AU5729390A - Tissue-derived tumor growth inhibitors, methods of preparation and uses thereof - Google Patents

Tissue-derived tumor growth inhibitors, methods of preparation and uses thereof

Info

Publication number
AU5729390A
AU5729390A AU57293/90A AU5729390A AU5729390A AU 5729390 A AU5729390 A AU 5729390A AU 57293/90 A AU57293/90 A AU 57293/90A AU 5729390 A AU5729390 A AU 5729390A AU 5729390 A AU5729390 A AU 5729390A
Authority
AU
Australia
Prior art keywords
protein
tgf
activity
tumor growth
tumor
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Granted
Application number
AU57293/90A
Other versions
AU668072B2 (en
Inventor
J. Gordon Foulkes
Robert Franco
Leslie I. Gold
Kenneth K. Iwata
John R. Stephenson
Peter Ten Dijke
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
OSI Pharmaceuticals LLC
Original Assignee
OSI Pharmaceuticals LLC
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by OSI Pharmaceuticals LLC filed Critical OSI Pharmaceuticals LLC
Publication of AU5729390A publication Critical patent/AU5729390A/en
Application granted granted Critical
Publication of AU668072B2 publication Critical patent/AU668072B2/en
Assigned to OSI PHARMACEUTICALS, INC. reassignment OSI PHARMACEUTICALS, INC. Alteration of Name(s) in Register under S187 Assignors: ONCOGENE SCIENCE, INC.
Anticipated expiration legal-status Critical
Expired legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/475Growth factors; Growth regulators
    • C07K14/495Transforming growth factor [TGF]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61PSPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P35/00Antineoplastic agents
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/22Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against growth factors ; against growth regulators
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00Medicinal preparations containing peptides

Landscapes

  • Chemical & Material Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Organic Chemistry (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Medicinal Chemistry (AREA)
  • Genetics & Genomics (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Molecular Biology (AREA)
  • Biophysics (AREA)
  • Biochemistry (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Veterinary Medicine (AREA)
  • Animal Behavior & Ethology (AREA)
  • Zoology (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Public Health (AREA)
  • General Chemical & Material Sciences (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • Toxicology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Immunology (AREA)
  • Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
  • Peptides Or Proteins (AREA)
  • Pharmaceuticals Containing Other Organic And Inorganic Compounds (AREA)
  • Preparation Of Compounds By Using Micro-Organisms (AREA)
  • Medicines Containing Material From Animals Or Micro-Organisms (AREA)

