AU5860198A - Annexin v-binding polypeptides derived from hbsag and their uses - Google Patents
Annexin v-binding polypeptides derived from hbsag and their usesInfo
- Publication number
- AU5860198A AU5860198A AU58601/98A AU5860198A AU5860198A AU 5860198 A AU5860198 A AU 5860198A AU 58601/98 A AU58601/98 A AU 58601/98A AU 5860198 A AU5860198 A AU 5860198A AU 5860198 A AU5860198 A AU 5860198A
- Authority
- AU
- Australia
- Prior art keywords
- hbsag
- annexin
- binding
- polypeptide
- seq
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims description 282
- 102000004196 processed proteins & peptides Human genes 0.000 title claims description 234
- 230000027455 binding Effects 0.000 title claims description 134
- 229920001184 polypeptide Polymers 0.000 title claims description 128
- 102000000412 Annexin Human genes 0.000 title description 6
- 108050008874 Annexin Proteins 0.000 title description 6
- 108090000672 Annexin A5 Proteins 0.000 claims description 108
- 102000004121 Annexin A5 Human genes 0.000 claims description 108
- 241000700721 Hepatitis B virus Species 0.000 claims description 73
- 241000282414 Homo sapiens Species 0.000 claims description 45
- 208000015181 infectious disease Diseases 0.000 claims description 41
- 239000000203 mixture Substances 0.000 claims description 33
- 241000724709 Hepatitis delta virus Species 0.000 claims description 29
- 229960005486 vaccine Drugs 0.000 claims description 26
- 208000037262 Hepatitis delta Diseases 0.000 claims description 23
- 208000029570 hepatitis D virus infection Diseases 0.000 claims description 23
- 230000003993 interaction Effects 0.000 claims description 23
- 238000000034 method Methods 0.000 claims description 18
- 239000003814 drug Substances 0.000 claims description 17
- 210000002966 serum Anatomy 0.000 claims description 16
- 239000000427 antigen Substances 0.000 claims description 13
- 108091007433 antigens Proteins 0.000 claims description 13
- 102000036639 antigens Human genes 0.000 claims description 13
- 238000004519 manufacturing process Methods 0.000 claims description 12
- 241000282412 Homo Species 0.000 claims description 11
- 230000000903 blocking effect Effects 0.000 claims description 11
- 150000001413 amino acids Chemical class 0.000 claims description 10
- 208000002672 hepatitis B Diseases 0.000 claims description 10
- 239000002054 inoculum Substances 0.000 claims description 10
- 239000013543 active substance Substances 0.000 claims description 9
- 239000012634 fragment Substances 0.000 claims description 8
- 230000002163 immunogen Effects 0.000 claims description 8
- 238000000338 in vitro Methods 0.000 claims description 8
- 150000001875 compounds Chemical class 0.000 claims description 7
- 239000012472 biological sample Substances 0.000 claims description 6
- 239000000969 carrier Substances 0.000 claims description 6
- 229940079593 drug Drugs 0.000 claims description 5
- 238000011081 inoculation Methods 0.000 claims description 5
- 239000000872 buffer Substances 0.000 claims description 4
- 238000005406 washing Methods 0.000 claims description 4
- 230000001900 immune effect Effects 0.000 claims description 3
- 239000008194 pharmaceutical composition Substances 0.000 claims description 3
- 208000005331 Hepatitis D Diseases 0.000 claims description 2
- 210000004027 cell Anatomy 0.000 description 30
- 238000002474 experimental method Methods 0.000 description 21
- 230000009257 reactivity Effects 0.000 description 21
- 241000282577 Pan troglodytes Species 0.000 description 17
- 108010090804 Streptavidin Proteins 0.000 description 17
- 210000003494 hepatocyte Anatomy 0.000 description 16
- 238000013507 mapping Methods 0.000 description 16
- 235000001014 amino acid Nutrition 0.000 description 15
- 230000028993 immune response Effects 0.000 description 15
- 230000035772 mutation Effects 0.000 description 15
- 241000283973 Oryctolagus cuniculus Species 0.000 description 14
- 239000000243 solution Substances 0.000 description 14
- 102000013415 peroxidase activity proteins Human genes 0.000 description 11
- 108040007629 peroxidase activity proteins Proteins 0.000 description 11
- TZCPCKNHXULUIY-RGULYWFUSA-N 1,2-distearoyl-sn-glycero-3-phosphoserine Chemical compound CCCCCCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@H](N)C(O)=O)OC(=O)CCCCCCCCCCCCCCCCC TZCPCKNHXULUIY-RGULYWFUSA-N 0.000 description 10
- ZWZWYGMENQVNFU-UHFFFAOYSA-N Glycerophosphorylserin Natural products OC(=O)C(N)COP(O)(=O)OCC(O)CO ZWZWYGMENQVNFU-UHFFFAOYSA-N 0.000 description 10
- 101000780122 Homo sapiens Annexin A5 Proteins 0.000 description 10
- 108020004999 messenger RNA Proteins 0.000 description 10
- 108090001008 Avidin Proteins 0.000 description 9
- 230000005875 antibody response Effects 0.000 description 9
- 108090000623 proteins and genes Proteins 0.000 description 9
- 230000003053 immunization Effects 0.000 description 8
- 238000002649 immunization Methods 0.000 description 8
- 238000011534 incubation Methods 0.000 description 8
- 238000002360 preparation method Methods 0.000 description 8
- 235000018102 proteins Nutrition 0.000 description 8
- 102000004169 proteins and genes Human genes 0.000 description 8
- 238000013207 serial dilution Methods 0.000 description 8
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 125000003275 alpha amino acid group Chemical group 0.000 description 7
- 239000002245 particle Substances 0.000 description 7
- 230000003362 replicative effect Effects 0.000 description 7
- 210000001519 tissue Anatomy 0.000 description 7
- YRNWIFYIFSBPAU-UHFFFAOYSA-N 4-[4-(dimethylamino)phenyl]-n,n-dimethylaniline Chemical compound C1=CC(N(C)C)=CC=C1C1=CC=C(N(C)C)C=C1 YRNWIFYIFSBPAU-UHFFFAOYSA-N 0.000 description 6
- 239000002671 adjuvant Substances 0.000 description 6
- 239000003153 chemical reaction reagent Substances 0.000 description 6
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 6
- 239000011780 sodium chloride Substances 0.000 description 6
- 241000700605 Viruses Species 0.000 description 5
- 238000003556 assay Methods 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 239000001963 growth medium Substances 0.000 description 5
- 239000000546 pharmaceutical excipient Substances 0.000 description 5
- 241000894007 species Species 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 4
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 4
- 230000000763 evoking effect Effects 0.000 description 4
- 238000002347 injection Methods 0.000 description 4
- 239000007924 injection Substances 0.000 description 4
- 239000000543 intermediate Substances 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 150000003904 phospholipids Chemical class 0.000 description 4
- 108091036055 CccDNA Proteins 0.000 description 3
- 108010010803 Gelatin Proteins 0.000 description 3
- 101150010882 S gene Proteins 0.000 description 3
- 238000002105 Southern blotting Methods 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 230000009260 cross reactivity Effects 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 229920000159 gelatin Polymers 0.000 description 3
- 239000008273 gelatin Substances 0.000 description 3
- 235000019322 gelatine Nutrition 0.000 description 3
- 235000011852 gelatine desserts Nutrition 0.000 description 3
- 210000000987 immune system Anatomy 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 210000004185 liver Anatomy 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- WTJKGGKOPKCXLL-RRHRGVEJSA-N phosphatidylcholine Chemical compound CCCCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCC=CCCCCCCCC WTJKGGKOPKCXLL-RRHRGVEJSA-N 0.000 description 3
- 238000011160 research Methods 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- 125000006850 spacer group Chemical group 0.000 description 3
- 239000000126 substance Substances 0.000 description 3
- 238000001262 western blot Methods 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 2
- QUSNBJAOOMFDIB-UHFFFAOYSA-N Ethylamine Chemical compound CCN QUSNBJAOOMFDIB-UHFFFAOYSA-N 0.000 description 2
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 2
- 101000872838 Hepatitis B virus genotype C subtype adr (isolate China/NC-1/1988) Small envelope protein Proteins 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 2
- 101001006139 Podospora anserina Heterokaryon incompatibility protein s Proteins 0.000 description 2
- 241000288906 Primates Species 0.000 description 2
- 230000021736 acetylation Effects 0.000 description 2
- 238000006640 acetylation reaction Methods 0.000 description 2
- 230000003321 amplification Effects 0.000 description 2
- 239000002506 anticoagulant protein Substances 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 230000006287 biotinylation Effects 0.000 description 2
- 238000007413 biotinylation Methods 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 235000014113 dietary fatty acids Nutrition 0.000 description 2
- 230000029087 digestion Effects 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 230000000694 effects Effects 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 239000000194 fatty acid Substances 0.000 description 2
- 229930195729 fatty acid Natural products 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 238000003018 immunoassay Methods 0.000 description 2
- 238000012744 immunostaining Methods 0.000 description 2
- 230000002458 infectious effect Effects 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 239000011159 matrix material Substances 0.000 description 2
- 239000003068 molecular probe Substances 0.000 description 2
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 2
- 238000003199 nucleic acid amplification method Methods 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 239000003755 preservative agent Substances 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 238000004007 reversed phase HPLC Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- DRHZYJAUECRAJM-DWSYSWFDSA-N (2s,3s,4s,5r,6r)-6-[[(3s,4s,4ar,6ar,6bs,8r,8ar,12as,14ar,14br)-8a-[(2s,3r,4s,5r,6r)-3-[(2s,3r,4s,5r,6s)-5-[(2s,3r,4s,5r)-4-[(2s,3r,4r)-3,4-dihydroxy-4-(hydroxymethyl)oxolan-2-yl]oxy-3,5-dihydroxyoxan-2-yl]oxy-3,4-dihydroxy-6-methyloxan-2-yl]oxy-5-[(3s,5s, Chemical compound O([C@H]1[C@H](O)[C@H](O[C@H]([C@@H]1O[C@H]1[C@@H]([C@@H](O)[C@@H](O)[C@@H](CO)O1)O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@H]5CC(C)(C)CC[C@@]5([C@@H](C[C@@]4(C)[C@]3(C)CC[C@H]2[C@@]1(C=O)C)O)C(=O)O[C@@H]1O[C@H](C)[C@@H]([C@@H]([C@H]1O[C@H]1[C@@H]([C@H](O)[C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@](O)(CO)CO3)O)[C@H](O)CO2)O)[C@H](C)O1)O)O)OC(=O)C[C@@H](O)C[C@H](OC(=O)C[C@@H](O)C[C@@H]([C@@H](C)CC)O[C@H]1[C@@H]([C@@H](O)[C@H](CO)O1)O)[C@@H](C)CC)C(O)=O)[C@@H]1OC[C@@H](O)[C@H](O)[C@H]1O DRHZYJAUECRAJM-DWSYSWFDSA-N 0.000 description 1
- YHQZWWDVLJPRIF-JLHRHDQISA-N (4R)-4-[[(2S,3R)-2-[acetyl-[(3R,4R,5S,6R)-3-amino-4-[(1R)-1-carboxyethoxy]-5-hydroxy-6-(hydroxymethyl)oxan-2-yl]amino]-3-hydroxybutanoyl]amino]-5-amino-5-oxopentanoic acid Chemical compound C(C)(=O)N([C@@H]([C@H](O)C)C(=O)N[C@H](CCC(=O)O)C(N)=O)C1[C@H](N)[C@@H](O[C@@H](C(=O)O)C)[C@H](O)[C@H](O1)CO YHQZWWDVLJPRIF-JLHRHDQISA-N 0.000 description 1
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 1
- GOJUJUVQIVIZAV-UHFFFAOYSA-N 2-amino-4,6-dichloropyrimidine-5-carbaldehyde Chemical group NC1=NC(Cl)=C(C=O)C(Cl)=N1 GOJUJUVQIVIZAV-UHFFFAOYSA-N 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 108091005462 Cation channels Proteins 0.000 description 1
- 108010039939 Cell Wall Skeleton Proteins 0.000 description 1
- 208000003322 Coinfection Diseases 0.000 description 1
- 102000029816 Collagenase Human genes 0.000 description 1
- 238000009007 Diagnostic Kit Methods 0.000 description 1
- 238000002965 ELISA Methods 0.000 description 1
- LVGKNOAMLMIIKO-UHFFFAOYSA-N Elaidinsaeure-aethylester Natural products CCCCCCCCC=CCCCCCCCC(=O)OCC LVGKNOAMLMIIKO-UHFFFAOYSA-N 0.000 description 1
- 101710142246 External core antigen Proteins 0.000 description 1
- 241000287828 Gallus gallus Species 0.000 description 1
- 108090000288 Glycoproteins Proteins 0.000 description 1
- 102000003886 Glycoproteins Human genes 0.000 description 1
- 239000012981 Hank's balanced salt solution Substances 0.000 description 1
- 208000032843 Hemorrhage Diseases 0.000 description 1
- 241000700739 Hepadnaviridae Species 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 102100034349 Integrase Human genes 0.000 description 1
- AEFLONBTGZFSGQ-VKHMYHEASA-N L-isoglutamine Chemical compound NC(=O)[C@@H](N)CCC(O)=O AEFLONBTGZFSGQ-VKHMYHEASA-N 0.000 description 1
- 102100037611 Lysophospholipase Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 108010058846 Ovalbumin Proteins 0.000 description 1
- 241000282579 Pan Species 0.000 description 1
- 108010058864 Phospholipases A2 Proteins 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 206010042566 Superinfection Diseases 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 108010003533 Viral Envelope Proteins Proteins 0.000 description 1
- UZQJVUCHXGYFLQ-AYDHOLPZSA-N [(2s,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-4-[(2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-6-(hydroxymethyl)-4-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-6-(hy Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@]([C@@]3(CC[C@H]2[C@@]1(C=O)C)C)(C)CC(O)[C@]1(CCC(CC14)(C)C)C(=O)O[C@H]1[C@@H]([C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O[C@H]4[C@@H]([C@@H](O[C@H]5[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O5)O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O UZQJVUCHXGYFLQ-AYDHOLPZSA-N 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000000240 adjuvant effect Effects 0.000 description 1
- 238000007818 agglutination assay Methods 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- 239000004411 aluminium Substances 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 229910021502 aluminium hydroxide Inorganic materials 0.000 description 1
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 description 1
- 229940001007 aluminium phosphate Drugs 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 238000000211 autoradiogram Methods 0.000 description 1
- 230000004888 barrier function Effects 0.000 description 1
- 230000008275 binding mechanism Effects 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 208000034158 bleeding Diseases 0.000 description 1
- 231100000319 bleeding Toxicity 0.000 description 1
- 230000000740 bleeding effect Effects 0.000 description 1
- 230000023555 blood coagulation Effects 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 239000001110 calcium chloride Substances 0.000 description 1
