual 7. 6i Sz.1 21 1803 _______ Total 1P5 1667.121 _______ Reliability Estimates for- A3 treatMernts: -Z.207 Single Treatment: -.094 One Factor ANOVA-Repeated Measures 'or X~ X. Grcuo: Count: Mean: S t .'. 0 ev.: Std. Er.,rcr: media~~ _______198.375 -177 1 iZS 12n -J97 Jo 10 ifna 2 80.ZS 110.26 17.75 13E:R 2 96 14.243 13 i11 16 K:M 12 97 1.414 j1 One Factor ANOVA-Repeated Measures for X1 ... X Group: Count: Mean: Std. Oev.: Std. Error, 1 0Az97 11.414 1 241 96.5 1 3.536 2.5 26P:L 2 96.5 1__3.S36__ j2.5 50 WO 00/78266 PCT/IB00/01080 EXAMPLE VI Antiviral activity IFNs have historically been described by their antiviral activity, so this was a logical 5 screen for the activity of the IFN-r mutants. The ability of the six mutants to protect MDBK cells against VSV was tested and their antiviral activities were compared to that of wildtype ovIFN-Tlmod and human IFN-aA. One unit of antiviral activity is defined as the amount of protein needed to inhibit the cytopathic effect of VSV by 50%. 10 All the mutants possessed antiviral activity to some extent. The activity of the IFN tau 26P:L mutant was 9.5 x 107 U/mg, which is as great as that of both ovine IFN-tau and human IFN-alphaA. This is especially significant because the 26P:L mutation provides an interferon tau mutant that has antiviral activity equivalent to that of both 15 ovine IFN-tau and human IFN alpha, with antiproliferative activity that is much increased over native IFN tau (see below) and low toxicity. The clinical significance is that this mutant has a much better therapeutic index than human IFN alpha. The activity of four other mutants, 16K:M, 19D:A, 24L:1, and 34K:H, exhibited 20 significantly reduced the antiviral activity relative to the parental IFN controls. The least active mutant was 13E:R, having 3.2 x 104 units of activity/mg protein. This is significantly less antiviral activity than wildtype ovlFN-l 1mod (6.4 x 107 U/mg) or IFN alpha (8 x 107 U/mg). The reduced antiviral activity of 13 E:R did not correlate with receptor binding, since binding of 13 E:R was equivalent to that of ovlFN-taul mod. 25 The antiviral activities of the various mutants are summarized below. It should be emphasized that antiviral activity against bovine MDBK cells was tested because this is a recognized method to screen for interferons. A high level of antiviral activity in this assay does not necessarily correlate with exceptionally good 30 antiviral activity in humans, nor is the reverse necessarily true. Antiviral activity like antiproliferative activity, is anticipated to be viral- and host-specific. One discovery and embodiment of this invention is using specific cell lines and viruses to assess bioactivity and creating optimal drugs for each virus/host combination. The optimal drug may be dependent on the host HLA or other immunotype. 35 51 WO 00/78266 PCT/IB00/01080 TABLE 7. ANTIVIRAL ACTIVITY OF INTERFERON TAU MUTANTS Sample Average (U/mg) Standard Deviation IFN-a 8.8 x 10' IFN-r 6.9 x 10' 6.0 x 10' 13E-*R 3.2 x 10' 2.3 x 104 16K-+M 1.9 x 10b 1.2 x 100 19D:A 1.3 x 10b 5.4 x 10" 24L:I 3.3 x 10b 1.5 x 10 26P-*L 9.5 x 10' 8.9 x 10' 34K-)H 2.5 x 10' 2.4 x 10b Table 7 - Antiviral Activity of IFN mutants on MDBK cells. Antiviral activity was measured using serial dilutions of IFN from 1:100 to 1:5.9 x 107. Challenge was with a 1:500 dilution of stock VSV. Averages are based on 2-15 replicates. ANOVA was based on 5 replicates. 5 All documents cited above are hereby incorporated in their entirety by reference. The entire contents of U.S. Provisional Appln. 60/140,411, filed June 22, 1999, is incorporated herein by reference. One skilled in the art will appreciate from a reading of this disclosure that 10 various changes in form and detail can be made without departing from the true scope of the invention. 52

Claims (24)