Description

TISSUE-DERIVED TUMOR GROWTH INHIBITORS, METHODS OF PREPARATION AND USES THEREOF
This application is a continuation-in-part of U.S. Serial No. 183,224, filed April 20, 1988, which was a continuation in part of U.S. Serial No. 111,022, filed October 20, 1987 which was a continuation-in-part of U.S. Serial No. 992,121, filed October 20, 1986, now abandoned, which was a continuation-in-part of U.S. Serial No. 847,931, filed April 7, 1986, now abandoned, which was a continuation-in-part of U.S. Serial No. 725,003, filed April 19, 1985, now abandoned, the contents of each are hereby incorporated by reference into the present application.
Background of the Invention
Throughout this application, various publications are referenced. The disclosures of these publications in their entireties are hereby incorporated by reference into this application in order to more fully describe the state of the art as known to those skilled therein as of the date of the invention described and claimed herein.
Bichel [Bichel, Nature 23JL: 449-450 (1971)] reported that removing most of the tumor from mice bearing as- cites tumors at a plateau of tumor growth, was followed by a marked increase in the growth of the remaining tumor cells. Injection of cell-free ascites, obtained from mice bearing fully developed ascites tumors, into mice with growing ascites tumors, resulted in a pro¬ nounced inhibition of ascites growth. Bichel, supra, also observed that two surgically joined mice (para- biotic) , one mouse with an advanced tumor and the other with an early tumor, resulted in a pronounced inhibi¬ tion of growth of the early tumor. Based upon these observations, [Bichel, Europ. J. Cancer 6_: 291-296 (1970) and Bichel, supra] the existence of a diffus¬ ible inhibitory principle which circulated through the peritoneum of parabiotic mice and was present in the cell-free ascites fluid produced by the fully devel¬ oped ascites tumors was postulated. The nature of this inhibiting principle was not characterized, but it was speculated that the rate of growth of ascites tumors was dependent upon the amount of tumor tissue present in the mouse and that the amount of tumor tissue was determined by the amount inhibitory principle produced.
Substances having tumor growth inhibitory activity have been described. McMahon, et al. [Proc. Natl. Acad. Sci. USA 79, 456-460 (1982)] have purified from rat liver a 26,000 dalton substance which inhibits the proliferation of nonmalignant rat liver cells, but does not inhibit the proliferation of malignant rat liver cells. Other growth inhibitory substances have been identified in cultured chicken spinal cord cells [Kage, et al.. Experimental Neurology 58_: 347-360 (1970); Harrington, et al., Proc. Natl. Acad. Sci. USA 77_: 423- 427 (1980) and Steck, et al., J. Cell Biol. 8^: 562-575 (1979)].
Holley et al., [Proc. Natl. Acad. Sci. 77: 5989 (1980) and Cell Biol. Int. Reports 7: 525-526 (1983)] reported that a substance isolated from African green monkey
BSC-1 cells inhibited the growth of BSC-1 cells, human mammary tumor cells and normal human mammary cells.
More recently, biochemical characterization of this inhibitory substance [Tucker, et al.. Science 226: 705- 707.,(.1984); Roberts, et al. Proc. Natl. Acad. Sci. j32_: 119-123 (1985)] showed it to be identical, or highly related, to a 25,000 dalton two chain human platelet- derived polypeptide designated TGF-/3 [Assoian, et al., J. Biol. Chem 58: 7155-7160 (1983)]. TGF-5. derived from either human platelets [Sporn and Roberts, inter¬ national patent number WO 84/01106] or from human pla¬ centa [Frolik et al., (1983) PNAS JS0 3676-3680; Sporn and Roberts (WO84/01106) ] induces anchorage indepen¬ dent colony growth in soft agar of non-neoplastic rat kidney fibroblasts and other cells in the presence of transforming growth factor alpha or epidermal growth factor.
More recently, the bifunctional nature of this molecule as a regulator of cellular growth has been confirmed by Roberts et al. [Proc. Natl. Acad. Sci. 8_2: 119-123 (1985)]. Iwata et al., [J. Cellular Biochem. Suppl. 5_: 401 (1982)] previously described a microtiter plate system for assaying growth stimulation and growth inhi- bition activity. Todaro et al., [Todaro et al., in Tumor Cell Heterogeneity; Origins and Implications, Bristol-Myers Cancer Symposia, Volume 4, Owens, A.H., Coffey, D.S., and Baylin, S.B., Eds. (Academic Press, 1982), pp. 205-224)] and Iwata et al., [Fed. Proc. Fed. Am. Soc. Exp. Biol. 4_2: 1833 (1983)] reported the iso¬ lation of tumor inhibitory activity from tissue culture fluids of human tumor cells propagated in culture. The observations described in these reports were prelimi¬ nary and little detail was provided.
On April 20, 1984, a patent application was filed with the United States Patent and Trademark Office under U.S. Serial No. 602,520, entitled "Substantially Puri¬ fied Tumor Growth Inhibitory Factor (TIF) " on which one of us, Kenneth K. Iwata, is named as coinventor. This application concerns the preliminary identification of a not well-defined substance or substances present in, and derived from, human tumor cells propagated in cul¬ ture. This substance or substances resembles the tumor inhibitory activity previously reported. [Todaro, et al., in Tumor Cell Heterogeneity; Origins and Implica¬ tions, Bristol-Myers Cancer Symposia, Volume 4, Owens, A.H., D.S., and Baylin, S.B., Eds. (Academic Press, 1982), pp. 205-224; Iwata, et al.. Fed. Proc. Fed. Am. Soc. Exp. Biol. 42.: 1833 (1983).]
Todaro [Todaro, G.J. in Epigenetic Regulation of Can¬ cer, Terry Fox Cancer Research Conference (University of British Columbia; Vancouver, B.C., Canada) Abs. 13 (1984) ] subsequently reported two factors with tumor cell growth inhibitory properties which were reportedly sequenced and shown to consist of 70 and 90 amino acid residues, respectively. However, Todaro failed to report the source of the factors, their tissue type, the species the factors were derived from or the meth¬ od of the factor purification.
Summary of the Invention
This invention provides a protein having tumor growth inhibitory activity comprising the 112 amino acids shown in Figure 29 beginning with alanine at position 1 and ending with serine at position 112. The protein may also comprise the 412 amino acids shown in Figure 41 beginning with methionine at nucleotide position 263 and ending with serine at nucleotide position 1496. Thus, this 412 amino acid sequence contains the complete precursor sequence of the protein having tumor growth inhibitory activity as well as the complete sequence of the mature protein shown in Figure 29 beginning with alanine at position 1 and ending with serine at position 112. Finally, the invention provides a protein comprising the 411 amino acids shown in Figure 41 beginning with lysine at nucleotide position 266 and ending with serine at nucleotide position 1496.
BrieJE Description of the Figures
Figure 1 shows gel filtration chromatography at 23°C. Elution pattern of gel filtration chromatography at 23*C of crude acidified, ethanol extract from human umbilical cords. Two grams of acidified, ethanol ex¬ tract in 150 ml of 1.0 M acetic acid was applied to a 14 x 100 cm column (Amicon; #86012) containing Bio-Gel* P10 and eluted at a flow rate of 7 ml/min. One liter fractions were collected on a SuperRac* (LKB 2211) equipped with a type C collection rack (LKB) . One ml aliquots of each fraction (1 liter/fraction) were transferred to 12 x 75 mm sterile snap top tubes (Fal¬ con 2058) . TGI activity was determined as described in Materials and Methods. Inhibition of A549 human lung carcinoma cells is shown by triangles and mink lung (CCL 64) cells by circles. Absorbance at 280 n
( ) was detected by a Uvicord S* (LKB 2138) with a full scale absorbance range of 1.0 AUFS and a single channel chart recorder (LKB 2210) with a chart speed of 1 mm/min.
Figure 2 shows gel filtration chromatography at 4°C. Elution pattern of gel filtration chromatography at 4'C of crude acidified, ethanol extract from human umbili- cal cords. Two grams of acidified, ethanol extract in 150 ml of 1.0 M acetic acid was applied to a 14 x 100 cm column (Amicon; #86012) containing Bio-Gel* P10 and eluted at a flow rate of 7 ml/min. One liter fractions were collected on a SuperRac* (LKB 2211) equipped with a type C collection rack (LKB) . One ml aliquots of each fraction (1 liter/fraction) were transferred to 12 x 75 mm sterile snap top tubes (Falcon 1058) . Tumor growth inhibitory activity was determined as described in Materials and Methods. Inhibition of A549 human lung*-carcinoma cells is shown by open triangles and mink lung (CCL 64) cells by open circles. .Absorbance of 280 n ( ) was detected by a Uvicord S®
(LKB 2138) with a full scale absorbance range of 1.0 AUFS and a single channel chart recorder (LKB 2210) with a chart speed of 1 mm/min.
Figure 3 shows cell growth inhibition and normal human cell stimulation by fractions from gel filtration chro¬ matography at 4*C. Elution pattern of gel filtration chromatography at 4βC of crude acidified, ethanol ex¬ tract in 150 ml of 1.0 M acetic acid was applied to a 14 x 100 cm column (Amicon; #86012) containing Bio- Gel* P10 and eluted at a flow rate of 7 ml/min. One liter fractions were collected on a SuperRac* (LKB 2211) equipped with a type C collection rack (LKB) . One ml aliquots of each fraction (1 liter/fraction) were transferred to 12 x 75 mm sterile snap top tubes (Falcon 2058) . Tumor growth inhibitory activity was determined as described in Materials and Methods. Inhibition of A549 human lung carcinoma cells is shown by open triangles and mink lung (CCL 64) cells by open circles. Stimulation of normal human fibroblasts is shown by open squares. Absorbance of 280 nm ( ) was detected by Uvicord S* (LKB 2138) with a full scale absorbance range of 1.0 AUFS and a single channel chart recorder (LKB 2210) with a chart speed of l mm/min.
Figure 4 shows reverse phase high performance liquid chromatography (HPLC) of an active fraction from gel filtration chromatography. Fraction 4 derived from gel filtration chromatography on Bio-Gel* P10 of human umbilical cord acidified, ethanol extract (65.8 mg protein) was lyophilized and resuspended in 10 ml of 0.05% trifluoroacetic acid (TFA) . Fraction 4 was the firβt fraction following the major peaks of absorbance at 280 nm (Figure 2). The sample was centrifuged on a Beckman table top centrifuge (Beckman TJ-6) at 3000 rp for 20 minutes to remove insoluble material. Three separate injections of the supernatant were made through a Water's U6K injector equipped with a 2 ml sample loop. The sample was then loaded onto a μBOND- APAK* Clg column (0.78 x 30 cm) (Waters #84176). The flow rate was 2 ml/min. and the effluent monitored at 206 nm ( ) with a Waters u.v. detector (Wa¬ ters Model 481) at a sensitivity of 2.0 AUFS. Elution was achieved with a linear 30 min gradient from 0-25% of increasing concentrations of acetonitrile containing 0.05% trifluoroacetic acid (TFA) , followed by a linear 240 min gradient of 25-45% acetonitrile containing 0.05% TFA, followed by a linear 30 min gradient of 45- 100% acetonitrile containing 0.05% TFA. A SuperRac* (LKB 2211) was used to collect 12 ml fractions. One ml aliquots of each fraction were transferred to 12 x 75 mm polystyrene tubes (Falcon 2058) containing 50 icroliters of 1.0 M acetic acid and 50 icrograms of bovine serum albumin (Sigma A6003) and assayed for tumor growth inhibitory activity as described in Mate¬ rials and Methods. Inhibition of A549 human lung car¬ cinoma cells is shown by open triangles and of mink lung (CCL 64) by open circles. The solvent gradient is shown by large dashes ( — — — ) .
Figure 5 shows HPLC rechromatography of pooled TGI activity from HPLC (TGI-1) . Pooled fractions of tumor growth inhibitory activity (1.5 mg) eluting between 28-34% acetonitrile (fractions 13-22) by HPLC chroma¬ tography (Figure 4) were lyophilized and resuspended in 2 ml of 0.05% trifluoroacetic acid (TFA). The sam¬ ple was centrifuged on a Beckman table top centrifuge (Beckman TJ-6) at 3000 rpm for 20 minutes to remove insoluble material. Two separate injections of the supernatant were made through a Water's U6K injector equipped with a 2 ml sample loop. The sample was load¬ ed onto a μBONDAPAK* C.g column (0.39 x 30 cm) (Waters #27324) . The flow rate was 1 ml/min. and the effluent monitored at 206 nm ( ) with a Waters u.v. de¬ tector (Waters Model 481) at a sensitivity of 2.0 AUFS. Elution was achieved with a linear 20 min gradient from 0-15% of increasing concentrations of 2-propanol con¬ taining 0.05% TFA, followed by a linear 120 min gradi¬ ent of 15-35% 2-propanol containing 0.05% TFA. A SuperRac* (LKB 2211) was used to collect 4 ml frac¬ tions. One ml aliquots of each fraction were trans¬ ferred to 12 x 75 mm polystyrene tubes (Falcon 2058) containing 50 microliters of 1.0 M acetic acid and 5C micrograms of bovine serum albumin (Sigma A-6003) and assayed for tumor growth inhibitory activity as de¬ scribed in Materials and Methods. Inhibition of A549 human lung carcinoma cells is shown by open triangles and of mink lung (CCL 64) cells by open circles. The solvent gradient is shown by large dashes ( — — — ) •
Figure 6 shows reverse phase HPLC rechromatography of pooled activity from HPLC (TGI-2) . Pooled fractions of tumor growth inhibitory activity (0.8 mg) eluting be¬ tween 35-39% acetonitrile (fractions 25-31) by HPLC chromatography (Figure 4) were lyophilized and resus- pended in 2 ml of 0.05% trifluoracetic acid (TFA). The sample was centrifuged on a Beckman tabletop centri¬ fuge (Beckman TJ-6) at 3000 rpm for 30 min to remove insoluble material. Two separate injections of the supernatant were made through a Water's U6K injector equipped with a 2 ml sample loop. The sample was load- ed onto a μBONDAPAK* C18 column (0.39 x 30 cm) (Waters 27324) . The flow rate was 1 ml/min and the effluent monitored at 206 nm ( ) with a Waters u.v. de¬ tector (Waters Model 481) at a sensitivity of 1.0 AUFS. Elution was achieved with a linear 20 min gradient from 0-15% of increasing concentrations of 2-propanol con¬ taining 0.05% TFA, followed by a linear 120 min gradi¬ ent of 15-35% 2-propanol containing 0.05% TFA. A Sup- erRac* (LKB 2211) was used to collect 4 ml fractions. One ml aliquots of each fraction were transferred to 12 x 75 mm polystyrene tubes (Falcon 2058) containing 50 microliters of 1.0 M acetic acid and 50 micrograms of bovine serum albumin (Sigma A-6003) and assayed for tumor growth inhibitory activity as described in Mate¬ rials and Methods. Inhibition of A549 human lung car- cino a cells is shown by open triangles and of mink lung (CCL 64) cells by open circles. The solvent gra¬ dient is shown by large dashes ( — — — ) .
Figure 7 shows cation exchange chromatography of human umbilical cord extracts. CM-TRISACRYL* was resuspended in an equal volume of 0.1 M ammonium acetate, pH 4.0, containing 1.0 M NaCl. The resin was allowed to equil¬ ibrate for 3 hours and degassed at 4βC. Twenty ml of resin was packed into a 1.6 x 40 cm column (Pharmacia; #19-0362-01) and washed with 2 column volumes of 1.0 M ammonimu acetate pH 4.0, followed by 0.01 M ammonium acetate. The column was washed until the effluent matched the conductivity and the pH of the equilibrat¬ ing buffer (0.01 M ammonium acetate pH 4.0). One gram of human umbilical cord acidified, ethanol extract was resuspended in 50 ml of 1.0 M acetic acid and dialyzed against the column equilibration buffer at 4*C until the pH and the conductivity matched that of the equili¬ bration buffer. The dialyzed acidified, ethanol ex- tract was applied to the column at a flow rate of l ml/min at 4*C and the column was washed with the equil¬ ibrating buffer until the absorbance ( ), A280, as monitored by a Uvicord* S (LKB 2138) with a sensi¬ tivity of 1.0 AUFS, was at its lowest point. This was followed by 200 ml of an ascending molarity linear gradient from 0.01 to 1.0 M ammonium acetate, pH 4.0, which was applied using a gradient mixer (Pharmacia GM- 1, #19-0495-01) . At the end of the gradient, an addi¬ tional 30 ml of 1.0 M ammonium acetate, pH 4.0, were passed through the column. Two ml fractions were col¬ lected in 12 x 100 mm polystyrene tubes (Columbia Di¬ agnostics B-2564) in a SuperRac* fraction collector (LKB 2211) . ' One ml aliquots from each fraction were transferred to 12 x 75 mm tubes (Falcon 2058) contain- ing 50 microliters 1.0 M acetic acid and 50 micrograms bovine serum albumin (Sigma A6003) , lyophilized, and assayed for tumor growth inhibitory activity as de¬ scribed in Materials and Methods. Inhibition of A549 human lung carcinoma cells is shown by open triangles and of mink lung (CCL 64) cells by open circles. The salt gradient is shown by large dashes
Figure 8 shows rechromatography of a pooled fraction from cation exchange chromatography. CM-TRISACRYL* was prepared as described in Figure 9. The material from fractions containing CM III and CM IV were pooled, lyophilized, resuspended in 50 ml of 0.1 M acetic acid and dialyzed against the column equilibration buffer at 4'C until the pH and the conductivity matched that of the equilibration buffer. The sample was applied to the column at a flow rate of 1 ml/min at 4*C and the column was washed with 120 ml of the equilibrating buffer. Absorbance ( ) (280nm) was monitored by a~ Uvicord S (LKB 2138) with a sensitivity of 1.0 AUFS. One hundred ml of an ascending molarity linear gradient from 0.01 to 1.0 M ammonium acetate, pH 4.0, was applied using a gradient mixer (Pharmacia; GM-1, #19-0495-01) . At the end of the gradient, an addi¬ tional 30 ml of 1.0 M ammonium acetate, pH 4.0, was passed through the column. Two ml fractions were col¬ lected in 12 x 100 mm polystyrene tubes (Columbia Diag¬ nostics B2564) in a SuperRac* fraction collector (LKB 2211) . One ml aliquots from each fraction were trans¬ ferred to 12 x 75 mm tubes (Falcon 2058) containing 50 microliters 1.0 M acetic acid and 50 micrograms bovine serum albumin (Sigma A6003) , lyophilized, and assayed for tumor growth inhibitory activity as described in Materials and Methods. Inhibition of A549 human lung carcinoma cells is shown by open triangles and mink lung (CCL 64) cells by open circles. The salt gradient is shown by large dashes ( — — — ) .
Figure 9 shows the fractionation of TGI by cation ex¬ change chromatography at 4'C. 1.65 mg of protein ex¬ tract prepared as described in the Second Series of Experiments was dialyzed extensively against 20mM ammo¬ nium acetate (pH 4.5) and applied to a 5 ml (1 x 6.3 cm) column of CM-TRISACRYL* previously equilibrated in 20 mM ammonium acetate (pH 4.5) and 1.65 ml fractions (12 x 100 mm polystyrene tubes) were collected. Fol¬ lowing sample application, the column was washed with 20 mM ammonium acetate, pH 4.5, until the absorbance at 280 nm ( - ) returned to baseline values (less than 0.003) as determined with a Bausch and Lomb 1001 spec- trophotometer using a 1 cm light path quartz cuvet. A linear salt gradient (0-1.0 M NaCl in 20 mM ammonium acetate, pH 4.5) was applied and the absorbance at 280 nm of the 1.65 ml fractions was determined as de- scribed above. 10 microliter aliquots of the indicat¬ ed fractions were transferred to 12 x 75 mm tubes con¬ taining 50 ul 1.0 M acetic acid and 50 micrograms bo¬ vine serum albumin (Sigma A6003) , lyophilized, and assayed for inhibitory activity ( v - - - v ) against A549 human lung carcinoma cells as described under Materials and Methods. The NaCl gradient ( — — — ) was determined by measuring the conductivity (YSI Model 32 Conductance Meter) of suitable samples dilut¬ ed 100-fold in H20.
Figure 10 shows the fractionation of TGI by anion ex¬ change chromatography at 4*C. 1.65 mg of protein ex¬ tract prepared as described in the Second Series of Experiments was dialyzed extensively against 20 mM Tris-HCl (pH 8.0) and clarified by centrifugation at 3,000 x g for 15 minutes. DEAE-TRISACRYL* was pre¬ pared by suspending the resin first in 20 mM Tris-HCl (pH 8.0) containing 1.0 M NaCl for 3 hours and secondly in 0.5 M Tris-HCl (pH 8.0) for 1 hour. The sedimented resin was washed on a Buchner funnel with 1000 ml H20 and finally resuspended in 20 mM Tris-HCl (pH 8.0), degassed and poured into a 5 ml column (l x 6.3 cm) and the resin equilibrated with 20 mM Tris, HC1 (pH 8.0). The clarified sample was applied to the column and absorbance at 280 nm( ) , inhibitory activity against mink lung cells (0-0) , and the NaCl gradient ( — — — ) was determined as described in Figure 9 and under Materials and Methods. The linear NaCl gra¬ dient in 20 mM Tris-HCl (pH 8.0) ranged from 0 to 1.0 M NaCl.
Figure 11 shows the fractionation of TGI by cation exchange chromatography at 4*C. CM-TRISACRYL* was prepared as described in Figure 7 with the exception that,..the final equilibration buffer was 20 mM ammonium acetate, pH 4.5. Protein extract (9.9 mg) prepared as above was dialyzed extensively against 20 mM ammonium acetate (pH 4.5) and applied to a 15 ml (1.5 x 8.5 cm) column of CM-TRISACRYL* in 20 mM ammonium acetate (pH 4.5). Absorbance at 280 nM (-) and inhibitory activi¬ ty ( - 0 - - 0 - - ) against A549 human lung carcinoma cells were determined as described in Figure 7. The volume of the linear 0-1.0 M NaCl gradient was 150 ml. Volume of each fraction was 3.7 ml.
Figure 12 shows the reverse phase high performance liquid chromatography (HPLC) of active fractions from cation exchange chromatography. Fractions 59 thru 78 derived from cation exchange chromatography on CM-TRI- SACRYL* of human umbilical cord described in Figure 11 were pooled, lyophilized, and resuspended in 10 ml of 0.05% trifluoracetic acid (TFA). A total of twenty percent of dialyzed material containing 240 micrograms protein was injected in three separate injections through a Water's U6K injector equipped with a 2 ml sample loop. The sample was then applied onto a μBOND- APAK* C18 column (0.39 x 30 cm) (Waters 27324). The flow rate was 1 ml/min and the effluent was monitored at 206 nm ( ) with a Waters u.v. detector (Wa- ters Model 481) at a sensitivity of 0.5 AUFS. Elution was achieved with a linear 5 min gradient from 0-25% of increasing concentrations of acetonitrile containing 0.05% TFA, followed by a linear 15 min gradient of 25- 45% acetonitrile containing 0.05% TFA, followed by a linear 15 min gradient of 45-80% acetonitrile contain¬ ing 0.05% TFA, followed by a linear 5 min gradient of 80-100% acetonitrile containing 0.05% TFA. A Super- Rac* (LKB 2211) was used to collect 1 ml fractions. Five hundred microliter aliquots of every other frac- tion-were transferred to 12 x 75 mm polystyrene tubes (Falcon 2058) containing 50 microliters of 1.0 M ace¬ tic acid and 50 micrograms of bovine serum albumin (Sigma A0281) and assayed for tumor growth inhibitory activity as described under Materials and Methods. Inhibition of A549 human lung carcinoma cells is shown by open triangles and of mink lung (CCL 64) cells by open circles. The solvent gradient is shown by large dashes ( — — — ) .
Figure 13 shows the hydrophobic interaction chromatog¬ raphy phenyl-Sepharose. Phenyl-Sepharose (Pharmacia) was equilibrated with 4.0 M ammonium acetate, pH 4.5 and 15 ml of resin poured into a 1.5 x 20cm column (Pharmacia) . Thirty-one mg of ether ethanol precipi- tated TGI in 36.0 ml which was equilibrated by dialysis in Spectropor* 3 (molecular weight cutoff 3,500) in 4.0 M ammonium acetate, was applied to the column at a flow rate of 1.0 ml/min. After the absorbance at 0D_80 reached zero, a gradient containing a descending con- centration of 4.0 M to 0.04 M ammonium acetate (short broken lines) and an ascending concentration of ethylene glycol (Mallinkrodt) from 0-50% (long broken lines), pH 4.5 was applied through a flow adaptor (Pharmacia AC16) . The total volume of the gradient was 150 ml and 1.9 ml fractions were collected by a Redi- rac# fraction collector (LKB) . Thirty microliters of every other fraction was transferred to a sterile plas¬ tic 12 x 75 mm snap-top tubes (Falcon) containing 50 micrograms of bovine serum albumin (Sigma A0281) in 1.0 M acetic acid. Tumor growth inhibitory activity was determined for both CCL 64 mink lung cells and A549 cells as described in the initial procedure. Activity against A549 cells is not shown because the activity profiles were similar. Tumor growth inhibitory activ- ity-is plotted as percent inhibition and is illustrated by closed circles. The peak of growth inhibitory ac¬ tivity was eluted at 1.18 M ammonium acetate, 42% eth- ylene glycol. Protein concentration is indicated as absorbance at 280 nm and was determined using a spec- trophotometer (Baush & Lomb, Spectronic* 1001) .
Biologically active fractions 90-100 were pooled and dialyzed against 0.1 M acetic acid. The protein con¬ centration of the pooled fractions was determined by absorbance at OD 280' τhe recovered protein was 1.4 mg (see Table 7) . The quantity of inhibitory units ap¬ plied was 1.56 x 10 in 30.9 mg and the amount recov¬ ered was 1.5 x 10 in 1.4 mg.
Figure 14A shows reverse phase high pressure liquid chromatography (HPLC) (μBondpak* C18) . One mg of lyoph¬ ilized TGI derived from the stromal component of umbil¬ ical cord tissue (dissected) and obtained from the pooled biologically active fractions resulting from phenyl-Sepharose chromatography, was diluted in 2.0 ml of 0.05% trifluoroacetic acid (TFA) containing 10% acetonitrile. The amount of protein used for RPHPLC at this step represents 50% of the total biologically active proteins obtained following chromatography using phenyl-Sepharose. The protein solution was sonicated for two minutes (Branson B-220 Sonicator) and particu- late matter removed by centrifugation (Beckman Model TJ6) at 3,000 rpm for 5 minutes prior to injection into a (μBONDAPAK* C18) column (0.39 x 30 cm). The protein was eluted at a flow rate of 1.0 ml per minute using a stepwise gradient. The concentration of acetonitrile was initially increased to 25% in fifteen minutes and elution was continued at 25% for 10 minutes; the con¬ centration was then increased to 27% in two minutes and elutrion was continued at 27% for ten minutes; the con¬ centration increased to 28% in 2 minutes continued at 28% for 10 minutes, and finally the concentration was increased to 100% in 10 minutes. The fractions were collected into siliconized glass tubes. The solvent gradient is illustrated by short dashes. .Absorbance of protein was monitored at 210 nm ( ) . Each frac¬ tion volume contained 1.0 ml. The equipment used for RPHPLC was exactly as described in Figure 12. Five microliter aliquots from every other tube were removed to assess tumor growth inhibitory activity against CCL 64 and A549 as previously described. Activity against the CCL 64 cell line is indicated by closed circles. Fractions 47-51 were pooled separately for electro- phoresis by SDS-PAGE (marked by arrows). 350,000 in¬ hibitory units were applied in this chromagtographic procedure and the recovered units in the pooled frac¬ tions were: 150,000 in fractions 39-58; 14,850 in fractions 59-71 (Total 164,850). The growth inhibitory activity eluted at 27% and 28-30% acetonitrile.
Figure 14B -sisσws the reverse phase high pressure liquid chromatography (HPLC) (μBONDAPAK* C18) . Three hundred and forty-five micrograms of TGI derived from the stro- mal component of dissected human umbilical cord tissue and obtained from pooled biologically active fractions resulting from phenyl-Sepharose chromatography were diluted in 2.0 ml of 0.05% trifluoracetic acid (TFA) and 10% acetonitrile. The protein was prepared and chromatographed exactly as described in Figure 14A. Ten microliters from each 1.0 ml sample were used to test for inhibitory activity. This sample represented
30% of the total biologically active pooled fractions derived from phenyl-Sepharose chromatography. The number of inhibitory units applied to the column was 312,.500. The recovered units were 62,500 in fractions 46-50, 50,000 units in fraction 51-55, and 90,000 units in fractions 56-72 (Total 202,500 units recov¬ ered) .
Figure 15 shows Sodium Dodecyl Sulfate Polyacrylamide Slab Gel Electrophoresis (SDS-PAGE) . The lyophilized pool of biologically active protein, as marked by ar¬ rows, in Figure 14A from chromatography by μBONDAPAK* C18 from two identical chromatographic procedures were pooled and prepared for gel electrophoresis. Samples were diluted in 100 microliter sample buffer contain¬ ing 0.1 M Tris-HCl, pH 6.8 (Sigma), 15% glycerol (Kodak) , and 2% sodium dodecyl sulfate (SDS) . The samples were boiled for two minutes to remove protein which may have adhered to the glass (siliconized) and 50 microliters transferred to 50 microliters of sample buffer containing 10% ø-mercaptoethanol (BioRad*) for reduction of disulfide bonds. These samples were boiled for 2 minutes and both the unreduced and reduced samples were applied to two separate 1.5 mm wide slab gels (marked as lane 2) and electrophoresed through a 10-20% acrylamide gradient in a vertical electrophore¬ sis cell (BioRad, Model 155) under constant current at 30 milliamps (mA) per gel for 4.5 hours (Hoeffer power supply PS 1200 DC) . Molecular weight standards (Phar¬ macia) both reduced by 5% /3-mercaptoethanol and non- reduced are marked with their corresponding molecular weights. They are as follows, phosphorylase A, 96 kDa; bovine serum albumin, 68 kDa; ovalbumin, 43 kDa; car- bonic anhydrase, 30 kDa; soybean trypsin inhibitor, 21 kDa; and lysozyme 14.4 kDa. Fifty nanograms (50 ng) of a purified platelet derived TGF-ø supplied by Dr. Bruce Magun was diluted in sample buffer and electro¬ phoresed under non-reducing conditions (a) and reducing conditions (b) shown in lane 1. The gels were stained with 0.125% Coomassie Blue R-250 (BioRad) in 5.7% ace¬ tic acid 47% methanol for ten minutes (to fix the pro¬ tein in the gel) , and destained overnight in the same solution without Coomassie Blue. The gels were re- stained by a silver technique as described by Merril (BioRad silver staining kit #161-0443) Lane 1 (TGF-/9) contains approximately 1,000-1,500 (50 ng) units of growth inhibitory activity, and lane 2 contains ap¬ proximately 8,000-20,000 units of growth inhibitory activity.
Figure 16 shows reverse phase high pressure liquid chromatography (HPLC) (μBONDAPAK* CN) of active frac¬ tions from the previous HPLC procedure (14B) which were combined from two separate chromatographic runs. The lyophilized material from individual tubes (siliconized glass 13 x 100 mm tubes) was suspended in 4.0 ml of 0.1% trifluoracetic acid (TFA) containing 10% propanol, sonicated for two minutes and injected onto a μBONDAPAK* CN column (0.39 x 30 cm) at 1.0 ml/minute. Elution of the protein was achieved by increasing the concentra¬ tion of 2-propanol containing 0.05% TFA from 10% to 20% in 10 minutes, the concentration was then increased from 20 to 50% in 50 minutes (0.6% per minute), and finally the concentration was increased to 100% in twenty minutes. The solvent gradient is shown as short dashes. Absorbance of the eluted protein was monitored at 210 nm ( ) . The equipment used for RPHPLC was exactly as described in Figure 12. Each fraction volume was 1.0 ml and an aliquot of two hundred microliters was then removed from every other tube to assess biological activity (closed circles) . The inhibitory activity eluted from the column between approximately 40-45% 2-propanol. Twelve thousand units (12,*€00) of activity were applied to this column. The following fractions were lyophilized, iodinated and electrophoresed by SDS-PAGE (Fig. 17) . The total num¬ ber of units contained in these fractions were: Frac¬ tion #56 (0 units), #58 (488 units), #59-65 (11,750 units) , and #66-68 (185 units) .
Figure 17 shows SDS polyacrylamide slab gel electro¬ phoresis and autoradiography. Lyophilized samples from specific active and inactive fractions from chromatog- raphy on a μBONDAPAK* CN column illustrated in Figure 16 were iodinated as described in the text. Samples were dissolved in both non-reducing and reducing sample buffer as described for Figure 15 and electrophoresed using a 5-20% acrylamide gradient to resolve protein bands and remove free-radioactive iodine. The gels were stained and destained until the radioactive label disappeared from the destain solution. The gels were dried using a gel dryer (Hoeffer) and subjected to autoradiography using type XAR film (Kodak) for 1 week. Non-radioactive standards were also electrophoresed and are marked at the left of the gel. The number of cal¬ culated inhibitory units applied to this gel were: from Figure 16, fraction #58 (189 units) , lane 1; #59- 65 (2,068 units), lane 2; #66-68 (46 units), lane 3; #56 (0 units), lane 4; active fraction of undissected human umbilical cord following chromatography on a μBONDAPAK* CN column as described in Figure 18 chromatogram, (408 units), lane 5; inactive fractions from same stromal/vascular preparation, lane 6; plate- let-derived TGF-β purified by Bruce Magun (256 units, approximately 0.4 ng) , lane 7.
Figure 18 shows reverse phase high pressure liquid chromatography (HPLC) (μBONDAPAK* CN) . Active frac- tions from a previous HPLC procedure of undissected umbilical cord (similar to Figures 14A & 14B) , which eluted at 27% acetonitrile (Pool I) from a μBONDAPAK* C18 column were pooled, lyophilized to 1.0 ml volume in a siliconized glass tube (16 x 100 mm) and diluted to a final concentration of 0.1% trifluoracetic acid (TFA) and 20% 2-propanol. The sample was sonicated for 2 minutes and injected onto a μBONDAPAK* CN column (0.39 x 30cm) at 1 ml per minute. Elution of the protein was achieved by increasing the concentration of 2-propanol containing 0.1% TFA from 20% to 35% in 5 minutes fol¬ lowed by 35% to 50% in 50 minutes (0.375% per minute), and 50% to 100% in 5 minutes. The solvent gradient is shown as short dashes. An aliquot of 10 microliters was removed from each 1.0 ml sample to test for biolog- ical activity (closed circles) . The equipment used for RPHPLC is as described in Figure 14. The active frac¬ tions eluted between 39 to 43% with the peak of activi¬ ty eluting at 40-41%. The number of calculated inhibi¬ tory units applied to the column was 37,000. Protein concentrations could not be determined. Absorbance at 210 nm is shown by the solid line.
Figure 19 shows Reverse Phase High Pressure Liquid Chromatography (HPLC) (μBONDAPAK* CN) . Active fractions from a previous HPLC procedure (the same chromatograph- ic run as Figure 18 was derived) which eluted at 28-30% acetonitrile (Pool II) from a C18 resin pooled and applied to a μBONDAPAK* CN column as described in Figure 18. Gradient elution and equipment are as described for Figure 18. Aliquots of 100 microliters were re¬ moved • from every tube to test biological activity (closed circles) . Biological .activity eluted from 44% to 46% with the peak of activity at 44%. The number of growth inhibitory units applied to the column was 21,0<K>. Protein concentration could not be deter¬ mined.
