AU2022202136A1 - Trehalase in fermentations - Google Patents
Trehalase in fermentations Download PDFInfo
- Publication number
- AU2022202136A1 AU2022202136A1 AU2022202136A AU2022202136A AU2022202136A1 AU 2022202136 A1 AU2022202136 A1 AU 2022202136A1 AU 2022202136 A AU2022202136 A AU 2022202136A AU 2022202136 A AU2022202136 A AU 2022202136A AU 2022202136 A1 AU2022202136 A1 AU 2022202136A1
- Authority
- AU
- Australia
- Prior art keywords
- fermentation
- trehalase
- enzyme
- trehalose
- ethanol
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 238000000855 fermentation Methods 0.000 title claims abstract description 187
- 230000004151 fermentation Effects 0.000 title claims abstract description 184
- 108010087472 Trehalase Proteins 0.000 title claims abstract description 144
- 102100029677 Trehalase Human genes 0.000 title claims abstract description 136
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 claims abstract description 187
- 238000000034 method Methods 0.000 claims abstract description 98
- 230000003247 decreasing effect Effects 0.000 claims abstract description 4
- 108090000790 Enzymes Proteins 0.000 claims description 178
- 102000004190 Enzymes Human genes 0.000 claims description 177
- 229940088598 enzyme Drugs 0.000 claims description 177
- HDTRYLNUVZCQOY-LIZSDCNHSA-N alpha,alpha-trehalose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-LIZSDCNHSA-N 0.000 claims description 65
- HDTRYLNUVZCQOY-UHFFFAOYSA-N α-D-glucopyranosyl-α-D-glucopyranoside Natural products OC1C(O)C(O)C(CO)OC1OC1C(O)C(O)C(O)C(CO)O1 HDTRYLNUVZCQOY-UHFFFAOYSA-N 0.000 claims description 64
- HDTRYLNUVZCQOY-WSWWMNSNSA-N Trehalose Natural products O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HDTRYLNUVZCQOY-WSWWMNSNSA-N 0.000 claims description 64
- 102100022624 Glucoamylase Human genes 0.000 claims description 61
- 108010073178 Glucan 1,4-alpha-Glucosidase Proteins 0.000 claims description 47
- 238000004519 manufacturing process Methods 0.000 claims description 45
- -1 p-amylases Proteins 0.000 claims description 43
- 238000006243 chemical reaction Methods 0.000 claims description 37
- 108010065511 Amylases Proteins 0.000 claims description 36
- 102000013142 Amylases Human genes 0.000 claims description 36
- 235000019418 amylase Nutrition 0.000 claims description 35
- 239000008186 active pharmaceutical agent Substances 0.000 claims description 30
- 230000008569 process Effects 0.000 claims description 21
- 229940025131 amylases Drugs 0.000 claims description 19
- 230000001965 increasing effect Effects 0.000 claims description 15
- 241000223259 Trichoderma Species 0.000 claims description 14
- 108050008938 Glucoamylases Proteins 0.000 claims description 12
- 241000233866 Fungi Species 0.000 claims description 11
- 108090000637 alpha-Amylases Proteins 0.000 claims description 11
- 230000001976 improved effect Effects 0.000 claims description 9
- 108091005804 Peptidases Proteins 0.000 claims description 8
- 239000004365 Protease Substances 0.000 claims description 8
- 241000206602 Eukaryota Species 0.000 claims description 5
- 102000035195 Peptidases Human genes 0.000 claims description 5
- 108010059820 Polygalacturonase Proteins 0.000 claims description 5
- 230000002829 reductive effect Effects 0.000 claims description 5
- 108010011619 6-Phytase Proteins 0.000 claims description 4
- 101710188648 Acid trehalase Proteins 0.000 claims description 4
- 101710121765 Endo-1,4-beta-xylanase Proteins 0.000 claims description 4
- 108090000371 Esterases Proteins 0.000 claims description 4
- 102000004316 Oxidoreductases Human genes 0.000 claims description 4
- 108090000854 Oxidoreductases Proteins 0.000 claims description 4
- 101000679327 Schizosaccharomyces pombe (strain 972 / ATCC 24843) Cytosolic neutral trehalase Proteins 0.000 claims description 4
- 108010019077 beta-Amylase Proteins 0.000 claims description 4
- 108010005774 beta-Galactosidase Proteins 0.000 claims description 4
- 102000005936 beta-Galactosidase Human genes 0.000 claims description 4
- 108010093305 exopolygalacturonase Proteins 0.000 claims description 4
- 108010008885 Cellulose 1,4-beta-Cellobiosidase Proteins 0.000 claims description 3
- 108090001060 Lipase Proteins 0.000 claims description 3
- 102000004882 Lipase Human genes 0.000 claims description 3
- 239000004367 Lipase Substances 0.000 claims description 3
- 102000004139 alpha-Amylases Human genes 0.000 claims description 3
- 108010005400 cutinase Proteins 0.000 claims description 3
- 235000019421 lipase Nutrition 0.000 claims description 3
- 102000057234 Acyl transferases Human genes 0.000 claims description 2
- 108700016155 Acyl transferases Proteins 0.000 claims description 2
- 101710152845 Arabinogalactan endo-beta-1,4-galactanase Proteins 0.000 claims description 2
- 102100032487 Beta-mannosidase Human genes 0.000 claims description 2
- 108010053835 Catalase Proteins 0.000 claims description 2
- 102000016938 Catalase Human genes 0.000 claims description 2
- 108010084185 Cellulases Proteins 0.000 claims description 2
- 102000005575 Cellulases Human genes 0.000 claims description 2
- 108010023736 Chondroitinases and Chondroitin Lyases Proteins 0.000 claims description 2
- 102000011413 Chondroitinases and Chondroitin Lyases Human genes 0.000 claims description 2
- 101001096557 Dickeya dadantii (strain 3937) Rhamnogalacturonate lyase Proteins 0.000 claims description 2
- 101710147028 Endo-beta-1,4-galactanase Proteins 0.000 claims description 2
- 108050009363 Hyaluronidases Proteins 0.000 claims description 2
- 102000001974 Hyaluronidases Human genes 0.000 claims description 2
- 108010029541 Laccase Proteins 0.000 claims description 2
- 102000003820 Lipoxygenases Human genes 0.000 claims description 2
- 108090000128 Lipoxygenases Proteins 0.000 claims description 2
- 108700020962 Peroxidase Proteins 0.000 claims description 2
- 102000003992 Peroxidases Human genes 0.000 claims description 2
- 108010064785 Phospholipases Proteins 0.000 claims description 2
- 102000015439 Phospholipases Human genes 0.000 claims description 2
- 108700019535 Phosphoprotein Phosphatases Proteins 0.000 claims description 2
- 102000045595 Phosphoprotein Phosphatases Human genes 0.000 claims description 2
- 108091007187 Reductases Proteins 0.000 claims description 2
- 108060008539 Transglutaminase Proteins 0.000 claims description 2
- 108060008724 Tyrosinase Proteins 0.000 claims description 2
- 102000003425 Tyrosinase Human genes 0.000 claims description 2
- 108010027199 Xylosidases Proteins 0.000 claims description 2
- 108700014220 acyltransferase activity proteins Proteins 0.000 claims description 2
- 108010030291 alpha-Galactosidase Proteins 0.000 claims description 2
- 102000005840 alpha-Galactosidase Human genes 0.000 claims description 2
- 108010084650 alpha-N-arabinofuranosidase Proteins 0.000 claims description 2
- 108010009043 arylesterase Proteins 0.000 claims description 2
- 102000028848 arylesterase Human genes 0.000 claims description 2
- 108010055059 beta-Mannosidase Proteins 0.000 claims description 2
- 108010062085 ligninase Proteins 0.000 claims description 2
- 108010087558 pectate lyase Proteins 0.000 claims description 2
- 108010072638 pectinacetylesterase Proteins 0.000 claims description 2
- 102000004251 pectinacetylesterase Human genes 0.000 claims description 2
- 108010038851 tannase Proteins 0.000 claims description 2
- 102000003601 transglutaminase Human genes 0.000 claims description 2
- 229920001221 xylan Polymers 0.000 claims description 2
- 150000004823 xylans Chemical class 0.000 claims description 2
- 108010083879 xyloglucan endo(1-4)-beta-D-glucanase Proteins 0.000 claims description 2
- 101710111935 Endo-beta-1,4-glucanase Proteins 0.000 claims 1
- 229940024171 alpha-amylase Drugs 0.000 claims 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 abstract description 25
- 230000036541 health Effects 0.000 abstract description 2
- 210000004027 cell Anatomy 0.000 description 93
- 229920002472 Starch Polymers 0.000 description 87
- 235000019698 starch Nutrition 0.000 description 84
- 239000008107 starch Substances 0.000 description 83
- 108090000623 proteins and genes Proteins 0.000 description 50
- 239000004382 Amylase Substances 0.000 description 48
- 108090000765 processed proteins & peptides Proteins 0.000 description 47
- 102000004196 processed proteins & peptides Human genes 0.000 description 46
- 150000007523 nucleic acids Chemical class 0.000 description 45
- 229920001184 polypeptide Polymers 0.000 description 45
- 230000000694 effects Effects 0.000 description 39
- 102000039446 nucleic acids Human genes 0.000 description 38
- 108020004707 nucleic acids Proteins 0.000 description 38
- 230000014509 gene expression Effects 0.000 description 31
- 102000004169 proteins and genes Human genes 0.000 description 28
- 239000013598 vector Substances 0.000 description 28
- 235000018102 proteins Nutrition 0.000 description 26
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 25
- 239000000463 material Substances 0.000 description 25
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 24
- 239000008103 glucose Substances 0.000 description 23
- 239000000203 mixture Substances 0.000 description 23
- 108020004414 DNA Proteins 0.000 description 22
- 230000002538 fungal effect Effects 0.000 description 22
- 239000000047 product Substances 0.000 description 22
- 235000014680 Saccharomyces cerevisiae Nutrition 0.000 description 20
- 125000003275 alpha amino acid group Chemical group 0.000 description 20
- 102000040430 polynucleotide Human genes 0.000 description 20
- 108091033319 polynucleotide Proteins 0.000 description 20
- 239000002157 polynucleotide Substances 0.000 description 20
- 239000000758 substrate Substances 0.000 description 20
- 235000010633 broth Nutrition 0.000 description 19
- 239000002002 slurry Substances 0.000 description 17
- 241000196324 Embryophyta Species 0.000 description 16
- 239000000243 solution Substances 0.000 description 16
- 230000001580 bacterial effect Effects 0.000 description 15
- 239000007787 solid Substances 0.000 description 15
- 235000020357 syrup Nutrition 0.000 description 15
- 239000006188 syrup Substances 0.000 description 15
- 108091028043 Nucleic acid sequence Proteins 0.000 description 14
- 108010076504 Protein Sorting Signals Proteins 0.000 description 14
- 235000001014 amino acid Nutrition 0.000 description 14
- 239000013604 expression vector Substances 0.000 description 14
- 239000002609 medium Substances 0.000 description 14
- 240000005979 Hordeum vulgare Species 0.000 description 12
- 235000007340 Hordeum vulgare Nutrition 0.000 description 12
- 238000007792 addition Methods 0.000 description 12
- 229940024606 amino acid Drugs 0.000 description 12
- 150000001720 carbohydrates Chemical class 0.000 description 12
- 244000005700 microbiome Species 0.000 description 12
- 238000002360 preparation method Methods 0.000 description 12
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 12
- FFEARJCKVFRZRR-SCSAIBSYSA-N D-methionine Chemical compound CSCC[C@@H](N)C(O)=O FFEARJCKVFRZRR-SCSAIBSYSA-N 0.000 description 11
- 241000499912 Trichoderma reesei Species 0.000 description 11
- 150000001413 amino acids Chemical class 0.000 description 11
- 230000007062 hydrolysis Effects 0.000 description 11
- 238000006460 hydrolysis reaction Methods 0.000 description 11
- 241000894007 species Species 0.000 description 11
- 230000009466 transformation Effects 0.000 description 11
- 229920002245 Dextrose equivalent Polymers 0.000 description 10
- 125000000539 amino acid group Chemical group 0.000 description 10
- 241000228245 Aspergillus niger Species 0.000 description 9
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 9
- 238000003556 assay Methods 0.000 description 9