- 229910001628 calcium chloride Inorganic materials 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 210000004520 cell wall skeleton Anatomy 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 235000013330 chicken meat Nutrition 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 229960002424 collagenase Drugs 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 238000011109 contamination Methods 0.000 description 1
- 229920001577 copolymer Polymers 0.000 description 1
- 125000004122 cyclic group Chemical group 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 1
- 238000007877 drug screening Methods 0.000 description 1
- 230000009977 dual effect Effects 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- BDWFYHUDXIDTIU-UHFFFAOYSA-N ethanol;propane-1,2,3-triol Chemical compound CCO.OCC(O)CO BDWFYHUDXIDTIU-UHFFFAOYSA-N 0.000 description 1
- LVGKNOAMLMIIKO-QXMHVHEDSA-N ethyl oleate Chemical compound CCCCCCCC\C=C/CCCCCCCC(=O)OCC LVGKNOAMLMIIKO-QXMHVHEDSA-N 0.000 description 1
- 229940093471 ethyl oleate Drugs 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 108060003552 hemocyanin Proteins 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 125000005842 heteroatom Chemical group 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 238000009396 hybridization Methods 0.000 description 1
- 238000003365 immunocytochemistry Methods 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 230000016784 immunoglobulin production Effects 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 230000004957 immunoregulator effect Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- BWHLPLXXIDYSNW-UHFFFAOYSA-N ketorolac tromethamine Chemical compound OCC(N)(CO)CO.OC(=O)C1CCN2C1=CC=C2C(=O)C1=CC=CC=C1 BWHLPLXXIDYSNW-UHFFFAOYSA-N 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 239000006193 liquid solution Substances 0.000 description 1
- 239000006194 liquid suspension Substances 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 210000004072 lung Anatomy 0.000 description 1
- 150000002669 lysines Chemical class 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 229910001629 magnesium chloride Inorganic materials 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 239000013642 negative control Substances 0.000 description 1
- 230000010807 negative regulation of binding Effects 0.000 description 1
- 108010087904 neutravidin Proteins 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 239000000346 nonvolatile oil Substances 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 229940092253 ovalbumin Drugs 0.000 description 1
- 239000006179 pH buffering agent Substances 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 210000005152 placental membrane Anatomy 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 230000002516 postimmunization Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000159 protein binding assay Methods 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 235000017709 saponins Nutrition 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 229940031439 squalene Drugs 0.000 description 1
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 1
- 230000004936 stimulating effect Effects 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 239000000829 suppository Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- 238000001890 transfection Methods 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 239000003656 tris buffered saline Substances 0.000 description 1
- 239000003981 vehicle Substances 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 230000000007 visual effect Effects 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 238000009736 wetting Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/005—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/12—Antivirals
- A61P31/20—Antivirals for DNA viruses
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2730/00—Reverse transcribing DNA viruses
- C12N2730/00011—Details
- C12N2730/10011—Hepadnaviridae
- C12N2730/10111—Orthohepadnavirus, e.g. hepatitis B virus
- C12N2730/10122—New viral proteins or individual genes, new structural or functional aspects of known viral proteins or genes
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Virology (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- General Health & Medical Sciences (AREA)
- Biotechnology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Biophysics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Biochemistry (AREA)
- Engineering & Computer Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Communicable Diseases (AREA)
- Oncology (AREA)
- Genetics & Genomics (AREA)
- General Chemical & Material Sciences (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Peptides Or Proteins (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Description
ANNEXIN V-BINPEVG POLYPEPTIDES DERIVED FROM HBsAg
ANT) THEIR USES
FIELD OF THE INVENTION
The present invention relates to polypeptides derived from a hepatitis B virus envelope glycoprotein, termed hepatitis B surface antigen, which compete with the interaction between hepatitis B surface antigen and the phospholipid-binding protein annexin V. The present invention also concerns the use of these polypeptides, and antibodies against them, in order to diagnose, treat and vaccinate against, an infection with hepatitis B virus and hepatitis delta virus.
BACKGROUND OF THE INVENTION
Hepatitis B virus (HBV) belongs to the Hepadnaviridae which are characterized by a significant hepatotropism and species specificity. Hepatitis delta virus (HDV) represents a naturally occurring subviral satellite of HBV (Rizetto et al, 1986). HBV causes major medical problems, such as chronic liver disease and hepatocellular carcinoma (Schroder & Zentgraf, 1990). HDV su erinfection is usually more severe compared to HBV infection solely. It is estimated that there are 300 million human carriers ofthe virus worldwide, while in the US only 70,000 carriers are coinfected with HDV.
Within the HBV genome, and more particularly within the S gene (see also next paragraph), there exists a natural sequence variation. Genotypes A to F of HBV are designated based on this sequence divergence (for review, see Magnius & Norder, 1995).
The HBV envelope consists of three related glycoproteins, termed hepatitis B surface antigens (HBsAg), which are the product ofthe S gene: 1) the "small" transmembrane protein, also termed major protein or small S-protein, composed of 226 amino acids (aa), 2) the "middle" protein which comprises the small S-protein and 55 additional aa at the N-terminus corresponding to the pre-S2 region of the S gene, and 3) the "large" protein composed of 389 or 400 aa corresponding to the following regions: S + pre-S2 + pre-Sl (108-119 N-terminal aa) (Heerman et aL, 1984; Robinson et al, 1987). The envelope of HDV is also entirely derived from HBV and consists predominantly of small HbsAg, 5-10% of middle HbsAg and no or less then 1% of large
HbsAg (Bonino et al, 1986).
The region composed of aa 100 to 160 of "small" HBsAg has been predicted to be located on the outer surface ofthe virus (for review, see Beiting et al, 1995). Current vaccines, using recombinant "small" HBsAg, result in a protective antibody response directed against a limited number of epitopes such as the major "a" deteraiinant: aa 139-147. The latter determinant is shown to be the most immimodominant epitope within the region aa 100-160 of "small" HBsAg (for review, see Magnius & Norder, 1995, and, Howard & Allison, 1995). On the other hand, many vaccine escape mutants for the "a" deteπninant have evolved since (Howard & Allison, 1995). There is thus a need to characterize new epitopes which can be used in the design of new vaccines against hepatitis B.
Annexin V (also termed endonexin π, placental anticoagulant protein, PP4 or lipocortin V) is a member ofthe family of structurally related Ca^-dependent phosphohpid-binding proteins, known as annexins, which have molecular weights between 32 and 67 kDa (Klee, 1988; Zaks & Creutz, 1990). Annexin V is found in various tissues such as liver, spleen, lung, intestine and placenta (Walker et al, 1990). The protein has been described to bind, in a Ca2+-dependent manner, to placental membranes (Haigler et al, 1987) and to inhibit blood coagulation (Grundman et al, 1988) and phospholipase A2 activity in vitro (Pepinsky et al, 1988). Other investigators have demonstrated that annexin V behaves like an integral membrane protein and forms calcium- selective cation channels (Rojas et al, 1990; Bianchi et al, 1992). We have recently shown that annexin V, present on human liver plasma membranes. specifically binds to "small" HBsAg in a Ca2+-dependent manner (Hertogs et al, 1993; WO 94/01554). The receptor-ligand relationship between HBsAg and annexin V is further supported by the observation that rabbits, irmnunized with native human hver annexin V or recombinant annexin V, or chickens, immunized with F(ab')2-fragments of rabbit anti-annexin V IgG, spontaneously develop anti-idiotypic antibodies (Ab2) which specifically recognize HBsAg
(Hertogs et al, 1994). We also demonstrated that HDV particles are binding to annexin V via the HbsAg containing envelope of HBV (de Bruin et al, 1994). However, and although several peptides derived from HbsAg have been described (EP 044710; EP 0155146; WO 9516704) the exact site on HBsAg which binds annexin V was not known. Mapping of this site could lead to the development of new epitopes which can be used in the design of methods to interrupt the infection cycle of both HBV and HDV.
AIMS OF THE INVENTION
It is clear from the literature cited above that the appearance of vaccine escape mutants to the major "a" determinant of "small" HBsAg presents a problem with regard to the protection offered by the currently used vaccines against HBV infection. Indeed, HBV infections have been described in vaccinated children (Howard et al, 1995). The present invention aims, in general at providing new polypeptides which, when used in a vaccine or any other composition, result in a better protection against hepatitis B, and consequently hepatitis D, infection.
A polypeptide, used in a vaccine composition, which might provide a better protection is very likely derived from a viral antigen which plays a crucial role for survival ofthe virus. As it has been demonstrated that annexin V binds HBsAg and, thus, might play a vital role in the initiation of HBV and HDV infection, the annexin V-binding domain on HBsAg may not be subject to major mutations. This is in contrast to the "a" determinant on HBsAg for which many escape variants have already been characterized (Carman et al, 1990). In other words, the development of escape mutants in the annexin V-binding domain of HBsAg is unlikely. Therefore, the present invention aims at providing a polypeptide derived from HBsAg, which competes with the HBsAg/annexin V interaction or which binds a compound or antibody competing with the HBsAg/annexin V interaction, and is immunogenic. More specifically, the present invention aims at providing a polypeptide as described above which comprises less than 61 amino acids containing at least 4 amino acids of one of the following sequences: FAKYLWEWASVR,
KTCTTPAQGN and TTPAQGN. In this regard, it should be clear that mapping such a polypeptide is not an obvious undertaking. In particular, engineering a peptide in such a way that it evokes upon immunization a specific response against the annexin V-binding epitope or a part thereof, is not obvious at all. The present invention further aims at providing a polypeptide which comprises the sequence KTCTTPAQGN or TTPAQGN, and the sequence FAKYLWEWASVR, or functionally equivalent parts or variants of siad sequences.
The present invention also aims at providing a vaccine composition which comprises as an active substance a polypeptide as described above. Furthermore, the present invention aims at providing a vaccine composition as described above for use as an inoculum to vaccinate humans against infection with HBV and/or HDV or any
mutated strain thereof or to therapeutically vaccinate human earners of HBV and/or HDV or any mutated strain thereof The reason to be able to therapeutically vaccinate earners of HBV using the above-described vaccine composition is based on our surprising observation that the polypeptide derived from HBV, as described above, evokes a specific antibody response against this polypeptide whereas a natural HBV infection in a control chimpanzee (see Example 5) does not result in the production of such antibodies. In other words, the inoculation of the above- described vaccine composition during an infection with HBV results in a better immune response and hence a better protection.
Thus, the present invention also aims at providing a polypeptide as described above or any mutated version thereof which, upon inoculation in a mammalian host, results in the production of antibodies which specifically bind to said polypeptide, in particular to the sequence
KTCTTPAQGN or a part thereof or, to the sequence TTPAQGN or a part thereof, or, to the sequence FAKYLWEWASVR or a part thereof
The present invention also aims at providing a combination of a polypeptide according to any ofthe previous aims and a negatively charged phospholipid.
Furthermore, the present invention aims at providing a polypeptide composition comprising any combination of polypeptides as defined above.
The present invention also aims at providing antibodies or fragments thereof which specifically bind to a polypeptide as defined above and inhibit binding of said polypeptide to annexin V.
The present invention further aims at providing a pharmaceutical composition comprising as an active substance the antibodies or fragments thereof as defined above for use in a method to treat humans infected with HBV and/or HDV or any mutated strain thereof.
Furthermore, the present invention aims at providing a method, using a polypeptide as defined above, to detect antibodies which are capable of competing with the HBsAg/annexin V interaction and which are present in a biological sample, comprising: a) contacting the biological sample to be analysed for the presence of HBsAg antibodies with a polypeptide as defined above, b) detecting the immunological complex formed between said antibodies and said polypeptide. The present invention also aims at providing a pharmaceutical composition comprising as an active substance a polypeptide as defined above for use in a method to treat humans infected
with HBV and/or HDV or any mutated strain thereof
Moreover, the present invention aims at
a polypeptide as defined above for use in a method to screen for drugs which block the binding between annexin V and said polypeptide.