Figure 20 shows the Reverse Phase High Liquid Chroma¬ tography (HPLC) (μBONDAPAK* CN) . The elution profiles reflecting biological activity (peaks only) from Figure 18 (Pool I) and Figure 19 (Pool II) have been traced onto a separate chromatogram for comparison. Pool I eluted at 40-41% and Pool II at 44%.
Figure 21 shows the Reverse Phase HPLC of A431 Condi¬ tioned Media. Lyophilized conditioned media from 4 x g
10 A431 cells (110 ml) was processed, as described in the text, for the effect of DTT on tumor growth inhibi¬ tory activity derived from tumor cell conditioned media. Lyophilized conditioned media from A431 cells was resuspended in 5 ml 4 mM HCl and centrifuged to remove insoluble material (RC5B-Sorvall* SA600 rotor) for 15 minutes at 3,5000 RPM at 4"C. The supernatant was transferred to 1.5 ml microfuge tubes and centri¬ fuged in =?n Eppendorf* microfuge for 15 min at 4°C. Protein ntration was determined by absorbance at 280 nm. An aliquot of 0.2 ml containing 680 micrograms protein was added to 1.8 ml 0.1 M ammonium bicarbon¬ ate. The samples were incubated at room temperature for 2 hours, lyophilized, and resuspended in 2 ml of 0.05% trifluoroacetic acid. The material (2.0ml) was injected onto a reverse phase semipreparative μBONDAPAK* C18 column at 1.0 ml/min and 2.0 ml frac¬ tions were collected at the start of the linear aceto¬ nitrile from 0-50% in 50 min. An aliquot of 1.0 ml gradient from each fraction was assayed for tumor growth inhibitory activity against mink cell line (CCL 64) ( —0—0—O— )and human tumor cell line (A549) ( —Δ—Δ— ) as previously described. Absorbance at 206 jjm is indicated by the solid line.
Figure 22 shows the Reverse-phase HPLC of A431 Condi¬ tioned Media Treated with DTT. Lyophilized conditioned g media from 4 x 10 A431 cells (110 ml) was processed, as previously described, for the effect of DTT on tumor growth inhibitory activity in tumor cell conditioned media. Lyophilized conditioned media from A431 cells was resuspended in 5 ml 4 mM HCl and centrifuged to remove insoluble material (RC5B-Sorvall* SA 600 rotor) for 15 minutes at 3,500 RPM at 4βC. The supernatant was transferred to 1.5 ml microfuge tubes and centri¬ fuged in an Eppendorf* microfuge for 15 min. at 4°C. Protein concentration was determined by absorbance at 280 nm. An aliquot of 0.2 ml containing 680 micrograms protein was added to 1.8 ml 0.1 M ammonium bicarbonate containing a final concentration of 65 mM DTT. The samples were incubated at room temperature for 2 h. , lyophilized, and resuspended in 2 ml of 0.05% tri¬ fluoroacetic acid. The material (1.0 ml) was injected onto a reverse phase semipreparative μBONDAPAK* C18 column, and 2.0 ml fractions were collected at the start of a linear gradient and assayed for growth in¬ hibitory activity against mink lung cell line (CCL 64) ( —o—0— ) and human tumor cell line (A549) ( —D— D— ) as previously described. Absorbance at 206 nm is indicated by the solid line.
Figure 23 in a schematic representation of trpE: :TGF- βl plasmid constructs using pATH 11 and pKS-1 expres- sion vectors for the production of TGF-,51 polypeptide in bacteria.
Figure 24 shows a Southern blot analysis of human tumor DNAs hybridized with a Pvu II-Pvu II TGF-βl cDNA probe. SCC -is standard saline-citrate buffer, which consists of : 0.15M sodium chloride and 0.15M sodium citrate. (pH 7.0) .
Figure 25 shows a restriction map of the phage sub- clone that hybridized to the TGF-βl cDNA probe at high stringency wash. The clone corresponds to TGF-βl genomic locus. The Sal I-Sal I fragment of the phage clone was subcloned into pUC. Abreviations for re¬ striction enzyme sites are: S-Sal I; K-Kpnl; E-Eco RI; H-Hind III; B-Bam HI; Bg-Bgl II.
Figure 26 shows a restriction map of the phage sub- clone that hybridized to the TGF-βl cDNA probe only under conditions of low stringency.
Figure 27 shows a comparison of the nucleotide sequence and the predicted amino acid sequence of TGF-ySl and the related gene encoding the protein with tumor inhibitory activity. Indentical amino acids are boxed. (A) cor¬ responds to the gene encoding the protein having tumor growth inhibitory activity.
Figure 28 shows a restriction map of the Bam HI frag¬ ment of the related gene encoding the protein having tumor growth inhibitory activity subcloned into pUC. The position of the repeat free fragment (BamHI-TaqI) is indicated with a bar.
Figure 29 shows a partial nucleotide sequence of the 1.7 kb cDNA encoding the protein having tumor growth inhibitory activity and its corresponding amino acid sequence. Figure 30 shows the restriction map of the 1.7 kb Eco RI subclone of the TGF-βl related gene encoding the protein having tumor growth inhibitory activity.
Figure 31 shows a nucleotide and predicted amino acid sequence comparison of the gene encoding the protein having tumor growth inhibitory activity with TGF-βl and TGF-β2. (A) corresponds to the gene encoding the pro¬ tein having tumor growth inhibitory activity.
Figure 32 shows a Northern blot analysis of A673, A549, and A498 cell lines using an Eco RI-Bgl II 1.7 kb cDNA fragment of the gene encoding the protein having tumor growth inhibitory activity as a probe.
Figure 33 shows a Northern blot analysis of A673, A549, and A498 cell lines using a Pvu II-Taq I probe from genomic sequences of the gene related to TGF-βl and encoding the protein having tumor inhibitory activity.
Figure 34 shows a Northern blot analysis of A673, A549, and A498 cell lines using a Pst I-Bal I TGF-/31 probe.
Figure 35 shows a Northern blot analysis of A673, A549 and A498 cell lines using TGF-βl cDNA containing the complete coding sequence of TGF-βl precursor as a probe.
Figure 36 shows a Northern blot analysis of mRNA from umbilical cord and A673 cell line using an Eco RI - Bgl II cDNA fragment of the gene encoding the protein hav¬ ing tumor growth inhibitory activity as a probe.
Figure 37 shows the production of trpE: :protein having tumor growth inhibitory activity fusion protein of three lysates by SDS polyacrylamide gel electrophore¬ sis. (A) corresponds to the gene encoding the protein having tumor growth inhibitory activity.
Figure 38 shows a Western blot analysis of an antibody recognizing a fusion protein of the protein having tumor growth inhibitory activity. (A) represents the polypeptide sequences corresponding to the last 150 amino acids of the protein having tumor growth inhibi¬ tory activity.
Figure 39 shows whole cell bacterial lysates containing trpE: :TGF-j1 fusion proteins (lanes 1 and 4), trpE: : (A) fusion proteins (lanes 2 and 5) , and the TGF-βl protein (purchased from R & D Systems) (lanes 3 and 6) were separated on a 12.5% SDS-polyacrylamide gel. The pro¬ teins were electrophoretically transferred to a nitro¬ cellulose filter (1 μ pore size) and incubated with 100 ug of affinity purified anti-peptide antibody either in the absence (lanes 1, 2 and 3) or presence of a 300 fold molar excess of the antigenic peptide (lanes 4, 5, and 6) . The antibodies were detected using alkaline phosphatase conjugated ' to goat anti-rabbit antibody (Promega) according to the manufacturer's instruc¬ tions.
Figure 40 shows a schematic diagram of mRNA encoding the protein having tumor growth inhibitory activity with the coding sequence boxed. The relative extension of the cDNA inserts obtained from placenta (1.7 kb) , umbilical cord (1.9 kb) and A673 (1.7 kb) libraries is indicated. The dashed part of the box represents the C-terminal region showing high- homology to TGF-βs . The 5' EcoRI-Bg II restriction fragment of the placenta cDNA is indicated by a bar. Figure 41 shows the nucleotide sequence encoding the protein having tumor growth inhibitory activity and its deduced amino acid sequence. Putative glycosylation sites and polyadenylation signal are underlined. The start of the mature protein is marked by an asterisk at position 1164.
Figure 42 shows a comparison of the nucleotide sequence and predicted amino acid sequence of the gene encoding the protein having tumor growth inhibitory activity with TGF-01 and TGF-β2. Identical amino acids are boxed. The mature amino acid sequences start at posi¬ tion 315. (A) corresponds to the gene encoding the protein having tumor growth inhibitory activity.
Figure 43 shows a homolpgy matrix plot between the gene encoding the protein having tumor growth inhibitory activity and TGF-βl and TGF-,92.
Figure 44 is a schematic representation of the construction of the pCMV-TGF-/33 expression plasmid from pORFX and pBlue-TGF-^3 plasmids.
Figure 45 shows the level of TGF-/53 mRNA expression, determined by Northern hybridization using a TGF-^3 specific probe, of parental CHO cells (lane 1) , CHO cells transfected with TGF-03 cDNA (CHO 6.35) (lane 2) and CHO 6.35 amplified with 20nM Mtx (CHO 6.35/20nM) (lane 3)
Figure 46A shows the dose response of mink cell growth inhibition using purified TGF-βl . Cell growth was quantitated by the metabolism of MTT (3-[4,5- Dimethylthiazol-2-yl]-2,5-diphenyltetrazolium bromide; Thiazolyl blue) (Mossman, T. (1983) J. Immunol. Methods j55, 55-65) .
Figure 46B shows the dose response of mink cell growth inhibition using acid activation serum free supernatants CHO 6.35/20nM transfectant and CHO 6.35 transfectant. Cell growth was quantitated by the metabolism of MTT.
Figure 47 shows the relative location of the various TGF- 3 peptides used as antigens.
Figure 48A shows the immunoblot of TGF- 3 from conditioned media of CHO 6.35/20nM transfectant using
03III and β3V antibodies for detection from gels under reducing conditions.
Figure 48B shows the immunoblot of TGF-03 from conditioned media of CHO 6.35/20nM transfectant using 3111 and 03V antibodies for detection from gels under non-reducing conditions.
Figure 49 shows a Western blot of cell extract (49A) and conditioned media (49B) of the CHO 6.35/20nM transfectant using 03V antibody for detection.
Figure 50 shows the immunoprecipitation of native recombinant TGF-03 protein by βV antibody.'
Figure 51 shows the staining to paraffin sections of human umbilical cord by βV antibody (Figure 51 A,C) and control antibody (51B, D) .
Figure 52 shows a silver stained gel of purified TGF-03 and TGF-øl. Figure 53 shows antibody neutralization of TGF-03 inhibition of mink cell growth.
Detailed Description of the Invention
This invention provides a protein having tumor growth inhibitory activity comprising the 112 amino acids shown in Figure 29 beginning with alanine at position 1 and ending with serine at position 112. Preferably, this protein may be a purified protein having 112 amino acids beginning with alanine at position 1 and ending with serine at position 112 as shown in Figure 29. This 112 amino acid protein is the mature form of the protein having tumor growth inhibitory activity.
A biologically active derivative of a protein having the tumor growth inhibitory activity is also provided, wherein the derivative has substantially the same amino acid sequence shown in Figure 29 beginning with alanine at position 1 and ending with serine at position 112.
The protein may also comprise the 412 amino acids shown in Figure 41 beginning with methionine at nucleotide position 263 and ending with serine at nucleotide position 1496. Thus, this 412 amino acid sequence contains the complete precursor sequence of the protein having tumor growth inhibitory activity as well as the complete sequence of the mature protein.
Further, a biologically active derivative of the protein comprising the 412 amino acids shown in Figure 41 is provided. The biologically active derivative has substantially the same amino acid sequence as shown in Figure 41 beginning with methionine at nucleotide position 263 and ending with serine at nucleotide position 1496. Further provided is a protein comprising the 411 amino acids shown in Figure 41 beginning with lysine at nucleotide position 266 and ending with serine at nucleotide position 1496.
This invention further provides a nucleic acid molecule encoding the protein having tumor growth inhibitory activity comprising the 112 amino acids shown in Fig- ure 29 beginning with alanine at position 1 and ending with serine at position 112. The nucleic acid molecule may encode the entire protein shown in Figure 41 begin¬ ning with methionine at nucleotide position 263 and ending with serine at nucleotide position 1496. Alter- natively, the nucleic acid molecule may encode only the 112 amino acids found in the functional protein shown in Figure 29 beginning with alanine at position 1 and ending with serine at position 112. These nucleic acid molecules may be cDNA, genomic DNA, or mRNA and may also comprise the entire nucleotide sequence set forth in Figure 41 begining with cytosine at position 1 and ending with guanine at position 2529 or only the 112 amino acid sequence of the mature protein shown in Figure 29 beginning with guanine of the codon at position 1 and ending with cytosine of the codon at position 112.
It would be clear to one skilled in the art that certain amino acids as well as the nucleic acids encod- ing these amino acids may be varied, thus producing biologically active derivatives, e.g. mutants, without changing the function of the protein. This invention encompasses all variations of the amino acid and nucleotide sequence which produce a functional protein.
This invention also provides a plasmid which comprises the nucleic acid molecules of this invention as well as a host vector system comprising the plasmid in a suit- able-host cell. This host vector system comprises any plasmid and vector known in the art which are suitable for producing the proteins of this invention. The suitable host cell may be a bacteria cell or a eucaryo- tic cell.
This invention further provides a method for producing a protein comprising growing the host vector system of this invention so as to produce the protein having tumor growth inhibitory activity in the host and recov¬ ering the protein so produced.
Additionally, the invention provides a polypeptide derived from the protein having tumor growth inhibitory activity. The polypeptide comprises the 20 amino acids shown in Figure 29 beginning with arginine at position 9 and ending with leucine at position 28. The invention further provides an antibody which specifically binds to an epitope contained within the protein having tumor growth inhibitory activity. The antibody may be monoclonal or polyclonal.
This invention also provides an antibody which specifi¬ cally binds to an epitope contained within the polypeptide comprising the 20 amino acids shown in Figure 29 beginning with arginine at position 9 and ending with leucine at position 28. The antibody may be monoclonal or a polyclonal.
A method for diagnosing a tumor is also provided in the invention. The method comprises contacting a sample from a human subject with an antibody of the invention under suitable conditions so as to form a complex between the antibody and an epitope contained with the protein and detecting the complex so formed, thereby diagnosing a tumor. By suitable conditions applicants contemplate any conditions which would be conducive to the formation of a complex which are known in the art.
This invention provides a pharmaceutical composition comprising the antibodies of this invention and a phar¬ maceutically acceptable carrier. A pharmaceutically acceptable carrier includes all carriers known in the art. Merely by way of example, the carrier may be sa¬ line.
This invention further provides a method of treating a tumor which comprises administering to the subject an effective tumor treating amount of the pharmaceutical composition. This invention also provides a method of treating a proliferative type disorder which comprises administering to the subject an effective proliferative type disorder treating amount of the pharmaceutical composition. The composition may be used to treat various types of proliferative type dis¬ orders. Examples of proliferative type disorders of which the composition may be effective include arte¬ riosclerosis, inflammation, and psoriasis.
The protein having tumor growth inhibitory activity may e used in a pharmaceutical composition which comprise an effective amount of the protein having tumor growth inhibitory activity, or a biologically active derivative thereof, together with a suitable phar¬ maceutical carrier. Effective amounts may vary among the various tumor growth inhibitors depending on the indication to be treated, the patient or the stage of tumor development, by methods well known to those skilled in the art. Similarly, suitable carriers such as saline or other aqueous solutions, gels, creams and the#1ike are well known to those skilled in the art.
The protein having tumor growth inhibitory activity may be used in a method to inhibit the growth of human tumor cells, e.g., carcinoma, melanoma or leukemia cells, by contacting the cells with an effective tumor growth inhibiting amount of the pharmaceutical composition which includes the protein having tumor growth inhibitory activity. The protein having tumor growth inhibitory activity may also be used in a method to treat burns or to facilitate the healing of wounds by contacting the burn or wound with a pharmaceutical composition which includes an effective amount of the protein having tumor growth inhibitory activity and a suitable pharmaceutical carrier.
This invention also provides a method of treating a proliferative type disorder in a subject which compris¬ es administering to the subject an effective amount of the composition which includes the protein having tumor growth inhibitory activity comprising the 112 amino acids shown in Figure 29 beginning with alanine at position 1 and ending with serine at position 112 in a suitable pharmaceutical carrier effective to treat the proliferative type disorder. Various proliferative type disorders may be treated using the proteins of the invention. Examples of proliferative type disorders include arteriosclerosis, inflammation, and psoriasis. The various proteins of this invention may further be used as an immune modulator.
Further provided in the invention is a pharmaceutical composition comprising an effective amount of the protein comprising the 412 amino acids shown in Figure 41, or a biologically active derivative thereof, in a suitable pharmaceutical carrier. The pharmaceutical composition may be used in a method of inhibiting the growth of human tumor cells. The method comprises contacting the cells with an effective tumor growth- inhibiting amount of the pharmaceutical composition.
A method of treating a proliferative type disorder with the pharmaceutical composition comprising the 412 amino acid protein is also disclosed. The method comprises administrating to a subject an amount of the pharmaceutical composition effective to treat the proliferative disorder.
Further, the pharmaceutical composition comprising the 412 amino acid protein may also be used in a method for treating a burn or healing a wound. The method comprises contacting the burn or wound with an effective amount of the pharmaceutical composition.
A method for detecting the presence of a tumor is dis- closed. The method comprises quantitatively determin¬ ing the amount of the protein having tumor growth inhbitory activity present in a sample, e.g., blood, amniotic fluid, peritoneal fluid, ascites fluid, cere- brospinal fluid or urine, from a subject and comparing the amount so determined with the amount present in a sample from a normal subject, the presence of a sig¬ nificantly different amount, e.g. a significantly higher amount, indicating the presence of a tumor.
Another method for detecting the presence of a tumor is disclosed. The method comprises separately quantita¬ tively determining both the amount of the protein having tumor growth inhibitory activity and of transforming growth factor alpha (TGF-alpha) present in a sample from a subject, determining the ratio of the amount of the protein having tumor growth inhibitory activity present in the sample to the amount of TGF- alpha present in the sample from a subject, determining the ratio of the amount of the protein having tumor growth inhibitory activity present in the sample, determining the comparable ratio for a sample from a normal subject and comparing the ratio for the sample from the subject to the ratio for the sample from the normal subject, a significant variation in the ratio indicating the presence of a tumor.
A method for typing tumors is disclosed which comprises quantitatively determining for a sample from a subject with a tumor the amount of each of TGI-1, TGI, TGI-2, the protein having tumor growth inhibitory activity, CM-I, or the polypeptide recoverable from conditioned media of A431 cells present in the sample, the presence of specific amounts or relative amounts thereof, e.g, a significant increase in the amount of TGI or a signif¬ icant variation in a ratio such as the ratio of TGI-1 to CM-I, being indicative of a specific tumor type.
This invention further provides a method of inhibiting the activity, for example, immunosuppressive activity, of the protein having tumor growth inhibitory activity, or any biologically active fragment thereof, which comprises contacting the cells with an effective amount of the antibody which specifically binds to an epitope contained with the protein having tumor growth inhibitory activity comprising the 112 amino acids shown' in figure 29 beginning with alanine at position 1 and ending with serine at position 112. Finally, another method of inhibiting the activity, for example immunosuppressor activity, of the protein having tumor growth inhibitory activity, or any biologically active fragment thereof, is disclosed. The method comprises contacting the cells with an effective amount of the antibody which specifically binds to an epitope contained within the 20 amino acid polypeptide shown in Figure 29 beginning with arginine at position 9 and ending with leucine at position 28.
This invention is illustrated in the Experimental Details section which follows. This section is set forth to aid in an understanding of the invention but is not intended to, and should not be construed to, limit in any way the invention as set forth in the claims which follow.
- 37A -
This invention further provides a method of producing TGF- B3 which comprises:
(a) preparing DNA encoding a precursor of TGF-B3 and having a nucleotide sequence substantially identical to the nucleotide sequence shown in Figure 41 beginning with nucleotide 263 and ending with nucleotide 1498;
(b) inserting the DNA so prepared into an expression vector so positioned with respect to a suitable promoter as to permit expression of the DNA in a suitable host cell;
(c) transforming the host cell with the expression vector under conditions permitting expression of the DNA;
(d) culturing the host cell so transformed in a suitable medium under conditions such that the DNA is expressed, the precursor of TGF- B3 is produced, and the precursor TGF-B3 so produced is secreted into the medium;
(e) treating the medium containing the secreted precursor of TGF-B3 with an activating agent so as to convert the precursor into TGF-B3; and (f) recovering the TGF-B3 so produced.
The foregoing method is particularly intended for use with a eucaryotic host cell, preferably a mammalian host cell. Presently a CHO cell, e.g. a DHFR" CHO cell, is particularly preferred.
In the practice of this method, various promoters may be used as is well known to those skilled in the art. Presently, the preferred promoter is an inducible promoter, e.g. a promoter associated with the dhfr gene. - 37B -
Finally, in order to convert the precursor of TGF-B3 to mature TGF-B3, a activating agent, such as an acid, is employed. Those skilled in the art will readily appreciate the types of acids which may be so employed.
- 38 -
EXP.ERIMENTAL DETAILS
Four sets of experiments are discussed below. Each series of experiments comprises a means of isolating proteins exhibiting tumor growth inhibitory activity. In the first series of experiments six discrete pro¬ teins are purified that demonstrated tumor growth in¬ hibitory activity. These proteins were designated TGI, TGI-1, TGI-2 and CM I-IV. The second and third series of experiments are improvements of the purification process resulting in more purified proteins demonstrat¬ ing tumor growth inhibitory activity. In the fourth series of experiments TGF-01 was cloned and used to isolate a related gene encoding a protein having tumor growth inhibitory activity. Although it has not yet been determined which of TGI-1 or TGI-2 corresponds to the protein having tumor growth inhibitory activity, one skilled in the art would understand that such a correspondence exists although the exact nature of this correspondence remains to be clarified.
First Series of Experiments
Materials and Methods
Isolation of Tissue-Derived Tumor Growth Inhibitors (TGIs) From Tissue Extracts
Human umbilical cord or placenta tissues were extracted using a modification of the acid/ethanol extraction procedure described by Davoren et al (Bioche . Bio- phys. Acta. 63:150 (1962) and Roberts et al, Proc. Natl. Acad. Sci. USA. 77:3494 (1980). - 39 -
The Jsuffer for extraction consisted of 375 ml of 95% (v/v) ethanol (punctilious, 190 proof, U.S. Industrial Chemicals, #UN1170) , 7.5 ml of concentrated HCl, 33 mg of phenylmethylsulfonyl fluoride (PMSF) (Sigma P-7627) and 1 ml of Aprotinin (Sigma A6012 with 19.8 Trypsin inhibitor units per ml in 0.9% NaCl and 0.9% benzyl alcohol) mixed with 192 ml of distilled water at 4βC. Four hundred to six hundred grams of frozen human um¬ bilical cords or placentas (Advanced Biotechnologies) (stored at -80*C) were thawed at 4βC for six hours. T e thawed tissue was placed in a 4°C chilled Cuisinart food processor (Model DLC-7-PR0) and suspended in 200 ml of 4*C extraction buffer. The suspended tissue was homogenized by the food processor. After the first minute of homogenization, the suspension became creamy white. Another 200 ml of 4*C extraction buffer was added to this white suspension. The suspension changed to a dark coffee brown color. The tissue suspension was homogenized for a total of 10 min. at 4"C. Extrac¬ tion buffer was added to this homogenized tissue mix- ture to a final volume of 6 ml per gram of tissue homo- genate.
The homogenized tissue suspension was transferred to a large 4 liter beaker with a 3 inch stir bar and stirred at half of the maximum stirring capacity of a Lab-line Multimagnestir multi-mixer. Model #1278. After over¬ night extraction with stirring at 4"C, the homogenate was transferred to 1 liter centrifuge bottles (Sorvall) and centrifuged at 3500 rpm (RCF=350) for 30 minutes at 4°C in a Sorvall RC-3B centrifuge equipped with a Sorval H-6000A rotor. The supernatant was transferred to a large 4 liter beaker and adjusted to pH 5.0 with the slow addition of concentrated ammonium hydroxide. With increasing pH, the color of the super- - 40 -
natant changed from brown to an orange solution. The solution was precipitated following the addition of 2.0 M ammonium acetate, pH 5.2, added at an amount of 1% of the total volume. This precipitate was removed follow¬ ing centrifugation at 4500 rpm (RCF=5900) for 4 hours in a Sorvall RC-3B at 4*C. The supernatant was trans¬ ferred to large 6 liter flasks to which four volumes of anhydrous ether (-20 C) (Baker 9244-3) and two vol¬ umes of 95% ethanol (4*C) were added. The mixture was allowed to stand undisturbed at -22°C for 48 hours to allow the resulting precipitate to settle.
At the end of the 48 hr precipitation, the etherized material was brought to ambient temperature in a fume- hood. Warming of the acidified, ethanol extract to ambient temperature enhances the aggregation of the precipitate. The clear organic phase of ether and ethanol was removed by a water aspirator and the pre¬ cipitate was left in the fume hood for several hours to allow the residual organic phase to evaporate. The "dried" precipitate was dissolved in 1.0 M acetic acid and dialyzed extensively against 1.0 M acetic acid (Baker #9507-5) using dialysis membranes with a molecu¬ lar cutoff of 3500 (Spectropor 3, Spectrum Medical Industries, Los Angeles, CA) . The dialyzed acidified ethanol extract was lyophilized in 250 ml Corning coni¬ cal centrifuge tubes (Corning 25350) and stored as crude acidified, ethanol extract.
An alternative procedure for precipitating TGIs from the acidified, ethanol extract replaces the addition of four volumes of ether and two of ethanol with the addi¬ tion of only the two volumes of ethanol at 4'C. The advantage of eliminating ether from the acidified, ethanol extract precipitation step was the elimination - 41 -
of a step requiring the use of a highly flammable sol¬ vent which makes the procedure and any scale-up of the processing of large amounts of materials difficult.
Gel Filtration Chromatography
Lyophilized crude acidified, ethanol extract was re¬ suspended in 1.0 M acetic acid (10-30 mg/ml) and clari¬ fied by centrifugation at 3500 rpm for 30 min at 4"C in a Sorval RC-3B centrifuge equipped with a Sorvall H- 6000A rotor before sample application to the column. Sample volumes of one hundred to 150 ml were chroma¬ tographed on Bio-Gel* P10, 100-200 mesh (Bio-Rad; 150- 1040) in 1.0 M acetic acid at either 23* or 4*C.
The column (14 x 100 cm) (Amicon; #86012) contained 13.8 liters of equilibrated and degassed Bio-Gel* P10 in 1.0 M acetic acid at either 23°C or 4'C. The void volume was determined by the addition of 50 ml of blue dextran (Sigma #D5751) at 2 mg/ml in 1.0 M acetic acid. After calibration, the column was "conditioned" with 100 ml of bovine serum albumin (Sigma #A-4503) at 100 mg/ml in 1.0 M acetic acid followed by extensive wash¬ ing with 1.0 M acetic acid.
Following sample application, 1 liter fractions were collected using a SuperRac* (LKB 2211) equipped with a type C collection rack, at a flow rate of 7 ml/min into 2 liter plastic tissue culture roller bottles (Falcon; 3207) . Fractions were monitored by a Uvicord* S (LKB 2138) at 280 nm set at an absorbance range of 2.0 AUFS and recorded by a single channel chart recorder (LKB 2210). One ml aliquots were removed from each frac¬ tion, lyophilized and assayed for tumor growth inhibi¬ tory activity as described. The remainder of each - 42 -
fraction was lyophilized in 2 liter lyophilization jars (Virtis* #6503-2050) using a Virtis freeze-model 24.
High performance liguid chromatography (HPLC)
Individual fractions containing TGI activity from the Bio-Gel* P-10 column were lyophilized and resuspended in 1 to 10 ml of 0.05% trifluoracetic acid (TFA) (Pierce #28901) depending upon the amount of protein in each fraction. Water used for HPLC was generated using a Milli-Q water purification system. Starting buffer in all HPLC chromatography runs consisted of Milli-Q water containing 0.05% TFA. Prior to injection, the sample was centrifuged in a Beckman tabletop centrifuge (Beckman TJ-6) at 3000 rpm for 20 min to remove insol¬ uble material. The supernatant was injected into ei¬ ther a Waters uBondapak* analytical Clg column (0.39 x 30 cm) (Waters PN27324) or semipreparative column (0.78 x 30 cm) (Waters PN84176) as specified in individual experiments. A Waters automated gradient controller (Waters Model 510) was utilized for column elution monitored by a variable wavelength u.v. detectors (Wa¬ ters Lambda-Max, Model 481) set at 206 nm. The solvent used for elution was either acetonitrile (Baker 9017-3) or 2-propanol (Fisher, A452) containing 0.05% TFA. Fractions were collected by a SuperRac* (LKB 2211) equipped with a type B collection rack into siliconized (Pierce, Aquasil #42799) 13 x 100 mm or 16 x 100 mm test tubes. Aliquots from each collected fraction were assayed for tumor growth inhibitory activitiy as de¬ scribed below. - 43 -
Ion exchange chromatography
Both the lyophilized material from the acidified, etha¬ nol and ether extractions and various lyophilized frac¬ tions derived from the Bio-Gel* P-10 gel filtration chromatography were separately subjected to ion ex¬ change chromatography. CM, SP, and DEAE-TRISACRYL* (LKB) ion exchange resins were used in these proce¬ dures. The samples for chromatography were diluted to a final concentration of approximately 20 mg/ml in 1.0 M acetic acid. The samples were dialyzed at 4"C until both the pH and conductivity were equal to the starting (equilibration) buffer. All ion exchange chro ato- graphic procedures were performed at 4"C.
a. Chromatography using CM- and SP-TRISACRYL* ion exchange results.
The resins, as aqueous suspensions, were suspended in an equal volume of 0.1 M ammonium acetate, pH 4.0, con- taining 1.0 M NaCl. The resin was allowed to equili¬ brate for at least 3 hours and was degassed at 4"C. Twenty ml of resin was packed into a 1.6 x 20 cm column (Pharmacia; #19-0362-01) and washed with 2 column vol¬ umes of 1.0 ammonium acetate, pH 4.0, followed by 0.01 M ammonium acetate, pH 4.0. The column was washed until the effluent exactly matched the conductivity of the equilibrating buffer (i.e., 0.01M ammonium acetate. Fisher A637) , pH 4.0. The sample was applied to the resin (1 gm/20 ml resin) at a flow rate of 1 ml/min, the column was washed with equilibration buffer until the optical density leveled (e.g., approaching zero optical density) and 200 ml of an ascending molarity linear gradient (Pharmacia gradient mixer GM-1, #19- 0495-01) was applied through a column flow adaptor of - 44 -
concentrations 0.01 to 1.0 M ammonium acetate, pH 4.0. In certain experiments, a second gradient was applied to the same column. This second gradient ranged from 1.0 M ammonium acetate, pH 4.0, to 50% acetonitrile in 1.0 M ammonium acetate, pH 4.0. Two ml fractions were collected in polystyrene tubes, 13 x 100mm, (Columbia Diagnostics; B2564) in a SuperRac* Fraction collector (LKB 2211) , equipped with an A type collection rack. All column chromatography was performed with the aid of a Uvicord S with a 280 nm filter (LKB 2138) and a sin¬ gle channel recorder (LKB 2210) . Fractions were ali- quoted based upon optical density ranging from lOOul to 1 ml, and assayed for tumor growth inhibitory activity.
b. Chromatography using DEAE-TRISACRYL
The chro atographic resin preparation and procedure was performed exactly as described for CM- and SP- TRISACRYL* chromatography, except the equilibration buffer used was 0.1 M ammonium acetate, pH 6.0, the gradient elution ranged from 0.1 M to 1.0 M ammonium acetate, pH 6.0, and the sample was equilibrated in the above mentioned equilibration buffer.
Monolayer assay for tumor growth inhibitory activity
Test cells were sub-cultured on 96-well tissue culture plates (Nunc 167008) in 50 ul of Dulbecco's modified Eagle's medium (Whittaker M.A. Bioproducts 12-6143) containing 10% fetal bovine serum (Whittaker M.A. Bio- products 14-501B) , 2% L-glutamine (Whittaker M.A. Bio¬ products 17-605-A) , 1% penicillin and 1% streptomycin. Human lung carcinoma cells, A549, and normal human fibroblasts (HuF) required a seeding density of 5 x 10 cells per well. Mink cells (ATCC: CCL 64) required - 45 -