- 235000013339 cereals Nutrition 0.000 description 9
- 238000012217 deletion Methods 0.000 description 9
- 230000037430 deletion Effects 0.000 description 9
- 210000001938 protoplast Anatomy 0.000 description 9
- 238000006467 substitution reaction Methods 0.000 description 9
- 238000013518 transcription Methods 0.000 description 9
- 230000035897 transcription Effects 0.000 description 9
- 241000894006 Bacteria Species 0.000 description 8
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 8
- 239000000523 sample Substances 0.000 description 8
- 240000006439 Aspergillus oryzae Species 0.000 description 7
- 241000194108 Bacillus licheniformis Species 0.000 description 7
- 241000209140 Triticum Species 0.000 description 7
- 235000021307 Triticum Nutrition 0.000 description 7
- 240000008042 Zea mays Species 0.000 description 7
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 description 7
- 235000002017 Zea mays subsp mays Nutrition 0.000 description 7
- 239000002253 acid Substances 0.000 description 7
- 235000005822 corn Nutrition 0.000 description 7
- 238000000746 purification Methods 0.000 description 7
- 241000228212 Aspergillus Species 0.000 description 6
- 235000014469 Bacillus subtilis Nutrition 0.000 description 6
- WHUUTDBJXJRKMK-GSVOUGTGSA-N D-glutamic acid Chemical compound OC(=O)[C@H](N)CCC(O)=O WHUUTDBJXJRKMK-GSVOUGTGSA-N 0.000 description 6
- 240000003183 Manihot esculenta Species 0.000 description 6
- 235000016735 Manihot esculenta subsp esculenta Nutrition 0.000 description 6
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 6
- 241001557886 Trichoderma sp. Species 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 230000002255 enzymatic effect Effects 0.000 description 6
- 239000001963 growth medium Substances 0.000 description 6
- 235000019534 high fructose corn syrup Nutrition 0.000 description 6
- 238000004128 high performance liquid chromatography Methods 0.000 description 6
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 6
- 229920001223 polyethylene glycol Polymers 0.000 description 6
- 238000000926 separation method Methods 0.000 description 6
- 235000000346 sugar Nutrition 0.000 description 6
- 108091026890 Coding region Proteins 0.000 description 5
- AGPKZVBTJJNPAG-RFZPGFLSSA-N D-Isoleucine Chemical compound CC[C@@H](C)[C@@H](N)C(O)=O AGPKZVBTJJNPAG-RFZPGFLSSA-N 0.000 description 5
- ROHFNLRQFUQHCH-RXMQYKEDSA-N D-leucine Chemical compound CC(C)C[C@@H](N)C(O)=O ROHFNLRQFUQHCH-RXMQYKEDSA-N 0.000 description 5
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 5
- 108010028688 Isoamylase Proteins 0.000 description 5
- 240000006394 Sorghum bicolor Species 0.000 description 5
- 235000011684 Sorghum saccharatum Nutrition 0.000 description 5
- 230000008901 benefit Effects 0.000 description 5
- 239000011575 calcium Substances 0.000 description 5
- 230000000295 complement effect Effects 0.000 description 5
- 230000001086 cytosolic effect Effects 0.000 description 5
- 230000012010 growth Effects 0.000 description 5
- 238000009396 hybridization Methods 0.000 description 5
- 238000003780 insertion Methods 0.000 description 5
- 230000037431 insertion Effects 0.000 description 5
- 239000012528 membrane Substances 0.000 description 5
- 230000007935 neutral effect Effects 0.000 description 5
- 229920000642 polymer Polymers 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 235000002247 Aspergillus oryzae Nutrition 0.000 description 4
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 4
- DCXYFEDJOCDNAF-UWTATZPHSA-N D-Asparagine Chemical compound OC(=O)[C@H](N)CC(N)=O DCXYFEDJOCDNAF-UWTATZPHSA-N 0.000 description 4
- CKLJMWTZIZZHCS-UHFFFAOYSA-N D-OH-Asp Natural products OC(=O)C(N)CC(O)=O CKLJMWTZIZZHCS-UHFFFAOYSA-N 0.000 description 4
- CKLJMWTZIZZHCS-UWTATZPHSA-N D-aspartic acid Chemical compound OC(=O)[C@H](N)CC(O)=O CKLJMWTZIZZHCS-UWTATZPHSA-N 0.000 description 4
- RGHNJXZEOKUKBD-SQOUGZDYSA-N D-gluconic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)=O RGHNJXZEOKUKBD-SQOUGZDYSA-N 0.000 description 4
- ZDXPYRJPNDTMRX-GSVOUGTGSA-N D-glutamine Chemical compound OC(=O)[C@H](N)CCC(N)=O ZDXPYRJPNDTMRX-GSVOUGTGSA-N 0.000 description 4
- AYFVYJQAPQTCCC-STHAYSLISA-N D-threonine Chemical compound C[C@H](O)[C@@H](N)C(O)=O AYFVYJQAPQTCCC-STHAYSLISA-N 0.000 description 4
- KZSNJWFQEVHDMF-SCSAIBSYSA-N D-valine Chemical compound CC(C)[C@@H](N)C(O)=O KZSNJWFQEVHDMF-SCSAIBSYSA-N 0.000 description 4
- 241000588724 Escherichia coli Species 0.000 description 4
- 229930091371 Fructose Natural products 0.000 description 4
- 239000005715 Fructose Substances 0.000 description 4
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 4
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 4
- 240000007594 Oryza sativa Species 0.000 description 4
- 235000007164 Oryza sativa Nutrition 0.000 description 4
- WCUXLLCKKVVCTQ-UHFFFAOYSA-M Potassium chloride Chemical compound [Cl-].[K+] WCUXLLCKKVVCTQ-UHFFFAOYSA-M 0.000 description 4
- 241000187747 Streptomyces Species 0.000 description 4
- 235000013405 beer Nutrition 0.000 description 4
- 229960005069 calcium Drugs 0.000 description 4
- 229910052791 calcium Inorganic materials 0.000 description 4
- 235000014633 carbohydrates Nutrition 0.000 description 4
- 238000005119 centrifugation Methods 0.000 description 4
- 210000000349 chromosome Anatomy 0.000 description 4
- 210000004748 cultured cell Anatomy 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 239000004744 fabric Substances 0.000 description 4
- 238000001914 filtration Methods 0.000 description 4
- 239000000446 fuel Substances 0.000 description 4
- 239000000499 gel Substances 0.000 description 4
- 238000011534 incubation Methods 0.000 description 4
- 230000001939 inductive effect Effects 0.000 description 4
- 238000004255 ion exchange chromatography Methods 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 150000007524 organic acids Chemical class 0.000 description 4
- 239000013612 plasmid Substances 0.000 description 4
- 235000009566 rice Nutrition 0.000 description 4
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 4
- 238000000108 ultra-filtration Methods 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- OWEGMIWEEQEYGQ-UHFFFAOYSA-N 100676-05-9 Natural products OC1C(O)C(O)C(CO)OC1OCC1C(O)C(O)C(O)C(OC2C(OC(O)C(O)C2O)CO)O1 OWEGMIWEEQEYGQ-UHFFFAOYSA-N 0.000 description 3
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 3
- 229920000856 Amylose Polymers 0.000 description 3
- 244000063299 Bacillus subtilis Species 0.000 description 3
- 108010059892 Cellulase Proteins 0.000 description 3
- 229920002261 Corn starch Polymers 0.000 description 3
- XUJNEKJLAYXESH-UWTATZPHSA-N D-Cysteine Chemical compound SC[C@@H](N)C(O)=O XUJNEKJLAYXESH-UWTATZPHSA-N 0.000 description 3
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 3
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 3
- 241000193385 Geobacillus stearothermophilus Species 0.000 description 3
- 229920001503 Glucan Polymers 0.000 description 3
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 3
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- 239000004472 Lysine Substances 0.000 description 3
- 102100033448 Lysosomal alpha-glucosidase Human genes 0.000 description 3
- GUBGYTABKSRVRQ-PICCSMPSSA-N Maltose Natural products O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@@H](CO)OC(O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-PICCSMPSSA-N 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 3
- 241000209056 Secale Species 0.000 description 3
- 235000007238 Secale cereale Nutrition 0.000 description 3
- 244000061456 Solanum tuberosum Species 0.000 description 3
- 235000002595 Solanum tuberosum Nutrition 0.000 description 3
- 244000062793 Sorghum vulgare Species 0.000 description 3
- 101000895926 Streptomyces plicatus Endo-beta-N-acetylglucosaminidase H Proteins 0.000 description 3
- AYFVYJQAPQTCCC-UHFFFAOYSA-N THREONINE Chemical compound CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 239000000872 buffer Substances 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 239000008120 corn starch Substances 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000009837 dry grinding Methods 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 239000008187 granular material Substances 0.000 description 3
- 108010002430 hemicellulase Proteins 0.000 description 3
- 239000011630 iodine Substances 0.000 description 3
- 229910052740 iodine Inorganic materials 0.000 description 3
- 239000004310 lactic acid Substances 0.000 description 3
- 235000014655 lactic acid Nutrition 0.000 description 3
- 235000018977 lysine Nutrition 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 239000011159 matrix material Substances 0.000 description 3
- 229910052751 metal Inorganic materials 0.000 description 3
- 239000002184 metal Substances 0.000 description 3
- 230000000813 microbial effect Effects 0.000 description 3
- 235000019713 millet Nutrition 0.000 description 3
- 229910052757 nitrogen Inorganic materials 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 229920001542 oligosaccharide Polymers 0.000 description 3
- 239000000123 paper Substances 0.000 description 3
- 238000006116 polymerization reaction Methods 0.000 description 3
- 229920001282 polysaccharide Polymers 0.000 description 3
- 239000005017 polysaccharide Substances 0.000 description 3
- 235000019419 proteases Nutrition 0.000 description 3
- 238000011084 recovery Methods 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 239000000600 sorbitol Substances 0.000 description 3
- 235000010356 sorbitol Nutrition 0.000 description 3
- 239000003381 stabilizer Substances 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 238000001890 transfection Methods 0.000 description 3
- 230000014616 translation Effects 0.000 description 3
- 238000001238 wet grinding Methods 0.000 description 3
- 229940100445 wheat starch Drugs 0.000 description 3
- 235000020985 whole grains Nutrition 0.000 description 3
- 210000005253 yeast cell Anatomy 0.000 description 3
- DNIAPMSPPWPWGF-VKHMYHEASA-N (+)-propylene glycol Chemical compound C[C@H](O)CO DNIAPMSPPWPWGF-VKHMYHEASA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- YPFDHNVEDLHUCE-UHFFFAOYSA-N 1,3-propanediol Substances OCCCO YPFDHNVEDLHUCE-UHFFFAOYSA-N 0.000 description 2
- 229920000945 Amylopectin Polymers 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 241001513093 Aspergillus awamori Species 0.000 description 2
- 241000351920 Aspergillus nidulans Species 0.000 description 2
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 241000193830 Bacillus <bacterium> Species 0.000 description 2
- 241000193744 Bacillus amyloliquefaciens Species 0.000 description 2
- 239000002028 Biomass Substances 0.000 description 2
- BHPQYMZQTOCNFJ-UHFFFAOYSA-N Calcium cation Chemical compound [Ca+2] BHPQYMZQTOCNFJ-UHFFFAOYSA-N 0.000 description 2
- UXVMQQNJUSDDNG-UHFFFAOYSA-L Calcium chloride Chemical compound [Cl-].[Cl-].[Ca+2] UXVMQQNJUSDDNG-UHFFFAOYSA-L 0.000 description 2
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 2
- 229920002134 Carboxymethyl cellulose Polymers 0.000 description 2
- 108020004705 Codon Proteins 0.000 description 2
- 241000195493 Cryptophyta Species 0.000 description 2
- AHLPHDHHMVZTML-SCSAIBSYSA-N D-Ornithine Chemical compound NCCC[C@@H](N)C(O)=O AHLPHDHHMVZTML-SCSAIBSYSA-N 0.000 description 2
- ONIBWKKTOPOVIA-SCSAIBSYSA-N D-Proline Chemical compound OC(=O)[C@H]1CCCN1 ONIBWKKTOPOVIA-SCSAIBSYSA-N 0.000 description 2
- MTCFGRXMJLQNBG-UWTATZPHSA-N D-Serine Chemical compound OC[C@@H](N)C(O)=O MTCFGRXMJLQNBG-UWTATZPHSA-N 0.000 description 2
- QNAYBMKLOCPYGJ-UWTATZPHSA-N D-alanine Chemical compound C[C@@H](N)C(O)=O QNAYBMKLOCPYGJ-UWTATZPHSA-N 0.000 description 2