The present invention also aims at providing polypeptides as defined above for use as a medicament to treat humans infected with hepatitis B virus and/or hepatitis delta virus or any mutated strain thereof
The present invention finally aims at providing a kit for the in vitro determination of antibodies to HBsAg present in human serum containing: at least one microplate, polypeptides as defined above, appropriate buffer, blocking and washing solutions which favor binding of said polypeptides with the antibodies in human serum samples, and appropriate markers which allow to determine the complexes formed between the antibodies in human serum samples and said polypeptides.
All the aims ofthe present invention are considered to have been met by the embodiments as set out below.
BRIEF DESCRIPTION OF DRAWINGS AND TABLES
Table 1 provides sequence information concerning the region aa 99 to 169 of "small" HBsAg which determines four genotypes of HBsAg (A,B,C and D) and regarding the polypeptides which were examined for binding to annexin V and to several antibodies and for their immunogenicity in cliimpanzee and rabbits.
Table 2 shows the relative affinity of peptides for binding the the anti-HBsAg monoclonal C11F5. Briefly binding of C11F5 to HBsAg coated on microtiterplates is competed with the peptides IGP 1076-1083 in soloution. The molar concentration of HBsAg itself yielding a 50% competition is equal to 1.
Figure 1 shows the influence of anti-idiotypic antibodies (Ab2) on the production of HBsAg in culture medium of primary cultures of adult human hepatocytes infected with HBV. HBsAg production of infected cells at days 3, 5, 7, 8 and 10 post-infection in the absence of anti-idiotypic antibodies is represented by "O". Results of HBsAg production in media of non-infected cells or
of cells infected in the presence of anti-idiotypic antibodies are represented by "+" and "*■", respectively. The findings presented are the average of results obtained from five experiments.
Figure 2 demonstrates that anti-idiotypic antibodies (Ab2) which specifically recognize the annexin V binding domain of HBsAg prevent HBV infection in primary cultures of human hepatocytes in vitro. Briefly, the figure represents an autoradiogram ofthe Southern blot analysis of HBV-DNA and replicative intermediates in primary cultures of human hepatocytes infected with HBV in the presence and absence of anti-idiotypic antibodies. Integrated HBV-DNA sequences were present in HepG2.2.15 (a HepG2 cell line transfected with the HBV genome (Sells et al, 1987) (lane 1). HBV-DNA replicative intermediates were detected in cells infected with HBV inoculum in the absence of anti-idiotypic antibodies (lane 4). Lane 2 and 3 represent the results of HBV-DNA detection in experiments without HBV inoculum and in parallel experiments in the presence of anti-idiotypic antibodies, respectively.
Figure 3 demonstrates the binding of an anti-idiotypic antibodies (Ab2), which mimic annexin V, to the polypeptides indicated in table 1 and "small" HBsAg. Briefly, the polypeptides or HBsAg were adsorbed to microtiterplates which were incubated after blocking with a serial dilution of Ab2 (1/50 to 1/5000). Binding of Ab2 was visualized using an anti-rabbit IgG preparation conjugated with peroxidase. Plates were developed using tetramethylbenzidine as colour reagent, finally plates were read at 450 nm.
Figure 4 shows the binding of Ab2 to biotinilated forms of some ofthe polypeptides indicated in table 1. Briefly, streptavidin was adsorbed to microtiterplates which were incubated after blocking with biotinilated peptides, followed by an incubation with serial dilutions of Ab2 (1/50 to 1/5000). Binding of Ab2 was visualized using an anti-rabbit IgG preparation conjugated with peroxidase. Plates were developed using tetramethylbenzidine as colour reagent, finally plates were read at 450 nm.
Figure 5 shows that HBsAg of either genotypes A or D binds Ab2 and annexin V. Briefly, a serial dilution of HBsAg was coated on microtiterplates. After blocking the plates were incubated with
Ab2 (Figure 5A) derived from a rabbit immunized with annexin V or with annexin V itself labelled
with peroxidase (Figure 5B). Binding of Ab2 was visualized using an anti-rabbit IgG peroxidase conjugate.
Figure 6. Binding of horse radish peroxidase (HRPO) labelled recombinant human A-V to solid phase HBsAg in the presence of a serial dilution of phosphatidylserine (open symbols) or phosphatidylcholine (closed symbols).
Figure 7. Binding of HRPO labelled A-V to HBsAg in the presence of a serial dilution of mAbs directed against human A-V (U4C8: open triangles, U1E10: closed triangles, E1E8: open circles, CM1995: closed circles).
Figure 8. Relative inhibition, expressed as % of competition, to a positive control (experiment without competitor) ofthe binding of HRPO labelled A-V to solid phase mAb in the presence of a 75 molar excess of unlabelled rat or human A-V (CM1995: open bars, U4C8: hatched bars, U1E10: closed bars).
Figure 9. Relative inhibition, expressed as % of competition, to a positive control (experiment without competitor) ofthe binding HRPO labelled recombinant human A-V to solid phase mAb in the presence of excess of phosphatidylserine (open bars) or phosphatidylcholine (hatched bars) (ratio phosphoHpid/mAb is 30 (w/w)).
Figure 10. Visual impression of binding between HBsAg and A-V and ofthe binding sites of all inhibiting antibodies.
Figure 11 shows the antibody response of a chimpanzee vaccinated with some ofthe polypeptides indicated in table 1. Briefly, streptavidin or HBsAg was adsorbed to microtiterplates, strepta\idin coated wells were incubated after blocking with biotinilated peptides (IGP 1103, 1119 and the control peptides 1030 and 1038), followed by an incubation with a serial dilution ofthe vaccinated clώnpanzee serum (1/20 to 1/2560). Binding was visualized using an anti-human IgG preparation conjugated with peroxidase. In this regard, it should be noted that IgG antibodies of humans and chimpanzees show sufficient CToss-reactrvity so that chimpanzee IgG's can be detected using anti-
human IgG conjugates. Plates were developed using tetramethylbenzidine as colour reagent, finally plates were read at 450 nm.
Figure 12 demonstrates the evolution of antibody titer of a chimpanzee vaccinated with the polypeptides IGP 1103 and 1119 as described in table 1. Briefly, streptavidin or HBsAg was adsorbed to microtiterplates, streptavidin coated wells were incubated after blocking with biotinilated peptides (IGP 1103, 1119), followed by an incubation with a serial dilution ofthe vaccinated chimpanzee serum (1/20 to 1/2560). Binding was visualized using an anti-human IgG preparation conjugated with peroxidase. Plates were developed using tetramethylbenzidine as colour reagent, finally plates were read at 450 nm Titer is expressed as the serum dilution still giving a positive signal compared to a negative control.
Figure 13 shows the antibody response of a chimpanzee challenged with HBV. Briefly, streptavidin or HBsAg was adsorbed to microtiterplates, streptavidin coated wells were incubated after blocking with biotinilated peptides (IGP 1103, 1119 and the control peptides 1030 and
1038), followed by an incubation with a single dilution of the vaccinated chimpanzee serum (1/20). Binding was visualized using an anti-human IgG preparation conjugated with peroxidase. Plates were developed using tetramethylbenzidine as colour reagent, finally plates were read at 450 nm No specific reactivity with IGP 1119 or 1103 could be measured. The reactivity with the control peptides 1030 and 1038 always exceeded the reactivity with 1119 and 1103.
Figure 14 shows the cross reactivity of antibodies evoked by a genotype A derived peptide. Briefly, streptavidin was adsorbed to microtiterplates which were incubated after blocking with biotinilated peptides, followed by an incubation with a serial dilution of chimpanzee serum (1/24 to 1/213). Binding of cMmpanzee antibodies was visualized using an anti-human IgG preparation conjugated with peroxidase. Plates were developed using tetramethylbenzidine as colour reagent, finally plates were read at 450 nm. IGP 1030 represents a control peptide not related to HbsAg.
Figure 15 shows binding of annexin V to HBsAg peptides representing the amino acid region 112-169. Briefly, binding of annexin V (coupled with horse radish peroxidase) to HBsAg itself or to the biotinylated peptides IGP 671, 673 and 80 (representing the aa region 112-169), the
control peptide IGP 1038 and the peptide binding with the anti-idiotypic antibody (IGP 1119) coated to microtiterplates as a streptavidin complex was evaluated. The specificity of binding of the peptides to annexin V was demonstrated by adding an excess (100 μg/ml) of an anti-annexin V monoclonal antibody which is known to compete with the binding of annexin V to HBsAg (see further example 7).
Figure 16 shows further fine mapping ofthe annexin V binding site on HBsAg. Briefly, binding of a new series of peptides (IGP 1189-1193, IGP 1190- 1192 being hetero-branched peptides, see Table 1) to annexin V was analysed as described above for Figure 15.
Figure 17 shows further fine mapping of the annexin V binding site on HBsAg by direct competition. Briefly, binding of annexin V to HBsAg coated on microtiterplates is competed with HBsAg and with the peptides IGP 1119 and IGP 1193 in solution (both peptides are presented as streptavidin complexes).
Figure 18 shows further fine mapping ofthe Ab2 epitope. Briefly binding of Ab2 to coated on microtiterplates is competed with the peptides P467-P471 in solution.
Figure 19 shows the mapping ofthe epitope for the monoclonal anti-HBsAg antibody, Cl 1F5. Briefly peptides were adsorbed to microtiterplates as streptavidin complexes. Binding of C 11F5 was visualized using a goat-anti-mouse antibody conjugated to peroxidase.
Figure 20 shows the binding of annexin V to peptides containing the HBsAg region 158-169. Briefly binding was performed as described for figure 15, but binding was performed at room temperature instead of 37°C, this in order to select for stronger binding peptides.
Figure 21 shows the relative affinity of peptides for binding to annexin V. Briefly, binding of annexin V to HBsAg coated on microtiterplates is competed with a 200 or 20 molar excess of peptide in solution.
Figure 22 shows the mapping ofthe antibody response of chimpanzee and rabbit against he epitope region 115-134. Briefly peptides were adsorbed to microtiterplates as streptavidin complexes. Binding of antibodies was visualized using a rabbit- anti-human or goat-anti-rabbit antibody conjugated to peroxidase.
Figure 23 shows the mapping ofthe antibody response of rabbit against different peptides (IGP 1273 and 1274) containing the epitope region 158-169. Briefly peptides were adsorbed to microtiterplates as streptavidin complexes. Binding of antibodies was vizualized using a rabbit- anti-human or goat-anti-rabbit antibody conjugated to peroxidase.
DETAILED DESCRIPTION OF THE INVENTION
The invention described herein draws on previously published work and pending patent applications. By way of example, such work consists of scientific papers, patents or pending patent apphcations. All these pubhcations and apphcations, cited previously or below are hereby incorporated by reference.
The present invention is based on the finding of a polypeptide derived from HBsAg which competes with the HBsAg/annexin V interaction, or which binds a compound or antibody competing with this interaction, and is immunogenic. Accordingly, this polypeptide, and antibodies against it, can be used to prevent, diagnose or treat HBV and/or HDV infection. In this regard, it should be clear that the usage of the terms 'ΗBV and/or FEW' indicate that an infection with HBV can occur solely or can be accompanied by a superinfection with HDV. On the other hand, an infection with HDV does not occur solely. In other words, the polypeptides ofthe present invention, and antibodies against them, can be used to prevent, diagnose or treat a HBV infection solely or a mixed HB V/HDV infection.
HBsAg is a known antigen (Heerman et al, 1984; Robinson et al, 1987). Based on this knowledge, polypeptides derived from HBsAg, as herein described, can be prepared by any method known in the art such as classical chemical synthesis, as described by Houbenweyl (1974) and Atheiton & Shepard (1989), or by means of recombinant DNA techniques as described by Maniatis et al. (1982). As used herein, the terms "polypeptides derived from HBsAg" refer to polypeptides having an aa sequence which is equal or similar to a part of the aa sequence of
"small" HBsAg. It should be clear that the 'polypeptides derived from HBsAg'1 can be derived fiom any genotype of HBV (genotype A to F, see Example 6). Furthermore, the term "polypeptide" refers to a polymer of aa which comprises less aa in its sequence than HBsAg, more specifically to a polypeptide which comprises preferentially less than 226, 200, 190, 180, 170, 160, 150, 140, 130, 120, 110, 100, 90 or 80 aa, and most preferably less than 70 aa. This term does not refer to, nor does it exclude, post-translational modifications ofthe polypeptide such as gbycosylation, acetylation, phosphorylation, modifications with fatty acids and the like. Included within the definition are, for example, polypeptides containing one or more analogues of an aa (including unnatural aa's), polypeptides with substituted linkages, mutated versions or natural sequence variations ofthe polypeptides (coπesponding to the genotypes A to F of HBV, as indicated above), polypeptides containing disulfide bounds between cysteine residues, as well as other modifications known in the art.
The polypeptides as set out above are particularly characterized in that they bind anti- idiotypic antibodies (Ab2) which compete with the binding of HBsAg to Annexin V as set out in the Example section or that they bind directly with annexin V.