    What Is Claimed Is:
  1. Claim 1. A method for making a recombinant protein having improved biological activity comprising: a) selecting a first protein for which the biological activity is to be improved, and for which the amino acid sequence is known, b) identifying a second protein that is structurally similar to the first protein, which second protein has the desired biological activity, and for which the amino acid sequence is known; c) identifying one or more amino acids on the first protein that are different from the corresponding amino acids on the second protein; d) substituting one or more of the differing amino acids identified in the second protein in c), for the corresponding one or more amino acids in the first protein, to obtain the recombinant protein having improved biological activity.
  2. Claim 2. A method for making a recombinant protein having improved biological activity comprising: a- selecting a first protein for which the biological activity is to be improved, and for which a nucleic acid sequence and the amino acid sequence is known, b- identifying a second protein that is structurally similar to the first protein, which second protein has the desired biological activity, and for which the amino acid sequence is known; c- identifying one or more amino acids on the first protein that are different from the corresponding one or more amino acids on the second protein; d- substituting one or more of the differing amino acids identified in the second protein in c), for the corresponding one or more amino acids in the first protein, by making one or more mutations to the nucleic acid sequence of the first protein to make a recombinant nucleic acid sequence that includes codons for the one or more substituted amino acids, and e- translating the recombinant nucleic acid sequence in vivo or in vitro to obtain the recombinant protein having improved biological activity.
  3. Claim 3. The method of claim 1 , wherein the first protein is interferon tau.
  4. Claim 4. The method of claim 1 , wherein the second protein is interferon alpha.
  5. Claim 5. The method of claim 3, wherein the interferon tau ovine is interferon tau 1mod identified by amino acid SEQ. ID NO. 2.
  6. Claim 6. The method of claim 4, wherein the interferon alpha is human interferon alphaA identified by amino acid SEQ. ID NO. 3.
  7. Claim 7. The method of claim 1 , wherein the biological activity is antiviral activity.
  8. Claim 8. The method of claim 1 , wherein the biological activity is antiproliferative activity.
  9. Claim 9. The method of claim 1 , wherein the one or more differing amino acids are located in a binding site or other region of known biological activity.
  10. Claim 10 The method of claim 9, wherein the antiviral activity inhibits viral replication.
  11. Claim 11. The method of claim 1 , wherein step c further includes the sub steps of: a)-determining which amino acids in the first protein are exposed to solvent, b)-determining which amino acids in the second protein are exposed to solvent, c)-determining which solvent-exposed amino acids on the second protein are different from the corresponding solvent-exposed amino acids on the native protein.
  12. Claim 12. The method of claim 1 , wherein the first and second proteins are from the same species.
  13. Claim 13. The method of claim 1 , wherein the first and second proteins are from different species.
    Claim 14. The method of claim 1 , wherein the first and second proteins are naturally occurring proteins.
  14. Claim 14. The method of claim 1 , wherein the first and second proteins are non- naturally occurring proteins.
  15. Claim 15. A recombinant interferon tau protein, selected from the group comprising amino acids identified by SEQ. ID NOs. 4-10, and 18-20.
  16. Claim 16. A method for treating cancer or a tumor, comprising administering to an animal in need of such treatment, a therapeutically effective amount of a recombinant interferon tau protein selected from the group comprising amino acid sequences identified by SEQ. ID NOs. 4-10, and 18-20, sufficient to treat the cancer.
  17. Claim 17. A method of treating a viral disease, comprising administering to an animal in need of such treatment, a therapeutically effective amount of a recombinant interferon tau protein selected from the group comprising amino acid sequences identified by SEQ. ID NOs. 4-10, and 18-20, sufficient to treat the viral disease.
  18. Claim 18. The method of claim 17, wherein the virus is a human immunodeficiency virus or hepatitis C virus.
  19. Claim 19. The method of claim 17, where said virus is an RNA virus.
  20. Claim 20. A method of decrease tumor cell growth, comprising contacting tumor cells in vivo or in vitro, with a recombinant IFN-tau protein selected from the group comprising amino acid sequences identified by SEQ. ID NOs. 4-10, and 18-20, at a concentration effective to decrease growth of said tumor cells.
  21. Claim 21. The method of claim 16, wherein said cancer or tumor is selected from the group comprising human adenocarcinoma, treat breast cancer, prostate cancer, glioblastomas, melanomas, myelomas, lymphomas, leukemias, lung cancer, skin cancer, bladder cancer, kidney cancer, brain cancer, ovarian cancer, pancreatic cancer, uterine cancer, bone cancer, colorectal cancer, cervical cancer and neuroectodermal cancer, monoclonal gammapothies, and cervical and oral dysplasia.
  22. Claim 22. A method of treating autoimmune disease in an animal in need of such treatment, comprising administering to the animal an effective amount of recombinant IFN-tau protein selected from the group comprising amino acid sequences identified by SEQ. ID NOs. 4-10, and 18-20, sufficient to treat the autoimmune disease.
  23. Claim 23. The method of claim 22, wherein said autoimmune disease is selected from the group consisting of Type I diabetes mellitus, rheumatoid arthritis, lupus erythematosus and psoriasis.
  24. Claim 24. A method of treating multiple sclerosis in an animal in need of such treatment, comprising administering to the animal an effective amount of a recombinant IFN-tau protein selected from the group comprising amino acid sequences identified by SEQ. ID NOs. 4-10, and 18-20, sufficient to treat the autoimmune disease.
AU61758/00A 1999-06-22 2000-06-22 Interferon tau mutants and methods for making them Abandoned AU6175800A (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US14041199P 1999-06-22 1999-06-22
US60140411 1999-06-22
PCT/IB2000/001080 WO2000078266A2 (en) 1999-06-22 2000-06-22 Interferon tau mutants and methods for making them

Publications (1)