- ODKSFYDXXFIFQN-SCSAIBSYSA-N D-arginine Chemical compound OC(=O)[C@H](N)CCCNC(N)=N ODKSFYDXXFIFQN-SCSAIBSYSA-N 0.000 description 2
- RGHNJXZEOKUKBD-UHFFFAOYSA-N D-gluconic acid Natural products OCC(O)C(O)C(O)C(O)C(O)=O RGHNJXZEOKUKBD-UHFFFAOYSA-N 0.000 description 2
- HNDVDQJCIGZPNO-RXMQYKEDSA-N D-histidine Chemical compound OC(=O)[C@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-RXMQYKEDSA-N 0.000 description 2
- KDXKERNSBIXSRK-RXMQYKEDSA-N D-lysine Chemical compound NCCCC[C@@H](N)C(O)=O KDXKERNSBIXSRK-RXMQYKEDSA-N 0.000 description 2
- COLNVLDHVKWLRT-MRVPVSSYSA-N D-phenylalanine Chemical compound OC(=O)[C@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-MRVPVSSYSA-N 0.000 description 2
- SRBFZHDQGSBBOR-IOVATXLUSA-N D-xylopyranose Chemical compound O[C@@H]1COC(O)[C@H](O)[C@H]1O SRBFZHDQGSBBOR-IOVATXLUSA-N 0.000 description 2
- 229920001353 Dextrin Polymers 0.000 description 2
- 239000004375 Dextrin Substances 0.000 description 2
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 2
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 2
- 108050001049 Extracellular proteins Proteins 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 241000238631 Hexapoda Species 0.000 description 2
- 244000017020 Ipomoea batatas Species 0.000 description 2
- 235000002678 Ipomoea batatas Nutrition 0.000 description 2
- 108090000769 Isomerases Proteins 0.000 description 2
- 102000004195 Isomerases Human genes 0.000 description 2
- RRHGJUQNOFWUDK-UHFFFAOYSA-N Isoprene Chemical compound CC(=C)C=C RRHGJUQNOFWUDK-UHFFFAOYSA-N 0.000 description 2
- 241000235058 Komagataella pastoris Species 0.000 description 2
- WTDRDQBEARUVNC-LURJTMIESA-N L-DOPA Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C(O)=C1 WTDRDQBEARUVNC-LURJTMIESA-N 0.000 description 2
- WTDRDQBEARUVNC-UHFFFAOYSA-N L-Dopa Natural products OC(=O)C(N)CC1=CC=C(O)C(O)=C1 WTDRDQBEARUVNC-UHFFFAOYSA-N 0.000 description 2
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 2
- QEFRNWWLZKMPFJ-YGVKFDHGSA-N L-methionine S-oxide Chemical compound CS(=O)CC[C@H](N)C(O)=O QEFRNWWLZKMPFJ-YGVKFDHGSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- CSNNHWWHGAXBCP-UHFFFAOYSA-L Magnesium sulfate Chemical compound [Mg+2].[O-][S+2]([O-])([O-])[O-] CSNNHWWHGAXBCP-UHFFFAOYSA-L 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 241000235395 Mucor Species 0.000 description 2
- LRHPLDYGYMQRHN-UHFFFAOYSA-N N-Butanol Chemical compound CCCCO LRHPLDYGYMQRHN-UHFFFAOYSA-N 0.000 description 2
- 239000004677 Nylon Substances 0.000 description 2
- 241000235648 Pichia Species 0.000 description 2
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 2
- 241000235403 Rhizomucor miehei Species 0.000 description 2
- 241000235346 Schizosaccharomyces Species 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 241000228341 Talaromyces Species 0.000 description 2
- BGRWYDHXPHLNKA-UHFFFAOYSA-N Tetraacetylethylenediamine Chemical compound CC(=O)N(C(C)=O)CCN(C(C)=O)C(C)=O BGRWYDHXPHLNKA-UHFFFAOYSA-N 0.000 description 2
- 241000223257 Thermomyces Species 0.000 description 2
- 235000009430 Thespesia populnea Nutrition 0.000 description 2
- 102000004357 Transferases Human genes 0.000 description 2
- 108090000992 Transferases Proteins 0.000 description 2
- 241000894120 Trichoderma atroviride Species 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 108700040099 Xylose isomerases Proteins 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 108010028144 alpha-Glucosidases Proteins 0.000 description 2
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 2
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 2
- 235000011130 ammonium sulphate Nutrition 0.000 description 2
- 230000003625 amylolytic effect Effects 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 239000004599 antimicrobial Substances 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 108010047754 beta-Glucosidase Proteins 0.000 description 2
- 102000006995 beta-Glucosidase Human genes 0.000 description 2
- GUBGYTABKSRVRQ-QUYVBRFLSA-N beta-maltose Chemical compound OC[C@H]1O[C@H](O[C@H]2[C@H](O)[C@@H](O)[C@H](O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@@H]1O GUBGYTABKSRVRQ-QUYVBRFLSA-N 0.000 description 2
- 235000013361 beverage Nutrition 0.000 description 2
- 239000012620 biological material Substances 0.000 description 2
- 239000001110 calcium chloride Substances 0.000 description 2
- 235000011148 calcium chloride Nutrition 0.000 description 2
- 229910001628 calcium chloride Inorganic materials 0.000 description 2
- 229910001424 calcium ion Inorganic materials 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 235000010948 carboxy methyl cellulose Nutrition 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 229940106157 cellulase Drugs 0.000 description 2
- 239000000919 ceramic Substances 0.000 description 2
- 239000007795 chemical reaction product Substances 0.000 description 2
- 229960005091 chloramphenicol Drugs 0.000 description 2
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 2
- 235000015165 citric acid Nutrition 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 238000001816 cooling Methods 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 239000008367 deionised water Substances 0.000 description 2
- 229910021641 deionized water Inorganic materials 0.000 description 2
- 150000002016 disaccharides Chemical class 0.000 description 2
- 238000002474 experimental method Methods 0.000 description 2
- 235000019985 fermented beverage Nutrition 0.000 description 2
- 239000000835 fiber Substances 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 108010061330 glucan 1,4-alpha-maltohydrolase Proteins 0.000 description 2
- 239000000174 gluconic acid Substances 0.000 description 2
- 235000012208 gluconic acid Nutrition 0.000 description 2
- 235000013922 glutamic acid Nutrition 0.000 description 2
- 239000004220 glutamic acid Substances 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 238000000227 grinding Methods 0.000 description 2
- 239000000413 hydrolysate Substances 0.000 description 2
- 238000000338 in vitro Methods 0.000 description 2
- 230000002779 inactivation Effects 0.000 description 2
- 238000002347 injection Methods 0.000 description 2
- 239000007924 injection Substances 0.000 description 2
- 230000010354 integration Effects 0.000 description 2
- 230000000968 intestinal effect Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 238000006317 isomerization reaction Methods 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000001404 mediated effect Effects 0.000 description 2
- 238000002844 melting Methods 0.000 description 2
- 230000008018 melting Effects 0.000 description 2
- 108020004999 messenger RNA Proteins 0.000 description 2
- 239000002207 metabolite Substances 0.000 description 2
- 238000001471 micro-filtration Methods 0.000 description 2
- 210000000110 microvilli Anatomy 0.000 description 2
- 229920001778 nylon Polymers 0.000 description 2
- 150000002482 oligosaccharides Chemical class 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 230000035790 physiological processes and functions Effects 0.000 description 2
- 229940085127 phytase Drugs 0.000 description 2
- 230000008488 polyadenylation Effects 0.000 description 2
- 150000004804 polysaccharides Chemical class 0.000 description 2
- 229920000166 polytrimethylene carbonate Polymers 0.000 description 2
- 229920002451 polyvinyl alcohol Polymers 0.000 description 2
- 239000001103 potassium chloride Substances 0.000 description 2
- 235000011164 potassium chloride Nutrition 0.000 description 2
- 229920001592 potato starch Polymers 0.000 description 2
- 239000000843 powder Substances 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000000284 resting effect Effects 0.000 description 2
- 150000003839 salts Chemical class 0.000 description 2
- 238000005070 sampling Methods 0.000 description 2
- ATHGHQPFGPMSJY-UHFFFAOYSA-N spermidine Chemical compound NCCCCNCCCN ATHGHQPFGPMSJY-UHFFFAOYSA-N 0.000 description 2
- 230000004763 spore germination Effects 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- 230000002103 transcriptional effect Effects 0.000 description 2
- 238000010361 transduction Methods 0.000 description 2
- 230000026683 transduction Effects 0.000 description 2
- 238000013519 translation Methods 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- DPVHGFAJLZWDOC-PVXXTIHASA-N (2r,3s,4s,5r,6r)-2-(hydroxymethyl)-6-[(2r,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxane-3,4,5-triol;dihydrate Chemical compound O.O.O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 DPVHGFAJLZWDOC-PVXXTIHASA-N 0.000 description 1
- SMWADGDVGCZIGK-AXDSSHIGSA-N (2s)-5-phenylpyrrolidine-2-carboxylic acid Chemical compound N1[C@H](C(=O)O)CCC1C1=CC=CC=C1 SMWADGDVGCZIGK-AXDSSHIGSA-N 0.000 description 1
- JWBYADXJYCNKIE-SYKZBELTSA-N (2s)-5-phenylpyrrolidine-2-carboxylic acid;(2s)-pyrrolidine-2-carboxylic acid Chemical compound OC(=O)[C@@H]1CCCN1.N1[C@H](C(=O)O)CCC1C1=CC=CC=C1 JWBYADXJYCNKIE-SYKZBELTSA-N 0.000 description 1
- AEQDJSLRWYMAQI-UHFFFAOYSA-N 2,3,9,10-tetramethoxy-6,8,13,13a-tetrahydro-5H-isoquinolino[2,1-b]isoquinoline Chemical compound C1CN2CC(C(=C(OC)C=C3)OC)=C3CC2C2=C1C=C(OC)C(OC)=C2 AEQDJSLRWYMAQI-UHFFFAOYSA-N 0.000 description 1
- JAHNSTQSQJOJLO-UHFFFAOYSA-N 2-(3-fluorophenyl)-1h-imidazole Chemical compound FC1=CC=CC(C=2NC=CN=2)=C1 JAHNSTQSQJOJLO-UHFFFAOYSA-N 0.000 description 1
- UHTQHHLSGVOGQR-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-4-ium-1-yl]ethanesulfonate Chemical compound OCCN1CCN(CCS(O)(=O)=O)CC1.OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 UHTQHHLSGVOGQR-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- VBUYCZFBVCCYFD-NUNKFHFFSA-N 2-dehydro-L-idonic acid Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)C(=O)C(O)=O VBUYCZFBVCCYFD-NUNKFHFFSA-N 0.000 description 1
- MHKLKWCYGIBEQF-UHFFFAOYSA-N 4-(1,3-benzothiazol-2-ylsulfanyl)morpholine Chemical compound C1COCCN1SC1=NC2=CC=CC=C2S1 MHKLKWCYGIBEQF-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- ZMZGIVVRBMFZSG-UHFFFAOYSA-N 4-hydroxybenzohydrazide Chemical compound NNC(=O)C1=CC=C(O)C=C1 ZMZGIVVRBMFZSG-UHFFFAOYSA-N 0.000 description 1
- IZSRJDGCGRAUAR-MROZADKFSA-M 5-dehydro-D-gluconate Chemical compound OCC(=O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O IZSRJDGCGRAUAR-MROZADKFSA-M 0.000 description 1
- 238000010269 ABTS assay Methods 0.000 description 1
- 101150006240 AOX2 gene Proteins 0.000 description 1
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 1
- 108010013043 Acetylesterase Proteins 0.000 description 1
- 108010021809 Alcohol dehydrogenase Proteins 0.000 description 1
- 102000007698 Alcohol dehydrogenase Human genes 0.000 description 1
- 102000016912 Aldehyde Reductase Human genes 0.000 description 1
- 102100036826 Aldehyde oxidase Human genes 0.000 description 1
- 108010053754 Aldehyde reductase Proteins 0.000 description 1
- 241000534414 Anotopterus nikparini Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 108010017640 Aspartic Acid Proteases Proteins 0.000 description 1
- 102000004580 Aspartic Acid Proteases Human genes 0.000 description 1
- 241001225321 Aspergillus fumigatus Species 0.000 description 1
- 241000122821 Aspergillus kawachii Species 0.000 description 1
- 101000757144 Aspergillus niger Glucoamylase Proteins 0.000 description 1
- 241000228232 Aspergillus tubingensis Species 0.000 description 1
- 241000222400 Athelia Species 0.000 description 1
- 235000007319 Avena orientalis Nutrition 0.000 description 1
- 244000075850 Avena orientalis Species 0.000 description 1
- 241001112741 Bacillaceae Species 0.000 description 1
- 101500000959 Bacillus anthracis Protective antigen PA-20 Proteins 0.000 description 1
- 241000193749 Bacillus coagulans Species 0.000 description 1