The expression "which competes with the HBsAg/annexin V interaction or which binds a compound or antibody competing with the HBsAg/annexin V interaction " refers to the description as given by Hertogs et al. (1993 & 1994). It should be clear that this expression also impEes that the polypeptide as defined above may interact with, or may bind (both terms can be used interchangeably), annexin V. Furthermore, it should be understood that the expression "a compound or antibody competing with the HBsAg/annexin V interaction" refers to any molecule which is able to compete with the HBsAg/annexin V interaction. More specifically, the latter terms refer to the anti-idiotypic antibodies as described in the Examples section.
The terms "irnmunogenic polypeptide" relate to the ability ofthe polypeptide to provoke an immune response such as antibody production. These terms further imply that the polypeptide contains a B cell and /or T cell epitope.
More particularly, the present invention relates to a polypeptide as defined above which comprises preferentially less than 61, 55, 51, 45, 41, 35, 31 or 25 aa, and most preferably less than 21 aa and includes one ofthe following sequences: KTCTTPAQGN (SEQ LD NO 2, also referred to as "aa 122-131"), or 9, 8, 7, 6, 5 or 4 aa thereof, or, FAKYLWEWASVR (SEQ LD NO 35, also referred to as "aa 158-169"), or 11, 10, 9, 8, 7, 6, 5 or 4 aa thereof; or, TTPAQGN (SEQ
ID 37. also referred to as "aa 125-131 ) or 6. 5 or 4 aa thereof More specifically, the present invention relates, with regaid to the polypeptides comprising 4 to 9 aa derived fiom the sequence aa 122-131 (SEQ LD NO 2) as defined above, to peptides with the following aa sequence: aa 122- 125, aa 123-126, aa 124-127, aa 125-128, aa 126-129, aa 127-130, aa 128-131, aa 122-126, aa 123-127, aa 124-128, aa 125-129, aa 126-130, aa 127-131, aa 122-127, aa 123-128, aa 124-129, aa 125-130, aa 126-131, aa 122-128, aa 123-129, aa 124-130, aa 125-131, aa 122-129, aa 123- 130, aa 124-131, aa 122-130, aa 123-131 and a a 122-131. In this regard, it should be clear that the present invention preferably relates to the peptide aa 125-131 (SEQ LD 37), aa 125-128, aa 125-129 and aa 125-130. Similarly, the present invention relates, with regard to the polypeptides comprising 4 to 11 aa derived from the sequence FAKYLWEWASVR (also referred to as "aa
158-169 (SEQ LD NO 35) as defined above, to peptides with the following aa sequence: aa 158- 161. aa 159-162, aa 160-163, aa 161-164, aa 162-165, aa 163-166, aa 164-167, aa 165-168, aa 166-169, aa 158-162, aa 159-163, aa 160-164, aa 161-165, aa 162-166, aa 163-167, aa 164-168, aa 165-169, aa 158-163, aa 159-164, aa 160-165, aa 161-166, aa 162-167, aa 163-168, aa 164- 169, aa 158-164, aa 159-165, aa 160-166, aa 161-167, aa 162-168, aa 163-169, aa 158-165, aa
159-166, aa 160-167, aa 161-168, aa 162-169, aa 158-166, aa 159-167, aa 160-168, aa 161-169, aa 158-167, aa 159-168, aa 160-169, aa 158-168 and aa 159-169. Furthermore, it should also be noted that: 1) the polypeptides comprising 4 to 9 aa which are derived from the sequence KTCTTPAQGN (SEQ LD NO 2) and the polypeptides comprising 4 to 11 aa which are derived from the sequence FAKYLWEWASVR (SEQ LD NO 35), and form a binding region to annexin
V, can be mapped by any method known in the art such as those described above, and, 2) the binding region to annexin V formed by the latter polypeptides might be a conformational binding region and should thus not be composed of a contiguous aa sequence.
In this regard, the present invention relates to polypeptides as which comprise the sequences: KTCTTPAQGN (SEQ LD NO 2) or TTPAQGN (SEQ LD NO 37), and the sequence
FAKYLWEWASVR (SEQ LD 35). or functionally equivalent parts or variants of said sequences. The terms ''functionally equivalent parts or variants of said sequences" refer to any variant or fragment ofthe peptides represented by SEQ LD 2, 35 and 37 which competes with the hepatitis surface antigen annexin V interaction or which binds a compound or antibody competing with the hepatitis B surface antigen/annexin V interaction. The latter terms do not specifically refer to, not do they exclude, post-translational modifications of the peptides such as glycosylation,
acetylation. phosphorylation, modifications with fatty acids and the like. Included with the definition are, for example, peptides containing one or more analogues of an aa (including unnatural aa's), peptides with substituted linkages, mutated versions or natural sequence variations ofthe peptides (corresponding to the genotypes of HBV), peptides containing disulfide bounds between cysteine residues, biotinylated peptides as well as other modifications known in the art.
The present invention further relates to a polypeptide, as defined above, which, upon inoculation in a mammalian host, results in the production of antibodies which specifically bind to said polypeptide, in particular to one ofthe following sequences KTCTTPAQGN (SEQ LD NO 2) or parts thereof, or, TTPAQGN (SEQ LD 37) or parts thereof, or, FAKYLWEWASVR (SEQ
LD NO 35) or parts thereof
It should be noted that we were surprised to find a polypeptide derived from HBsAg which is involved in annexin V binding and is immunogenic because firstly, there was no reasonable expectation of success to discover the annexin V-binding region on HBsAg, and secondly, the peptide as defined above is not immunogenic when presented to the immune system as part of HBsAg but is only immunogenic when presented as a peptide (see Example 3).
The present invention also relates to a combination of a polypeptide as defined above and a negatively charged phospholipid such as phosphatidylserine. The interaction between phosphatidylserine and A-V is demonstrated in the Examples section. The combination of said polypeptide and said negatively charged phospholipid component may be in any possible way known in the art such as for instance in the form of covalently or non-covalently coupled molecules or in the form of Iiposomes, etc.
The present invention further relates to a polypeptide composition comprising any combination ofthe above-described polypeptides. The terms "polypeptide composition" refers to any possible mixture of above-described polypeptides with the same or with a different sequence or any possible linkage (covalently or otherwise) between above-described polypeptides with the same or with a different sequence. Examples ofthe latter polypeptide compositions are simple mixtures, homo -or hetero branched peptides, combinations of biotinylated peptides presented on streptavidin, avidin or neutravidin, chemically cross-linked peptides with or without spacer, condensing peptides and recombinantly produced peptides.
The present invention also relates to a vaccine composition comprising as an active
substance a polypeptide as defined above which can be used as an inoculum to vaccinate humans against infection with HBV and or HDV or any mutated strain thereof or to therapeutically vaccinate human carriers of HBV and/or HDV or any mutated strain thereof.
The term "a vaccine composition" relates to an immunogenic composition capable of eliciting protection against HBV and/or HDV, whether partial or complete. The term "as an active substance" relates to the component ofthe vaccine composition which elicits protection against HBVand/or HDV. An active substance (ie. the polypeptides ofthe present invention) can be used as such, in a biotinylated form (as explained in WO 93/18054) and/or complexed to Neutralite Avidin according to the manufacturer's instruction sheet (Molecular Probes Inc., Eugene, OR). It should also be noted that "a vaccine composition" comprises, in addition to an active substance, a suitable excipient, diluent, carrier and/or adjuvant which, by themselves, do not induce the production of antibodies harmful to the individual receiving the composition nor do they elicit protection. Suitable carriers are typically large slowly metabolized macromolecules such as proteins, polysaccharides, polylactic acids, polyglycohc acids, polymeric aa's, aa copolymers and inactive virus particles. Such carriers are well known to those skilled in the art. Preferred adjuvants to enhance effectiveness ofthe composition include, but are not limited to: aluminium hydroxide, aluminium in combination with 3-0-deacylated monophosphoryl lipid A as described in WO 93/19780, aluminium phosphate as described in WO 93/24148, N-acetyl-muramyl-L- threonyl-D-isoglutamine as described in U.S. Patent N° 4,606,918, N-acetyl-normuramyl-L- alanyl-I isoglutamine, N-acetylmuramyl-L-alanyl-D-isoglutamyl-L^alanine2( 1 '2'dipalmitoyl-sn- gycero-3-hydroxyphosphoryloxy) ethylamine and RLBI (ImmunoChem Research Inc., Hamilton, MT) which contains monophosphoryl lipid A, detoxified endotoxin, trehalose-6,6-dimycolate, and cell wall skeleton (MPL + TDM + CWS) in a 2% squalene/Tween 80 emulsion. Any ofthe three components MPL, TDM or CWS may also be used alone or combined 2 by 2. Additionally, adjuvants such as Stimulon (Cambridge Bioscience, Worcester, MA) or SAF- 1 (Syntex) may be used. Furthermore, Complete Freund's Adjuvant (CFA) and Incomplete Freund's Adjuvant (LFA) may be used for non-human apphcations and research purposes. "A vaccine composition" will further contain excipients and diluents, which are inherently non-toxic and non-therapeutic, such as water, saline, glycerol ethanol wetting or emulsifying agents, pH buffering substances, preservatives, and the like. Typically, a vaccine composition is prepared as an injectable, either as a liquid solution or suspension. Solid forms, suitable for solution on, or suspension in, liquid
vehicles prior to injection may also be prepared. The preparation may also be emulsified or encapsulated in liposomes for enhancing adjuvant effect. The polypeptides may also be incorporated into Immune Stimulating Complexes together with saponins, for example Quil A (ISCOMS). Vaccine compositions comprise an immunologically effective amount of the polypeptides ofthe present invention, as well as any other ofthe above-mentioned components.
"Immunologically effective amount" means that the administration of that amount to an kdrvidual either in a single dosis or as part of a series, is effective for prevention or treatment. This amount varies depending upon the health and physical condition of the individual to be treated, the taxonomic group of the mdividual to be treated (e.g. nonhuman primate, primate, etc.), the capacity ofthe individual's immune system to mount an effective immune response, the degree of protection desired, the formulation ofthe vaccine, the treating's doctor assessment, the strain of the infecting HBV, the co-infection status with HDV, and other relevant factors. It is expected that the amount will fall in a relatively broad range that can be determined through routine trials. Usually, the amount will vary from 0.01 to 1000 μg/dose, more particularly from 0.1 to 100 μg/dose. The vaccine compositions are conventionally administered parenterally, typically by injection, for example, subcutaneously or intramuscularly. Additional formulations suitable for other methods of administration include oral formulations and suppositories. Dosage treatment may be a single dose schedule or a multiple dose schedule. The vaccine may be administered in conjunction with other immunoregulatory agents. It should be noted that a vaccine may also be useful for treatment of an individual in which case it is called a "therapeutic vaccine".
The present invention further relates to antibodies, or fragments thereof which specifically bind to a polypeptide as defined above and inhibit bmding of said polypeptide to annexin V. As used herein, the term "antibody" refers to polyclonal or monoclonal antibodies. The term "monoclonal antibody" refers to an antibody composition having a homogeneous antibody population. The term is not limiting regarding the species or source ofthe antibody, nor is it intended to be limited by the manner in which it is made. In addition, the term "antibody" also refers to humanized antibodies in which at least a portion of the framework regions of an immunoglobulin are derived from human iirimunoglobulin sequences and single chain antibodies as described in U.S. patent N° 4,946,778. As used herein, the term "fragments (of antibodies)" refers to Fab, F,(ab)2, F^ and other fragments which retain the antigen binding function and specificity ofthe parent antibody. The inhibition of binding of said polypeptides to annexin V by
these antibodies can be demonstrated in experiments which are similar to the ones described by Hertogs et al. (1993 and 1994).
The present invention also relates to the usage of said antibodies as a medicament to treat humans infected with HBV and/or HDV or any mutated strain thereof. The term "medicament" refers to a composition comprising an antibody according to the present invention possibly in the presence of suitable excφients known to the skilled man such as saline, Ringer's solution, dextrose solution, Hank's solution, fixed oils, ethyl oleate, 5% dextrose in saline, substances that enhance isotonicity and chemical stability, buffers and preservatives. The "medicament" may be administered by any suitable method within the knowledge ofthe skilled man. The preferred route of administration is parenterally. In parental administration, the medicament of this invention will be formulated in a unit dosage injectable form such as a solution, suspension or emulsion, in association with the pharmaceutically acceptable excipients as defined above. However, the dosage and mode of administration will depend on the individual. Generally, the medicament is administered so that the antibody is given at a dose between 1 μg/kg and 10 mg/kg, more preferably between 10 μg/kg and 5 mg/kg, most preferably between 0.1 and 2 mg/kg. Preferably, it is given as a bolus dose. Continuous infusion may also be used. If so, the medicament may be infused at a dose between 5 and 20 μg/kg/minute, more preferably between 7 and 15 μg/kg/minute.
The present invention further relates to the usage ofthe polypeptide as defined above for use in a method to detect antibodies which are capable of competing with the HBsAg/annexin V interaction and which are present in a biological sample, comprising:
1) contacting the biological sample to be analysed for the presence of HBsAg antibodies with a polypeptide as defined above,
2) detecting the immunological complex formed between said antibodies and said polypeptide. As used herein, the term "a method to detect" refers to any immunoassay known in the art such as assays which utilize biotin and avidin or streptavidin, ELISA's and immunoprecipitation and agglutination assays. A detailed description of these assays is given in WO 96/13590. In this regard, the present invention also relates to a diagnostic kit for the in vitro determination of antibodies to HBsAg containing: at least one microplate, polypeptides as defined above, appropriate buffer, blocking, and washing solutions which favor binding ofthe said polypeptides with the antibodies in human serum samples, and appropriate markers which allow to determine
the complexes formed between the antibodies in human serum samples and said polypeptides.