Publication Number Publication Date
AU6175800A true AU6175800A (en) 2001-01-09

Family

ID=22491109

Family Applications (1)

Application Number Title Priority Date Filing Date
AU61758/00A Abandoned AU6175800A (en) 1999-06-22 2000-06-22 Interferon tau mutants and methods for making them

Country Status (5)

Country Link
EP (1) EP1156771A2 (en)
JP (1) JP2003525592A (en)
AU (1) AU6175800A (en)
CA (1) CA2382425A1 (en)
WO (1) WO2000078266A2 (en)

Families Citing this family (13)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US7083782B2 (en) 2000-07-19 2006-08-01 Pepgen Corporation Method of treatment using interferon-tau
EP1355938A2 (en) * 2000-07-19 2003-10-29 Pepgen Corporation Composition for treatment of and method of monitoring hepatitis c virus using interferon-tau
JP2006213597A (en) 2000-07-19 2006-08-17 Pepgen Corp Composition for treating hepatitis c virus by using interferon tau and method of monitoring
US7105154B2 (en) 2000-07-19 2006-09-12 Pepgen Corporation Method of treatment using interferon-tau
US20040126360A1 (en) * 2002-10-09 2004-07-01 Manning Mark C. Oral formulations for proteins and polypeptides
US20060134750A1 (en) * 2004-03-10 2006-06-22 Pepgen Corporation Method of treatment using interferon-tau
US20070025963A1 (en) * 2005-07-27 2007-02-01 Chih-Ping Liu Methods for reduction of scar tissue formation
US20070243163A1 (en) * 2006-02-17 2007-10-18 Chih-Ping Liu Respiratory tract delivery of interferon-tau
FR2905375A1 (en) * 2006-08-29 2008-03-07 Biomethodes Sa Thermostable variants of human interferon alpha useful for preparing antiviral, antiproliferative or immunomodulatory medicaments have one or more selected amino acid substitutions
JP2010525821A (en) 2007-05-02 2010-07-29 アンブルックス，インコーポレイテッド Modified IFN beta polypeptides and their use
CN108840921B (en) * 2018-05-31 2021-06-29 浙江善测禾骑士生物科技有限公司 Sheep alpha interferon mutant and preparation method and application thereof
RU2739261C1 (en) * 2019-12-31 2020-12-22 Федеральное государственное бюджетное учреждение науки институт биоорганической химии им. академиков М.М. Шемякина и Ю.А. Овчинникова Российской академии наук (ИБХ РАН) Method for quantitative determination of anti-proliferative activity of human interferon-beta
CN115968291A (en) * 2020-04-22 2023-04-14 南湖制药公司 Pegylated interferon TAU and compositions and methods thereof

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US6372206B1 (en) * 1989-03-02 2002-04-16 University Of Florida Orally-administered interferon-TAU compositions and methods
CN1090510A (en) * 1992-10-30 1994-08-10 佛罗里达大学 Interferon constituent and uses thereof

Also Published As

Publication number Publication date
WO2000078266A3 (en) 2001-08-23
JP2003525592A (en) 2003-09-02
CA2382425A1 (en) 2000-12-28
EP1156771A2 (en) 2001-11-28
WO2000078266A2 (en) 2000-12-28

Similar Documents

Publication Publication Date Title
US6833256B1 (en) Interferon tau mutants and methods for making them
EP0888122B1 (en) HYBRID WITH INTERFERON-alpha AND AN IMMUNOGLOBULIN Fc LINKED THROUGH A NON-IMMUNOGENIC PEPTIDE
KR100630849B1 (en) Polymer conjugates of interferon beta-1a and uses
US9629898B2 (en) Use of interleukin-22 in treating viral hepatitis
HRP20020387A2 (en) Interferon gamma conjugates
JP2003530070A (en) Expression and export of interferon-α protein as Fc fusion protein
EP1121382A2 (en) Interferon-beta fusion proteins and uses
CA2572751A1 (en) Pegylated interferon alpha-1b
AU6175800A (en) Interferon tau mutants and methods for making them
CN103079586A (en) Use of G-CSF dimer in the treatment of neutropenia
AU755078B2 (en) IFNAR2/IFN complex
US6242570B1 (en) Production and use of recombinant protein multimers with increased biological activity
Hauptstein et al. Bioconjugation strategies and clinical implications of Interferon-bioconjugates
KR20030094336A (en) Interferon gamma polypeptide variants
US20030017550A1 (en) DNA sequences encoding fusion proteins comprising IFN-beta and TM-alpha1
US7235232B2 (en) Interferon alpha hybrids
RU2268749C2 (en) Interferon-gamma conjugates
WO2000006596A2 (en) Interferon alpha hybrids
Shorts et al. Characterization of N-terminal interferon τ mutants: P26L affords enhanced activity and lack of toxicity
AU706762B2 (en) Interferon tau compositions and methods of use
CA2495480A1 (en) Interferon and immunoglobulin fc fragment hybrid
MXPA00005886A (en) Ifnar2/ifn complex
CN101172160A (en) Interferon gamma conjugates