- 241000193422 Bacillus lentus Species 0.000 description 1
- 241000194107 Bacillus megaterium Species 0.000 description 1
- 241000193388 Bacillus thuringiensis Species 0.000 description 1
- 108020000946 Bacterial DNA Proteins 0.000 description 1
- 108091005658 Basic proteases Proteins 0.000 description 1
- 108010006654 Bleomycin Proteins 0.000 description 1
- 238000009010 Bradford assay Methods 0.000 description 1
- 241000193764 Brevibacillus brevis Species 0.000 description 1
- 238000009631 Broth culture Methods 0.000 description 1
- 244000025254 Cannabis sativa Species 0.000 description 1
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 241000193403 Clostridium Species 0.000 description 1
- 241001509321 Clostridium thermoamylolyticum Species 0.000 description 1
- 108020004635 Complementary DNA Proteins 0.000 description 1
- 229920000742 Cotton Polymers 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-UHFFFAOYSA-N D-alpha-Ala Natural products CC([NH3+])C([O-])=O QNAYBMKLOCPYGJ-UHFFFAOYSA-N 0.000 description 1
- VBUYCZFBVCCYFD-UHFFFAOYSA-N D-arabino-2-Hexulosonic acid Natural products OCC(O)C(O)C(O)C(=O)C(O)=O VBUYCZFBVCCYFD-UHFFFAOYSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- PHOQVHQSTUBQQK-SQOUGZDYSA-N D-glucono-1,5-lactone Chemical compound OC[C@H]1OC(=O)[C@H](O)[C@@H](O)[C@@H]1O PHOQVHQSTUBQQK-SQOUGZDYSA-N 0.000 description 1
- 125000002353 D-glucosyl group Chemical group C1([C@H](O)[C@@H](O)[C@H](O)[C@H](O1)CO)* 0.000 description 1
- QIVBCDIJIAJPQS-SECBINFHSA-N D-tryptophane Chemical compound C1=CC=C2C(C[C@@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-SECBINFHSA-N 0.000 description 1
- OUYCCCASQSFEME-MRVPVSSYSA-N D-tyrosine Chemical compound OC(=O)[C@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-MRVPVSSYSA-N 0.000 description 1
- ZAQJHHRNXZUBTE-WUJLRWPWSA-N D-xylulose Chemical compound OC[C@@H](O)[C@H](O)C(=O)CO ZAQJHHRNXZUBTE-WUJLRWPWSA-N 0.000 description 1
- 108010058076 D-xylulose reductase Proteins 0.000 description 1
- 101100342470 Dictyostelium discoideum pkbA gene Proteins 0.000 description 1
- 241000588921 Enterobacteriaceae Species 0.000 description 1
- 101100385973 Escherichia coli (strain K12) cycA gene Proteins 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- IAYPIBMASNFSPL-UHFFFAOYSA-N Ethylene oxide Chemical compound C1CO1 IAYPIBMASNFSPL-UHFFFAOYSA-N 0.000 description 1
- 241000223218 Fusarium Species 0.000 description 1
- 241000223221 Fusarium oxysporum Species 0.000 description 1
- 108010001498 Galectin 1 Proteins 0.000 description 1
- 102100021736 Galectin-1 Human genes 0.000 description 1
- 102100024637 Galectin-10 Human genes 0.000 description 1
- 101001011019 Gallus gallus Gallinacin-10 Proteins 0.000 description 1
- 101001011021 Gallus gallus Gallinacin-12 Proteins 0.000 description 1
- 241000626621 Geobacillus Species 0.000 description 1
- 101100001650 Geobacillus stearothermophilus amyM gene Proteins 0.000 description 1
- 101100295959 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) arcB gene Proteins 0.000 description 1
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 1
- 101000928314 Homo sapiens Aldehyde oxidase Proteins 0.000 description 1
- 101000643895 Homo sapiens Ubiquitin carboxyl-terminal hydrolase 6 Proteins 0.000 description 1
- 241000223198 Humicola Species 0.000 description 1
- 241000223199 Humicola grisea Species 0.000 description 1
- 102000004157 Hydrolases Human genes 0.000 description 1
- 108090000604 Hydrolases Proteins 0.000 description 1
- AYRXSINWFIIFAE-SCLMCMATSA-N Isomaltose Natural products OC[C@H]1O[C@H](OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C=O)[C@@H](O)[C@@H](O)[C@@H]1O AYRXSINWFIIFAE-SCLMCMATSA-N 0.000 description 1
- 241000235649 Kluyveromyces Species 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-N L-arginine Chemical compound OC(=O)[C@@H](N)CCCN=C(N)N ODKSFYDXXFIFQN-BYPYZUCNSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- 125000000174 L-prolyl group Chemical group [H]N1C([H])([H])C([H])([H])C([H])([H])[C@@]1([H])C(*)=O 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 125000000510 L-tryptophano group Chemical group [H]C1=C([H])C([H])=C2N([H])C([H])=C(C([H])([H])[C@@]([H])(C(O[H])=O)N([H])[*])C2=C1[H] 0.000 description 1
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 1
- 241000186604 Lactobacillus reuteri Species 0.000 description 1
- 241000186610 Lactobacillus sp. Species 0.000 description 1
- 241000178948 Lactococcus sp. Species 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 241001627205 Leuconostoc sp. Species 0.000 description 1
- 239000007993 MOPS buffer Substances 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 229920002774 Maltodextrin Polymers 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 102100036617 Monoacylglycerol lipase ABHD2 Human genes 0.000 description 1
- 240000005561 Musa balbisiana Species 0.000 description 1
- 235000018290 Musa x paradisiaca Nutrition 0.000 description 1
- QPCDCPDFJACHGM-UHFFFAOYSA-N N,N-bis{2-[bis(carboxymethyl)amino]ethyl}glycine Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(=O)O)CCN(CC(O)=O)CC(O)=O QPCDCPDFJACHGM-UHFFFAOYSA-N 0.000 description 1
- 239000000020 Nitrocellulose Substances 0.000 description 1
- 238000000636 Northern blotting Methods 0.000 description 1
- 108091005461 Nucleic proteins Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 241000194109 Paenibacillus lautus Species 0.000 description 1
- 102100026367 Pancreatic alpha-amylase Human genes 0.000 description 1
- 241000604136 Pediococcus sp. Species 0.000 description 1
- 241001326562 Pezizomycotina Species 0.000 description 1
- 235000010627 Phaseolus vulgaris Nutrition 0.000 description 1
- 244000046052 Phaseolus vulgaris Species 0.000 description 1
- 241000235061 Pichia sp. Species 0.000 description 1
- 240000004713 Pisum sativum Species 0.000 description 1
- 235000010582 Pisum sativum Nutrition 0.000 description 1
- 241000209504 Poaceae Species 0.000 description 1
- 229920001030 Polyethylene Glycol 4000 Polymers 0.000 description 1
- HLCFGWHYROZGBI-JJKGCWMISA-M Potassium gluconate Chemical compound [K+].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O HLCFGWHYROZGBI-JJKGCWMISA-M 0.000 description 1
- 108010009736 Protein Hydrolysates Proteins 0.000 description 1
- 241000947836 Pseudomonadaceae Species 0.000 description 1
- 108010011939 Pyruvate Decarboxylase Proteins 0.000 description 1
- 238000010240 RT-PCR analysis Methods 0.000 description 1
- 241000959173 Rasamsonia emersonii Species 0.000 description 1
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 1
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 1
- 241000235402 Rhizomucor Species 0.000 description 1
- 101000968489 Rhizomucor miehei Lipase Proteins 0.000 description 1
- 241000235527 Rhizopus Species 0.000 description 1
- 241000235070 Saccharomyces Species 0.000 description 1
- 240000000111 Saccharum officinarum Species 0.000 description 1
- 235000007201 Saccharum officinarum Nutrition 0.000 description 1
- 229940125377 Selective β-Amyloid-Lowering Agent Drugs 0.000 description 1
- 229920005654 Sephadex Polymers 0.000 description 1
- 239000012507 Sephadex™ Substances 0.000 description 1
- HIWPGCMGAMJNRG-ACCAVRKYSA-N Sophorose Natural products O([C@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O)[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 HIWPGCMGAMJNRG-ACCAVRKYSA-N 0.000 description 1
- 102100026974 Sorbitol dehydrogenase Human genes 0.000 description 1
- 235000009337 Spinacia oleracea Nutrition 0.000 description 1
- 244000300264 Spinacia oleracea Species 0.000 description 1
- 244000057717 Streptococcus lactis Species 0.000 description 1
- 235000014897 Streptococcus lactis Nutrition 0.000 description 1
- 241000194022 Streptococcus sp. Species 0.000 description 1
- 241000187432 Streptomyces coelicolor Species 0.000 description 1
- 241001468239 Streptomyces murinus Species 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- 241001484137 Talaromyces leycettanus Species 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 244000269722 Thea sinensis Species 0.000 description 1
- 241000193447 Thermoanaerobacter thermohydrosulfuricus Species 0.000 description 1
- 101100157012 Thermoanaerobacterium saccharolyticum (strain DSM 8691 / JW/SL-YS485) xynB gene Proteins 0.000 description 1
- 241001136490 Thermomyces dupontii Species 0.000 description 1
- 241001494489 Thielavia Species 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 241000222354 Trametes Species 0.000 description 1
- 108700029229 Transcriptional Regulatory Elements Proteins 0.000 description 1
- 102000005924 Triose-Phosphate Isomerase Human genes 0.000 description 1
- 108700015934 Triose-phosphate isomerases Proteins 0.000 description 1
- 239000007984 Tris EDTA buffer Substances 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 235000019714 Triticale Nutrition 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102100021015 Ubiquitin carboxyl-terminal hydrolase 6 Human genes 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 241000588901 Zymomonas Species 0.000 description 1
- 108010048241 acetamidase Proteins 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 238000005273 aeration Methods 0.000 description 1
- 108010045649 agarase Proteins 0.000 description 1
- 230000032683 aging Effects 0.000 description 1
- 238000013019 agitation Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 235000013334 alcoholic beverage Nutrition 0.000 description 1
- 150000008051 alkyl sulfates Chemical class 0.000 description 1
- 101150069003 amdS gene Proteins 0.000 description 1
- 229960000723 ampicillin Drugs 0.000 description 1
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 1
- 238000005349 anion exchange Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- 239000013011 aqueous formulation Substances 0.000 description 1
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 1
- 101150008194 argB gene Proteins 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 229940091771 aspergillus fumigatus Drugs 0.000 description 1
- OHDRQQURAXLVGJ-HLVWOLMTSA-N azane;(2e)-3-ethyl-2-[(e)-(3-ethyl-6-sulfo-1,3-benzothiazol-2-ylidene)hydrazinylidene]-1,3-benzothiazole-6-sulfonic acid Chemical compound [NH4+].[NH4+].S/1C2=CC(S([O-])(=O)=O)=CC=C2N(CC)C\1=N/N=C1/SC2=CC(S([O-])(=O)=O)=CC=C2N1CC OHDRQQURAXLVGJ-HLVWOLMTSA-N 0.000 description 1
- 229940054340 bacillus coagulans Drugs 0.000 description 1
- 229940097012 bacillus thuringiensis Drugs 0.000 description 1
- 238000010923 batch production Methods 0.000 description 1
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 1
- UCMIRNVEIXFBKS-UHFFFAOYSA-N beta-alanine Chemical compound NCCC(O)=O UCMIRNVEIXFBKS-UHFFFAOYSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- HIWPGCMGAMJNRG-UHFFFAOYSA-N beta-sophorose Natural products OC1C(O)C(CO)OC(O)C1OC1C(O)C(O)C(O)C(CO)O1 HIWPGCMGAMJNRG-UHFFFAOYSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 229960001561 bleomycin Drugs 0.000 description 1
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 230000003139 buffering effect Effects 0.000 description 1
- OWBTYPJTUOEWEK-UHFFFAOYSA-N butane-2,3-diol Chemical compound CC(O)C(C)O OWBTYPJTUOEWEK-UHFFFAOYSA-N 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- 238000010804 cDNA synthesis Methods 0.000 description 1
- 239000004227 calcium gluconate Substances 0.000 description 1
- 235000013927 calcium gluconate Nutrition 0.000 description 1
- 229960004494 calcium gluconate Drugs 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- RKFLKNFLAJISPF-OGXRZFKVSA-L calcium;(3s,4s)-3,4,6-trihydroxy-2,5-dioxohexanoate Chemical compound [Ca+2].OCC(=O)[C@@H](O)[C@H](O)C(=O)C([O-])=O.OCC(=O)[C@@H](O)[C@H](O)C(=O)C([O-])=O RKFLKNFLAJISPF-OGXRZFKVSA-L 0.000 description 1