The present invention also relates to the usage of a polypeptide as defined above as a medicament to treat humans infected with HBV and/or HDV or any mutated strain thereof The term "medicament" refers to a composition comprising a polypeptide according to the present invention possibly in the presence of suitable excipients known to the skilled man. The suitable excipients, route of administration and dosage ofthe medicament are the same as described above for a medicament comprising an antibody.
The present invention finally relates to the usage of a polypeptide as defined above for use in a method to screen for drugs which block the binding between annexin V and said polypeptide. As used herein, the term "a method to screen for drugs" refers to any assay known in the art suitable for drug screening. In particular, the term refers to any immunoassay as described in WO 96/13590. The term "drug" may refer to any compound targetting or binding a polypeptide as defined above.
The present invention will now be illustrated by reference to the following examples which set forth particularly advantageous embodiments. However, it should be noted that these embodiments are illustrative and can not be construed as to restrict the invention in any way.
EXAMPLES
Example 1: Transfection of the rat FTO2B cells with human annexin V
To demonstrate the involvement of human A-V (hA-V) in the initial step of HBV infection two in vitro cell models, namely primary human hepatocytes and rat hepatoma cells, were used. Human A-V expression in these cells was assessed by Western-blotting and immunocytochemistry using a monoclonal antibody that specifically detects human A-V (monoclonal antibody U4C8).
HBV infectabihty of these cells was deteπnined by two replicative markers, namely by precore/core mRNA detection and by covalently closed circular (ccc) DNA detection. Firstly, the specificity ofthe HBV precore/core mRNA detection as a replicative marker was investigated. Precore/core mRNA was detected in HBV infected ver tissue, but not in control hver tissue negative for HBV infection. It was also detected in HBV producing cells derived from the HBV-DNA transfected HepG2.2.15 cell line (Sells et al, 1987), while it was not detected in
PLC/PRF/5 cells. These cells contain an integrated HBV genome and produce HBsAg. but no HBV infectious particles. The HBV inoculum used in further experiments contained no precore/core mRNA. but only HBV-DNA.
The fact that RNA was indeed the template for amplification was confirmed by omission ofthe RT step or RNAse digestion before cDNA synthesis which resulted in failure of amplification.
Southern Blot hybridization using a HBV-DNA specific oligonucleotide probe showed that the PCR products of HBV infected hver tissue and HBV-DNA transfected HepG2.2.15 cells (Sells et al, 1987) contain specific HBV sequences. No band was observed in control hver tissue. In order to confirm further that precore/core mRNA is the result of HBV replication and not due to a contamination of RNA present in HBV particles, another replicative marker, namely ccc
DNA was detected by PCR. Ccc DNA was demonstrated in HBV infected ver tissue and in HBV-DNA transfected HepG2 cells, but not in inoculum.
The presence of ccc DNA is associated with the presence of precore/core mRNA. To demonstrate the involvement of hA-V in the initial step of HBV infection, we have first investigated the infectabihty of primary human hepatocytes versus rat hepatocytes.
Immunostaining and western blotting showed that human hepatocytes express hA-V, while rat hepatocytes express no hA-V. After in vitro infection of primary human hepatocytes precore/core mRNA was detected from 1 day to 15 days after infection so far investigated and HBV-DNA became detectable in the culture medium from 3 to 15 days after infection so far investigated. After in vitro infection of rat hepatocytes no precore/core mRNA, neither HBV-DNA was detected.
In order to further determine the involvement of human annexin V in HBV infection, a rat hepatoma FTO2B cell line which is not infectable by HBV and does not express hA-V, was transduced with a construct containing the hA-V gene. One ofthe transduced cell lines is assigned as FTO9.1. Immunostaining and western blotting showed that the hA-V transfected rat hepatoma cell line FTO9.1 express hA-V, while the original non-transfected rat hepatoma cell line FTO2B does not express hA-V. The infectabihty of the FTO9.1 cell line was demonstrated by HBV precore/core mRNA detected as early as one day after infection, while non-transduced FTO2B cells were negative for HBV precore/core mRNA up to 7 days after infection so far investigated. In addition, ccc DNA was detected in FTO9.1 cells from 1 day up to 3 day after infection so far investigated. Furthermore, HBV-DNA, which was not detectable in the culture medium before
infection and in the first 2 days after infection, became detectable from day 3 until day 7 so far investigated. HBV-DNA was not detectable in culture medium of non-transduced FTO2B cells up to one week after infection.
We can conclude that human annexin V is involved in the initial step of HBV infection and that human annexin V plays a key role in the cell susceptibility to and the species barrier of HBV infection.
Example 2: The effect of anti-idiotypic antibodies (Ab2) on HBV infection in primary cultures of human hepatocytes.
Human hepatocytes were isolated from human hver tissue obtained from post mortem donors by two-step collagenase perfusion method as described previously (Rijntjes et al., 1986). Cultured human hepatocytes were infected overnight at 37 °C by incubation with a 1/20 dilution of infectious human serum (HBV-DNA positive, HBsAg positive, HBeAg positive) followed by thorough washing. A sandwich ELISA using specific monoclonal antibodies was used both for capturing and detection of HBsAg.
As shown in figure 1, HBsAg production was observed in the culture medium of human hepatocytes infected with HBV containing inoculum (n=5). In contrast, in the presence of Ab2, no such HBsAg production could be observed. Figure 1 further indicates that the production of HBsAg was maximal at day 8 post infection. Thereafter, the HBsAg production declined due to deteriorated conditions ofthe primary culture of human hepatocytes as has also been seen in parallel control experiments.
Since the presence of HBV replicative intermediates in the infected cells is an indispensable marker for succesftil infection, total DNA is isolated from primary cultures of human hepatocytes used for these experiments and subjected for Southern blot analysis (Maniatis et al, 1982). As a control for the specificity ofthe probe, DNA isolated from the HepG2.2.15 cell line, as defined in Brief description of Figure 2, was also investigated. As shown in figure 2, HBV-DNA and replicative intermediates were detected in cells that were infected with inoculum in the absence of Ab2. In contrast, HBV-DNA sequences were not observed in experiments in which Ab2 were used.
Example 3: Mapping of he annexin V-binding site on HBsAg
To find the binding site on HBsAg the region composed of aa 112 to 169 was investigated. Firstly, because this region has been predicted to be located on the outer surface of the virus; Secondly, because bmding of HBsAg with anti-idiotypic antibody Ab2 (generated in rabbits immunized with human Annexin V, Hertogs et al, 1994) is completely inhibited after digestion of HBsAg with endoproteinase-LysC. Lysines are only found in this region of the HBsAg molecule (genotype A), namely at aa 122, at aa 141 and at aa 160. Three peptides covering this region were synthesized. The first two peptides represent the outer part ofthe HBsAg molecule. These peptides have been derived from a genotype C sequence. The third polypeptide represents the region ofthe outer part of HBsAg which is most subjected to non- conservative mutations. This peptide is derived from genotype A.
polypeptide IGP673 (aa 112-141): GTGTTSTGPCKTCTIPAQGTSMFPSCCCTK (genotype C) polypeptide IGP671 (aa 139-169): CT PSDGNCTCIPIPSSWAFARFLWEGASVR
(genotype C) polypeptide IGP80 (aa 122-157): KTCTTPAQGNSMEPSCCCTKPTDSNCTCIPIPSSWA (genotype A)
Since Ab2 binds polypeptide 3, we concluded that this polypeptide contains the binding epitope on HBsAg for human annexin V.
Based on these results and since monoclonal antibodies recognizing the HBsAg major "a" determinant covering amino acid positions 139 to 147 do not interfere with the HBsAg/annexin V interaction, the "a" determinant may not be directly involved in annexin V binding. Therefore, we focused on the amino terminal part ofthe HBsAg ectodomain. Polypeptides covering the region between aa 99 and 136 of "small" HBsAg (IGP 1076-1083, see table 1) were synthesized.
The polypeptides 1077 and 1080, which are derived from genotype C, comprised a mutation (aa 107 from C to S) in order to reduce the number of cysteines in the peptide. Moreover, there are two aa within the region aa 99-136 which appear to mutate in a non-conservative way (eg. aa 126 from T to I and aa 131 from N to T) and which determine four of the naturally occuring genotypes of HBsAg (A, B, C and D, see table 1). For this reason, we synthesized two other peptides: one bearing the sequence aa 115-134 from genotype A (IGP 1094) and another one containing the genotype C mutation at position 126 only C (IGP 1093). In this respect, it should
be noted that some other natural mutations also exist but are usually of a conseivative nature (aa 122 fiom R to K, aa 134 fiom F to Y and aa 113 and 114 from S to T).
All these synthesized polypeptides (IGP 1076-1094) were tested for reactivity with the anti-idiotypic antibody Ab2 (see above Brief description of drawings and tables). Ab2 mimics annexin V and bound IGP 1094 only (figure 3). Polypeptide 1094 was also produced a second time and the latter result was confirmed a second time.
The lack of reactivity ofthe other polypeptides covering the region 115-134 was found to be a consequence of substitutions at positions 126 and 131. Indeed, four polypeptides based on IGP 1094 were synthesized representing all the combinations of mutations at these two positions (IGP 1102-1105). The latter polypeptides were synthesized in a biotinylated form and purified by RP-
HPLC. Subsequently, their reactivity with Ab2 was determined (see figure 4). As such, we demonstrated that binding of peptides to Ab2 is indeed influenced by the latter mutations: the mutation at position 126 (T to I, peptide IGP 1103 and 1102) resulted in a minor loss of binding whereas the mutation at position 131 (N to T, peptides IGP 1104 and 1105) resulted in an almost complete loss of binding to Ab2.
It therefore appears that the C terminal region of this polypeptide (aa 125-134) is highly important since mutations within this region can alter or destroy binding with Ab2. Within the complete HBsAg molecule, however, these mutations do not destroy binding to annexin V since binding of annexin V and Ab2 to HBsAg of either genotypes A or D occurs (see figure 5) possibly because the complete molecule adopts a more rigid conformation which is not affected by mutations at positions 126 and 131. On the other hand, within a short polypeptide (20 aa) a single mutation may result in more drastic conformational changes which influences binding to annexin.
Example 3': Mapping of the annexin V-binding site on HBsAg (further experiments)
To further characterize which part ofthe polypeptide 115-134 is responsible for binding of HBsAg, peptides of 10 amino acids covering the sequence were subsequently synthesized.
pept (115-134) TTSTGPCKTCTTPAQGNSMF (SEQ LD 1)
P461 (115-124) TTSTGPCKTC (SEQ LD 25)
P462 (116-125) TSTGPCKTCT (SEQ LD 26)
P463 (117-126) STGPCKTCTT (SEQ LD 27)
P464 (118-127) TGPCKTCTTP (SEQ LD 28)
P465 (119-128) GPCKTCTTPA (SEQ LD 29) P466 (120-129) PCKTCTTPAQ (SEQ LD 30)
P467 (121-130) CKTCTTPAQG (SEQ LD 31)
P468 (122-131) KTCTTPAQGN (SEQ LD 2)
P469 (123-132) TCTTPAQGNS (SEQ LD 32)
P470 (124-133) CTTPAQGNSM (SEQ LD 33) P471 (125-134) TTPAQGNSMF (SEQ LD 34)
These peptides were tested for reactivity with anti-idiotypic antibody Ab2. We found that peptide P468. which covers the region of aa 122 to aa 131 of HBsAg, is able to bind anti-idiotypic antibody (Ab2). This means that the binding epitope of HBsAg must be located in the region from aa 122 to aa 131. Since Ab2 have previously been shown to compete the binding of HBsAg to A-V, these experiments indicate that the Annexin V binding domain of HBsAg is located between aa 122 and aa 131, or in the conformational vicinity of this region.
Therefore, the skilled man may synthesize variants and/or derivatives of said region which specifically bind human Annexin V. Such variants may include any types of peptide variations discussed above.
Example 4: Influence of phosphatidylserine on the HBsAg-annexin V binding
The propensity of annexin V to bind phosphohpids (phosphatidylserine) has led also to consider the possibility that this protein might bind to HBsAg via its hpid content, since HBsAg hpids may account for up to 30% of the mass of HBsAg particles. Herefore, the influence of phosphohpids on annexin V binding to HBsAg was investigated. A clear inhibiting effect of phosphatidylserine on the binding of A-V to HBsAg is observed, while phosphatidylcholine did not inhibit the binding (see figure 6). Moreover, HBV infection of transfected rat hepatoma cells, namely FTO9.1 cells can be inhibited by phosphatidylserine.