seeding density of 4.5 x 10 3 cells per well.
Aliquots from column fractions to be assayed for tumor growth inhibitory activity were transferred to sterile 12 x 75 mm tubes (Falcon 2058) containing 50 of micro- ^ liters lmg/ml solution of bovine serum albumin (BSA; Sigma A-6003) in 1 M acetic acid and lyophilized. Immediatetly prior to the assay, the lyophilized sample was resuspended in 400 μl, for each cell type tested. One hundred microliters aliquots of the resuspended " sample were added to wells containing test cells. Each sample was assayed in triplicate. The cells were incu¬ bated for 72 hours at 37° in a humidified 5% CO_/95% air atmosphere. At the end of the incubation period, each well was pulsed with 100 microliters of complete 5 medium containing 1 μCi/ml 5-[ I]Iodo-2'deoxyuridine
125 ( IUdR) (New England Nuclear; NEX-072) for 24 hours.
The monolayers were washed once with wash buffer A
(Dulbecco's phosphate buffered saline, with 10 mM
MgCl_, containing 1 mg/ml BSA, pH 6.8), fixed for 10 0 minutes in methanol (Fisher A452) , and air dried for 15 minutes. The 125IUdR incorporated by the cells was solubilized with 200 microliters of 1.0 N NaOH and the plates incubated for 20 minutes at 60"C. Solubilized
125 IUdR was collected using the Titertek Supernatant 5 Collection System* (Skatron Inc. , 7072) . The amount of cell growth is approximated by the extent of 125 IUdR incorporated into the DNA of cells in the log phase of growth. Before the assay was harvested each well was observed using a Zeiss* inverted microscope to visually 0 note the amount of cell growth. Inhibition or stimula- tion of growth was expressed as a ratio of 125IUdR incorporated by test cells (e.g. human tumor cells) containing the test aliquots relative to 125IUdR incor¬ porated by the untreated control cells. The inhibition 5 - 46 -
or stimulation observed by microscopic examination of treated cells corresponded well with decreased or in- creased incorporation of 125IUdR, respectively.
Characterization of TGI activities
a. Heat Treatment
One ml aliquots from fractions 2, 4, and 6 obtained from gel filtration chromatography on Bio-Gel* P-10, were lyophilized in 12 x 75 mm polystyrene tubes (Fal¬ con 2034) and resuspended in 1 ml of 1.0 M acetic acid. The samples were heated for 3 minutes in a boiling water bath, lyophilized, and assayed for tumor growth inhibitory activity as described above.
SDS-Polyacrylamide slab gel electrophoresis
Aliquots from samples from each chro atographic proce¬ dure were lyophilized for electrophoresis. Samples were diluted in 80 microliters of sample buffer con¬ taining 0.1 M Tris-HCl (Sigma; T-1503) , pH 6.8, 15% glycerol (Kodak; 114-9939) , 2% sodium dodecyl sulfate (SDS) Bio-Rad; 116-0302) , and 5% 2-mercaptoethanol (Bio-Rad; 161-0710) , and electrophoressed on a 5-20% acrylamide linear gradient essentially as described (Laemmli, U.K. (1970) Nature 22_7, 680-685) . The sam¬ ples were boiled for 2 minutes prior to application to a 1.5 mm wide slab gel in a Bio-Rad Model 155 Vertical Electrophoresis Cell (BioRad* 165-1420) under contant current at 30 mA per gel for 4 hours (Hoeffer power supply'; PS 1200 DC) at 9'C. Constant temperature was maintained by a water bath circulator (Haake, A81) . Gels were stained with 0.5% Coomassie Blue R250 (Bio¬ Rad #16-0400) in 5.7% acetic acid and 47% methanol - 47 -
overnight and destained in the same solution without stain. Specific gels demonstrating low concentrations of proteins were restained by a silver technique as described by Merril (Merril, C.R., Goldman, D. , Sedman, S. and Ebert, M.H. (1981) 211:1437-1438), (Bio-Rad silver staining kit; #161-0443).
Results
Comparison of tumor growth inhibitory activities from gel filtration chromatography on Bio-Gel P10 at room temperature and at 4'C. The growth inhibitory activity derived from acidified, ethanol extracts of human um¬ bilical cords eluted by gel filtration chromatography using Bio-Gel* P10 resin with apparent molecular weights ranging from 5,000-16,000 daltons. Occasional¬ ly, another peak of activity has been observed at mo¬ lecular weights ranging from 3000-5000 daltons. The molecular weight calculations are based on the elution profiles of molecular weight standards (i.e., carbonic anhydrase - 29,000; RNase - 14,400; insulin - 6,000) chromatographed on 1 liter of resin in a column of 4 x 100 cm. The elution profile derived from the column and from the large 14 x 100 cm column were superi pos- able. Acidified, ethanol extracts from human placenta identically chromatographed demonstrated elution pro¬ files very similar to the umbilical cord extracts.
Fractions 1 to 3 from the umbilical cord acidified, ethanol extract are a very intense brown color; the color gradually disappears as the fractions progress. Fortunately, although (TGI) eluted in fractions 1, 2, and 3 containing the highest protein concentrations, the majority of activity extends past the observed protein peaks as is clearly demonstrated in Figures 1 - 48 -
and "2. Extracts from human placental material showed a greater overlap of TGI with the major protein peaks than was observed with material from human umbilical cords (data not shown) . Aliquots of identical volumes from gel filtration chromatography electrophoresed by SDS-PAGE on a 5-20% polyacrylamide gradient also il¬ lustrated that by fraction 4, considerably less protein is found than in fractions 1 to 3. In fractions 5 an 6, major protein bands of 5,600 and 14,000 band are observed and by fraction 7 very little protein remains, although inhibitory activity extends into fraction 10 as shown in Figure 2. The obvious advantage of the majority of activity eluting in regions of less protein is that it facilitates further purification of TGIs.
A comparison of Bio-Gel* P-10 chromatograms performed at room temperature and 4*C, illustrated in Figures l and 2, respectively, clearly indicate that inhibitory activity is better preserved at 4*C. At 23'C, no ac¬ tivity is observed past fraction 6 (Figure 1) , while at 4'C, activity is extended for 4 more fractions to fraction 10. Most importantly, the net amount of ac¬ tivity recovered is at least two-fold higher when ex¬ tracts are chromatographed at 4*C, since 80% or more tumor growth inhibitory activity is obtained in 7 frac- tions at 4'C (Figure 2) and in only 3 fractions at 23*C. This was not due to a concentration of the same quantity of activity eluting in 3 fractions (2 *C) rather then being spread over 7 fractions (4*C), but apparently to actual increase in the yield of tumor growth inhibitory activity. One ml aliquots of frac¬ tion 5 from both columns separately and dilutions of these fractions to 1/5 to 1/125 were tested on both the human lung adenocarcinoma (A549) and mink lung cells (CCL 64) (Table 1) . The tumor growth inhibitory activ- - 49 -
ity*-©f the undiluted fraction was 2-fold higher in the fraction 5 obtained from chromatography at 4βC. More¬ over, a 25-fold dilution of fraction 5 from chromatog¬ raphy at 4'C continued to yield maximum tumor growth inhibitory activity against the human tumor cell line. A fraction of equivalent dilution from chromatography at 23*C showed no detectable activity. A similar ob¬ servation was made with the mink cell line. This in¬ formation was not based on activities observed in Fig¬ ures 1 and 2 but from two separate columns which demon¬ strated equivalent TGI activities in their respective fifth fraction.
Comparison of the effects of TGIs on normal human fi¬ broblasts (HuFs) and transformed human lung carcinoma cells (A549) . Aliquots of fractions obtained from human umbilical cord acidified, ethanol extracts chro¬ matographed on a Bio-Gel* P-10 resin, (4*C), were test¬ ed for tumor growth inhibitory activity on human normal and transformed cells as described in Materials and Methods. As illustrated in Figure 3, tumor growth inhibitory activity against human A549 cells (open triangles) ranged from fractions 3 to 12, while these same fractions induced as much as an 85% increase in growth stimulation of the normal human fibroblasts. Thus, the inhibitory activity is specific for human tumor cells. This observed inhibitory activity is not due to cytotoxicity, as demonstrated by light micro¬ scopic studies and indirectly by its stimulatory ef¬ fect on normal human fibroblasts. The TGI's have pre- viously been tested on "normal" epithelial derived cells and simlar results were observed. - 50 -
TABLE 1
EFFECT OF TEMPERATURE ON THE RECOVERY
OF TUMOR GROWTH INHIBITORY ACTIVITY FROM GEL
FILTRATION CHROMATOGRAPHY
PERCENT INHIBITION OF THE TEST CELL
TEMPERATURE OF COLUMN RUN 4*C 23*C
TEST CELL LINE
A549 (Human Carcinoma)
Undiluted 57 30
1/5 62 25
1/25 54 0
1/125 15
Mink lung (CC1 64) Undiluted 91 43 1/5 90 13 1/25 70 9 1/125 31 2
One ml aliquots from gel filtration on fraction 5 (Fig¬ ures 1 & 2) containing 120 micrograms were used to assay TGI activity.
High performance liquid chromatography (HPLC) . TGIs from acid ethanol extracts of human umiblical cords partially purified by gel filtration on a Bio-Gel* P-10 column followed by further purification using reverse - 51 -
phase HPLC (μBONDAPAK* C18 resin) inhibited the growth of both A549 human carcinoma and an established mink lung cell line, CCL 64, but did not inhibit the growth of normal human fibroblasts. Figure 4 illustrates an elution profile of the tumor growth inhibitory activity obtained by HPLC using a linear acetonitrile gradient of lyophilized fraction 4 (19.8 mg/3ml 0.05% triflur- oacetic acid) derived from the Bio-Gel* P-10 chromato- graphic step.
Evidence of two distinct peaks of growth inhibitory activities against both the A549 human carcinoma and the mink cells were observed. The fractions eluting between 28-34% (fractions 13-22) acetonitrile and 35- 39% (fractions 25-31) acetonitrile were pooled sepa¬ rately and rechromatographed on a C-8 μBONDAPAK* column using a linear gradient of 2-propanol.
The first peak of tumor growth inhibitory activity was designated TGI-1 and the second TGI-2. Figure 5 demon¬ strates the elution profile and tumor growth inhibitory activity of TGI-1 (Figure 4). The concentration of injected material was 1.5 mg/1.5 ml of 0.05% trifluro- acetic acid (TFA) . TGI-1 activity elutes between 17- 23% using a linear gradient of 2-propanol (Figure 5) . Similarly, Figure 6 indicates that TGI-2 (0.8 mg/1.8 ml 0.05% TFA) rechromatographed between 23-27% (fraction 17-23) using a linear gradient of 2-propanol. The tumor growth inhibitory activity presented in Figures 4 and 5 are consistently 20% higher against the mink cells than against the A549 human carcinoma cells.
Acid ethanol extracts of human placenta contained TGI activities which, following a gel filtration chromato- graphic step, also eluted between 26-34% acetonitrile - 52 -
of -a C-8 column using a linear acetonitrile gradient containing 0.05% TFA.
Ion exchange chromatography. One gram of a lyσphilyzed acidified, ethanol extract of human umbilical cords was directly subjected to ion exchange chromatography on CM-TRISACRYL* in 0.01 M ammonium acetate, pH 4.0. A linear gradient was applied from 0.01 to 1.0 M ammonium acetate, pH 4.0. Figure 7 demonstrates at least 4 separate tumor growth inhibitory activities designated CM-I, CM-II, CM-II, and CM-IV. CM-I was presently inhibited only the A549 human carcinoma cells at 60% inhibition (Table 2) . CM peaks II and III have similar levels of growth inhibiting activity against both A549 human carcinoma (80 and 63%, respectively) and mink cells (61 and 76%, respectively) . The last peak of activity (CM-IV) demonstrates a specificity in activi¬ ty against mink (i.e. mink cells were more inhibited (95%) than were the A549 human carcinoma cells (69%)). CM-I was not retained and CM-II was slightly retarded by the negatively charged resin since they both were eluted before the gradient was started by 0.01 M ammo¬ nium acetate, pH 4.0.
Although all the proteins that have inhibitory activity are acidic proteins, since they are soluble at pH 4.0 and bind to a negatively charged resin, peaks CM-III and IV are probably slightly more basic since they bind more tightly to the CM-TRISACRYL* resin (eluting at greater than 0.5M ammonium acetate). This is substanti¬ ated by the fact that no TGI activity was retained by a - 53 -
TABLE 2
TGI ACTIVITY FROM CATION EXCHANGE CHROMATOGRAPHY
PEAK OF TGI PERCENT INHIBITION
ACTIVITY OF THE TEST CELL
A549 Mink
CM I 60 0 CM II 80 • 61 CM III 63 76 CM IV 69 95
Protein concentrations for the fractions tested for TGI activity ranged from 15-300 μg.
- 54 -
positively charged resin (i.e. DEAE-TRISACRYL*) (data not shown) . The more acidic inhibitory f ctors appear to be more specific for the A549 human carcinoma cells in their respective activities. These 4 peaks of TGI activities (CM-I, CM-II, CM-III, and CM-IV) have been repeatedly observed (6 separate chromatographic proce¬ dures with CM-TRISACRYL*) . To ensure that the tumor growth inhibitory activities observed in CM-III and CM-IV would not yield material that could be eluted earlier from the column, and also to provide support for the notion that each peak of activity is a separate entity, material from CM-III and CM-IV was pooled, lyophilized, and rechromatographed using CM-TRISACRYL* under the same conditions as the column from which it was derived. CM-III and CM-IV eluted (greater than 0.5 M ammonium acetate) in exactly the same position as did the original column fractions from which they were derived (Figure 10) . The higher tumor growth inhibito¬ ry inhibitory activity against mink cells was preserved and the difference between the inhibitory activity against the two cell lines remained exactly the same at 25-30% around the peak of activity.
Physical and biological characterization of tissue derived tumor cell growth inhibitory activity (TGIs) .
Fractions 2, 4 and 6 derived from gel filtration chro¬ matography by Bio-Gel* P-10 were either heat treated (Table 3) . All fractions tested retained tumor growth inhibitory activity following either heat or acid treatment (see Table 4). Fractions 2, 4 and 6 were found- to inhibit human cancer cell growth and stimulate normal human cell growth. - 55 -
TABLE 3
EFFECT OF HEAT TREATMENT ON TGI ACTIVITY OF FRACTIONS FROM GEL FILTRATION CHROMATOGRAPHY
A549 MINK
CONTROL AFTER HEAT CONTROL AFTER
COLUMN PERCENT TREATMENT PERCENT HEAT FRACTION INHIBITION PERCENT INHIBITION TREAT¬
INHIBITION MENT
PERCENT
INHIBI¬
TION
2 16 32 54 68
4 63 65 78 80 6 70 63 82 71
Protein concentrations for the fractions tested from TGI activity ranged from 15-300 μg.
- 56 -
TABLE 4
PHYSICAL AND BIOLOGICAL PROPERTIES OF TISSUE- DERIVED TUMOR CELL GROWTH INHIBITORY ACTIVITY
(TGI)
Column Fraction
Fraction Fraction Fraction 2 4 6
Stable to 1.0 M acetic acid
Stable to boiling at 100'C Inhibits human cancer cells
Inhibits normal human cells
- 57 -
Second Series of Experiments
Materials and Methods
Isolation of Tissue-Derived Tumor Growth Inhibitors (TGIs) From Tissue Extracts Depleted of Blood, Veins, and Arteries
Veins and arteries were removed from human umbilical cord tissues and the remaining tissues were extensively washed to remove blood prior to acid/ethanol extraction as described under First Series of Experiments.
The buffer for washing and homogenizing the tissue (PBS-PA) consisted of 2 liters of water containing 16 gm NaCl, 2.5 gm Na2HP04.H20, 0.4 gm NaH2P04 *7H20, 116 mg phenylmethylsulfonyl fluoride (PMSF) (Sigma P7627) and 3.3 ml Aprotinin (Sigma A6012 with 19.8 units Try- psin inhibitor per ml in 0.9% NaCl and 0.9% benzyl alcohol), adjusted to pH 7.4 with HCl and NaOH. The extraction buffer consisted of 375 ml of 95% (v/v) ethanol (punctilious, 190 proof, U.S. Industrical Chem¬ icals, #UN1170) , 7.5 ml of concentrated HCl, 33 mg of phenylmethylsulfonyl fluoride (PMSF) (Sigma P-7627) and 1 ml of Aprotinin (Sigma A6012) mixed with 192 ml of distilled water at 4'C. Eight hundred to one thousand grams of frozen human umbilical cords (Advanced Bio¬ technologies*; stored at -80*C) were thawed by immer¬ sion in PBS-PA for two hours at 4'C. Individual umbil¬ ical cords were removed and rinsed with PBS-PA. Veins and arteries were removed from the umbilical cords by dissection at 4'C. The dissected umbilical cord was washed with fresh PBS-PA to remove residual blood and vascular debris. - 58 -
The._iissue was placed in a 4°C chilled Cuisinart food processor (Model DLC-7-PR0) and suspended in 200 ml of 4'C PBS-PA. The suspended tissue was homogenized by the food processor. After the first minute of homoge¬ nization, an additional 200 ml of 4'C PBS-PA was added. The tissue suspension was homogenized for a total of 10 min. at 4'C. The homogenate was transferred to 200 ml centrifuge bottles (Sorvall) and centrifuged at 9000 rpm (RCF=13,000) for 5 minutes at 4'C in a Sorvall RC5B centrifuge equipped with a Sorvall GSA rotor. The supernatant fluid was removed and discarded .and the pellet resuspended to the original homogenate volume with fresh PBS-PA.
The pellet was washed by repeated centrifugation and resuspension as described until the supernatant fluid was clear with no tint of red from contaminating blood or blood products. The resulting washed pellet was white. The washed pellet was resuspended in the buff¬ er for extraction to a final volume of 6 ml per gram of original dissected tissue. The homogenate was trans¬ ferred to a large 4 liter beaker with a 3 inch stir bar and stirred at half of the maximum stirring capacity of a LAB-line Multimagnestir* multimixer. Model #1278. After overnight extraction with stirring at 4'C, the homogenate was transferred to 1 liter centrifuge bot¬ tles (Sorvall) and centrifuged at 3500 rpm (RCF=3570) for 30 minutes at 4'C in a Sorvall RC-3B centrifuge equipped with a Sorvall H-6000A rotor. The supernatant was transferred to a large 4 liter beaker and adjusted to pH 5.0 with the slow addition of concentrated ammo¬ nium hydroxide. With increasing pH, the supernatant remained clear with a slight yellowish tint. A 2.0 M solution of ammonium acetate, pH 5.2, was added in an amount 1% of the total volume. Any precipitate formed - 59 -
by this step was removed by centrifugation at 4500 rpm (RCF=5900) for 4 hours in a Sorvall* RC-3B at 4'C. The supernatant was transferred to large 6 liter flasks to which four volumes of anhydrous ether (-20'C) (Baker #9244-3) and two volumes of 95% ethanol (4'C) were added. The mixture was allowed to stand undisturbed at -20'C for 48 hours to allow the resulting precipi¬ tate to settle.
At the end of the 48 hr precipitation, the material was brought to ambient temperature in a fumehood. Warming of the acidified, ethanol extract to ambient tempera¬ ture enhances the aggregation of the precipitate. The clear organic phase of ether and ethanol was removed by a water aspirator and the precipitate remained in the fume hood for several hours to allow the residual or¬ ganic phase to evaporate. A gentle stream of dried nitrogen gas over the extract accelerated the evapora¬ tion of the remaining organic solvent present with the precipitate. The "dried" precipitate was dissolved in 1.0 M acetic acid and dialyzed extensively against 1.0 M acetic acid (Baker #9507-5) using dialysis membranes with a molecular weight cutoff of 3500 (Spectropor 3*, Spectrum Medical Industries, Los Angeles, CA) . The dialyzed acidified extract was lyophilized in 250 ml Corning conical centrifuge tubes (Corning 25350) and stored as crude acidified, ethanol extract or dialyzed extensively against 20 mM NH.O-C-H-, pH 4.5.
Comparison of tumor growth inhibitory activity in the initial acid/ethanol extract from tissue prepared as described in the First Series of Experiments with tis¬ sue prepared as described above. - 60 -
The ..-improvement in the specific activity and total recovered activity seen when the tissue was prepared as described above is shown in Table 5. The table com¬ pares the yields of protein and tumor growth inhibitory activity from frozen umbilical cord when it was pro- cessed according to the procedures detailed in the
First Series of Experiment (hereinafter "initial pro¬ cedure") and when it was processed as describe above (hereinafter "modified procedure") .
There are several obvious differences in the two proce¬ dures which are of importance for the subsequent puri¬ fication of TGI. For example, based on the wet weight of the tissue, acidified ethanol extraction by the initial procedure resulted in the recovery of 0.33% as protein (3.3 g from 1000 g tissue) whereas only 0.015% as protein (0.05 g from 340 g tissue) was extracted when following the modified procedure. Because the yield of activity was 50% greater (3.3 x 10 units) by the modified procedure than in the initial procedure (2 x 10 units) from 66% less tissue (340g vs lOOOg) the overall efficiency of extraction was improved. The initial procedure yielded 2000 units of tumor growth inhibitory activity per gram of umbilical cord (wet weight) . The modified procedure yielded 9700 units of tumor growth inhibitory activity per gram of umbilical cord (wet weight) . The overall efficiency of extrac¬ tion was improved 5-fold by the modified procedure. Furthermore, since less protein was extracted by acid¬ ified ethanol, the volumes of ether and ethanol required to precipitate the extracted proteins are less. Finally, the amounts of protein and the numbers of different proteins extracted by the modified proce¬ dure are fewer and therefore the subsequent purifica¬ tion procedures to be employed will require less chro- - 61 -
matographic materials, shorter processing times and fewer steps to obtain a pure product.
Fractionation of TGI extracted using the modified pro¬ cedure on the cation exchange resin CM-TRISACRYL* was resolved as a single peak from the bulk of the applied protein when the bound material was eluted by a linear salt gradient from 0-1.0 M NaCl. Figure 9 shows that following application of TGI to a CM-TRISACRYL* column no inhibitory activity was detectable from material not bound to the resin (i.e., fractions 1-24). The linear addition of increasing amounts of NaCl (- -) removed the majority of protein bound to the resin (fractions 25-38) prior to the removal of significant amounts of inhibitory activity ( - - - - - ) fractions 39-49) . The NaCl concentration most effective in removing bound TGI was approximately 0.6 M (fraction 44). Comparison of Figure 9 with Figure 8 suggests that the inhibitory activity eluted in the experiment of Figure 9 most closely corresponds to the elution of CM-III and CM-IV from the CM-TRISACRYL* resin as depicted in Figure 7 since the salt concentrations (NaCl, Figure 9; NH.O - C2H3, Figure 8) for elution are similar (0.6 M, Figure 11; 0.6-0.7 M, Figure 8). The above information also suggests that treatment of the tissue by the modified procedure allows the preferential isolation of a sin¬ gle peak of TGI, thus improving subsequent character¬ ization of the factor.
Another property of the TGI extracted from the tissue by the modified procedure is its failure to bind to anion exchange resin. Figure 10 shows that following adjustment of the pH to 8.0 as described in the figure legend and application of the extract (an identical amount to that used in Figure 9) to the anion exchange - 62 -
resin DEAE-TRISACRYL* resulted in the majority of in¬ hibitory activity associating with nonbinding material (fractions 1-30) , whereas the bulk of the applied pro¬ tein (as determined by absorbance at 280 nm,
( ) bound to the column resin. These results show that under the conditions of Figure 10, contami¬ nating proteins can be removed from TGI and, there¬ fore, that it is a useful procedure for purification of TGI. In addition, these results show that at pH 8.0, TGI is a cation since it does not bind the anion ex¬ change resin. Finally, the results of Figure 10 show that TGI as extracted by the modified procedure is similar in ionic character to those polypeptides (TGI- 1, TGI-2, CM-I, CM-II, CM-III and CM-IV) extracted by ion exchange resin in the initial procedure since none of these bound to the anion exchange resin.
Large amounts of sample can be reproducibly fractionat¬ ed by CM-TRISACRYL*, thus furnishing more TGI for sub¬ sequent purification procedures. In Figure 11, 9.9 mg of tissue extract were applied to a CM-TRISACRYL* col¬ umn (15 ml) under the same chromatographic conditions as shown in Figure 10 for a smaller sample size (2.65 mg protein) on a smaller CM-TRISACRYL* column (5 ml) . Resolution of tumor growth inhibitory activity from the majority of proteinaceous material by a linear gradi¬ ent of NaCl was essentially the same in both experi¬ ments.
Figure 12 shows fractionation of pooled samples from a CM-TRISACRYL column by HPLC on a μBONDAPAK* C18 column. Following application of the sample, no significant inhibitory activity was observed by linearly increasing acetonitrile concentrations from 0-25%. However, tu¬ mor growth inhibitory activity against both A549 (human - 63 -
lung-carcinoma) and CCL 64 (mink lung, 0-0) eluted in a single peak between 28-34% acetonitrile (fractions 21- 31) while the majority of material absorbing at 206 nm was eluted at lower (fractions 11-19) and at higher (fractions 37-50) acetonitrile concentrations.
An apparent molecular weight of TGI (termed TGI-1 and CM-III and CM-IV in the initial procedure) was deter¬ mined by gel filtration chromatography (Sephadex G-50, data not shown) using suitable protein standards of known molecular weights. Thus, in the absence. of cer¬ tain interfering proteins (e.g., hemoglobin) the appar¬ ent molecular weight of TGI has been determined to be between 20 kDa and 30 kDa under nondenaturing condi¬ tions.
The modified procedure detailed herein describes a powerful and simple procedure for removing inert or interfering compounds from the TGI extracts prepared as described in the initial procedure. Furthermore, the modified procedure improves the efficacy of the various chromatographic steps employed in the isolation of TGI by reducing the amount of chromatographic mate¬ rials required thus reducing the preparation time of TGI. In addition, and as shown, extraction of TGI from the umbilical cord as described herein allows TGI and other proteins to chromatograph more reproducibly than in the procedure previously described.
TGI isolated according to the modified procedure has been characterized with respect to the chromatographic features on both reverse phase high performance liquid chromatography and CM-TRISACRYL* ion exchange chroma¬ tography. TGI has been found to behave similarly to or identically with TGI-l (compare Figures 5 and 12) by - 64 -
RPHPJjC, and thus has similar or identical hydrophobic properties and is shown also to behave similarly to or identically with CM-III and CM-IV (compare Figures 9 and 11) on a cation exchange resin, thus having similar or identical ionic properties. It is therefore con- eluded that TGI as isolated in the modified procedure and TGI-1 and CM-III and CM-IV are similar or identical compounds having similar or identical ionic and hydro¬ phobic properties and thus are of similar or identical composition. Therefore, the modified procedure de- scribed herein provides a more efficacious method of obtaining a purer form of TGI for further analysis and characterization.
Third Series of Experiments
Materials and Methods
Acidified ethanol extraction and ether/ethanol precipi- tation
The buffers and equipment used were exactly as de¬ scribed in the second series of experiments, for each relevant step in the procedure. Two hundred to four hundred grams (200-400 gr.) of human umbilical cord, either dissected free of vasculature or left intact and chopped into 1/2 inch pieces were washed free of the majority of blood in PBS-PA at 4'C. The cord was drained by gravity through a sieve and transferred to a chilled food processor at 4'C for homogenization in a maximum volume of 200 ml of PBS-PA. The tissue was homogenized for fifteen minutes and washed free of blood by repeated centrifugation in 200 ml plastic bottles at 5,000 rpm using an RC-5B centrifuge
(Sorvall) equipped with a GSA rotor (Sorvall) for ten - 65 -
minutes with PBS-PA, until the optical density at 280 nm was less than 0.05 and the pellet obtained, was essentially white in color. The pellet was trans¬ ferred to a 2 liter glass beaker and suspended in ex¬ traction buffer, as described in the first series of experiments, at a final volume of 3 ml per gram of the original wet weight of tissue and stirred for twenty- four hours at 4°C. The suspension was centrifuged in a 1.0 liter plastic centrifuge bottle using a RC-3B cen¬ trifuge (Sorvall) equipped with a H6000A rotor (Sorvall) for 30 minutes at 3,500 rpm. The resulting supernatant was transferred to a 2 liter beaker and the pH adjusted first to 5.0 with concentrated ammonium hydroxide, and then to 5.2 by the addition of 2 M ammo¬ nium acetate to a final concentration of 1% of the total volume. The solution retained a clear or very slightly yellow tinted appearance.
Following ether/ethanol precipitation, as described previously, the supernatant was siphoned from the flask to within 3/4 of an inch above the bottom of the flask containing the flocculent precipitate. The precipitate and remaining ether/ethanol solution was centrifuged in a GSA rotor at 5,000 rpm for 20 minutes in 250 ml plas¬ tic conical bottles (Corning #25350) in a Sorvall RC-5B centrifuge. This step in the procedure was designed to decrease the loss of TGI's from the ether/ethanol su- peraatants immediately above the precipitate. The resulting pellet was suspended in 1.0 M acetic acid and the flask containing the ether/ethanol precipitate was also washed with 1.0 M acetic acid to remove any TGI protein remaining on the wall of the flask. The opti¬ cal density at 280 nm was between 0.5 and 1.0 and the final volume did not exceed 100 ml for each prepara¬ tion. The TGI containing protein solution was dialyzed - 66 -
for .one day against 1.0 M acetic acid and for one to two days against two changes of 4.0 M ammonium acetate, pH 4.5 using dialysis membranes with a molecular weight cutoff of 3,500 (Spectropor 3).
It should be noted that tumor growth inhibitory activi¬ ty can also be obtained from acidified ethanol extrac¬ tion of the tissue with omission of the ether-ethanol precipitation step. However, the specific activity of these preparations is 50% less and the total yield of activity 10-30% less than "standard" preparation uti¬ lizing the ether-ethanol precipitation.
Hydrophobic Interaction Chromatography
The dialyzed protein was subjected to hydrophobic in¬ teraction chromatography using phenyl-Sepharose* (Phar¬ macia) as the chromatographic resin. The phenyl-Sepha¬ rose* was equilibrated with 4.0 M ammonium acetate, pH 4.5. Following dialysis (at least 24 to 48 hours), the conductivity and pH of the protein solution was mea¬ sured and dialysis terminated when the conductivity of the dialysate and equilibration buffer were the same. The protein was pumped onto (Microperplex* pump #2132 - LKB) the resin contained in a 1.6 x 2.0 cm chromatogra- phy column (K-20-Pharmacia) using 1 ml of resin per 2.0 mg of protein, at 1.0 ml per minute. The column was washed until the OD280 was zero and tumor growth inhibitory activity eluted from the column using a decreasing gradient from 4.0 M to 0.04 M ammonium ace- tate, pH 4.5 containing an increasing concentration of ethylene glycol (Mallinkrodt) from 0 to 50%. The total volume of the eluting gradient was 10 times the total volume of the resin used for each individual prepara¬ tion. The bound protein was eluted over approximately - 67 -
fifty fractions. Ten microliters of sample were trans¬ ferred to a plastic tube (polystyrene) containing 50 micrograms of BSA, for assay of inhibitory activity against both the mink CCL 64 and A549 cell lines, as described in the first series of experiments.
As seen in Figure #13, the tumor growth inhibitory activity began eluting from the column at 1.5 M ammoni¬ um acetate, 31% ethylene glycol and was completely eluted from the column by 40 mM ammonium acetate and 50% ethylene glycol. The biologically active fractions were pooled, dialyzed against 0.1 M acetic acid, and lyophilized in a polypropylene 50 ml tube (Scientific Products #C2390-50) or siliconized glass lyophilization flask (Virtis) .
Reverse Phase High Pressure Liquid Chromatography
The lyophilized biologically active material was dilut¬ ed in 1.0 to 3.0 ml of 0.05% trifluoracetic acid (TFA) containing 10% acetonitrile, placed in a 16 x 100 mm siliconized disposable glass tube, sonicated for two minutes, centrifuged at 3,000 rpm for 10 minutes (Beck¬ man Model TJ-6) to remove insoluble material, and sub¬ jected to reverse phase, high pressure liquid chro¬ matography (RPHPLC) using a μBondapak* C18 resin (Waters Assoc. 0.39 x 30 cm, PN 27324). No more than 1 mg of TGI was applied to each column such that the number of column procedures necessary for each preparation de¬ pended on the total protein concentration of the active fraction obtained following chromatography by phenyl- Sepharose. This amount was approximated at OD2gQ using a value of 1.0 optical density units equal to 1.0 mg/ml of protein. The protein was eluted from the column, at 1.0 ml per minute in a stepwise, gradient fashion us- - 68 -
ing "-100% acetonitrile containing 0.05% TFA as the eluting mobile phase. The gradient was increased to 25% acetonitrile (CH3CN) in 15 minutes, eluted for 10 minutes at 25% (CH3CN) , increased to 27% in two min¬ utes, 17% for 10 minutes, increased to 28% in two in- utes, 28% for 10 minutes, increased to 30% over 10 minutes, resulting to 44% in 10 minutes, and to 100% in 10 minutes. The absorbance of protein was monitored at 210 nm and 0.005 ml aliquots were removed from every other 1.0 ml fraction to assay for tumor growth inhibi¬ tory activity against both CCL 64 and A549 cell lines. Tumor growth inhibitory activity eluted initially at 27% acetonitrile and continued to elute at 28-30% ace¬ tonitrile as shown in Figure #14A & 14B. At every step in the purification, the biologically active fractions were pooled and subsequently assayed for total tumor growth inhibitory activity by removing an aliquot and multiplying the activity obtained in the assay by the appropriate dilution factor. The quantity of tumor growth inhibitory activity present in the pool was compared to an aliquot of starting material. Thus, column recoveries of activity and protein (where mea¬ surable) could be obtained.
The area designated with arrows (fractions 47-51) in Figure 14A derived from two separate C18 chromatograph¬ ic procedures (derived from one phenyl-Sepharose col¬ umn, from one isolation) was pooled and subjected to SDS-PAGE both under non-reducing conditions (Figure 15A) and in the presence of 0.5% ø-Mercaptoethanol (reducing conditions) (Figure 15B) . This area of the chro atogram (Figure 14A) demonstrated the highest biological activity and lowest amount of contaminating proteins (highest specific activity and lowest absor¬ bance at 210 nm) . Experimental details of SDS-PAGE are - 69 -