- NEEHYRZPVYRGPP-UHFFFAOYSA-L calcium;2,3,4,5,6-pentahydroxyhexanoate Chemical compound [Ca+2].OCC(O)C(O)C(O)C(O)C([O-])=O.OCC(O)C(O)C(O)C(O)C([O-])=O NEEHYRZPVYRGPP-UHFFFAOYSA-L 0.000 description 1
- 239000004202 carbamide Substances 0.000 description 1
- 235000011089 carbon dioxide Nutrition 0.000 description 1
- HJMZMZRCABDKKV-UHFFFAOYSA-N carbonocyanidic acid Chemical compound OC(=O)C#N HJMZMZRCABDKKV-UHFFFAOYSA-N 0.000 description 1
- 239000001768 carboxy methyl cellulose Substances 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 239000008112 carboxymethyl-cellulose Substances 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 101150114858 cbh2 gene Proteins 0.000 description 1
- 230000006727 cell loss Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 210000004671 cell-free system Anatomy 0.000 description 1
- 239000004464 cereal grain Substances 0.000 description 1
- 230000008859 change Effects 0.000 description 1
- 235000013351 cheese Nutrition 0.000 description 1
- 238000007385 chemical modification Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 235000019219 chocolate Nutrition 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 239000004927 clay Substances 0.000 description 1
- 238000004140 cleaning Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000013599 cloning vector Substances 0.000 description 1
- 239000012141 concentrate Substances 0.000 description 1
- 239000003636 conditioned culture medium Substances 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010924 continuous production Methods 0.000 description 1
- 238000012364 cultivation method Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 101150005799 dagA gene Proteins 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- CYQFCXCEBYINGO-IAGOWNOFSA-N delta1-THC Chemical compound C1=C(C)CC[C@H]2C(C)(C)OC3=CC(CCCCC)=CC(O)=C3[C@@H]21 CYQFCXCEBYINGO-IAGOWNOFSA-N 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- GSPKZYJPUDYKPI-UHFFFAOYSA-N diethoxy sulfate Chemical compound CCOOS(=O)(=O)OOCC GSPKZYJPUDYKPI-UHFFFAOYSA-N 0.000 description 1
- 239000012470 diluted sample Substances 0.000 description 1
- 229960001760 dimethyl sulfoxide Drugs 0.000 description 1
- 230000035622 drinking Effects 0.000 description 1
- 235000013601 eggs Nutrition 0.000 description 1
- 238000004520 electroporation Methods 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000011067 equilibration Methods 0.000 description 1
- 238000011156 evaluation Methods 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 238000005189 flocculation Methods 0.000 description 1
- 230000016615 flocculation Effects 0.000 description 1
- 230000004907 flux Effects 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 238000012224 gene deletion Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 229950006191 gluconic acid Drugs 0.000 description 1
- 235000012209 glucono delta-lactone Nutrition 0.000 description 1
- 239000000182 glucono-delta-lactone Substances 0.000 description 1
- 229960003681 gluconolactone Drugs 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 125000003147 glycosyl group Chemical group 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 239000010931 gold Substances 0.000 description 1
- 229910052737 gold Inorganic materials 0.000 description 1
- 230000005484 gravity Effects 0.000 description 1
- 235000013882 gravy Nutrition 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 239000000411 inducer Substances 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000000976 ink Substances 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 239000000543 intermediate Substances 0.000 description 1
- PNDPGZBMCMUPRI-UHFFFAOYSA-N iodine Chemical compound II PNDPGZBMCMUPRI-UHFFFAOYSA-N 0.000 description 1
- 238000005342 ion exchange Methods 0.000 description 1
- ODBLHEXUDAPZAU-UHFFFAOYSA-N isocitric acid Chemical compound OC(=O)C(O)C(C(O)=O)CC(O)=O ODBLHEXUDAPZAU-UHFFFAOYSA-N 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- DLRVVLDZNNYCBX-RTPHMHGBSA-N isomaltose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OC[C@@H]1[C@@H](O)[C@H](O)[C@@H](O)C(O)O1 DLRVVLDZNNYCBX-RTPHMHGBSA-N 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 108010032581 isopullulanase Proteins 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 108010059345 keratinase Proteins 0.000 description 1
- 229940001882 lactobacillus reuteri Drugs 0.000 description 1
- 235000021374 legumes Nutrition 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 101150039489 lysZ gene Proteins 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 229910052943 magnesium sulfate Inorganic materials 0.000 description 1
- 235000019341 magnesium sulphate Nutrition 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000005360 mashing Methods 0.000 description 1
- 235000012054 meals Nutrition 0.000 description 1
- 239000012092 media component Substances 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- LVHBHZANLOWSRM-UHFFFAOYSA-N methylenebutanedioic acid Natural products OC(=O)CC(=C)C(O)=O LVHBHZANLOWSRM-UHFFFAOYSA-N 0.000 description 1
- 238000000520 microinjection Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 238000003801 milling Methods 0.000 description 1
- 235000010755 mineral Nutrition 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- LPUQAYUQRXPFSQ-DFWYDOINSA-M monosodium L-glutamate Chemical compound [Na+].[O-]C(=O)[C@@H](N)CCC(O)=O LPUQAYUQRXPFSQ-DFWYDOINSA-M 0.000 description 1
- 239000004223 monosodium glutamate Substances 0.000 description 1
- 235000013923 monosodium glutamate Nutrition 0.000 description 1
- 230000035772 mutation Effects 0.000 description 1
- 101150095344 niaD gene Proteins 0.000 description 1
- 229920001220 nitrocellulos Polymers 0.000 description 1
- 239000002777 nucleoside Substances 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 229940012843 omega-3 fatty acid Drugs 0.000 description 1
- 235000020660 omega-3 fatty acid Nutrition 0.000 description 1
- 238000005457 optimization Methods 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 230000003204 osmotic effect Effects 0.000 description 1
- KHPXUQMNIQBQEV-UHFFFAOYSA-N oxaloacetic acid Chemical compound OC(=O)CC(=O)C(O)=O KHPXUQMNIQBQEV-UHFFFAOYSA-N 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 239000006072 paste Substances 0.000 description 1
- 229960003330 pentetic acid Drugs 0.000 description 1
- 150000002972 pentoses Chemical class 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 210000002824 peroxisome Anatomy 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 229960002816 potassium chloride Drugs 0.000 description 1
- 239000004224 potassium gluconate Substances 0.000 description 1
- 235000013926 potassium gluconate Nutrition 0.000 description 1
- 229960003189 potassium gluconate Drugs 0.000 description 1
- 235000012015 potatoes Nutrition 0.000 description 1
- 230000001376 precipitating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000001902 propagating effect Effects 0.000 description 1
- 235000008001 rakum palm Nutrition 0.000 description 1
- 239000012429 reaction media Substances 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 210000001995 reticulocyte Anatomy 0.000 description 1
- 229920002477 rna polymer Polymers 0.000 description 1
- 230000001523 saccharolytic effect Effects 0.000 description 1
- 238000005185 salting out Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 239000013605 shuttle vector Substances 0.000 description 1
- 235000020374 simple syrup Nutrition 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 235000010352 sodium erythorbate Nutrition 0.000 description 1
- 239000004320 sodium erythorbate Substances 0.000 description 1
- 239000000176 sodium gluconate Substances 0.000 description 1
- 235000012207 sodium gluconate Nutrition 0.000 description 1
- 229940005574 sodium gluconate Drugs 0.000 description 1
- RBWSWDPRDBEWCR-RKJRWTFHSA-N sodium;(2r)-2-[(2r)-3,4-dihydroxy-5-oxo-2h-furan-2-yl]-2-hydroxyethanolate Chemical compound [Na+].[O-]C[C@@H](O)[C@H]1OC(=O)C(O)=C1O RBWSWDPRDBEWCR-RKJRWTFHSA-N 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 239000002910 solid waste Substances 0.000 description 1
- 238000010563 solid-state fermentation Methods 0.000 description 1
- 239000002904 solvent Substances 0.000 description 1
- PZDOWFGHCNHPQD-VNNZMYODSA-N sophorose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](C=O)O[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O PZDOWFGHCNHPQD-VNNZMYODSA-N 0.000 description 1
- 239000004458 spent grain Substances 0.000 description 1
- 229940063673 spermidine Drugs 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 230000035882 stress Effects 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 230000005469 synchrotron radiation Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229920002994 synthetic fiber Polymers 0.000 description 1
- 239000012209 synthetic fiber Substances 0.000 description 1
- 235000013616 tea Nutrition 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 239000004753 textile Substances 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 230000007704 transition Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 241001515965 unidentified phage Species 0.000 description 1
- 238000003828 vacuum filtration Methods 0.000 description 1
- 229940088594 vitamin Drugs 0.000 description 1
- 235000013343 vitamin Nutrition 0.000 description 1
- 239000011782 vitamin Substances 0.000 description 1
- 229930003231 vitamin Natural products 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000002912 waste gas Substances 0.000 description 1
- 235000014101 wine Nutrition 0.000 description 1
- 241000228158 x Triticosecale Species 0.000 description 1
- 101150110790 xylB gene Proteins 0.000 description 1
Classifications
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02E—REDUCTION OF GREENHOUSE GAS [GHG] EMISSIONS, RELATED TO ENERGY GENERATION, TRANSMISSION OR DISTRIBUTION
- Y02E50/00—Technologies for the production of fuel of non-fossil origin
- Y02E50/10—Biofuels, e.g. bio-diesel
Landscapes
- Preparation Of Compounds By Using Micro-Organisms (AREA)
- Enzymes And Modification Thereof (AREA)
Abstract
Methods of improving yields of fermentation products including ethanol, improving yeast
health, decreasing end of fermentation DP2 levels, among other things, are disclosed
using trehalases.
Description
P/00/011 Regulation 3.2
Patents Act 1990
Name of Applicant: DANISCO US INC.
Actual Inventor(s): KOCOT, Boguslawa VROEMEN, Casper TORRES PAZMINO, Daniel E. CANNON JR., Donald Martin WARD, Donald E. FOERSTER, Hans SHETTY, Jayarama K. CLARKSON, Kathleen A. ALBERS, Keaton VAN BRUSSEL, Marco CHOW, Marina SCHEFFERS, Martijn SCHELLE, Michael W. WARD, Michael KRUITHOF, Paulien SALA, Rafael F. PRATT II, Robert James RABINOVICH, Roman BARENDS, Sharief
Address for Service: Houlihan2, Level 1, 70 Doncaster Road, Balwyn North, Victoria 3104, Australia
Invention Title: TREHALASE IN FERMENTATIONS
The following statement is a full description of this invention, including the best method of performing it known to the Applicant:
[001] The present Application is a Divisional Application from Australian Patent Application No. 2020204527 which in turn is a Divisional Application from Australian Patent Application No. 2018208775 which in turn is a Divisional Application from Australian Patent Application No. 2014342553. The entire disclosures of Australian Patent Application No.s 2020204527, 2014342553, and 2018208775 and the corresponding International Patent Application No. PCT/US2014/062578 are incorporated herein by reference. The Application Claims priority to US61/896,601 filed on 28 October 2013, which is herein incorporated by reference in its entirety.