To further elucidate the binding mechanism between HBsAg and annexin V, we used monoclonal
antibodies directed against human annexin V. All mAbs are ofthe IgG class. Two rnAbs. namely U4C8 and CM1995 (which can be obtained fiom Dr. Erik Depla, Innogenetics N. V, Industriepark 7 box 4, B-9052 Ghent, Belgium; phone: +32 9 241 07 11; fax: +32 9 241 07 99), were found to inhibit the binding of annexin V to HBsAg (see figure 7). The binding of labelled annexin V to a monoclonal antibody is reduced by unlabelled human hver annexin V, but not by rat liver annexin
V (see figure 8). This means that these antibodies are species specific. Mutual competition between these two antibodies revealed that they do not compete with each other for binding to annexin V, which means that they recognize different epitopes. The third antibody U1E10 (which can be obtained from Dr. Erik Depla, Innogenetics N.V., Industriepark 7 box 4, B-9052 Ghent, Belgium; phone: +32 9241 07 11; fax: +32 9 241 07 99), is not species specific and is not able to compete with HBsAg for binding to annexin V, moreover this antibody does not compete with U4C8 and CM 1995 and recognizes therefore a third epitope on A-V.
The influence of phosphohpids on the binding of these mAbs to annexin V was subsequently investigated (see figure 9). From the finding that phosphatidylserine can inhibit the binding of CM1995 to annexin V, but only very little the binding of U4C8to annexin V, we can conclude that
CM1995 inhibits a protein-phospholipid interaction, while U4C8 inhibits a protein-protein interaction between human annexin V and HBsAg. Moreover the interaction of HBsAg with Ab2 is not influenced at all by phosphohpids of any kind. We can conclude that HBsAg-annexin V binding is based on at least a dual interaction. This includes binding of annexin V to negatively charged phosphohpids, such as phosphatidylserine, of the HBsAg particle via the phospholipid binding site of annexin V, and a second interaction which is based upon a protein to protein binding between a second distinct epitope of annexin V and the protein content ofthe HBsAg particle. Figure 10 gives an overview of this interaction.
Example 5: Immunogenicity of the sequence aa 115-134.
The annexin V binding domain of HBsAg was produced both as an N-terminally biotinylated polypeptide (IGP 1103), purified by RP-HPLC (96.6% purity), and as a tetrameric polypeptide on a lysine matrix which was biotinylated C-terminally (IGP 1119, see table 1). The sequence of peptide 1119 was further elongated with another 2 aa at the C-terminus in order to obtain a small linker between the lysine matrix and the sequence of interest. Also the latter peptide
was purified by RP-HPLC in order to remove chemicals resulting fiom peptide synthesis. Of both peptides a Neutralite Avidin complex (Molecular Probes, Inc.. Eugene, OR) was made, -peptide 1103: 200 μg of peptide was mixed with 1.1 mg of Neutralite Avidin in a final volume of 2.5 ml saline. This solution was stored at -20°C as 500 μl ahquots for vaccine purposes. -peptide 1119: 832 μg of peptide was mixed with 1.1 mg of Neutralite A vidin in a final volume of
2.5 ml saline. This solution was also stored at -20°C as 500 μl ahquots for vaccine purposes. Both the free peptides and the two Neutralite Avidin complexes, as described above, were evaluated for binding with Ab2. All results were positive (i.e. all peptides did bind to Ab2) and a chimp was immunized according to the following protocol: Neutralite Avidin-cowpltxQά peptides were mixed with an equal volume of reconstituted RLBI (ImmunoChem. Research Inc.. Hamilton.
MT) as an adjuvant before injection into one ofthe upper arms ofthe chimpanzee; the injections were performed on days 0 and 21; bleedings were taken on day -3, 4, 11, 18, 25 and 32 post- immunization. Antibody response towards both Neutralite vtdm-complexed peptides, two control peptides (i.e. IGP 1038 and 1030 with similar characteristics [solubility, biotinylation, branching] as IGP 1103 and 1119, respectively) and HBsAg were monitored. A clear and specific reactivity was observed with HBsAg and with the peptides IGP 1103 and 1119 (Figure 11). In addition, the Ab titers against both HBsAg and the peptides IGP 1103 and 1119 increased after the second immunization (Figure 12). These results, thus, demonstrate that the peptide sequence aa 115-134 bears a B-cell epitope which is also present on HBsAg since Ab's induced by immunization with aa 115- 134 specifically recognize HBsAg.
A control chimpanzee was also challenged with a standard inoculum for HBV. Serum samples were taken before and after inoculation and were screened for the presence of antibodies binding to HBsAg and to the peptides IGP 1103 and IGP 1119. The specificity of binding was verified using the same control peptides as indicated above (IGP 1030 and 1038). Although anti-HBsAg seroconversion could be clearly shown, no specific antibody reactivity against any ofthe peptides (IGP 1103, 1119, 1030 and 1038) could be demonstrated (Figure 13). These results demonstrate that the B-cell epitope within the region aa 115-134 of HBsAg may not be particularly immunogenic when presented to the immune system as part of HBsAg.
Example 6: Cross-reactivity of antibodies evoked by a genotype A derived peptide.
The serum of a chimpanzee immunized with peptides 1103 and 1119 was evaluated for the presence of antibodies cross-reacting with the same region of HBsAg (aa 115-134) but derived from other genotypes. As can be judged from figure 14, the antibody response evoked by the genotype A derived peptides 1119 and 1103 clearly cross-reacts with peptides carrying the non- conservative mutations from genotype B (IGP 1104), genotype C (IGP 1105) and genotype D (IGP 1104). As a consequence it may be concluded that the peptides derived from the same region of HBsAg (aa 115-134) but from another genotype also will evoke a cross-reactive immune response. similar to the one evoked by the genotype A derived peptides IGP 1103 and 1119.
Example 7: Direct binding of annexin V to HBsAg peptides representing the amino acid region 112-169.
Binding of annexin V (coupled with horse radish peroxidase) to HBsAg itself or to biotinylated peptides coated to microtiterplates as a streptavidin complex was evaluated. These peptides represent the region 112-169 of HBsAg (IGP 671, 673 and 80), the peptide binding with the anti-idiotypic antibody (IGP 1119) as well as a control peptide (IGP 1038). Binding specificity is demonstrated by using an excess (100 μg/ml) of an anti- annexin V monoclonal antibody (U4C8, see example 4) which is known to compete with the binding of annexin V to HBsAg. The complete binding assay is performed in a tris buffered saline (10 mM tris, 150 mM NaCl pH 7.5) to which ImM CaCl2 and lmM MgCl2 are added (=TBSCa/mg). After coating of HbsAg or peptide/streptavidin complexes to the plate, aspecific binding is reduced by blocking the plates with TBSCa mg-3% gelatin at 37°C (fish gelatin). The incubation with annexin V and eventual competitors is performed in TBSc^-0.3% gelatin at 37°C. After incubation plates are washed with TBSCa/mg-
0.05% Tween 20.
The data shown in Figure 15 demonstrate that the peptides IGP 671 and IGP 1119 bind to annexin V. The latter data confirm the importance ofthe amino acid region 115-134 as covered by IGP 1119, but also demonstrate the importance of the region aa 158-169 since IGP 671 which covers the latter aa region binds to annexinV.
Example 8: Further fine mapping of the annexin V binding site on HBsAg
Based on the results fiom example 7, a new series of peptides was synthesized (IGP 1189- 1193). Their sequences cover the potential epitopes for binding to annexin V as concluded from examples 3, 3' and 7. In addition, the potential epitopes were combined in one molecule as hetero-branched peptides (IGP 1190- 1192). The setup ofthe experiment is similar as for example 7 and again the specificity was demonstrated by competing the binding to annexin V with the same monoclonal antibody (see Figure 16).
The highest binding was observed with the peptides IGP 1193, 1190, 671 and 1119. It therefore appears that the sequence of IGP 1119 (aa 115-134), and more specifically the amino terminal part of this sequence which is represented by IGP 1193 (aa 115-125), plays a crucial role in the binding of annexin V to HBsAg. However, also the C-terminal part of IGP 1119. especially in combination with the amino acid region 158-169, appears important in the binding of annexin V to HBsAg. The latter is demonstrated by the binding ofthe hetero-branched peptide IGP 1190 with annexin V in this example and the binding of Ab2 to the peptide covering amino acid region
122-131 shown in example 3'.
Example 9: Further fine mapping of the annexin V binding site on HBsAg by direct competition.
When the series of peptides used in example 8 were analysed (in an assay similar to the one outlined in example 7) for their ability to compete with the binding of HBsAg to annexin V, only peptides IGP 1119 and 1193 were found to do so in the concentration range studied. Peptides were presented as streptavidin- complexes in order to improve their presentation in solution. In the present experiment, binding of annexin V to HBsAg coated on microtiterplates was competed with HBsAg or with the peptides IGP 1119 and IGP 1193 in solution (both peptides were presented as streptavidin complexes). The results (see Figure 17, molar excess = [competitor in solution]/[HBsAg coated]) confirm the importance of the amino acid region 115-134, and especially the N-terminal part of this region as covered by IGP 1193.
Example 10: Further fine mapping of an Ab2 epitope.
The peptides mentioned under example 3' (P461-P471) were further analyzed for their capacity to bind Ab2 using a different approach as used in example 3'. In the latter example peptides were adsorbed to microtiterplates and the binding with Ab2 was evaluated. This may result in false negative scoring since not all of these peptides will adsorb equally well to the microtiteiplate. In the current setup, HBsAg itself is adsorbed to the microtiteiplate and the peptides are used in solution. Ab2 is allowed to bind to the peptides or HBsAg and finally binding of Ab2 to HBsAg itself is evaluated. In this way partial competition was observed with the peptides P468, P469, P470 and P471 (Figure 18, only the results for the peptide P467-471 are shown). This result allows to further map the binding site (or at least one ofthe binding sites) of Ab2 to the region 125-131 (TTPAQGN). which is the common part of these peptides. This result confirms the importance of the amino acids 126 and 131 in this Ab2 epitope. These two amino acids determine the genotype specific reactivity of this Ab2. The binding of Ab2 is however only partially genotype specific, since good reactivity is also observed with genotype D (example 3, figure 5). This observation, together with the finding of a 'partial' (up to 50%, figure 18) competition with the peptides P468-471 leads to the conclusion that another epitope must be involved in Ab2 (and consequently of annexin V) binding to HBsAg. This is also supported by the finding that the A-V binding is not genotype specific (example 3, figure 5). Based on the previous experiments two candidate regions have been identified: region 1 aa 115-126 region 2 aa 158-169
Example 11: Further establishment of the role of region 115-126.
In the light of the previous results the binding of annexin V to IGP 1193 (aa 115-126) needs confirmation since this peptide overlaps only with 2 amino acids with the Ab2 epitope, and may therefore be the second epitope needed to cover for complete Ab2/annexin V binding. Moreover this region does not carry amino acids which change in a n on- conservative way according to the genotype.
In order to confirm the results previously obtained (example 8 and 9) with this peptide purified peptide was needed. The crude peptide was first evaluated on mass-spectrometry (MS). The spectrum revealed a whole series of molecules, however none of them ofthe expected size and over
90% ofthe peptides having a molecular weight substantial!}' higher then expected (data not shown). For these reasons this peptide was synthesized again and immediately analyzed by MS. The new peptide preparation, which will be referred to as IGP 1193B, contained the expected molecule, however no binding with annexin V was. The lack of binding of annexin V to the region 115-126 was further confirmed by a whole series of new peptides which represent this region in different ways of presentation (branched peptide: IGP 1363, C-teπninal biotinylation: IGP 1368).
IGP 1193B bio-TTSTGPCKTCT IGP 1363 (TTSTGPCKTCT)2-KKGK(bio)GA IGP 1368 TTSTGPCKTCT-KKGK(bio)GA
This result is also confirmed from another experimental approach. A monoclonal antibody, Cl 1F5, which is directed against HBsAg but is not able to inhibit the binding of annexin V to HBsAg was mapped (example 12). Part ofthe epitope of this antibody covers the region 119- 124, which is an additional prove that this region is not involved in Ab2 and thus in annexin V binding.
Example 12 : Mapping of other epitopes (monoclonal antibodies).
Using our complete series of peptides from the HBsAg ectodomain, mapping of other determinants, such as monoclonal antibody epitopes, was pursued. Ofthe monoclonal antibodies investigated, only one, C11F5 (which can be obtained from Dr. Erik Depla, Innogenetics N.V., Industriepark 7 box 4, B-9052 Ghent, Belgium; phone: +32 9 241 07 11; fax: +32 9 241 07 99), could be mapped in detaiL The reactivity of this monoclonal to all the peptides used is shown in figure 1 , while the relative (to HBsAg) competition of the purified peptides 1076-1083 for binding of C11F5 to HBsAg is shown in Table 2. The peptides 1076 and 1081 show both a higher relative competition, compared to the other peptides. This observation supports the existence ofthe first part ofthe epitope in the region 105-111. Mutation ofthe cysteine at position 107 results in a loss of relative affinity which is comparable with the loss if this part ofthe epitope is omitted. The second part of the epitope is found in the region 119-124 (reactivity with peptide 1083, 1193B and 1275). This combined epitope is surprising, since it has never been described before and especially since it does not fit with the current structural model of HBsAg as predicted by Chen et al, 1996.
Therefore the mapping of this epitope leads to new insights in the structure of HBsAg.
Example 13 : Further elaboration of the role of the region 158-169.