reported in Figure #15. In lane 2, under non-reducing conditions (Figure 15A) , the biologically active frac¬ tions are shown to contain at least 4 major proteins bands. Lane 1 contains a purified preparation of TGF-ø derived from platelets (provided by Bruce Magun, Oregon State Health Science University, Portland, Oregon) . The biological activity that has been ascribed to this protein is the ability to confer anchorage independent growth to normal rat kidney cells (NRK) in a soft agar assay, only in the presence of a growth factor, such as EGF at 2.0-2.5 ng/ l. Thus, its growth promoting ac¬ tivity is directly dependent on other bioactive pro¬ teins (Roberts et al., Cold Spring Harbor Conf. Cell Proliferation, 9_: 319-332 (1982)); Anzano et al., Anal. Bioche . 125: 217-224 (1982) ; Cancer Research 42: 4776-4778 (1982).
In our assay for tumor growth inhibitory activity, TGF- β was shown to posses 1-30 units of inhibitory activity per ng of protein. By comparison it appears that one of the protein bands in the TGI preparation Figure 15A (lane 2) also migrated in the same position of approxi¬ mately M = 25 kDa as the TGF-0 , (lane 1) . The same samples electrophoresed in the presence of 5% β- mercaptoethanol, showed that the protein band that had migrated at M 26 kDa disappeared and a new band was evident at approximately 12.5 kDa Figure 15B (lane 2). TGF-0 Figure 15B (lane 1 also changed its migratory position to 13 kDa following reduction. All other proteins in the TGI containing sample remained in the same position of migration and thus were insensitive to reduction. The units of inhibitory activity applied to the gel for each sample was approximately 1,000-1,500 (50 ng) for TGF-0 in lane 1 and 10,000 to 20,000 for TGI in lane 2 (Figure 15A & B) . - 70 -
Further purification of the TGI biologically active fractions derived from the RPHPLC C18 chromatographic procedure was accomplished by RPHPLC using a CN μBONDAPAK* column (0.39 x 30 cm Waters PN 84042) (Figure #16) . The biologically active fractions were lyophi¬ lized in 16 x 100 mm siliconized glass tubes, dissolved in 1.0-3.0 ml 0.05% TFA containing 10% propanol and applied to the column. Column elution was achieved at 1.0 ml/minute by using a linear gradient of 2-propanol from 10 to 20% in ten minutes, followed by 20 to 50% in fifteen minutes (0.6% /min.), and finally from 50-100% in 20 minutes.
Iodination of Biologically Active Fractions for Analy¬ sis by SDS-PAGE
Active, lyophilized fractions 56, 58, 59-65, 66-68, illustrated in Figure #18, and approximately 4 ng of TGF-0 were iodinated by the chloramine T method (McConahey, P.J. and Dixon, F.J. (1966) Int. Arch, of Allergy 2_9, 185-189) . Each fraction was resuspended in 100 microliters of 0.1 M acetic acid, and 3 microliters of 1.5 M Tris, pH 8.8 was added to adjust the pH to 7.0. Ten microcuries of carrier-free sodium iodide I Na was added, followed by 2 microliters of chlora¬ mine T (Sigman #C9887) at 1.0 mg/ml. The tube was rocked for one minute and the reaction terminated by the addition of 2 microliters of sodium metabisulfite (Sigma #S9000) at 1.0 mg/ml. After two minutes 0.05 ml of each sample was transferred to a siliconized glass tube (10 x 75 mm) containing 0.05 ml of twice concen¬ trated sample buffer plus 5% ø-mercaptoethanol for SDS- PAGE slab gel electrophoresis. - 71 -
The -remainder of the sample was diluted in 0.05 ml of twice concentrated sample buffer and approximately 200,000 TCA precipitable radioactive counts were ap¬ plied to individual lanes for SDS-PAGE, Figure #17) . The gel was stained with 0.125% Coomassie Blue for 10 minutes to fix the protein in the gel, and exhaustively destained to remove free radioactive iodine. When the destain solution did not contain detectable label as judged by counting 1.0 ml of destain solution in a gamma counter (Beckman, Riaga ma #1294), the gel was dried using a gel dryer (Hoeffer-SE1150) and exposed to x-ray film (Kodak-XAR) for autoradiography (one week) .
All lanes to which biologically active TGI was added contained a faint band of protein migrating at M 24 kDA. This protein band also migrated directly in a horizontal plane with the M 26 kDa band in lane 7 containing 256 inhibitory units of TGF-β derived from platelets (Figure #17, lane 7 arrow).
In lanes 1, 2, 3 and 5 containing approximately 180, 2,000, 46 and 408 units of tumor growth inhibitory activity respectively, the M 25 kDa band was observed while lanes 4 and 6, which did not possess tumor growth inhibitory activity, did not contain this protein band. Lane 2, which contained the most active fractions (from Figure 16) , showed two faint bands at M 26 kDa and 30 kDa. Lane 3 appears to have only one band of M 26 kDa.
Following the last step of purification of TGI, protein concentration could not be measured because it was below the detection level using standard means of mea¬ surement. Therefore, the bands migrating at M 26 kDa (from lanes 2, 3 and 7) were excised from the dried gel - 72 -
and counted in a gamma counter in order to extrapolate the protein concentrations applied in lanes 2 and 3. Since it was known that 0.4 ng of TGF-ø was applied to the gel which had 5,593 cpm at M__ 26 kDa, then 362 (lane 2) and 195 (lane 3) cpm at the position of 26 kDa equals 26pg and 14pg, respectively. These calculations assume that the number of tyrosines and extent of iodi- nation of each tyorsine were the same.
Although the presence of the M 26 kDa band was consis¬ tent with the presence of tumor growth inhibitory ac¬ tivity (Figure 17) , the quantity (units) of activity, especially in lane 2, did not correlate with the amount of TGF-0 protein, as judged by the intensity of iodina¬ ted protein applied to the gel (0.4 ng) . Thus, TGI demonstrated at least one log more inhibitory activity than TGF-ø.
Since a broad peak of activity was obtained by RPHPLC C18* chromatography, Figure 14A; and in Figure 14B it appeared that there may be two peaks of activity, one at 27% and at 28-30%, the area designated by these separate peaks were pooled and chromatographed sepa¬ rately by RPHPLC using a CN column. The slope of the propanol gradient was changed so that the increase in increments of 2-propanol was 0.375% per minute, instead of 0.6% per minute. The shallow gradient was devised to achieve a better separation of active proteins elut¬ ing between 40-45% 2-propanol.
Figure #18 illustrates the elution profile of the CN column of active fractions pooled at 27% acetonitrile (Pool I) from the previous C18 column. The most active fraction (fraction #14) eluted at 40-41% 2-propanol. A lower amount of activity was seen eluting after this - 73 -
peak-r as a double peak at approximately 44% 2-propanol. Similarly, rechromatography of the active material derived from the peak of activity pooled at 28-30% acetonitrile (Pool II) from the C18 column, demonstrat¬ ed peak of activity corresponding to the elution from the CN column at 44% 2-propanol (Figure #19) . The first pool (Pool I) of activity eluting at 27% acetoni¬ trile contained some active material from Pool II elut¬ ing at 28-30% acetonitrile, thus a small quantity of this peak of activity was revealed in the chromatogram of Pool I at 40-41% 2-propanol (Figure #18) . Most significantly the further purification of TGI has per¬ mitted resolution of two major peaks of TGI activity, eluting at 40-41% for Pool I and 44% for Pool II.
Pool I from the C18 column contained 82% more total inhibitory activity than Pool II.
Figure #20 is a tracing of the peaks of activity from the two separate chromatographs Figures 20 (Pool I) , and 21 (Pool II). This figure (#20) illustrates two distinct peaks of inhibitory activity as the different active fractions from the C18 column Pool I and Pool II.
It was found that preservation of TGI biological activ¬ ity following chromatography through the C18 column was better achieved if the active fractions were not lyoph¬ ilized prior to CN chromatography. Therefore, the samples were concentrated by partial lyophilization (not to completion) and stored at -20'C. 74 -
II. Tumor Growth Inhibitory Activity from the Con¬ ditioned Media of Various Tumor Cell Lines
Effect of Dithiothreitol on TGI Activity from Tumor Cell Conditioned Media
Human tumor A431 (epidermoid carcinoma), A673
(rhabdomyosarcoma) and T24 (bladder carcinoma) cells
2 were grown to confluence on T150 (150 cm ) flasks 20 ml of complete growth medium containing DMEM supple¬ mented with 10% fetal bovine serum. The confluent monolayers were rinsed twice with Dulbecco's phosphate buffered saline and incubated in 10-12 ml serum-free DMEM per flask for 24 h. Conditioned media (100-115 g ml) was collected from 1-4 x 10 cells.
An erythroleukemia cell line, K562, was grown in sus¬ pension to a cell density of 10 cells per ml and one liter of serum-free conditioned media was collected. Cellular debris was removed from the conditioned media (RC-5B GSA rotor-Sorvall) by centrifugation at 800 rpm for 60 min. at 4'C. The supernatant was treated with l ml of 1 M acetic acid per 100 ml of conditioned media, extensively dialyzed in Spectropor 3 dialysis tubing (Spectrum Medical Laboratories) against multiple chang¬ es of 1 M acetic acid, and lyophilized. The lyophi¬ lized, acid-treated conditioned media was resuspended in 4 mm HCl at a volume of 5.0 ml for A431, A673 and T24, and 1.5 ml for K562 derived media. Insoluble material was removed by centrifugation in a RC-5B cen¬ trifuge (Sorvall, SA 600 rotor) at 3400 rpm for 15 min. at 4'C and the supernatants transferred to 1.5 ml microfuge tubes. Following centrifugation in an Eppendorf microfuge for 15 min. at 4'C, the superna¬ tants were transferred to 1.5 ml microfuge tubes for - 75 -
storage at -20'C. Protein concentration was determined by absorbance at 280 nm. The tumor growth inhibitory activity of individual samples was tested for sensitiv¬ ity to reduction by dithiothreitol (DTT) . An aliquot each of 0.5 ml was transferred to two tubes containing 4.5 ml of 0.1 M NH4HC03. One tube received a final concentration of 65 mM DTT, and both tubes were incu¬ bated for 2 hours at room temperature. The incubated mixture was then transferred to Spectropor 6 dialysis tubing and dialyzed against 1 M acetic acid for 2 days to remove DTT. The dialyzed samples were then assayed for tumor growth inhibitory activity as described in initial procedures. The effect of DTT on TGI activity derived from conditioned media from the A431, A673, K562 and T24 cell lines using mink cells, CCL 64, and A549 cells as target cells is summarized in Tables 6 and 7, respectively. The table shows the tumor growth inhibitory activity from conditioned media from A673, K562, and T24 against both mink and A549 cells was lost following reduction (Table 6) , whereas the tumor growth inhibitory activity from the conditioned media of A431 cells, which showed preferential inhibitory activity against A549 cell, was only slightly reduced following reduction (First column. Table 7) .
- 76 -
Revβgse Phase HPLC of A431 Conditioned Media g Lyophilized conditioned media from 4 x 10 A431 cells
(110 ml) was processed as previously described, except 5.0 ml of 4 mM HCl was used to solubilize the lyophi¬ lized material. The insoluble precipitate was removed by centrifugation as described and protein concentra¬ tion determined. An aliquot of 0.2 ml (680 μg protein) was added to 1.8 ml of 0.1 M ammonium bicarbonate or this same buffer containing 65 mM DTT. Following incu¬ bation for 2 hours at room temperature, both the re¬ duced and non-reduced samples were lyophilized and resuspended in 2.0 ml of 0.05% trifluoroacetic (TFA) for RPHPLC. Following injection onto a C18 semi-pre¬ parative column, the proteins were eluted at 1.0 ml per minute using a linear gradient of acetonitrile from 0-50% in 50 minutes. An aliquot of 1.0 ml was removed from each 2.0 ml fraction to assay for growth inhibito¬ ry activity against both mink and A549 cell lines as described in the initial procedures. Figure #21 illus¬ trates that there are two peaks of inhibitory activity, one that elutes at 25% acetonitrile, which inhibits both CCL 64 and A549 cells, and one that elutes at 30- 36% acetonitrile, which shows preferential inhibitory activity toward the A549 cell line. Following DTT treatment (Figure 22) , the first peak of activity (25% acetonitrile) is no longer present, while the activity that is selective for A5 9 cells retained activity.
Conclusions from the "Third Series of Experiments"
I. It was already demonstrated by the Second Se¬ ries of Experiments referred to as the "modification procedure" that removal of blood and vasculature from umbilical cord yielded approximately a 100-fold in- - 77 -
crearse in specific activity of the TGI over First Se¬ ries of Experiments (Table 5) . In the Third Series of Experiments, referred to as "alternate procedure", it was shown that only removal of blood, but not the vas- culature was necessary to obtain TGI with the same average degree of specific activity as indicated by the Second Series of Experiments. In fact, the vascular tissue from umbilical cord, dissected free form the stromal tissue, demonstrated tumor growth inhibitory activity of similar activity to the umbilical stromal tissue alone (data not shown) . It was further shown that tumor growth inhibitory activity could be recovered without ether/ethanol precipitation of the extracted material.
The volume of acidified ethanol per gram of tissue used for extraction was 50% less than described for both the initial procedure and modified procedure. Thus, the total volume of extracted protein was less, therefore requiring 1/2 the amount of ether and ethanol used for precipitation. This minimized the amount of protein that would remain on the flask walls. Moreover, the amount of 1.0 M acetic acid necessary to dissolve the precipitate and wash the flask was smaller so that final volumes were kept to a minimum. The obvious advantage is the minimization of protein/activity loss, thereby creating a more efficient method of extraction, including less reagents required. Also, chopping whole cord rather than dissecting cord shortened the tedious preparation time considerably. The average specific activity of the final preparation derived from 200-400 grams of umbilical cord (wet weight) prior to further purification by chromatographic techniques wwaass approximately 1-3.0 x 10 units/40-50 mg (see Table 8). - 78 -
These results are within the range of the experimental results reported for the "modified procedure" and therefore, represent the same range of improvement in protein recoveries and specific activities compared to the initial procedure (Table 5). Thus, the overall efficiency of extraction was improved approximately 5- fold as reported in the "modified procedure".
Table 8 summarizes the current procedure utilized to obtain active TGI from human umbilical cord. Between 60 to 100% recovery of units of activity was observed through the first two steps of purification (HIC and RPHPLC on C18) . This represents a 40,000 increase in specific activity of 1. x 10 units/microgram. (2.3 x 10 total units from 300 g wet umbilical cord) . It was observed that contaminating proteins probably aided in the stabilization of biological activity of TGI, be¬ cause as the purification ensued, activity became more labile. The greatest loss of recovery occurred follow¬ ing lyophilization of the active fraction obtained after RPHPLC on the C18 column. This greatly reduced the total number of units applied to the CN column in the final step of purification. This loss was amelio¬ rated by concentrating the active fractions by lyophi¬ lization, but not to completion. The recovery of units from this final step of purification was between 60- 100%.
Previously in the "initial procedure", chromatograms varied foremost of the preparations, thus, causing difficulty in devising subsequent steps for improve¬ ment. The current methodology described in both the modified and alternate procedure demonstrate reproduc- ibility of all chromatograms, yields of proteins, and yields of activity at each step, utilizing material - 79 -
derived from individual umbilical cord preparations. This improvement is a direct result of the removal of hemoglobin (denatured) , before acidified, ethanol ex¬ traction, and the more efficient removal of other con¬ taminating proteins during the first chromatographic step using phenyl-Sepharose.
The use of hydrophobic interaction chromatography (HIC) using phenyl-Sepharose as the first chromatographic step in the purification procedure proved to be a major improvement in overall yield of activity (total units) and specific activity (units/mg) . Following ion ex¬ change chromatography by CM-Trisacryl*, a specific ac- ti .vi.ty of 4.2 x 104 units per mg was obtained, while phenyl-Sepharose chromatography produced TGI with a specific activity of 1.07 x 10 u/mg. At this step, phenyl-Sepharose chromatography introduced approximate¬ ly a 20-fold purification into the procedure. However, the TGI containing protein obtained by phenyl-Sepharose chromatography demonstrated 26 times greater specific activity than TGI containing material derived from CM- Trisacryl chromatography.
Experiments have been devised to improve the overall yield (inhibitory units) and specific activity of the TGI-containing protein so that there would be adequate biologically active material present to subject the protein to as many steps necessary for purification to homogeneity. Both the removal of blood in the "modifi¬ cation procedure" and the use of phenyl-Sepharose chro- atography in the "alternate procedure" have aided greatly in accomplishment of this goal. The introduc¬ tion of phenyl-Sepharose chromatography into the puri¬ fication procedure has provided material with higher e. specific activity (1-2 x 10 units/microgram) which - 80 -
permitted further purification of a minimal amount of starting material (wet tissue weight) and requiring less steps toward the final purification to homogene¬ ity. One peak of TGI activity, eluting at 1.5 M ammo¬ nium acetate, 37% ethylene glycol, was obtained follow- mg phenyl-Sepharose chromatography (Figure 13) . This was also a major improvement in the isolation of TGI in the "modification procedure" using CM Trisacryl*, com¬ pared to the initial procedure (Figure 7) .
Another improvement introduced into the purification of TGI's by the "alternate procedure" was the use of a stepwise elution by acetonitrile from C18 RPHHPLC (Fig¬ ure 14A & 14B) rather than a linear gradient used in the "initial and modification procedures" (Figure 12) . Elution of the column in this fashion allows approxi¬ mately 90% of the biologically inactive contaminants to be separated from the major peak of activity. Of most significance is that two hundred to four hundred grams of wet cord material provides sufficiently less protein following chromatography on phenyl-Sepharose, to apply the entire preparation to a maximum of three and a minimum of two RPHPLC C18 and analytical columns using no more than 1.0 mg for each (Figure 14A & 14B) .
The ability to obtain larger quantities of a more high¬ ly purified biologically active protein following RPHPLC on a C18 resin is directly related to the isola¬ tion of tumor growth inhibitory activity of high spe¬ cific activity from phenyl-Sepharose chromatography. Following chromatography by CM-Trisacryl* (modification procedure) , only 20% of the total biologically active fraction could be subjected to one RPHPLC (C18) , while generally 50% of the "total biologically active, pooled fraction from phenyl Sepharose chromatography could be - 81 -
app ied at one time to a C18 column. In these individ¬ ual comparative experiments, the starting material for chromatography using CM TRISACRYL* was 9.9 mg and for phenyl-Sepharose was 42 mg, thus if the same amount of starting material was used for CM-TRISACRYL*, only 4.7% of the total preparation could have been utilized in the following C18 step. Because a greater amount of inhibitory activity could be applied to the C18 column, 100 times less sample (0.005 ml compared to 0.5 ml), was used to achieve the same degree of inhibitory ac- tivity. At this point in the procedure, the most bio¬ logically active fractions were resolved into six major protein bands by SDS-PAGE using silver stain.
Following HPLC on the C18 column, protein concentration could not be determined because the amount of avail¬ able protein was below the resolution of standard tech¬ niques (0D28- or Lowry) . Thus, it was assumed that protein concentration was less than 20 micrograms/ml. To further purify TGI, the active fractions were pooled, lyophilized and applied to a RPHPLC CN column. Using a 2-propanol gradient of 0.6% increase in solvent per minute, the activity was shown to be displaced to the right of most of the protein (Figure 16) . Various active fractions were iodinated and separated by SDS- PAGE. The fractions demonstrating the most biological activity (Figure 16, Fraction 59-65) illustrated in lane 2, contained two isotopically labeled bands, one of 25 kDa and one of 30 kDa and in lane 3 fractions 66- 68 contained a homogeneous band at 25 kDa. Fraction #58 lane 7 is active but contains at least 5 bands. Fraction #56 which is the major peak of protein and is not biologically active contained all of the protein bands in fraction #58 except that 26 kDa band (Figure 17, lane 1) . - 82 -
Three major conclusions can be deduced from the gel presented in Figure 17. One, a 26 kDa protein is al¬ ways present in fractions containing biologically ac¬ tive material and similarly it is always absent in fractions that are not biologically active. Two, the TGI demonstrates a similar qualitative activity to an ubiquitous protein derived from platelets and other tissues designated as TGF-ø , in that it migrates by SDS-PAGE as a protein of M 25 kDa as shown in Figures 15B and Figure 17. Three, the active fractions demon¬ strating the most biological activity in Figure 17, lane 2, (2,068 units), does not compare intensity (iodinated protein) to the appearance of the 25 kDa band for TGF-0 , observed in lane 7 containing 256 units of inhibitory activity. This implies a quantita¬ tive difference in specific activity.
The use of a stepwise gradient elution from the C18 column with acetonitrile resolved two peaks of activi- ty, one eluting at 27% and one at 28-30% (Figure 14A & 14B) . Following the combination of individual frac¬ tions into two separate pools, Pool I (27%) and Pool II (28-30%) , from a column demonstrating a similar profile as shown in Figures 14A & 14B, the pools were applied to a RPHPLC CN column using a more shallow gradient than shown in Figure 16 (0.37%/min. compared to 0.6%/min.). Pool I eluted at 40-41% 2-propanol (Figure 18) and Pool II at 44% 2-propanol (Figure 18) . It is important to note that, as expected, the more hydrophobic protein eluting from the C18 column (Pool II) continued to elute more hydrophobically from the CN column. Thus, two distinct peaks of growth inhibitory activity have been obtained using the "alternate proce¬ dure" of protein purification. The first peak of ac- - 83 -
tivity. Pool I, contains 82% more inhibitory units than Pool II.
A purified protein, derived from platelets, designated as TGF-ø, is biologically active in our inhibitory assay but consistently possesses 10-100 fold less ac¬ tivity than Pool I. Since activity in all cases. Pool I, Pool II, and TGF-0 is consistent with presence of a protein band of M 26 kDa (Figures 15 and 17), one can assume that all these proteins may be similar or belong to a family of growth inhibitory and/or growth modulat¬ ing proteins. Alternatively, because of the differen¬ tial elution of these proteins on both C18 and CN res¬ ins, and the greater specific activity of the TGIs, the TGIs may be entirely different than TGF-β (elevation of TGF-β profile not shown) . Further biochemical charac¬ terization (amino acid sequencing) should resolve this question. In conclusion, it appears that the TGI's are better than (inhibitor activity) and different from (eluting position) TGF-0 derived from platelets used for comparison by this study.
The conditioned media from A431 contained two types of growth inhibitory activity. One TGI elutes at approxi¬ mately 25% acetonitrile and inhibits both A549 and CC1 64 mink cells. The selectivity of inhibition of this TGI is similar to what is observed for TGI-1 and TGI-2 in human umbilical cord extracts. The second TGI elut¬ ing between 30-36% acetonitrile shows a greater speci¬ ficity for inhibiting A549 cells over mink cells.
Applicants presently contemplate a family of discrete entities which share certain common characteristics. Each family member is a polypeptide dimer, bound by disulfide bonds, with a molecular weight of 26,000 - 84 -
daltons which demonstrates tumor growth inhibitory activity against both a mink lung cell line (CCL 64) and a human carcinoma cell line (A549) in monolayer cultures.
The family comprises the novel discrete factors TGI-1 and TGI-2 and the previously disclosed factors TIF-1 and TGF-0. It is presently contemplated that TIF-1 and TGF-0 are the same polypeptide which may be distinct from both TGI-1 and TGI-2. TGI-1 and TGI-2 being discrete cannot both be the same as TGF-0 . TGI-1 and TGI-2 each have a specific activity greater than TGF-ø . Both TGI-1 and TGI-2 elute differently from TGF-0 on high pressure liquid chromatography on a CN column with 2-propanol. Further, TGI-1 and TGI-2 elute differently from each other on high pressure liquid chromatography on a CN column with 2-propanol.
Two separate factors CM-1 and a polypeptide derived from conditioned media of human tumor cell line (A549) are also disclosed. Because both have the property of substantially inhibiting the growth of a human tumor cell line (A549) but hot of an established mink lung cell line (CCL 64) it is contemplated that CM-1 may be the same as the TGI derived from conditioned media from A431 cells. It is also contemplated that CM-1 may be similar to TIF-2 of an earlier patent. - 85 -
Fourth Series of Experiments
Isolation and Sequence Determination of a Gene Encoding a Protein Having Tumor Growth Inhibitory Activity
Cloning of TGF-01
The sequence of TGF-01 cDNA is published (Derynck, R. , et al.. Nature, 316, 701-705). Based on this sequence, we synthesized a 25 mer oligonucleotide probe (TGGTGTCCAGGGCTCGGCGGTGCCG) which was used to isolate a TGF-01 cDNA from a commercial lambda-gtll human placen¬ ta library (Clonetech*) . For these, and the following experiments, standard molecular biological techniques were employed (e.g., Maniatis, T. , et al. (1982) Molec- ular Cloning, a laboratory manual. Cold Spring Harbor Lab) . By restriction mapping and partial sequence analysis, the clone was shown to contain the complete coding sequence for the 390 amino acid TGF-øl precur¬ sor but to lack some untranslated sequences from both the 5' and 3' ends (439 bp from the 5' end and approxi¬ mately 200 bp from the 3' end).
Bacterial Expression of TGF-01
Segments of the TGF-øl gene were expressed in E_-_ coli as trpE::TGF- l fusion proteins using two related in- ducible expression vectors: pATH II (Spindler et al. (1984) J. Virol. 49: 132-141) and pKS-1 (a pATH 11 derivative). The pATH ll::TGF-øl construct was made by cloning a Bal I-Sal I fragment into the multiple cloning site of pATH 11. The Bal I-Sal I fragment encodes amino acid residues 249-391 of TGF-øl. The pKS-1: :TGF-øl construct was made by cloning a Nae I-Sal I fragment into the multiple cloning site of pKSl. - 86 -
The.^Nae I-Sal I fragment encodes the TGF-øl amino acid residues 25-391 (Figure 23) .
Bacteria E^ coli RRI) containing the expression plasmids were grown overnight into l ml M9 media (for 1 liter: 10 g Na2HP04 & H20, 3 g KH2P04, 0.5 g NaCl, 1 g NH.C1, 5 g casamino acids, 1 ml MgS04, 0.2 ml 0.5 M CaCl2, 5 ml 40% glucose, 10 ml 1 mg/ml thiamine B.) supplemented with 50 μg/ml ampicillin and 20 ng/ml tryptophan. A half ml of the overnight culture was diluted into 5 ml M9 media supplemented with ampicillin and grown for one hour at 30"C with great aeration. The expression of the protein was induced by adding 12.5 μl of 2 mg/ml indole acylic acid (IAA) and grown another 2 hours at 30'C. One ml was centrifuged (su- pernatant is the soluble fraction) and the pellet was resuspended in 100 μl TEN buffer (50 mM Tris-HCl pH 7.5, 0.5 mM EDTA, 0.3 M NaCl). Then subsequently were add¬ ed:
10 μl lOmg/ml lysozyme, 15 minutes on ice. - 2 μl 10% NP-40, 10 minutes on ice.
150 μl 1.5 M9 NaCl, 12 mM MgCl2 and 0.4 μl 1.9 mg/ml DNase, 1 hour on ice.
Then the insoluble fraction was collected by spinning 5 minutes in a microfuge. The pellet was washed twice with 100 μl TEN buffer and finally dissolved in 50 μl 0.01 M Na phosphate pH 7.2, 1% -mercaptoethanol, 1% SDS, 6 M urea and incubated 30 minutes at 37*C.
Following standard SDS-PAGE and Coomassie Blue stain¬ ing, the constructed expression plasmids were found to produce fusion proteins with the predicted molecular weights (53kd and 45kd) . Both proteins in a Western Blot (Towbin, et al. (1979) Proc Natl. Acad. Sci. 76: - 87 -
4350-4354) reacted with a commercial (R and D Systems Inc.) polyclonal antisera against TGF-βl .
Cloning of the Gene Encoding the Protein Having Tumor Growth Inhibitory Activity
To identify sequences with homology to TGF-øl a Pvu II- Pvu II probe, containing most of the mature form of the TGF-øl cDNA sequence, was 32P labelled and used to screen a Southern blot (Southern, (1975) J. Mol. Biol. 98: 503-517) of total human DNAs digested with Eco RI, Hind III or Sst I using standard methods. In each digest, two bands were present at a low stringency wash (2.5 x SSC, 65'C) (Figure 24). When the wash stringen¬ cy was increased (0.01 x SSC, 65'C) only one hybridiz¬ ing band remained in each digest (Figure 24). The strongly hybridizing band is likely TGF-01, and the weakly hybridizing band is a related gene which also encodes a protein having tumor growth inhibitory ac¬ tivity. The nucleotide sequence encoding this protein having tumor growth inhibitory activity and its amino acid sequence are shown in Figure 29.
To isolate the gene encoding the protein having tumor growth inhibitory activity with homology to TGF-øl, the Pvu I-Pvu II probe from the TGF-01 clone was used to screen a human phage library constructed from the DNA of a chronic myelocytic leukemia cell line (K562) . Two genomic loci, which correspond to TGF-øl and the relat¬ ed gene encoding a protein having tumor growth inhibi- tory activity (Figure 29) , were cloned and the pUC subclones of phages were mapped by restriction enzyme analysis (Figure 25 and 26) . Construction of the K562 library, screening and isolation of recombinant clones was carried out essentially according to the procedures - 88 -
of Grosveld, et al. (1981) Gene 13: 227-237.
The phage DNA clone containing the sequence encoding the protein related to TGF-01 and with tumor growth inhibitory activity was cut with Sau 3A and the re¬ striction fragments cloned into M13. The recombinant plaques were screened with the Sma I-Pvu II probe of TGF-01. Six hybridizing genomic clones were sequenced by the method of Sanger, et al. (1977) Proc. Natl. Acad. Sci. 74: 5463-5467, and a region of approximately 130 bp was found to be homologous to TGF-01 cDNA (Fig¬ ure 27) . When the amino acid sequence of TGF-øl and the related gene cloned in these experiments were com¬ pared they were found to be 82% homologous.
jo obtain a repeat free probe of the related gene encoding the protein having tumor growth inhibitory activity, various restriction fragments from Bam HI- Bam HI subclone of this gene were hybridized to TGF-01 cDNA, as well as to total human DNA. A BamHI-TaqI fragment of the gene encoding the protein having tumor growth inhibitory activity was found to cross hybridize with the TGF-01 cDNA. The position of this fragment in the gene encoding the protein having tumor growth inhibitory activity is shown in Figure 28.
The Bam HI-Taq I unique probe of the sequence encoding the protein having tumor growth inhibitory activity was used to screen the lambda-gtll human placenta cDNA li¬ brary (Clonetech*) . Two strongly hybridizing clones, as well as four weakly hybridizing clones, were isolat¬ ed. By DNA sequence analysis the weakly hybridizing clones were shown to correspond to the TGF-01 (Figure 29) . One strongly hybridizing clone was isolated and a 1.7kb EcoRI insert was subcloned into pUC 8. The - 89 -
restriction map of this clone is shown in Figure 30.
Restriction fragments for this clone were subcloned into M13 and sequenced by the method of Sanger, et al. The deduced amino acid sequence of this gene exhibits extensive homology with a family of genes (Massague, J. (1987) Cell 4J9, 437-438) including TGF-01, TGF-02, glioblastoma T-cell suppressor factor (G-TsF) factor, inhibin/activin, Mullerian Inhibiting Substance (MIS) and decapentaplegic transcript complex of Drosophila with the six C-terminal cysteine residues being conserved throughout. The comparison with TGF-01 and TGF-02 is shown in Figure 31. The cDNA sequence (Figure 29) encoding the protein having tumor growth inhibitory activity corresponded with the sequence from genomic DNA (Figure 27) encoding the protein having tumor growth inhibitory activity.
A 17 kb genomic DNA fragment containing the sequence of the gene encoding the protein having tumor growth in¬ hibitory activity has been cloned (see Figure 26) . Hybridizing 5' and 3' portions of the 1.7 kb cDNA clone which encodes the protein having tumor growth inhibito¬ ry activity with the genomic locus of the protein hav¬ ing tumor growth inhibitory activity revealed that the 1.7 kb cDNA sequence is completely contained in the genomic clone. Taking into account that the full length message of the protein having tumor growth in¬ hibitory activity is 3.5 kb, additional 5' and 3' flanking sequences may be isolated to obtain the com- plete gene. This is done by screening genomic phage and cosmid libraries with probes unique to the gene encoding the protein having tumor growth inhibitory activity. - 90 -
In TGF-øl the sequence R-R (as indicated at position -l and -2 in Figure 31) represents the proteolytic cleav¬ age site which generates the mature protein. In the related protein having tumor growth inhibitory activi¬ ty, the sequence R-K-K-R likely represents the corre- sponding cleavage site.
In the region N-terminal to the predicted cleavage site, TGF-øl and the related gene encoding the protein having tumor growth inhibitory activity exhibit only 7% homology. Both proteins, however, contain the se¬ quence R-G-D-L in this region which may be recognized by the fibronectin receptor.
In order to determine which cell line types express the related gene encoding the protein having tumor growth inhibitory activity, Northern hybridization was car¬ ried out using a 5' terminal Eco RI-Bgl II probe (Fig¬ ure 32). This revealed a mRNA of approximately 3.5 kb in A673 (a rhabdomyoscarcoma) , A498 (a kidney carcino¬ ma) and a faintly hybridizing signal in A549 (a lung adenocarcinoma) .