[002] In fuel-ethanol production, a substantial percentage, approximately 50%, of the 'DP2 peak' (DP - degree of polymerization - equivalent to a disaccharide), at the end-of-fermentation (EOF) is trehalose, thought to be internally synthesized by yeast for osmolarity stabilization, (for example, for protection from desiccation from cellular environments of high ethanol, high glucose, etc.). Furthermore, these trehalose levels can increase with fermentation temperature, measured to be as high as 60-70% of the EOF DP2 levels. Since formation of trehalose is in direct competition with glucose utilization, this lost carbon will result in less than theoretical .0 yields of ethanol production. Nonetheless, the removal of trehalose for enhanced fermentation benefits could result in negative fermentation performance since trehalose is known to protect against stresses. However, there are literature references that suggest the hydrolysis of extracellular trehalose can be used for direct ethanol production as well as yeast growth (Basu et al., Biochem Boiphys. Acta 1760, 134-160 (2006)). The potential use of trehalase to lower EOF 'residual sugar' levels, while increasing ethanol yields, has industry interest.
[003] One molecule of trehalose is hydrolyzed to two molecules of glucose by the enzyme trehalase. Trehalase (a, a-trehalose-1-C-glucohydrolase, EC 3.2.1.28) has been reported from many organisms including prokaryotes, plants and animals. Though trehalose is not known to be present in mammals, trehalase enzyme is found to be present in the kidney brush border membrane and the intestinal villi membranes. Trehalose hydrolysis by trehalase enzyme is an important physiological process for various organisms, such as fungal spore germination, insect flight, and the resumption of growth in resting cells. At least two-types of trehalases, based on their pH optima, have been characterized; acid trehalases and neutral trehalases. It is also suggested that the neutral trehalase is mostly cytosolic while the acid trehalase is normally extracellularly secreted (Parrou JL et al., FEMS Yeast Res. (2005)5:503-11).
4 A
[004] Thus, there is a need in the industry to develop methods and compositions comprising trehalases that, among other things, improve ethanol yields, reduce DP2 peaks, and improve fermentation process.
[005] The present invention provides methods of increasing the production of ethanol from a
liquefact, comprising: fermenting the liquefact with a glucoamylase, a fermenting organism and
a trehalase; and recovering ethanol and other desired fermentation products at the end of the
fermentation, wherein the trehalase-treated fermentation yields increased ethanol compared to
the fermentation that is not treated with a trehalase. In another aspect, the invention provides
methods of decreasing the final concentrations of DP2 in a fermentation product, comprising:
fermenting a liquefact with a glucoamylase, a fermenting organism and a trehalase; and
recovering the desired fermentation products at the end of the fermentation wherein the DP2
concentrations are reduced compared to a fermentation not treated with a trehalase. In a
further aspect, the glucoamylase is DISTILLASE SSF. In another aspect, the trehalase is from
a eukaryote or a filamentous fungi, such as Trichoderma. In another aspect, the trehalase is an
acidic trehalase or a neutral trehalase. In another aspect, the trehalase is added at a
concentration of about 0.1 g/g DS to about 1000 g/g DS of liquefact, preferably at a
concentration of about 0.25 g/g DS to about 100 g/g DS of liquefact, more preferably at a
concentration of about 0.5 g/g DS to about 10 g/g DS of liquefact.
[006] The invention also provides methods of increasing the production of ethanol from a
liquefact, comprising fermenting the liquefact with a glucoamylase, a fermenting organism and
a fermentation-stable trehalase; and recovering ethanol and other desired fermentation
products at the end of the fermentation, wherein the trehalase-treated fermentation yields
increased ethanol compared to the fermentation that is not treated with a trehalase.
[007] The invention also provides methods of improving a fermentation reaction comprising
adding a trehalase, wherein the trehalase provides improved characteristics, such as healthier
yeast cells during fermentation, improved ethanol yield or extended ethanol production. The
trehalase may be added at the start of the fermentation or during fermentation.
[008] The invention also provides methods of improving ethanol production in a fermentation
reaction comprising maintaining trehalose levels below a threshold level throughout the
fermentation reaction, wherein the threshold level is below twice the trehalose concentration at
the start of the fermentation (%wt/v). The invention also provides methods of improving ethanol production in a fermentation reaction comprising adding trehalase to the fermentation reaction, thereby maintaining trehalose levels below a threshold level throughout the fermentation reaction, wherein the threshold level is below half the trehalose concentration that would have been present during fermentation if no trehalase was added to the process (%wt/v).
[009] The invention also provides methods as disclosed above, further comprising additional
enzymes, selected from the group consisting of acyl transferases, alpha-amylases, p-amylases,
alpha-galactosidases, arabinosidases, aryl esterases, beta-galactosidases, carrageenases,
catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4
glucanases, endo--mannanases, esterases, exo-mannanases, galactanases, glucoamylases,
hemicellulases, hyaluronidases, keratinases, laccases, lactases, ligninases, lipases,
lipoxygenases, mannanases, oxidases, pectate lyases, pectin acetyl esterases, pectinases,
pentosanases, peroxidases, phenoloxidases, phosphatases, phospholipases, phytases,
polygalacturonases, proteases, pullulanases, reductases, rhamnogalacturonases, 3
glucanases, tannases, transglutaminases, xylan acetyl-esterases, xylanases, xyloglucanases,
and xylosidases.
[0010] The invention also provides method for improving ethanol production in a fermentation
reaction comprising liquefact and backset by removing trehalose, comprising use of a
trehalase, wherein trehalose levels are lower than 0.01%w/v of the fermentation reaction. The
invention also provides a method for improving ethanol production in a fermentation reaction by
removing trehalose from the liquefaction comprising backset, comprising removal of trehalose
in backset by treatment with a trehalase, wherein trehalose levels are lower than 0.05%w/v of
the backset.
[0011] Figures 1-3 show concentrations of trehalose during fermentation for various trehalase concentrations and controls.
[0012] Figure 4 shows trehalose profile at 360C with and without trehalase.
[0013] Figure 5 shows DP2 profile at 360C with and without trehalase.
[0014] Figure 6 shows final ethanol production profile at 360C with and without trehalase.
[0015] Figures 7 and 8 show ethanol production profile for various fermentations with or without trehalase.
[0016] Figure 9 shows levels of trehalose in subsequent fermentations.
[0017] Described are compositions and methods comprising trehalases. Trehalases of the invention may be from a prokaryote or a eukaryote, such as from fungi, particularly from a Trichoderma fungus. Exemplary applications for the trehalase enzymes are for starch-based saccharification and fermentation. Saccharification and fermentation may be carried out simultaneously (SSF). These and other aspects of the compositions and methods are described in detail, below.
[0018] Prior to describing the various aspects and embodiments of the present compositions and methods, the following definitions and abbreviations are described.
1. Definitions and Abbreviations
[0019] In accordance with this detailed description, the following abbreviations and definitions apply. Note that the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise. Thus, for example, reference to "an enzyme" includes a plurality of such enzymes, and reference to "the dosage" includes reference to one or more dosages and equivalents thereof known to those skilled in the art, and so forth.
[0020] The present document is organized into a number of sections for ease of reading; .0 however, the reader will appreciate that statements made in one section may apply to other sections. In this manner, the headings used for different sections of the disclosure should not be construed as limiting.
[0021] Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art. The following terms are provided below.
1.1. Abbreviations and Acronyms
[0022] The following abbreviations/acronyms have the following meanings unless otherwise specified:
ABTS 2,2-azino-bis-3-ethylbenzothiazoline-6-sulfonic acid AE or AEO alcohol ethoxylate AESorAEOS alcohol ethoxysulfate AkAA Aspergillus kawachii a-amylase AnGA Aspergillus niger glucoamylase AOS a-olefinsulfonate AS alkyl sulfate cDNA complementary DNA CMC carboxymethylcellulose DE dextrose equivalent DNA deoxyribonucleic acid DPn degree of saccharide polymerization having n subunits ds or DS dry solids DTMPA diethylenetriaminepentaacetic acid EC Enzyme Commission EDTA ethylenediaminetetraacetic acid EO ethylene oxide (polymer fragment) EOF End of Fermentation GA glucoamylase GAU/g ds glucoamylase activity unit/gram dry solids HFCS high fructose corn syrup HgGA Humicola grisea glucoamylase IPTG isopropyl P-D-thiogalactoside IRS insoluble residual starch kDa kiloDalton LAS linear alkylbenzenesulfonate .0 LAT, BLA B. licheniformis amylase MW molecular weight MWU modified Wohlgemuth unit; 1.6x10-5 mg/MWU= unit of activity NCBI National Center for Biotechnology Information NOBS nonanoyloxybenzenesulfonate .5 NTA nitriloacetic acid OxAm Purastar HPAM 5000L (Danisco US Inc.) PAHBAH p-hydroxybenzoic acid hydrazide PEG polyethyleneglycol pl isoelectric point PI performance index ppm parts per million, e.g., tg protein per gram dry solid PVA poly(vinyl alcohol) PVP poly(vinylpyrrolidone) RCF relative centrifugal/centripetal force (i.e., x gravity) RNA ribonucleic acid SAS alkanesulfonate SDS-PAGE sodium dodecyl sulfate polyacrylamide gel electrophoresis SSF simultaneous saccharification and fermentation SSU/g solid soluble starch unit/gram dry solids sp. species
TAED tetraacetylethylenediamine Tm melting temperature TrGA Trichodermareesei glucoamylase w/v weight/volume w/w weight/weight v/v volume/volume wt% weight percent °C degrees Centigrade H 20 water dH 20 or DI deionized water dlH 20 deionized water, Milli-Q filtration g or gm grams pg micrograms mg milligrams kg kilograms pL and pl microliters mL and ml milliliters mm millimeters pm micrometer .0 M molar mM millimolar pM micromolar U units sec seconds min(s) minute/minutes hr(s) hour/hours DO dissolved oxygen Ncm Newton centimeter ETOH ethanol eq. equivalents N normal MWCO molecular weight cut-off SSRL Stanford Synchrotron Radiation Lightsource PDB Protein Database CAZy Carbohydrate-Active Enzymes database Tris-HCI tris(hydroxymethyl)aminomethane hydrochloride HEPES 4-(2-hydroxyethyl)-1-piperazineethanesulfonic acid mS/cm milli-Siemens/cm
CV column volumes DP2 disaccharide HPLC high-performance liquid chromatography HPAEC-PAD high-performance anion exchange chromatography with pulsed amperometric detection IC ion chromatography RID differential refractive index detector Da Dalton (molecular weight)...since you mention kDa as kiloDalton
1.2. Definitions
[0023] The term "trehalase" refers to enzymes that catalyze generation of two glucose molecules (a-D glucose and p-D glucose) from a trehalose molecule. Trehalase (a, a-trehalose 1-C-glucohydrolase, EC 3.2.1.28).