The role of this part of HBsAg was further evaluated using a series of new peptides (1273, 1274,
1362, 1367). The bmding of annexin V to these peptides is shown in figure 20. For this experiment binding was checked for all peptides containing the 158-169 region and some additional control peptides also derived from HBsAg. This assay was performed at room temperature (and not 37°C as in the previous examples) in order to select for peptides showing a high binding. The interpretation of these results indicate that :
1/ the binding previously observed to the peptides 671 and 1190 is confirmed;
2/ the region 158-167 contains sufficient information to allow binding of annexin V: binding to peptides 1367 and 1362;
3/ the N-terminus of this region needs to be available for binding since only the C-terminal biotinylated peptide allows binding, this observation stresses the importance of correct presentation of an epitope, the N-teπninal biotinylated peptide 1274 does not allow binding of annexin V. This finding stresses the importance ofthe way of presentation of a peptide in order to allow reactivity. This was confirmed in competition experiments (figure 21) which reveal the superior presentation ofthe 158-169 epitope by the peptide IGP 1362. From these experiments it can be concluded that the presentation will also be crucial in order to obtain good immune reactivity.
Example 14 : Immunogenicity.
The peptides 1119 and 1273 and 1274 were used for immunization of rabbits. As for the chimpanzee imiriunization (example 5) the peptides were complexed with Neutrahte avidin. Of each peptide three times 100 μg peptide complexed with an equimoiar amount of Neutrahte avidin was injected. In total six rabbits were used (2 rabbits for each peptide).
The antibody responses were evaluated for cross-reactivity with HBsAg and were mapped using all available peptides from the previous examples. For peptide 1119 the induced immune response was compared to the immune response induced in chimpanzee by a mixture of IGP 1103 and 1119
(example 5). The immune response induced in rabbits by 1273 (115-126 and 158-169 as branched
peptide) and 1274 (158-169 as N-terminal biotinylated peptide) were also compared as both peptides contain the sequence 158-169 but in a completely different presentation. From figure 22 it is clear that the immunization of a chimpanzee and rabbit results in an effective immune response against the sequence ofthe complete antigen (IGP 673, 1102, 1103, 1104, 1105, 1119 and HBsAg itself) however the recognition of single epitopes is completely different. No antibodies directed against the Ab2 epitope were detected in the chimpanzee (eg lack of reactivity with IGP 1189 and 80). However, both rabbits immunized with IGP 1119 solely mounted a very effective immune response against this specific epitope. The major conclusion from this experiment may be that IGP 1119 is much more efficient in generating the desired immune response, the simultaneous immunization with IGP 1103 resulted in an altered immune response with recognition of other epitopes. From this example it can also be predicted that a peptide limited to the desired epitope (122-131 or 125-131) will even be much more effective in generating the desired response since such peptide allows no alternative reactivity which were clearly selected in the chimpanzee experiment. In addition the presentation of such a minimal epitope will be crucial as can be judged from the immunizations with IGP 1273 and 1274.
When comparing the rabbit immune responses against IGP 1273 and 1274 it is immediately clear (Figure 23) that IGP 1274 fails to mount an efficient immune response, this can be judged from the lack of reactivity against HBsAg and the very poor reactivity with the peptides. However, the immunization with IGP 1273 results in a very effective immune response. Reactivity against HBsAg is observed and all peptides carrying the sequence 158-169 are recognized, however the sequence
115-126 which is also part of this peptide did not generate antibodies (eg lack of reactivity with IGP 1193B, 1363 and 1368). This example shows again that the structure and way of presentation is crucial in order to mount the desired immune response. From these examples it can be stated that any man skilled in the art may engineer such molecules using by way of example, but not limited to, peptides which are branched (homo- or hetero- (heterobranchrng can be performed by any sequence which is HBsAg derived or not), which are biotinylated (N-terminal with or without spacer, C-teπninal with or without spacer) and complexed to avidin like molecules, which are covalently conjugated to non-related molecules (eg ovalbumin, hemocyanin), which are repeats of a single sequence, which are made cyclic (eg addition of cysteine at C- and N-terminus).
Taken together, the above-described experiments clearly demonstrate that the amino acid regions
122-131 and 158-169, or parts thereof are directly involved in the binding of HBsAg to annexin V. Any new molecule which comprises these regions, or variants or parts thereof, and which specifically binds human annexin V is therefore part ofthe present invention.
LIST OF REFERENCES
Atherton, Shepard (1989) Solid phase peptide synthesis. LRL Press, Oxford. Berting A, Hahnen J, Kroger M, Gerhch WH (1995) Computer-aided studies on the spatial structure ofthe small hepatitis B surface protein. Intervirology 38:8-15.
Bianchi R, Giambanco I, Ceccarelh P, Pula G, Donato R (1992) Membrane-bound annexin
V isofoπns (CaBP33 and CaBP37) and annexin VI in bovine tissues behave like integral membrane proteins. FEBS Letters 296:158-162. Bonino F, Heermann K, Rizetto M, Gerhch W (1986) Hepatitis delta virus: protein composition of delta antigen and its hepatitis B virus-derived envelope . J. Virol. 58:945-950.
Carman WF, Zanetti AR, Karayiannis P, Waters J, Manzillo G, Tanzi E, Zuckerman AJ, Thomas
HC (1990) Vaccine-induced escape mutants of hepatitis B virus. Lancet 1990 ii:325-329. Chen Y-C, Delbrook K, Dealwis C, Mim s L, Mushawar K, Mandecki W (1996) Discontinuous epitopes of hepatitis B surface antigen derived from a filamentous phage peptide library. Proc. Natl
Acad. Sci. USA 93: 1997-2001. De Bruin W, Leenders W, Kos T, Hertogs K, Depla E, Yap S.H. (1994) Hepatitis delta virus attaches to human hepatocytes via human hver endonexin LI, a specific HbsAg binding protein. J. Viral Hepatitis 1: 33-38. Grundmann U, Abel K, Bohn H, Lobermann H, Lottspeich F, Kupper H (1988)
Characterization of cDNA encoding human placental anticoagulant protein (PP4) homology with the hpocortin family. Proc Natl Acad Sci USA 85:3708-3712. Haigler H, Schlaepher D, Burgess W, Haigler H (1987) Characterization of hpocortin I and an immunologically related 33-kD protein as epidermal growth factor receptor (human substrate and phopholipase A2 inhibitors). J Biol Chem 262:6921-6930.
Heermann K, Goldmann W, Schwartz T, Seyffrath H, Baumgarten W, Gerhch W (1984)
Large surface proteins of hepatitis B λirus containing the pre-S sequence. J. Virol. 52:396-402.
Hertogs K, Leenders WPJ, Depla E, De Bruin WCC, Meheus L, Raymackers J, Moshage H, Yap SH (1993) Endonexin LI, present on human hver plasma membranes, is a specific binding protein of small hepatitis B virus (HBV) envelope protein. Virology
197:549-557. Hertogs K, Depla E, Crabbe T, De Bruin W, Leenders W, Moshage H, Yap SH (1994)
Spontaneous development of anti-hepatitis B virus envelope (anti-idiotypic) antibodies in animals immunized with human hver endonexin II or with the F(ab')2 fragment of anti-human hver endonexin LI immunoglobulin G: evidence for a receptor-ligand-like relationship between small hepatitis B surface antigen and endonexin II. J Virol 68:1516-1521. Houbenweyl (1974) Methode der organischen chemie, vol. 15, I & II (ed. Wunch E). Thieme,
Stuttgart. Howard CR, Allison LMC (1995) Hepatitis B surface antigen variation and protective immunity.
Intervirology 38:35-40. Klee B (1988) Ca2+-dependent phosphohpid -and membrane-binding proteins. Biochemistry
27:6645-6653. Magnius LO, Norder H (1995) Subtypes, genotypes and molecular epidemiology ofthe hepatitis B virus as reflected by sequence variability ofthe S-gene. Intervirology 38:24-34.
Maniatis T, Fritsch E, Sambrook J (1982) Molecular cloning: a laboratory manual. Cold Spring
Harbor Laboratory Press, Cold Spring Harbor, NY. Pepinsky R, Tizard R, Mattahano J et al. (1988) Five distinct calcium and phosphohpid binding proteins share homology with hpocortin I. J Biol Chem 263:10799-10811. Rijntjes P, Moshage H, van Gemert P, de Waal R, Yap SH (1986) Cryopreservation of adult human hepatocytes: the influence of deep freezing on the viability, cell seeding, survival fine structures and albumin synthesis in primary cultures. J. Heptol. 3:7-18. Rizetto M, Verme G, Gerin J, Purcell R (1986) Hepatitis delta virus disease. In: Popper H and
Schaffner F eds. Progress in Liver Disease. Vol VLLI. Orlando: Grime and Straton: 417-431.
Robinson W, Miller R, Marion P (1987) Hepadnaviruses and retroviruses share genome homology and features of replication. Hepatology 7:64S-73S. Rojas E, Pollard H, Haigler H, Parra C, Burns L (1990) Calcium-activated human endonexin
LI forms calcium channels across acidic bilayer membranes. J Biol Chem 265:21207- 21215.
Schroder CH, Zentgraf H (1990) Hepatitis B virus related hep ato cellular carcinoma chronocity
of infection the opening to different pathways of malignant transformation.
Biochem Biophys Acta 1032: 137-156. Sells MA, Chen M-L, Acs G (1987) Production of Hepatitis B virus particles in HepG2 cells transfected with cloned hepatitis B virus DNA. PNAS 84: 1005-1009. Walker JH, Boustead C, Brown R, Koster J, Middleton C (1990) Tissue and subcellular distribution of endonexin, a calcium-dependent phosphohpid-binding protein.
Biochem Soc Trans 18:1235-1236. Zaks W, Creutz C (1990) Evaluation ofthe annexins as potential mediators of membrane fusion in exocvtosis. J. Bioener Biomembr 22:97-119.
100 110 120 130 140 150 160 creno * * * * * * *
HBsAσ A DYQGM PVCPLIPGSTTTSTGPCKTCTTPAQGNSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLW
HBsAσ B DYQGM PVCPLIPGSSTTSTGPCKTCTTPAQGTSMFPSCCCTKPTDGNCTCIPIPSSWAFAKYLW
HBsAg C DYQGMLPVCPL PGTSTTSTGPCKTCTIPAQGTSMFPSCCCTKPSDGNCTCIPIPSSWAFARFL
HBsAg D DYQGM PVCPLIPGSSTTSTGPCRTCTTPAQGTSMYPSCCCTKPSDGNCTCIPIPSSWAFGKFLW
IGP S73 bio-GTGTTSTGPCKTCTIPAQGTSMFPSCCCTK (SEQ ID 3)
IGP 671 bio-CTKPSDGNCTCIPIPSSWAFARFLW
IGP 80 bio-KTCTTPAQGNSMFPSCCCTKPTDSNCTCIPIPSS A (SEQ
IGP 532 . bio-CTKPSDRNCTCIPIP (SEQ ID 4
IGP 533 bio-CTKPSDGNCTCIPIP (SEQ ID 4
IGP 534 bio-KTCTIPAQGTSMFPSC (SEQ ID 44)
IGP 1076 PVCP LPGTSTTSTGPCKTCTIPAQGTSMFPS (SEQ ID 6)
IGP 1077 PVSPLLPGTSTTSTGPCKTCTIPAQGTSMFPS (SEQ ID 7)
IGP 1078 GTSTTSTGPCKTCTIPAQGTSMFPS (SEQ ID 8)
IGP 1079 GPCKTCTIPAQGTSMFPS (SEQ ID 9)
IGP 1081 DYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQG (SEQ ID 10)
IGP 1080 DYQGMLPVSPLLPGTSTTSTGPCKTCTIPAQG (SEQ ID 11)
IGP 1082 PL PGTSTTSTGPCKTCTIPAQG (SEQ ID 12)
IGP 1083 GPCKTCTIPAQG (SEQ ID 13)
IGP 1093 TTSTGPCKTCTIPAQGNSMF (SEQ ID 14)
IGP 1094 TTSTGPCKTCTTPAQGNSMF (SEQ ID 15)
IGP 1102 bio-TTSTGPCKTCTIPAQGNSMF (SEQ ID 14)
IGP 1103 bio-TTSTGPCKTCTTPAQGNSMF (SEQ ID 15)
IGP 1104 bio-TTSTGPCKTCTTPAQGTSMF (SEQ ID 18)
IGP 1105 bio-TTSTGPCKTCTIPAQGTSMF (SEQ ID 19) IGP 1106 TTSTGPCKTCTTPAQGTSMF (SEQ ID 18) σ m
IGP 1107 TTSTGPCKTCTIPAQGTSMF (SEQ ID 19) IGP 1119 ( (TTSTGPCKTCTTPAQGNSMFPS)2K)2-KGK(bio)GA (SEQ ID 45) π
0
3 IGP 1189 (KTCTTPAQGNSM) 2-KKGK (bio) GA (SEQ ID 46) r+ IGP 1363 (TTSTGPCKTCT) , -KKGK (bio) GA (SEQ ID 47) IGP 1362 (FAKYLEWASVR) 2-KKG (bio) GA (SEQ ID 48) IGP 1190 KTCTTPAQGNSM (KKGK (bio) GA) FAKYLWEWASVR (SEQ ID 49) IGP 1191 DYQGMLPVCPL- (KKGK (bio) GA) -KTCTTPAQGNSM (SEQ ID 50) IGP 1192 DYQGMLPVCPL (KKGK (bio) GA) FAKYLWEWASVR (SEQ ID 51) IGP 1273 TTSTGPCKTCT (KKGK (bio) GA) - -FAKYLWEWASVR (SEQ ID 52) IGP 1193 Bio-TTSTGPCKTCT (SEQ ID 53) IGP 1275 Bio-TTSTGPCKTC (SEQ ID 25) IGP 1276 Bio-TTSTGPCKT (SEQ ID 54) IGP 1277 Bio-TTSTGPCK (SEQ ID 55) IGP 1278 Bio-TTSTGPC (SEQ ID 56) IGP 1368 TTSTGPCKTCT-KKGK(bio)GA (SEQ ID 57) IGP 1274 bio-FAKYLEWASVR (SEQ ID 35) IGP 1279 bio-AKYLEWASVR (SEQ ID 58) IGP 1280 bio-KYLEWASVR (SEQ ID 59) IGP 1281 bio-YLEWASVR (SEQ ID 60) IGP 1367 FAKYLWEWASVR-KKGK (bio) GA (SEQ ID 61)
control peptides
IGP 1038 Bio-GGSQLFTISPRRHETVQD (SEQ ID 20) _,
%
IGP 1030 ( (SVRVEQWKPPQK)2K)2-KGK(bιo)GA (SEQ ID 62) ,_, o
3
peptide sequence Relative competition
(HBsAg gives a competition of 1)
IGP 1076 PVCP PGTSTTSTGPCKTCTIPAQGTSMFPS 12.9 ^3 IGP 1077 PVSPLLPGTSTTSTGPCKTCTIPAQGTSMFPS 0.4 IGP 1078 GTSTTSTGPCKTCTIPAQGTSMFPS 0.3 IGP 1079 GPCKTCTIPAQGTSMFPS 0.5 IGP 1081 DYQGMLPVCPLLPGTSTTSTGPCKTCTIPAQG 8.7 IGP 1080 DYQGM PVSPLLPGTSTTSTGPCKTCTIPAQG 0.9 IGP 1082 PLLPGTSTTSTGPCKTCTIPAQG 0.4 IGP 1083 GPCKTCTIPAQG 1.0
CO
Claims (14)
1. An immunogenic polypeptide derived from hepatitis B surface antigen which competes with the hepatitis B surface antigen/annexin V interaction or which binds a compound or antibody
5 competing with the hepatitis B surface antigen/annexin V interaction.