A genomic probe from the 3' region of the related gene encoding the protein having tumor growth inhibitory activity (corresponding to downstream of the presumed site of proteolytic cleavage) was then used to screen the same Northern blot. Three strong hybridization signals were observed in both A673 and A498, corre¬ sponding to TGF-01 (2.5kb), the related protein having tumor growth inhibitory activity (3.5kb) and, another related gene (4.2kb) (Figure 33). These results are consistent with the fact that this probe would be pre¬ dicted to cross react with sequences homologous to the protein having tumor growth inhibitory activity. - 91 -
Northern blot analysis of A673, A549 and A498 cell lines using a Pst I-Bal I TGF-01 probe was then per¬ formed. This probe should be highly specific for TGF- βl since it contains sequences corresponding to those N terminal to the proteolytic cleav.age site, a region where TGF-01 exhibits little homology to other members of this gene family. As predicted, based on the known 2.5 kb size of TGF-øl mRNA, a strong hybridization to a 2.5 kb mRNA band was observed in all three cell lines. Several weakly hybridizing bands are also ob¬ served at 4.2 kb and 3.5 kb (Figure 34).
Northern blot analysis of A673, A549 and A498 cell lines were then screened using TGF-øl cDNA containing the complete coding sequence of the TGF-øl precursor. This probe is predicted to cross hybridize with homolo¬ gous sequences to TGF-01. As predicted, there was strong hybridization to a 2.5 kb mRNA band correspond¬ ing to TGF-01 and a 4.2 kb mRNA band possibly corre- sponding to TGF-02 (Figure 35) .
Northern blot analysis of mRNA from human umbilical cord and A673 cell line were also screened using an Eco RI - Bgl II cDNA fragment of the related gene encoding the protein having tumor growth inhibitory activity as a probe (Figure 36) . The figure includes the result with a actin probe acting as a control to normalize mRNA levels in each lane. Normalized to actin mRNA levels, the cord expresses the highest level of mRNA of the gene encoding the protein having tumor growth inhibitory activity of any source so far examined (Figure 36) . - 92 -
Southern blot analysis was performed on a variety of different tumor DNAs digested with Eco RI and hybrid¬ ized with a Sma I- Ava I cDNA fragment of the TGF-øl related gene encoding the protein having tumor growth inhibitory activity as a probe at low (2.5 X SSC, 65'C) and high (0.3 X SSC, 65'C) stringency washes. Southern blot analysis indicates the possible presence of other loci related to the gene encoding the protein having tumor growth inhibitory activity, as the probe hybridizes with two bands (3 kb and 12 kb) which are only observed under conditions of washing at low stringency.
To obtain a full length cDNA clone of the gene encoding the protein having tumor growth inhibitory activity, a Okayama-Berg cDNA library blot of human fibroblasts was screened with the 5' Eco RI-Bgl II probe of the 1.7 kb cDNA clone of the gene encoding the protein having tumor growth inhibitory activity. A hybridizing band of 3.2 kb is visible at moderate wash stringency 0.3 x SSC, 65'C.
Production of Antibodies with Specificity for the TGF- βl Related Protein Having Tumor Growth Inhibitory Activity
Chimeric bacterial proteins have been constructed that contain the C terminal 150 amino acids of the related protein having tumor growth inhibitory activity fused to a small region of the trpE gene. Such a fusion protein was found to be recognized by an antibody that was produced against a peptide derived from amino acid numbers 9 to 28 of the mature form of the protein hav¬ ing tumor growth inhibitory activity. The antibody recognizes the trp: :protein having tumor growth in- - 93 -
hibi-tory activity fusion protein to a much higher de¬ gree than a trp: :TGF-0 fusion protein and the peptide specifically competes with the protein having tumor growth inhibitory activity for the binding of the anti¬ body.
DNA sequences that code for the the TGF-01 related protein having tumor growth inhibitory activity were cloned into a pKS vector. This vector is a pATH II derivative that contains the inducible trp promoter and a multiple cloning site. The resulting constructs produce a chimeric protein consisting of the first 22 amino acids of the trpE gene, the C-terminal 150 amino acids of the protein having tumor growth inhibitory activity. Transformants containing these clones were screened primarily by restriction endonuclease analysis and ultimately for production of the chimeric protein by SDS polyacrylamide gel electrophoresis. The protein products of 3 clones, pll6, pl34, and pl35, are shown in Figure 37. These cells were grown in defined media until they reached early log phase and then incubated for 3 hours either in the presence or absence of the trpE inducer indoleacrylic acid (IAA) . The cells were then collected, lysed and their proteins electro¬ phoresed on a 12.5% SDS polyacrylamide gel. Figure 37 is a photograph of one such gel that had been stained with Coomassie blue. As can be seen, lysates pll6 and pl35 produce a protein of about 19,000 Dalton molecular weight whose relative abundance increases in the pres¬ ence of IAA. In contrast, pl34 does not produce this protein species. Both pll6 and pl35 contain plasmids that, by restriction analysis, have the sequences of the protein having tumor growth inhibitory activity cloned in the orientation that should produce a 19,500 Dalton molecular weight fusion protein. The pl34 - 94 -
plasmid was found to have the sequences of the protein having tumor growth inhibitory activity in the opposite orientation.
The trpE: :protein having tumor growth inhibitory activ¬ ity fusion protein was used to test the specificity of an antibody that used a peptide homologous to part of the protein having tumor growth inhibitory activity as an antigen. A polypeptide was synthesized correspond¬ ing to residues 9 through 28 of the mature protein having tumor growth inhibitory activity, except that residue 9 in the sequence, arginine, was replaced by serine. The peptide was purified by RPHPLC and cou¬ pled to keyhole limpet hemocyanin for use as an immunogen in rabbits.
Thirty-three days following the first injection (500μg) , the antisera were screened by standard ELISA using lOOng of peptide per well. One rabbit demonstrated a signal of 1.0 OD units at a 1:25 dilution of the anti- body. Ten days after this rabbit was first bled, a boost of 250mg of coupled antigen was given. The fol¬ lowing bleed 20 days after the first bleed showed a 20- fold increase in antibody response to the peptide anti¬ gen. Forty days after the initial bleed (3rd bleed) a signal of 1.0 OD unit was achieved at a 1:8000 dilution of the antisera, a 16-fold increase in antibody titer over the second bleed. This antibody showed little cross-reactivity with a homologous peptide derived from TGF-01 sequences. The TGF- 1 derived peptide consisted of amino acid numbers 4 to 19 of the mature TGF- 1 protein. Of the 11 common amino acids, residues 9-19, 7 are conserved between the protein having tumor growth inhibitory activity and TGF-øl. - 95 -
To determine if the peptide recognizing antibody could recognize the protein having tumor growth inhibitory activity, the antibody was used in Western blot analy¬ sis against a fusion protein of the protein having tumor growth inhibitory activity and a TGF-øl fusion. As seen in Figure 38, the anti-peptide antibody reacted strongly with the fusion protein of the protein having tumor growth inhibitory activity while it reacted only weakly with a trp: :TGF-01 fusion protein. Both fusion proteins were recognized by a commercially available anti-TGF-01 antibody (R and D systems) (Figure 38) .
As can be seen in Figure 38, the anti-peptide antibody recognizing the protein having tumor growth inhibitory activity also has a high level of background reactivity to bacterial proteins. To reduce this cross reactivi¬ ty, we purified the antibody on a CNBr-Sepharose column containing the original peptide used as an antigen. The antibody retained its high titer to the peptide of the protein having tumor growth inhibitory activity and low cross reactivity to the homologous peptide TGF-øl (data not shown) . The purified peptide antibody was then tested by Western blot analysis for its cross- reactivity with TGF-øl. The results are shown in Fig¬ ure 39. The purified antibody reacts very strongly with the fusion protein of the protein having tumor growth inhibitory activity (lane 2)and with a higher molecular weight protein species, while the hybridiza¬ tion to other bacterial proteins was found to be greatly reduced compared to the unpurified antibody (Figure 38) . The purified antibody exhibits negligible reactivity with either the TGF-01 fusion protein (lane 1) or purified, TGF-01 obtained commercially (R and D systems) (lanes 3 and 6) . A competition experiment was also performed where the purified antibody was - 96 -
preincubated with a 300 fold molar excess of the peptide (lanes 4, 5 and 6). Preincubation of the anti¬ body with excess peptide for 60 minutes at room temper¬ ature considerably reduced hybridization to the fusion protein of the protein having tumor growth inhibitory activity (lane 5) but not to trace background reactivi¬ ty exhibited against the TGF-01 fusion protein or to other bacterial proteins (lane 4) . Thus the anti- peptide antibody specifically recognizes proteins con¬ taining sequences of the protein having tumor growth inhibitory activity.
Eucaryotic Expression of TGF-01 Fused With The Protein Having Tumor Growth Inhibitory Activity
Human recombinant TGF-01 has been expressed in monkey COS cells. Sequences encoding the complete precursor of the TGF-øl cDNA were cloned down stream from a SV40 promoter using the pSVL* eukaryotic expression vector (obtained from Pharmacia) . This construct was trans- fected into COS cells using a standard calcium phos¬ phate precipitation method, Graham and van der Eb (1973) Virology 52, 456-467. After transfection, ap¬ proximately 4x10 cells were grown in serum free media for two days. The conditioned media was then collect- ed, acidified and tested for biological activity. Conditioned media from TGF-øl transfected cells was found to inhibit the growth of a monolayer mink lung test cell line (CCL 64) by 59% as compared to condi¬ tioned media from COS cells tranfected with the pSVL vector alone which inhibited growth of CCL 64 cells by only 32%.
Since a full length clone for the sequences encoding the protein having tumor growth inhibitory activity is - 97 -
not currently available for expression analysis, a ch-iβeric TGF- 1::protein having tumor growth inhibito¬ ry activity fusion construct was made by substituting 3' sequences of the TGF-øl precursor with sequences encoding the protein having tumor growth inhibitory activity. Given the homology between these two pro¬ teins and the conserved position of their cysteine residues, when such a construct is transfected into COS cells the novel fusion protein may be processed into the biologically active mature protein having tumor growth inhibitory activity. Additional constructs, which consist of the trp E::gene encoding the protein having tumor growth inhibitory activity fusion cloned under the regulatory sequences of either the SV40 pro¬ moter or the long terminal repeat of the mouse mammary tumor virus (MMTV) have been made and may be tested for biological activity in transient tranfection experi¬ ments.
Conclusion from the Fourth Series of Experiments
In the Fourth Series of Experiments TGF-01 was cloned and used to isolate a related gene encoding a protein having tumor growth inhibitory activity. Although it has not yet been determined which of TGI-1 or TGI-2 corresponds to the protein related to TGF-øl and having tumor growth inhibitory activity, one skilled in the art would understand that such a correspondence exists although the exact nature of this corresponding remains to be clarified. - 98 -
Fifth Series of Experiments
Further seguence determination of a gene encoding the protein having tumor growth inhibitory activity
Screening a lambda gtll human placenta cDNA library (Clontech 1.2 x 10 independent clones) with a repeat free probe, as described at page 87, lines 15-18, and figure 28, of the gene encoding the protein having tumor growth inhibitory activity, resulted in the iso¬ lation of a 1.7 kb cDNA clone. On Northern analysis, the mRNA for the protein having tumor growth inhibitory activity was found to be approximately 3.5 kb, indicat¬ ing that we had not obtained a full length cDNA.
To obtain additional 5' sequence information, we screened a lambda gtll human umbilical cord cDNA li¬ brary (Clontech, 1.5 x 10 independent clones) with a 5' EcoRI-Bgl II restriction fragment (Fig. 40, indicat¬ ed as E-B) derived from the placenta cDNA clone. This resulted in the isolation of a 1.9 kb cDNA (Fig. 40). Sequence analysis revealed this clone contained an additional 180 nucleotides of 5' sequence information. The isolation of this cDNA from an umbilical cord li¬ brary again confirms that this gene is actively tran¬ scribed in this tissue.
To obtain further cDNA sequence information for the gene encoding the protein having tumor growth inhibito¬ ry activity, mRNA was isolated from A673 cells and a cDNA library prepared. Starting with 5 μg poly (A)+ RNA, a random primed cDNA library of approximately 2 x 10 clones was constructed in lambda gtlO, using the Amersham cDNA synthesis system plus according to the . manufacturer's procedures. Approximately 0.7 x 10 - 99 -
unamplified cDNA clones were screened with a 25-mer oligonucleotide probe (5'-A T A T A G C G C T G T T T G G C A A T G T G C T -3') corresponding to a sequence near the 5' end of the 1.9 kb cDNA clone and a single positive clone containing a 1.7 kb insert was identified.
Analysis of the three overlapping cDNAs (Fig. 41) re¬ vealed a sequence of 2529 bases, with the largest open reading frame being 1236 bases. We found no sequence differences in the overlapping cDNAs indicating they were derived from transcripts of the same gene. Our sequence contains a complete 3' untranslated region of 1031 bp with a polyadenylation signal 25 bp upstream from the poly (A) tract. The 5' untranslated region comprises 262 bp but lacks approximately 1 kb, as judged from the size of the mRNA estimated by Northern analysis. The predicted amino acid sequence of the gene encoding the protein having tumor growth inhibito¬ ry activity shows extensive homology to TGF-øl and 02 (Fig. 42) (Derynck, et al. (1985) Nature 3_16, 701-705; de Martin, et al. (1987) EMBO J. 6 , 3673-3677; Madisen, et al. (1988) DNA 7, 1-8).
TGF-01 and TGF-02 are produced in precursor forms of 390 and 414 amino acid residues respectively (Derynck, et al. (1985) Nature 3_16, 701-705; de Martin, et al.
(1987) EMBO J. 6, 3673-3677) . The cDNA sequence we have obtained for the gene encoding the protein having tumor growth inhibitory activity (Fig. 41) contains an open reading frame coding for 412 amino acids, with the first ATG preceeded by a stop codon, 162 nucleotides upstream. As found with TGF-øl (Derynck, et al. (1985)
Nature 316, 701-705) and TGF-02 (de Martin, et al. EMBO
J. 6_, 3673-3677) , the predicted initiating codon for - 100 -
the protein having tumor inhibitory activity does not forn part of a Kozak consensus sequence (Kozak (1986) Cell 44_, 283-292). Interestingly, six nucleotides downstream there is a second ATG, with an A at posi¬ tion -3, which aligns with the initiating codon in TGF- 02 (de Martin, et al. (1987) EMBO J. 6, 3673-3677). Homodimers of the C-terminal 112 residues of TGF-øl and 02 represent the biologically active forms of these proteins. Preceeding the site of cleavage to their mature forms, TGF-øl and -02 have stretches of 4 and 5 basic residues respectively. In the gene encoding the protein having tumor growth inhibitory activity, there are 5 basic residues preceeding the predicted cleavage site marked by the asterisk (Fig. 41) . The mature forms of TGF-øl and -02 share 80/112 identical resi- dues. The corresponding 112 C-terminal amino acids in this gene exhibit 86/112 and 89/112 identical residues compared to TGF-øl and -02 respectively (Fig. 42) . Many of the remaining differences represent conserva¬ tive substitutions. All three proteins show a strict conservation of the cysteine residues in this region. The N-terminal domain of the precursor portion of the gene encoding the protein having tumor growth inhibito¬ ry activity exhibits approximately 35% homology to TGF- øl and 45% homology to TGF-02. By comparison, the corresponding sequences of the TGF-øl and -02 precur¬ sors have 33% sequence homology (Fig. 42) (Derynck, et al. (1985) Nature 316, 701-705; de Martin, et al. (1987) EMBO J. 6, 3673-3677) . A homology matrix plot clearly illustrates the greater similarity between the gene encoding the protein having tumor growth inhibito¬ ry activity and TGF-02, compared to TGF-øl (Fig. 43). Four potential glycosylation sites are contained in the N-terminal part of the gene encoding the protein having tumor growth inhibitory activity, one of which is con- - 101 -
served in all three proteins. All three proteins also posses hydrophobic N-termini which may represent presecretory signal peptide sequences (Perlman and Halvorson (1983) J. Mol Biol. 107, 391-409). Interest¬ ingly, both TGF-øl and the gene encoding the protein having tumor growth inhibitory activity (but not TGF- 02) contain the fibronectin binding sequence RGD (Ruoslahti and Pierschbacher (1986) Cell 44, 517-518). By analogy to TGF-øl and -02, the protein having tumor growth inhibitory activity is likely to be synthesized as a 412 amino acid precursor which undergoes proteolytic cleavage to produce the mature polypeptide. Based on the functional and structural homology to TGF-øl and -02, the protein having tumor growth inhibi¬ tory activity likely has therapeutic activity in can¬ cer therapy, wound healing and i ir. osuppression.
- 102 -
The- Sixth Series of Experiments
Note on Nomenclature
Given the extensive sequence identity of the protein having tumor growth inhibitory activity with TGF-øl and TGF-02, we have hereafter termed the protein having tumor growth inhibitory activity as TGF-03.
TGF-03 Expression Construct
A 1500 bp Alul-Hgal restriction fragment of TGF-03 cDNA (sites are indicated in Figure 41) which encodes the complete TGF-03 protein was cloned into the Bluescript plasmid (Strategene, La Jolla, CA) , to yield the plasmid pBlue-TGF-03. The fl intergenic region of this vector allows the production of single stranded DNA via infection of its host bacteria with fl helper phage. The predicted initiation codon of TGF-03 does not form part of a Kozak consensus sequence (CCACC[ATG]G; Kozak, Cell 44:283-292, 1986), which has been shown to influence the efficiency of translation. In order to promote high yields of the recombinant TGF-03 protein, we mutagenized the flanking sequence of the initiation codon to a more efficient translation sequence by changing CACAC[ATG]A into CCACC[ATG]A using the method of Nakamaye and Eckstein (Nucleic Acids Res. 14:9679- 9698, 1986). Mutagenesis was confirmed by sequence analysis. Subsequently, the mutagenized pBlue-TGF-03 was cut with Kpnl and Spel, two polylinker restriction sites flanking the cDNA insert. This fragment was cloned into the eukaryotic expression vector pORFEX (Bernard, et al., EMBO J. 6:283-292, 1987) cut with Kpnl and Xbal. In this construct (pCMV:TGF-03) the - 103 -
TGF-03 cDNA sequence is transcriptionally regulated by the,, cytomegalovirus immediate early promoter (see Figure 44) .
DNA Transfection and Gene Amplification
Stable transformants expressing TGF-03 were obtained by cotransfecting the pCMV-TGF-03 construct (Figure 44) with the dihydrofolate reductase (DHFR) gene (the pDCHIP plasmid containing hamster DHFR minigene driven by its own promoter) into Chinese Hamster Ovary (CHO) cells, which lack the DHFR gene (Urlaub and Chasin, Proc. Natl. Acad. Sci. USA 77:4216-4220, 1980).
A standard CaP04.DNA precipitation method (Graham and van der Ep, Virology 52:456-457, 1973) was used for DNA transfection. pCMV:TGF-3 (5.7 kb) and pDCHIP (2.5 kb) were coprecipitated with CaPO. in a ratio of 10μg to 50ng respectively and the precipitate added to 0.5 X 10 CHO (DHFR-)cells. Selection of transformants with a DHFR phenotype was performed in alpha MEM (Gibco, Grand Island, NY) supplemented with 10% dialyzed fetal calf serum. The colonies that appeared after culturing for 10-14 days in selection medium were isolated by standard methods and expanded.
For gene amplification, the primary transfectants were subjected to stepwise selection with increasing concentrations of Methotrexate (Mtx; Sigma Chemical Co., St. Louis, MO). The first round of selection was carried out at 20nM Mtx. TGF-03 expression levels were measured by RNA cytodot hybridization normalizing the expression of TGF-03 mRNA to that of actin. Two of the three clones with initial high expression (clones CHO 6.35 and CHO 9.1) showed increased TGF-03 mRNA - 104 -
expression at 20 nM Mtx concentration (Figure 45) . Total RNA (75 μg) from CHO cells (lane l) , CHO 6.35 (lane 2), and CHO 6.35/20 nM (lane 3), were fractionated on a 1.2% agarose-for aldehyde gel, blotted onto nitrocellulose and probed with a TGF-03 specific probe (EcoRI-Smal cDNA restriction fragment of the umbilical cord clone) (see Figure 40). CHO 6.35/20 nM (primary transfectant CHO clone 6.35 at 20nM Mtx), which had the highest level of expression, was chosen for initial protein purification from conditioned media and for further gene amplification.
Biological Assay of Conditioned Media
Conditioned media was treated with acetic acid to a final concentration of 0.1 M and serial dilutions tested for biological activity. CCL 64, a cell line derived from Mink lung (American Type Culture Collection, Rockville, MD) , was found to be extremely sensitive to the naturally occurring TGF-03 isolated from umbilical cord. This cell line was initially chosen, therefore, to test conditioned media for biological activity of the recombinant TGF-03 protein according to the method of Iwata et al. , Cancer Res. 45:2689-2694, 1985. Growth inhibition of CCL 64 mink lung cells produced by TGF-øl (purified) or TGF-03 (from conditioned media) is shown in Figure 46. Figure 46A shows a dose response of growth inhibition using purified TGF-øl (Calbiochem) ; a 50% inhibition was obtained with 0.1 ng TGF-øl. An increase in mink cell growth inhibitory activity was found comparing conditioned media from the transfectant selected at 20nM Mtx versus media from the parental transfectant. Figure 46B shows the biological activity of acid activated serum free supernatants of CHO 6.35/20 nM - 105 -
transfectant (closed circles) and CHO 6.35 transfectant
(open circles) ; 50% inhibition was obtained equivalent to 30 and 5 ng/ml TGF-øl activity, respectively.
Conditioned medium from parental CHO (DHFR~) possessed much lower growth inhibition than either transfectant (data not shown) . These results clearly suggest that the TGF-03 cDNA is transcribed and that TGF-03 mRNA is translated and produces biologically active protein.
In the presence of EGF, acidified conditioned media from CHO 6.35, containing TGF-03 was able to promote soft agar growth of NRK cells. Growth of NRK cells in soft agar has been shown to be inducible by stimulating the production of extracellular matrix proteins, an important parameter in wound healing.
Immunodetection
Peptides corresponding to various partial amino acid sequences of the TGF-03 protein were synthesized on an Applied Biosysterns peptide synthesizer (Model 430A) using tBoc chemistry (see Figure 47) . Peptides were coupled to keyhole limpet hemocyanin with glutaraldehyde and used for immunization of rabbits. Enzyme-linked immunosorbent assays were used initially to characterize the antibody titers (see Table 9). For this, and the following immunological experiments, standard techniques were employed as described by Harlow and Lane, 1988, in Antibodies, A Laboratory Manual. High titer antisera from immunized rabbits injected with 03V or 03III peptides were purified using an affinity matrix composed of the respective peptide 03 antigen conjugated to Affi-prep ιo (Bio Rad, Richmond, CA) . - 106 -
TABLE 9
Peptide Sequence Elisa Titer
I EEMHGEREEGCTQENTESEY 1:6,000
∑1 GDILENIHEVMEIKFKGVDNEDD 1:10,000
IZs GDILENIHEVMEIK 1:19,000 III DTNYCFRNLEENC 1:26,000
IV CVRPLYIDFRQDLGWKWVHEPKG YANFC 1:19,000
V YLRSADTTHSTVLGLYNT.LNPEASASY 1:26,000
VI CVPQDLEPLTILYYVGRTPKVEQLSNMWKSC 1:4,000
- 107 -
The affinity purified 0 III antisera exhibits greater than 300 fold specificity for the 03III peptide compared to the cognate peptide sequences from either the TGF-øl or -02. Furthermore, no significant cross reactivity of this antisera has been observed against either the TGF-øl or -02 proteins. However, this antibody shows only a very limited ability to immunoprecipitate the native recombinant TGF-03 protein from conditioned media. The affinity purified 03V antisera exhibits at least a 400-fold selectivity for the 03V peptide compared to the corresponding peptide sequence from TGF-01. This antibody can also efficiently immunoprecipitate the native TGF-03 protein (see figure 50) . However, this polyclonal sera appears to contain a significant population of antibodies (approximately 30-50%) which react with both the TGF-02 cognate peptide sequence and the TGF-02 protein.
Figure 48 shows an immunoblot of TGF-03 in conditioned media produced by the CHO 6.35/20 nM transfectant using 03III and 03V antibodies for detection. For peptide blocking experiments, the antibody was preincubated with 80-fold molar excess of peptide prior to incubation with the blot. For detection, alkaline phosphataβe (Zymed, San Francisco, CA) conjugated to goat anti-rabbit IgG was used as a second antibody. Figure 48A shows a western blot of a gel where the sample was subject to reduction prior to electrophoresis while Figure 48B shows the Western blot of the sample under non-reducing conditions. In each figure, lanes 1-3 and 4-6 corresponds to conditioned media immunoblotted with 03V and 03III antisera, respectively, lanes 2 and 5 immunoblots carried out in the presence of excess cognate peptide, while lanes 3 and 6 represent immunoblots in the presence of an - 108 -
excess unrelated peptide sequence. Western blotting of conditioned media from CHO 6.35/20 mM cells under reducing conditions, using affinity purified 03III and 03V antisera, detected a 50 kDa and a 12 kDa band. We believe these bands correspond to a precursor and mature form of TGF-03, by analogy to the processing of TGF-01 and TGF-02 previously described by Gentry et al., Mol. Cell. Biol. 7, 3418-3427 (1987) and Madison et al. DNA 8, 205-212 (1989) (Figure 48). Under non- reducing conditions, a 100 kDa and 24 kDa band were observed, which we believe to correspond to homodimeric forms of the precursor and mature forms of TGF-03. The apparent precursor appears as a broad band, characteristic of some glycosylated proteins. Following cleavage of the signal peptide sequence of the precursor form of TGF-03, one would expect a protein with MW of 43 kDa (under reduced conditions) . Based on the primary sequence of TGF-03, there are four N-linked glycosylation sites, further indicating that the detected precursor protein may be glycosylated. Figure 49 shows a Western blot of cell extract (Fig. 49A) and conditioned media (Fig. 49B) of the CHO 6.35/20 nM transfectant using 03V antibody for detection. For preparation of cell extracts, cells were first washed with phosphate buffered saline with and then lysed directly with SDS-ø mercapthoethanol prior to gel electrophoresis. For peptide blocking (lanes 2 and 4), the antibody was incubated with a 100- fold molar excess of specific peptide prior to incubation with the blot (I 125 protein A was used for detection). In cell extracts of CHO 6.35/20nM under reducing conditions, only the 50 kDa band corresponding to a potential precursor form is detected (Figure 49) . The specificity of the antisera was demonstated by preabsorbing the antibodies with peptide immunogen - 109 -
prior to Western blotting (Figures 48 and 49) . As expected, based on mRNA and biological activity data, the antisera did not detect any TGF-03 protein in conditioned media of the parental CHO (DHFR") cells.
Both antisera were also tested for immunoprecipitation of native recombinant TGF-03 protein (Figure 50) . CHO 6.35/20nM were grown to confluency and labeled with
[ 35S] methionine for 24 hours in methionine-free DMEM in the presence of 5% dialyzed plus 5% non-dialyzed fetal calf serum. The medium was collected and immmunoprecipitated with 10μg/ml affinity purified antibody and 20μl/ml (1:2 dilution) protein A agarose, for 2 hours at 4'C. Separation of the immunoprecipitated proteins on a 12.5% SDS polyacrylamide gel revealed two proteins migrating identically to the mature (12 kDa) and precursor form (50 kDA) of TGF-03, as detected by Western blotting (Figure 50) . However, one extra immunoprecipitated protein was found at 43 kD. This protein may correspond to either the non-glycosylated precursor or a proteolytic breakdown product. The 03V antibody proved to be much more efficient in immunoprecipitation of TGF-03 protein than the 03III antibody. The specificity of the immunoprecipitation was determined by preincubating the antibody with a 80-fold molar excess of either the cognate peptide or an unrelated peptide sequence. The specific peptide showed complete competition of all three bands whereas the unrelated peptide did not. As expected, based on the amino acid composition and distribution of methionines in the TGF-
03 protein, the 50 kDa contains significantly more S 35 label. - 110 -
The 0V affinity purified antibody was also used in paraffin sections of human umbilical cord (see Figure 51) . Fibroblasts and epithelial cells stained (Fig. 51A) as did the smooth muscle fibers of the cord vasculature (Fig. 51C) whereas neither ;he connective tissue nor the extracellular matrix stained with this antisera. A control rabbit polyclonal antisera (Ig against P210phl/abl:OSI catalog #PC02) showed no staining (Figs. 51B and D) . The strong staining in this tissue is in agreement with earlier data in which we showed extracts from umbilical cord possessed high levels of tissue derived tumor growth inhibitors, with similar to identical physico-chemical properties to recombinant TGF-03 protein. Also, umbilical cord was found to express the highest level of TGF-03 mRNA.
Protein Purification
Conditioned media was prepared from CHO 6.35/20nM cells grown to confluence in the presence of 20nM methotrexate. The cells were washed with phosphate buffered saline and incubated with serum free medium for 2 hours to eliminate carryover of serum proteins. Conditioned media was derived from cells incubated with fresh serum-free media for 48 hours. The conditioned media was centrifuged, acidified and dialyzed in (Spectrapor 3 membrane (3.500 MW, cut off) Thomas Philadelphia, PA) against 1 M acetic acid and subsequently lyophilized. The acid-soluble material was applied to a BioGel P-60 column (4 x 100 cm) , equilibrated with 1 M acetic acid. Fractions containing 10 ml were collected and aliquots of selected column fractions analyzed by Western blot analysis using the 03III antibody for detection. Two peaks of cross-reactive bands were found which - Ill -
correspond to precursor and mature forms of TGF-03, respectively. Fractions containing the mature TGF-03 protein were pooled and partially lyophilized. This pool was neutralized with 2M Tris to pH 7 and passed through an affinity column of 03V antibody coupled to protein A agarose with dimethylpimelimidate using standard procedures as described by Harlow and Lane (Antibodies, A Laboratory Manual, Cold Spring Harbor Laboratory, Cold Spring Harbor, 1988) . After extensive washing with buffer A (0.1 M Tris HCL pH 7.5, 10 mM EGTA, 1 mM PMSF, 1% Triton) and buffer A +1M NaCl, and finally with 20 mM Tris-HCl pH 7.5, the TGF-03 protein was eluted with 50 mM glycine -HCl pH 2.0. Figure 52 shows a silver stain of purified TGF-03 and TGF-01 (Calbiochem) . TGF-03 (100 ng) (lanes 1 and 3) and TGF- øi (lanes 2 and 4) were electrophoresed on 12.5% polyacrylamide gels treating the samples in the absence (lanes 1 and 3) or presence (lanes 2 and 4) of 10 mM DTT in the loading buffer. Fractions were analyzed by silver stain and Western blot analysis and peak fractions pooled. The silver stained gel showed a single band of 12kDa and 24 kDa under reducing and non- reducing conditions, respectively (Figure 52). The detection of a single silver staining band indicates that the preparation is greater than 90% homogeneous.
Effects of Recombinant TGF-03 on the Growth of Cell Lines in Culture
The effect of TGF-03 on the growth of various cell lines is shown in Table 10. Growth was determined using a modification of the monolayer assay for tumor growth inhibitory activity described in the Materials and Methods section of the "First Series of Experiments". Cells were subcultured on 96-well tissue - 112 -
culture plates in 100 μl of media at a seeding density of* 2 x 103 cells per well. Except for MCF-7, the above-identified cells were maintained and assayed in Dulbecco's modified Eagle's medium containing 10% fetal bovine serum and 2% L-glutamine. MCF-7 was maintained in Dulbecco's modified Eagle's medium containing 10% fetal bovine serum, 2% L-glutamine and 1% sodium pyruvate. Cells were treated with 25 ng/ml of TGF-03, labeled 24 hours with 5-[ 125I]Iodo-2'deoxyuridine when cells in the untreated control wells were 90% confluent and harvested as described.
In Table 10, it is observed that recombinant TGF-03 has only minimal effect on normal human fibroblasts while significantly inhibiting mink lung cells (CCL 64) and human tumor cells from lung, skin, colon and breast tumor tissue.
Antibodies Which Neutralize TGF-03 Activity
Purified recombinant TGF-03, at concentrations from 3.125 to 0.049 ng/ml, was incubated with 5 ug/ ml of affinity purified polyclonal rabbit antibodies (03III and 03V antisera) for 3 hours at 37*C. Control TGF-03 was incubated without antibodies. Growth inhibition of mink cells by antibody treated and control untreated TGF-03 was determined as described above. Figure 53 shows that the 03V antisera (closed squares ) decreases the growth inhibitory activity of TGF-03 on mink cells relative to the growth inhibitory activity of identical concentrations of TGF-03 in either the absence of antibody (closed circles) or treated with 03III antisera (open squares) . Neither antisera had any significant effect on the growth of CCL 64 cells in the absence of TGF-03. Antibodies against the TGF-03 - 113 -
peptide 0V are apparently neutralizing the growth inhibitory activity of TGF-03.