[0024] The terms "amylase" or "amylolytic enzyme" refer to an enzyme that is, among other things, capable of catalyzing the degradation of starch. a-amylases are hydrolases that cleave the a-D-(1->4) O-glycosidic linkages in starch. Generally, a-amylases(EC3.2.1.1;a-D-(1->4) glucan glucanohydrolase) are defined as endo-acting enzymes cleaving a-D-(1->4) 0 glycosidic linkages within the starch molecule in a random fashion yielding polysaccharides containing three or more (1-4)-a-linked D-glucose units. In contrast, the exo-acting amylolytic .0 enzymes, such as P-amylases (EC 3.2.1.2; a-D-(1->4)-glucan maltohydrolase) and some product-specific amylases like maltogenic a-amylase (EC 3.2.1.133) cleave the polysaccharide molecule from the non-reducing end of the substrate. P-amylases, a-glucosidases (EC 3.2.1.20; a-D-glucoside glucohydrolase), glucoamylase (EC 3.2.1.3; a-D-(1->4)-glucan glucohydrolase), and product-specific amylases like the maltotetraosidases (EC 3.2.1.60) and the maltohexaosidases (EC 3.2.1.98) can produce malto-oligosaccharides of a specific length or enriched syrups of specific maltooligosaccharides. A preferred glucoamylase is TrGA variant of amino acid seqeunce: SVDDFISTETPIALNNLLCNVGPDGCRAFGTSAGAVIASPSTIDPDYYYMWTRDSALVFKNLIDR FTETYDAGLQRRIEQYITAQVTLQGLSNPSGSLADGSGLGEPKFELTLKPFTGNWGRPQRDGP ALRAIALIGYSKWLINNNYQSTVSNVIWPIVRNDLNYVAQYWNQTGFDLWEEVNGSSFFTVAN QHRALVEGATLAATLGQSGSAYSSVAPQVLCFLQRFWVSSGGYVDSNINTNEGRTGKDVNSV LTSIHTFDPNLGCDAGTFQPCSDKALSNLKVVVDSFRSYGVNKGIPAGAAVAIGRYAEDVYYN GNPWYLATFAAAEQLYDAIYVWKKTGSITVTATSLAFFQELVPGVTAGTYSSSSSTFTNIINAVS TYADGFLSEAAKYVPADGSLAEQFDRNSGTPLSAVHLTWSYASFLTAAARRAGIVPPSWANSS ASTIPSTCSGASVVGSYSRPTATSFPPSQTPKPGVPSGTPYTPLPCATPTSVAVTFHELVSTQF GHTVKVAGNAAALGNWSTSAAVALDAVNYRDNHPLWIGTVNLEAGDVVEYKYIIVGQDGSVT WESDPNHTYTVPAVACVTQVVKEDTWQS (SEQ ID NO: 3); as disclosed in USPN 8058033.
[0025] "Enzyme units" herein refer to the amount of product formed per time under the specified conditions of the assay. For example, a "glucoamylase activity unit" (GAU) is defined as the amount of enzyme that produces 1 g of glucose per hour from soluble starch substrate (4% DS) at 60°C, pH 4.2. A "soluble starch unit" (SSU) is the amount of enzyme that produces 1 mg of glucose per minute from soluble starch substrate (4% DS) at pH 4.5, 50°C. DS refers to "dry solids."
[0026] The term "starch" refers to any material comprised of the complex polysaccharide carbohydrates of plants, comprised of amylose and amylopectin with the formula (C 6 H0 O5 )x, wherein X can be any number. The term includes plant-based materials such as grains, cereal, grasses, tubers and roots, and more specifically materials obtained from wheat, barley, corn, rye, rice, sorghum, brans, cassava, millet, milo, potato, sweet potato, and tapioca. The term "starch" includes granular starch. The term "granular starch" refers to raw, i.e., uncooked starch, e.g., starch that has not been subject to gelatinization.
[0027] The term 'liquefact' refers to a starch that has undergone liquefaction.
[0028] The terms, "wild-type," "parental," or "reference," with respect to a polypeptide, refer to a naturally-occurring polypeptide that does not include a man-made substitution, insertion, or deletion at one or more amino acid positions. Similarly, the terms "wild-type," "parental," or "reference," with respect to a polynucleotide, refer to a naturally-occurring polynucleotide that does not include a man-made nucleoside change. However, note that a polynucleotide .0 encoding a wild-type, parental, or reference polypeptide is not limited to a naturally-occurring polynucleotide, and encompasses any polynucleotide encoding the wild-type, parental, or reference polypeptide.
[0029] Reference to the wild-type polypeptide is understood to include the mature form of the polypeptide. A "mature" polypeptide or variant, thereof, is one in which a signal sequence is absent, for example, cleaved from an immature form of the polypeptide during or following expression of the polypeptide.
[0030] The term "variant," with respect to a polypeptide, refers to a polypeptide that differs from a specified wild-type, parental, or reference polypeptide in that it includes one or more naturally occurring or man-made substitutions, insertions, or deletions of an amino acid. Similarly, the term "variant," with respect to a polynucleotide, refers to a polynucleotide that differs in nucleotide sequence from a specified wild-type, parental, or reference polynucleotide. The identity of the wild-type, parental, or reference polypeptide or polynucleotide will be apparent from context.
[0031] The term "recombinant," when used in reference to a subject cell, nucleic acid, protein or vector, indicates that the subject has been modified from its native state. Thus, for example, recombinant cells express genes that are not found within the native (non-recombinant) form of the cell, or express native genes at different levels or under different conditions than found in nature. Recombinant nucleic acids differ from a native sequence by one or more nucleotides and/or are operably linked to heterologous sequences, e.g., a heterologous promoter in an expression vector. Recombinant proteins may differ from a native sequence by one or more amino acids and/or are fused with heterologous sequences. A vector comprising a nucleic acid encoding an amylase is a recombinant vector.
[0032] The terms "recovered," "isolated," and "separated," refer to a compound, protein (polypeptides), cell, nucleic acid, amino acid, or other specified material or component that is removed from at least one other material or component with which it is naturally associated as found in nature. An "isolated" polypeptides, thereof, includes, but is not limited to, a culture broth containing secreted polypeptide expressed in a heterologous host cell.
[0033] The term "purified" refers to material (e.g., an isolated polypeptide or polynucleotide) that is in a relatively pure state, e.g., at least about 90% pure, at least about 95% pure, at least about 98% pure, or even at least about 99% pure.
[0034] The term "enriched" refers to material (e.g., an isolated polypeptide or polynucleotide) that is in about 50% pure, at least about 60% pure, at least about 70% pure, or at least about 90% pure or more.
[0035] The terms "thermostable" and "thermostability," with reference to an enzyme, such as .0 an amylase or a trehalase enzyme, refer to the ability of the enzyme to retain activity after exposure to an elevated temperature. The thermostability of an enzyme, such as an amylase enzyme, is measured by its half-life (t1 2) given in minutes, hours, or days, during which half the enzyme activity is lost under defined conditions. The half-life may be calculated by measuring residual a-amylase activity following exposure to (i.e., challenge by) an elevated temperature.
[0036] A "pH range," with reference to an enzyme, refers to the range of pH values under which the enzyme exhibits catalytic activity.
[0037] The terms "pH stable" and "pH stability," with reference to an enzyme, relate to the ability of the enzyme to retain activity over a wide range of pH values for a predetermined period of time (e.g., 15 min., 30 min., 1 hour).
[0038] The term "amino acid sequence" is synonymous with the terms "polypeptide," "protein," and "peptide," and are used interchangeably. Where such amino acid sequences exhibit activity, they may be referred to as an "enzyme." The conventional one-letter or three-letter codes for amino acid residues are used, with amino acid sequences being presented in the standard amino-to-carboxy terminal orientation (i.e., N->C).
[0039] The term "nucleic acid" encompasses DNA, RNA, heteroduplexes, and synthetic molecules capable of encoding a polypeptide. Nucleic acids may be single stranded or double stranded, and may be chemical modifications. The terms "nucleic acid" and "polynucleotide" are used interchangeably. Because the genetic code is degenerate, more than one codon may be used to encode a particular amino acid, and the present compositions and methods encompass nucleotide sequences that encode a particular amino acid sequence. Unless otherwise indicated, nucleic acid sequences are presented in 5'-to-3' orientation.
[0040] "Hybridization" refers to the process by which one strand of nucleic acid forms a duplex with, i.e., base pairs with, a complementary strand, as occurs during blot hybridization techniques and PCR techniques. Stringent hybridization conditions are exemplified by hybridization under the following conditions: 650C and 0.1X SSC (where 1X SSC = 0.15 M NaCl,0.015MNa 3 citrate,pH7.0). Hybridized, duplex nucleic acids are characterized by a melting temperature (Tm), where one half of the hybridized nucleic acids are unpaired with the complementary strand. Mismatched nucleotides within the duplex lower the Tm.
[0041] A "synthetic" molecule is produced by in vitro chemical or enzymatic synthesis rather than by an organism.
[0042] The terms "transformed," "stably transformed," and "transgenic," used with reference to a cell means that the cell contains a non-native (e.g., heterologous) nucleic acid sequence integrated into its genome or carried as an episome that is maintained through multiple .0 generations. A non-native sequence may be an endogenous sequence.
[0043] The term "introduced" in the context of inserting a nucleic acid sequence into a cell, means "transfection", "transformation" or "transduction," as known in the art.
[0044] A "host strain" or "host cell" is an organism into which an expression vector, phage, virus, or other DNA construct, including a polynucleotide encoding a polypeptide of interest (e.g., an amylase) has been introduced. Exemplary host strains are microorganism cells (e.g., bacteria, filamentous fungi, and yeast) capable of expressing the polypeptide of interest and/or fermenting saccharides. The term "host cell" includes protoplasts created from cells.
[0045] The term "heterologous" with reference to a polynucleotide or protein refers to a polynucleotide or protein that does not naturally occur in a host cell.
[0046] The term "endogenous" with reference to a polynucleotide or protein refers to a polynucleotide or protein that occurs naturally in the host cell.
[0047] The term "expression" refers to the process by which a polypeptide is produced based on a nucleic acid sequence. The process includes both transcription and translation.
[0048] A "selective marker" or "selectable marker" refers to a gene capable of being expressed in a host to facilitate selection of host cells carrying the gene. Examples of selectable markers include but are not limited to antimicrobials (e.g., hygromycin, bleomycin, or chloramphenicol) and/or genes that confer a metabolic advantage, such as a nutritional advantage on the host cell.
[0049] A "vector" refers to a polynucleotide sequence designed to introduce nucleic acids into one or more cell types. Vectors include cloning vectors, expression vectors, shuttle vectors, plasmids, phage particles, cassettes and the like.
[0050] An "expression vector" refers to a DNA construct comprising a DNA sequence encoding a polypeptide of interest, which coding sequence is operably linked to a suitable control sequence capable of effecting expression of the DNA in a suitable host. Such control sequences may include a promoter to effect transcription, an optional operator sequence to control transcription, a sequence encoding suitable ribosome binding sites on the mRNA, enhancers and sequences which control termination of transcription and translation.
[0051] The term "operably linked" means that specified components are in a relationship (including but not limited to juxtaposition) permitting them to function in an intended manner. For example, a regulatory sequence is operably linked to a coding sequence such that expression of the coding sequence is under control of the regulatory sequences.
[0052] A "signal sequence" is a sequence of amino acids attached to the N-terminal portion of .0 a protein, which facilitates the secretion of the protein outside the cell. The mature form of an extracellular protein lacks the signal sequence, which is cleaved off during the secretion process.
[0053] "Biologically active" refer to a sequence having a specified biological activity, such an enzymatic activity.
[0054] The term "specific activity" refers to the number of moles of substrate that can be converted to product by an enzyme or enzyme preparation per unit time under specific conditions. Specific activity is generally expressed as units (U)/mg of protein.
[0055] As used herein, "water hardness" is a measure of the minerals (e.g., calcium and magnesium) present in water.
[0056] As used herein, an "effective amount of amylase," or similar expressions, refers to an amount of amylase sufficient to produce a visible, or otherwise measurable amount of starch hydrolysis in an particular application. Starch hydrolysis may result in, e.g., a visible cleaning of fabrics or dishware, reduced viscosity of a starch slurry or mash, and the like.
[0057] A "swatch" is a piece of material such as a fabric that has a stain applied thereto. The material can be, for example, fabrics made of cotton, polyester or mixtures of natural and synthetic fibers. The swatch can further be paper, such as filter paper or nitrocellulose, or a piece of a hard material such as ceramic, metal, or glass. For amylases, the stain is starch based, but can include blood, milk, ink, grass, tea, wine, spinach, gravy, chocolate, egg, cheese, clay, pigment, oil, or mixtures of these compounds.