2. A polypeptide according to claim 1 which comprises less than 61 amino acids containing at least 4 amino acids of one ofthe following sequences:
-FAKYLWEWASVR (SEQ ID 35) o - KTCTTPAQGN (SEQ ID 2)
- TTPAQGN (SEQ ID 37).
3. A polypeptide according to claim 1 which comprises the sequence KTCTTPAQGN (SEQ ID 2) or TTPAQGN (SEQ ID 37), and, the sequence FAKYLWEWASVR (SEQ ID 35) or 5 functionally equivalent parts or variants of said sequences.
4. A polypeptide according to claims 2 and 3 or any mutated version thereof which, upon inoculation in a mammalian host, results in the production of antibodies which specifically bind to said polypeptide, in particular to the sequence KTCTTPAQGN (SEQ ID 2) or a part thereof 0 or, to the sequence TTPAQGN (SEQ ID 37) or a part thereof, or, to the sequence
FAKYLWEWASVR (SEQ ID 35) or a part thereof
5. A combination of a polypeptide according to any of the previous claims and a negatively charged phosphohpid. 5
6. A polypeptide composition comprising any combination of polypeptides according to claims
2-5.
7. A vaccine composition comprising as an active substance a polypeptide as defined in any of 0 claims 1 to 4.
8. A vaccine composition according to claim 7 for use as an inoculum to vaccinate humans against infection with hepatitis B virus and/or hepatitis delta virus or any mutated strain thereof or to therapeutically vaccinate human carriers of hepatitis B virus and/or hepatitis delta virus or any mutated strain thereof.
9. Antibodies which specifically bind to a polypeptide as defined in any of claims 1 to 4 and inhibit binding of HBsAg to annexin V.
10. A pharmaceutical composition comprising as an active substance antibodies, or fragments thereof, according to claim 9 for use in a method to treat humans infected with hepatitis B virus and/or hepatitis delta virus or any mutated strain thereof.
11. A polypeptide according to any of claims 1 to 4 for use in a method to detect antibodies which are capable of competing with the hepatitis B and/or hepatitis delta surface antigen/annexin V interaction and which are present in a biological sample, comprising: a) contacting the biological sample to be analysed for the presence of FIBsAg antibodies with a polypeptide as defined above, b) detecting the immunological complex formed between said antibodies and said polypeptide.
12. A kit for the in vitro determination of antibodies in human serum containing: at least one microplate, polypeptides according to any of claims 1 to 4, appropriate buffer, blocking, and washing solutions which favor binding of the said polypeptides with the antibodies in human serum samples, and appropriate markers which allow to determine the complexes formed between the antibodies in human serum samples and said polypeptides.
13. A polypeptide according to any of claims 1 to 4 for use as a medicament to treat humans infected with hepatitis B virus and/or hepatitis delta virus or any mutated strain thereof.
14. A polypeptide according to any of claims 1 to 4 for use in a method to screen for drugs which block the binding between annexin V and said polypeptide.
Applications Claiming Priority (5)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP96870164 | 1996-12-30 | ||
EP96870164 | 1996-12-30 | ||
EP97870103 | 1997-07-11 | ||
EP97870103 | 1997-07-11 | ||
PCT/EP1997/007268 WO1998029442A1 (en) | 1996-12-30 | 1997-12-23 | ANNEXIN V-BINDING POLYPEPTIDES DERIVED FROM HBsAg AND THEIR USES |
Related Child Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU81422/01A Division AU8142201A (en) | 1996-12-30 | 2001-10-18 | Annexin V-binding polypeptides derived from HBsAg and their uses |
Publications (2)
Publication Number | Publication Date |
---|---|
AU5860198A true AU5860198A (en) | 1998-07-31 |
AU736032B2 AU736032B2 (en) | 2001-07-26 |
Family
ID=26144424
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU58601/98A Ceased AU736032B2 (en) | 1996-12-30 | 1997-12-23 | Annexin V-binding polypeptides derived from HBsAg and their uses |
Country Status (5)
Country | Link |
---|---|
EP (1) | EP0948533A1 (en) |
JP (1) | JP2001508054A (en) |
AU (1) | AU736032B2 (en) |
CA (1) | CA2274585A1 (en) |
WO (1) | WO1998029442A1 (en) |
Families Citing this family (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
AU5624799A (en) * | 1998-09-01 | 2000-03-21 | Innogenetics N.V. | Benzodiazepines and benzothiazepines derivatives and hbsag peptides binding to annexins, their compositions and use |
US7635676B2 (en) | 2001-02-21 | 2009-12-22 | Alavita Pharmaccuticals, Inc. | Modified annexin proteins and methods for their use in organ transplantation |
US7645739B2 (en) | 2001-02-21 | 2010-01-12 | Alavita Pharmaceuticals, Inc. | Modified annexin compositions and methods of using same |
EP1839670A3 (en) | 2001-02-21 | 2009-11-11 | Alavita Pharmaceuticals, Inc. | Modified Annexin Proteins and their use against thrombosis |
US7635680B2 (en) | 2001-02-21 | 2009-12-22 | Alavita Pharmaceuticals, Inc. | Attenuation of reperfusion injury |
CA2667859C (en) * | 2006-10-30 | 2017-01-24 | Advanced Life Science Institute, Inc. | Method for analysis of hepatitis b virus s antigen |
JP6775827B2 (en) * | 2015-08-07 | 2020-10-28 | 国立大学法人愛媛大学 | Method for measuring hepatitis B virus using mass spectrometry |
WO2017059878A1 (en) * | 2015-10-07 | 2017-04-13 | Humabs Biomed Sa | Antibodies that potently neutralize hepatitis b virus and uses thereof |
CN111879932B (en) * | 2020-06-24 | 2022-09-27 | 南方医科大学南方医院 | Hepatitis B Virus (HBV) specific B cell epitope detection method and application thereof |
Family Cites Families (10)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
FI83662C (en) * | 1980-07-17 | 1991-08-12 | Scripps Clinic Res | Diagnostic antibody and procedure for its preparation |
EP0082789B1 (en) * | 1981-12-22 | 1987-04-08 | Baylor College of Medicine | Immunological composition and method for hepatitis b virus |
JPS60162000A (en) * | 1984-02-02 | 1985-08-23 | Chemo Sero Therapeut Res Inst | Novel peptide |
AU579148B2 (en) * | 1984-03-09 | 1988-11-17 | Scripps Clinic And Research Foundation | Synthetic hepatitis b virus vaccine including both t cell and b cell determinants |
NZ235315A (en) * | 1989-09-19 | 1991-09-25 | Wellcome Found | Chimaeric hepadnavirus core antigen proteins and their construction |
EP1018344A3 (en) * | 1991-08-26 | 2000-09-20 | Epimmune, Inc. | HLA-restricted hepatitis B virus CTL epitopes |
PT672136E (en) * | 1992-07-08 | 2000-08-31 | Innogenetics Nv | POLYMPEPTIDES DERIVED FROM ENDONEXIN 2 HAVING RECEPTOR ACTIVITY OF HEPATITIS B VIRUS AND ITS USE IN DIAGNOSIS AND PHARMACEUTICAL COMPOSITIONS |
WO1994005698A1 (en) * | 1992-09-01 | 1994-03-17 | United Nations Industrial Development Organization | Peptide showing cross-reactivity with the anti-hepatitis b surface antigen antiserum |
GB9325772D0 (en) * | 1993-12-16 | 1994-02-16 | Smithkline Beecham Biolog | Novel compounds |
GB9608626D0 (en) * | 1996-04-25 | 1996-07-03 | Univ College Of London | Hepatitis b monoclonal antibodies |
-
1997
- 1997-12-23 EP EP97954465A patent/EP0948533A1/en not_active Withdrawn
- 1997-12-23 CA CA002274585A patent/CA2274585A1/en not_active Abandoned
- 1997-12-23 AU AU58601/98A patent/AU736032B2/en not_active Ceased
- 1997-12-23 JP JP52960298A patent/JP2001508054A/en active Pending
- 1997-12-23 WO PCT/EP1997/007268 patent/WO1998029442A1/en not_active Application Discontinuation
Also Published As
Publication number | Publication date |
---|---|
AU736032B2 (en) | 2001-07-26 |
CA2274585A1 (en) | 1998-07-09 |
EP0948533A1 (en) | 1999-10-13 |
JP2001508054A (en) | 2001-06-19 |
WO1998029442A9 (en) | 2000-02-17 |
WO1998029442A1 (en) | 1998-07-09 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
Heermann et al. | Surface proteins of hepatitis B viruses | |
Bremer et al. | N-terminal myristoylation-dependent masking of neutralizing epitopes in the preS1 attachment site of hepatitis B virus | |
US5780036A (en) | Peptides for inducing cytotoxic T lymphocyte responses to hepattis B virus | |
JP3738395B2 (en) | CTL epitope of HLA-restricted hepatitis B virus | |
Cooreman et al. | Characterization of the reactivity pattern of murine monoclonal antibodies against wild-type hepatitis B surface antigen to G145R and other naturally occurring “a” loop escape mutations | |
Maeng et al. | Fine mapping of virus-neutralizing epitopes on hepatitis B virus PreS1 | |
US6306625B1 (en) | Method for obtaining expression of mixed polypeptide particles in yeast | |
US7368118B2 (en) | Peptides for inducing cytotoxic T lymphocyte responses to hepatitis B virus | |
US20090239265A1 (en) | Virus like particles | |
JP3657603B2 (en) | Peptides that induce the response of cytotoxic T lymphocytes to hepatitis B virus | |
Borisova et al. | Spatial structure and insertion capacity of immunodominant region of hepatitis B core antigen | |
Bichko et al. | Epitopes recognized by antibodies to denatured core protein of hepatitis B virus | |
AU736032B2 (en) | Annexin V-binding polypeptides derived from HBsAg and their uses | |
Billaud et al. | Advantages to the use of rodent hepadnavirus core proteins as vaccine platforms | |
Standring | The molecular biology of the hepatitis B virus core protein | |
De Meyer et al. | Characterization of small hepatitis B surface antigen epitopes involved in binding to human annexin V | |
Gerlich et al. | Functions of hepatits B virus proteins and molecular targets for protective immunity | |
Waters et al. | A study of the antigenicity and immunogenicity of a new hepatitis B vaccine using a panel of monoclonal antibodies | |
AU8142201A (en) | Annexin V-binding polypeptides derived from HBsAg and their uses | |
PT97632A (en) | PROCESS OF OBTAINING POLYEPEPTIDES RELATED TO HEPATITIS B VIRUS SURVEILLANCE ANTIGEN PROTEIN AND VACCINES THAT CONTAIN THEM | |
Clayton | Investigations into the surface antigens of Hepatitis B Virus | |
CA2156416C (en) | Peptides for inducing cytotoxic t lymphocyte responses to hepatitis b virus | |
ES2393963T3 (en) | HBcAg expression and therapeutic and diagnostic uses | |
Persing | Identification and characterization of the presurface proteins of hepatitis B virus | |
Yang et al. | Expression and characterization of hepatitis C virus core protein fused to hepatitis B virus core antigen |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
FGA | Letters patent sealed or granted (standard patent) | ||
SREP | Specification republished | ||
MK14 | Patent ceased section 143(a) (annual fees not paid) or expired |