Claims (49)

- 114 -What is claimed is:
1. A protein having tumor growth inhibitory activ- ity comprising the 112 amino acids shown in
Figure 29 beginning with alanine at position 1 and ending with serine at position 112.
2. A biologically active derivative of claim 1, wherein the derivative having tumor growth inhibitory activity has substantially the same amino acid sequence shown in Figure 29 beginning with alanine at position 1 and ending with serine at position 112.
A purified protein of claim 1.
A protein of claim 3 having 112 amino acids.
A protein comprising the 412 amino acids shown in Figure 41 beginning with methionine at nucleotide position 263 and ending with serine at nucleotide position 1496.
A biologically active derivative of claim 5, wherein the protein has substantially the same amino acid sequence as shown in Figure 41 beginning with methionine at nucleotide position 263 and ending with serine at nucleotide position 1496.
A protein comprising the 411 amino acids shown in Figure 41 beginning with lysine at nucleotide position 266 and ending with serine at nucleotide position 1496. - 115 -
8. A nucleic acid molecule encoding the protein of claim 1.
9. A nucleic acid molecule encoding the protein of claim 4.
10. A nucleic acid molecule encoding the protein of claim 5.
11. A cDNA of claim 8 shown in Figure 29.
12. A cDNA of claim 9 shown in Figure 29 beginning with guanine of the codon at position 1 and ending with cytosine of the codon at position 112.
13. A cDNA of claim 10 shown in Figure 41 beginning with cytosine at position 1 and ending with guanine at position 2529.
14. A plasmid which comprises the nucleic acid molecule of claim 8.
15. A host vector system, comprising a plasmid of claim 14 in a suitable host cell.
16. A host vector system of claim 15, wherein the suitable host cell is a bacterial cell.
17. A host vector system of claim 15, wherein the suitable host cell is a eucaryotic cell.
18. A method for producing a protein comprising growing the host vector system of claim 15 so as to produce the protein in the host and re- - 116 -
covering the protein so produced.
19. A polypeptide derived from the protein of claim 1, comprising the 20 amino acids shown in Figure 29 beginning with arginine at position 9 and ending with leucine at position 28.
20. An antibody which specifically binds to an epitope contained with the protein of claim 1.
21. A monoclonal antibody of claim 20.
22. An antibody of which specifically binds to an epitope contained within the polypeptide of claim 19.
23. A monoclonal antibody of claim 22.
24. A method for diagnosing a tumor which comprises contacting a sample from a human subject with an antibody of claim 20 under suitable condi¬ tions so as to form a complex between the anti¬ body and an epitope contained with the protein and detecting the complex so formed, thereby diagnosing a tumor.
25. A pharmaceutical composition comprising the antibody of claim 20 and a pharmaceutically acceptable carrier.
26. A method of treating a tumor which comprises administering to the subject an effective tumor treating amount of the composition of claim 25. - 117 -
27. A method of treating a proliferative type dis¬ order which comprises administering to the subject an effective proliferative type disor¬ der treating amount of the composition of claim 25.
28. A pharmaceutical composition comprising an effective amount of the protein of claim 1 or a biologically active derivative thereof in a suitable pharmaceutical carrier.
29. A method of inhibiting the growth of human tumor cells which comprises contacting the cells with an effective tumor growth-inhibiting amount of the composition of claim 28.
30. A method of treating a proliferative type dis¬ order in a subject which comprises administering to the subject an amount of the composition of claim 28 effective to treat the proliferative type disorder.
31. A method for treating a burn or healing a wound which comprises contacting the burn or wound with a pharmaceutical composition of claim 28.
32. A pharmaceutical composition comprising an effective amount of the protein of claim 5 or a biologically active derivative thereof in a suitable pharmaceutical carrier.
33. A method of inhibiting the growth of human tumor cells which comprises contacting the cells with an effective tumor growth-inhibiting amount of the composition of claim 32. - 118 -
34. A method of treating a proliferative type dis¬ order in a subject which comprises administering to the subject an amount of the composition of claim 32 effective to treat the proliferative type disorder.
35. A method for treating a burn or healing a wound which comprises contacting the burn or wound with a pharmaceutical composition of claim 32.
36. A method for detecting the presence of a tumor which comprises quantitatively determining the amount of the protein of claim 1 present in a sample from a subject and comparing the amount so determined with the amount present in a sample from a normal subject, the presence of a significantly different amount indicating the presence of a tumor.
37. A method for detecting the presence of a tumor which comprises separately quantitatively de¬ termining the amount of the protein of claim 1 and of transforming growth factor alpha (TGF- alpha) present in a sample from a subject, determining the ratio of the amount of the protein of claim 1 present in the sample to the amount of TGF-alpha,determining the comparable ratio for a sample from a normal subject and comparing the ratio for the subject to the ratio for the normal subject, a significant variation in the ratio indicating the presence of a tumor. - 119 -
38. A method for typing tumors which comprises quantitatively determining for a sample from a subject with a tumor the amount of each of TGI- 1, TGI, TGI-2, the protein of claim 1, CM-I, or a polypeptide recoverable from conditioned media of A431 cells present in the sample, the presence of specific amounts or relative amounts thereof being indicative of a specific tumor type.
39. A method of inhibiting the activity of the protein having tumor growth inhibitory activity, or the biologically active derivative thereof, which comprises contacting the cells with an effective amount of the antibody of claim 20.
40. A method of inhibiting the activity of the protein having tumor growth activity, or the biologically active derivative thereof, which comprises contacting the cells with an effective amount of the antibody of claim 22.
41. A method of inhibiting the activity of the protein having tumor growth activity of claim 39, wherein the activity is im unσsuppressive activity.
42. A method of inhibiting the activity of the protein having tumor growth activity of claim 40, wherein the activity is immunosuppressive activity. - 119A -
43. A method of producing TGF-B3 which comprises:
(a) preparing DNA encoding a precursor of TGF-B3 and having a nucleotide sequence substantially identical to the nucleotide sequence shown in Figure 41 beginning with nucleotide 263 and ending with nucleotide 1498;
(b) inserting the DNA so prepared into an expression vector so positioned with respect to a suitable promoter as to permit expression of the DNA in a suitable host cell;
(c) transforming the host cell with the expression vector under conditions permitting expression of the DNA;
(d) culturing the host cell so transformed in a suitable medium under conditions such that the DNA is expressed, the precursor of TGF- 63 is produced, and the precursor TGF-63 so produced is secreted into the medium;
(e) treating the medium containing the secreted precursor of TGF-B3 with an activating agent so as to convert the precursor into TGF-B3; and (f) recovering the TGF-B3 so produced.
44. A method of claim 43, wherein the host cell is a eucaryotic cell.
Q 45. A method of claim 44, wherein the eucaryotic cell is a mammalian cell.
46. A method of claim 45, wherein the mammalian cell is a CHO cell. 5 - 119B -
47. A method of claim 43, wherein the suitable promoter is an inducible promoter.
48. A method of claim 47, wherein the inducible promoter is associated with dhfr.
49. A method of claim 43, wherein the activating agent comprises an acid.
AU57293/90A 1989-05-17 1990-05-17 Tissue-derived tumor growth inhibitors, methods of preparation and uses thereof Expired AU668072B2 (en)

Applications Claiming Priority (3)

Application Number Priority Date Filing Date Title
US35341089A 1989-05-17 1989-05-17
US353410 1989-05-17
PCT/US1990/002753 WO1990014360A1 (en) 1989-05-17 1990-05-17 Tissue-derived tumor growth inhibitors, methods of preparation and uses thereof

Publications (2)

Publication Number Publication Date
AU5729390A true AU5729390A (en) 1990-12-18
AU668072B2 AU668072B2 (en) 1996-04-26

Family

ID=23388978

Family Applications (1)

Application Number Title Priority Date Filing Date
AU57293/90A Expired AU668072B2 (en) 1989-05-17 1990-05-17 Tissue-derived tumor growth inhibitors, methods of preparation and uses thereof

Country Status (5)

Country Link
EP (1) EP0508983A4 (en)
JP (1) JPH04505325A (en)
AU (1) AU668072B2 (en)
CA (1) CA2056981A1 (en)
WO (1) WO1990014360A1 (en)

Families Citing this family (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO1992000318A1 (en) * 1990-06-25 1992-01-09 Oncogene Science, Inc. Tissue-derived tumor growth inhibitors, methods for preparation and uses thereof
EP0625989B1 (en) * 1992-02-12 2000-01-19 BIOPHARM GESELLSCHAFT ZUR BIOTECHNOLOGISCHEN ENTWICKLUNG VON PHARMAKA mbH Dna sequences encoding novel growth/differentiation factors
JP2000508898A (en) * 1996-04-12 2000-07-18 アストラ・アクチエボラーグ Cysteine-containing or methionine-containing peptides with immunomodulatory activity

Family Cites Families (2)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4886747A (en) * 1985-03-22 1989-12-12 Genentech, Inc. Nucleic acid encoding TGF-β and its uses
NZ222168A (en) * 1986-10-20 1991-05-28 Oncogene Science Inc Tumour growth inhibiting protein related to tgf-#b#1 and tgf-#b#2, preparation by genetic engineering methods, antibodies and pharmaceutical compositions

Also Published As

Publication number Publication date
AU668072B2 (en) 1996-04-26
EP0508983A1 (en) 1992-10-21
EP0508983A4 (en) 1993-05-05
JPH04505325A (en) 1992-09-17
CA2056981A1 (en) 1990-11-18
WO1990014360A1 (en) 1990-11-29

Similar Documents

Publication Publication Date Title
CA1341182C (en) Tissue-derived tumor growth inhibitors, methods of preparation and uses thereof
Connolly et al. Human vascular permeability factor: isolation from U937 cells
US4816561A (en) Biologically active polypeptides
US4997929A (en) Purified ciliary neurotrophic factor
EP0491675A1 (en) Improvements relating to growth factors
US4863899A (en) Biologically active polypeptides
AU668072B2 (en) Tissue-derived tumor growth inhibitors, methods of preparation and uses thereof
CA1341535C (en) Transforming growth factor peptides
Noro et al. Murine IgA binding factors (IgA-BF) suppressing IgA production: characterization and target specificity of IgA-BF.
US6425769B1 (en) Tissue-derived tumor growth inhibitors, methods of preparation and uses thereof
AU659412B2 (en) Tissue-derived tumor growth inhibitors
JP2519561B2 (en) Acidic glycoprotein
US5235042A (en) Endothelial cell growth factor
JP2690956B2 (en) Biogenic protein
JPH01500188A (en) Hepatome-derived growth factor
JPH01104100A (en) Protein having blood vessel activity obtained from monocyte and its analogue, extraction of said protein and utilization thereof for treatment and production of antibody
US6586394B1 (en) Tissue-derived tumor growth inhibitor
Daëron et al. Identification of FcγRIIa, a product of the murine αFcγR gene
CA1341536C (en) Transforming growth factor peptides
FI81497C (en) ANTIKROPPAR MOT BIOLOGISKT AKTIVA POLYPEPTIDER OCH DERAS ANVAENDNING VID DIAGNOSTISKA FOERFARANDEN.
AU7696487A (en) Peptide fragments of organ-specific neoantigens
WO1989011288A1 (en) Lung growth stimulatory and inhibitory factors for carcinoma tumor cells
JPS58192827A (en) Novel substance with action of growing nerves