[0058] A "smaller swatch" is a section of the swatch that has been cut with a single hole punch device, or has been cut with a custom manufactured 96-hole punch device, where the pattern of the multi-hole punch is matched to standard 96-well microtiter plates, or the section has been otherwise removed from the swatch. The swatch can be of textile, paper, metal, or other suitable material. The smaller swatch can have the stain affixed either before or after it is placed into the well of a 24-, 48- or 96-well microtiter plate. The smaller swatch can also be made by applying a stain to a small piece of material. For example, the smaller swatch can be a stained piece of fabric 5/8" or 0.25" in diameter. The custom manufactured punch is designed in such a manner that it delivers 96 swatches simultaneously to all wells of a 96-well plate. The device allows delivery of more than one swatch per well by simply loading the same 96-well plate multiple times. Multi-hole punch devices can be conceived of to deliver simultaneously swatches to any format plate, including but not limited to 24-well, 48-well, and 96-well plates. In another conceivable method, the soiled test platform can be a bead made of metal, plastic, glass, ceramic, or another suitable material that is coated with the soil substrate. The one or more coated beads are then placed into wells of 96-, 48-, or 24-well plates or larger .0 formats, containing suitable buffer and enzyme.
[0059] "A cultured cell material comprising an enzyme" or similar language, refers to a cell lysate or supernatant (including media) that includes an enzyme as a component. The cell material may be from a heterologous host that is grown in culture for the purpose of producing the enzyme.
[0060] "Percent sequence identity" means that a particular sequence has at least a certain percentage of amino acid residues identical to those in a specified reference sequence, when aligned using the CLUSTAL W algorithm with default parameters. See Thompson et al. (1994) Nucleic Acids Res. 22:4673-4680. Default parameters for the CLUSTAL W algorithm are:
Gap opening penalty: 10.0 Gap extension penalty: 0.05 Protein weight matrix: BLOSUM series DNA weight matrix: IUB Delay divergent sequences %: 40 Gap separation distance: 8 DNA transitions weight: 0.50 List hydrophilic residues: GPSNDQEKR
Use negative matrix: OFF Toggle Residue specific penalties: ON Toggle hydrophilic penalties: ON Toggle end gap separation penalty OFF.
[0061] Deletions are counted as non-identical residues, compared to a reference sequence. Deletions occurring at either termini are included. For example, a variant 500-amino acid residue polypeptide with a deletion of five amino acid residues from the C-terminus would have a percent sequence identity of 99% (495/500 identical residues x 100) relative to the parent polypeptide. Such a variant would be encompassed by the language, "a variant having at least 99% sequence identity to the parent."
[0062] "Fused" polypeptide sequences are connected, i.e., operably linked, via a peptide bond between two subject polypeptide sequences.
[0063] The term "filamentous fungi" refers to all filamentous forms of the subdivision Eumycotina, particularly Pezizomycotina species.
[0064] The term "degree of polymerization" (DP) refers to the number (n) of anhydro glucopyranose units in a given saccharide. Examples of DP1 are the monosaccharides glucose and fructose. Examples of DP2 are the disaccharides maltose and sucrose. The term "DE," or "dextrose equivalent," is defined as the percentage of reducing sugar, i.e., D-glucose, as a fraction of total carbohydrate in a syrup.
.0 [0065] The term "dry solids content" (ds) refers to the total solids of a slurry in a dry weight percent basis. The term "slurry" refers to an aqueous mixture containing insoluble solids.
[0066] The phrase "simultaneous saccharification and fermentation (SSF)" refers to a process in the production of biochemicals in which a microbial organism, such as an ethanologenic microorganism, and at least one enzyme, such as an amylase, are present during the same process step. SSF includes the contemporaneous hydrolysis of starch substrates (granular, liquefied, or solubilized) to saccharides, including glucose, and the fermentation of the saccharides into alcohol or other biochemical or biomaterial in the same reactor vessel.
[0067] An "ethanologenic microorganism" refers to a microorganism with the ability to convert a sugar or oligosaccharide to ethanol.
[0068] The term "fermented beverage" refers to any beverage produced by a method comprising a fermentation process, such as a microbial fermentation, e.g., a bacterial and/or fungal fermentation. "Beer" is an example of such a fermented beverage, and the term "beer" is meant to comprise any fermented wort produced by fermentation/brewing of a starch-containing plant material. Often, beer is produced exclusively from malt or adjunct, or any combination of malt and adjunct.
[0069] The term "malt" refers to any malted cereal grain, such as malted barley or wheat.
[0070] The term "adjunct" refers to any starch and/or sugar containing plant material that is not malt, such as barley or wheat malt. Examples of adjuncts include common corn grits, refined corn grits, brewer's milled yeast, rice, sorghum, refined corn starch, barley, barley starch, dehusked barley, wheat, wheat starch, torrified cereal, cereal flakes, rye, oats, potato, tapioca, cassava and syrups, such as corn syrup, sugar cane syrup, inverted sugar syrup, barley and/or wheat syrups, and the like.
[0071] The term "mash" refers to an aqueous slurry of any starch and/or sugar containing plant material, such as grist, e.g., comprising crushed barley malt, crushed barley, and/or other adjunct or a combination thereof, mixed with water later to be separated into wort and spent grains.
[0072] The term "wort" refers to the unfermented liquor run-off following extracting the grist during mashing.
[0073] "Iodine-positive starch" or "IPS" refers to (1) amylose that is not hydrolyzed after liquefaction and saccharification, or (2) a retrograded starch polymer. When saccharified starch or saccharide liquor is tested with iodine, the high DPn amylose or the retrograded starch polymer binds iodine and produces a characteristic blue color. The saccharide liquor is thus .0 termed "iodine-positive saccharide," "blue saccharide," or "blue sac."
[0074] The terms "retrograded starch" or "starch retrogradation" refer to changes that occur spontaneously in a starch paste or gel on ageing.
[0075] The term "about" refers to ±15% to the referenced value.
2. Enzymes of the Invention
[0076] Trehalases
[0077] Trehalases are enzymes that catalyze generation of two glucose molecules (a-D glucose and p-D glucose) from a trehalose molecule. Trehalase (a, a-trehalose-1-C glucohydrolase, EC 3.2.1.28) has been reported from many organisms including prokaryotes, plants and animals. Though trehalose is not known to be present in mammals, trehalase enzyme is found to be present in the kidney brush border membrane and the intestinal villi membranes. Trehalose hydrolysis by trehalase enzyme is an important physiological process for various organisms, such as fungal spore germination, insect flight, and the resumption of growth in resting cells. At least two-types of trehalases, based on their pH optima, are known; acid (extracellular) trehalases and neutral (cytosolic) trehalases. A trehalase of the invention may be isolated from an organism of interest using molecular biology techniques known in the art. Trehalase may be derived from a prokaryote or a eukaryote. For example, Trichoderma fungus is known to have at least two trehalases, acidic (extracellular) trehalases and neutral (cytosolic) trehalases. A prokaryotic trehalase is also available: MEGAZYMES (Megazymes International, Ireland). Trehalases may be a variant trehalase that may show improved properties over its parent molecule.
[0078] In some embodiments, the present enzymes have a defined degree of amino acid sequence identity to other enzymes, for example, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or even at least 99%, amino acid sequence identity. In some embodiments, the present enzymes are derived from a parental enzyme having a defined degree of amino acid sequence identity, for example, at least 80%, at least 85%, at least 90%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99%, amino acid sequence identity.
[0079] In some embodiments, the present enzymes comprise conservative substitution of one or several amino acid residues relative to the amino acid sequence of a parent enzyme. Exemplary conservative amino acid substitutions are listed in the Table 1Some conservative mutations can be produced by genetic manipulation, while others are produced by introducing synthetic amino acids into a polypeptide or other means.Table 1. Conservative amino acid .0 substitutions For Amino Cod Replace with any of Acid e Alanine A D-Ala, Gly, beta-Ala, L-Cys, D-Cys Arginine R D-Arg, Lys, D-Lys, homo-Arg, D-homo-Arg, Met, lie, D-Met, D-Ile, Orn, D-Orn Asparagine N D-Asn, Asp, D-Asp, Glu, D-Glu, GIn, D-Gln Aspartic Acid D D-Asp, D-Asn, Asn, Glu, D-Glu, GIn, D-Gln Cysteine C D-Cys, S-Me-Cys, Met, D-Met, Thr, D-Thr Glutamine Q D-Gln, Asn, D-Asn, Glu, D-Glu, Asp, D-Asp Glutamic Acid E D-Glu, D-Asp, Asp, Asn, D-Asn, GIn, D-Gln Glycine G Ala, D-Ala, Pro, D-Pro, b-Ala, Acp Isoleucine I D-Ile, Val, D-Val, Leu, D-Leu, Met, D-Met Leucine L D-Leu, Val, D-Val, Leu, D-Leu, Met, D-Met Lysine K D-Lys, Arg, D-Arg, homo-Arg, D-homo-Arg, Met, D-Met, lie, D-Ile, Orn, D-Orn Methionine M D-Met, S-Me-Cys, lie, D-Ile, Leu, D-Leu, Val, D-Val Phenylalanine F D-Phe, Tyr, D-Thr, L-Dopa, His, D-His, Trp, D-Trp, Trans-3,4, or 5-phenylproline, cis-3,4,or 5-phenylproline Proline P D-Pro, L-1-thioazolidine-4- carboxylic acid, D-or L-1-oxazolidine 4-carboxylic acid Serine S D-Ser, Thr, D-Thr, allo-Thr, Met, D-Met, Met(O), D-Met(O), L Cys, D-Cys Threonine T D-Thr, Ser, D-Ser, allo-Thr, Met, D-Met, Met(O), D-Met(O), Val, D Val
For Amino Cod Replace with any of Acid e Tyrosine Y D-Tyr, Phe, D-Phe, L-Dopa, His, D-His Valine V D-Val, Leu, D-Leu, lie, D-Ile, Met, D-Met
[0080] In some embodiments, the present enzymes comprises a deletion, substitution, insertion, or addition of one or a few amino acid residues. In some embodiments, the present enzymes are derived from the amino acid sequence of the parent enzyme by conservative substitution of one or several amino acid residues. In some embodiments, the present enzymes are derived from the amino acid sequence of the parent enzyme by deletion, substitution, insertion, or addition of one or a few amino acid residues. In all cases, the expression "one or a few amino acid residues" refers to 10 or less, i.e., 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10, amino acid residues.
[0081] In some embodiments, the present enzymes are encoded by a nucleic acid that hybridizes under stringent conditions to a nucleic acid sequence that is complementary to a nucleic acid that encodes the parent enzyme.
[0082] The present enzymes may be "precursor," "immature," or "full-length," in which case they may include a signal sequence, or "mature," in which case they may lack a signal sequence. Mature forms of the polypeptides are generally the most useful. Unless otherwise noted, the amino acid residue numbering used herein refers to the mature forms of the respective polypeptides. The present enzyme polypeptides may also be truncated to remove the N or C-termini, so long as the resulting polypeptides retain enzyme activity.
[0083] The present enzyme may be a "chimeric" or "hybrid" polypeptide, in that it includes at .0 least a portion of a first enzyme polypeptide, and at least a portion of a second enzyme polypeptide (such chimeric enzymes have recently been "rediscovered" as domain-swap enzymes). The present enzymes may further include heterologous signal sequence or an epitope, foe example, to allow tracking or purification. Exemplary heterologous signal sequences are from B. licheniformis amylase (LAT), B. subtilis (AmyE or AprE), and Streptomyces CeA.
[0084] In another aspect, nucleic acids encoding an enzyme polypeptide is provided. The nucleic acid may encode the enzyme having the amino acid sequence having a specified degree of amino acid sequence identity. In some embodiments, the nucleic acid encodes an enzyme having at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or even at least 99%, amino acid sequence identity to a parental enzyme. In some embodiments, the nucleic acid has at least 80%, at least 85%, at least 90%, at least 95%, or even at least 98% nucleotide sequence identity to parental enzyme.
[0085] In some embodiments, the present compositions and methods include nucleic acids that encode an enzyme having deletions, insertions, or substitutions, such as those mentioned, above. It will be appreciated that due to the degeneracy of the genetic code, a plurality of nucleic acids may encode the same polypeptide.
[0086] In another example, the nucleic acid hybridizes under stringent or very stringent conditions to a nucleic acid complementary to a nucleic acid encoding an enzyme having at least 80%, at least 81%, at least 82%, at least 83%, at least 84%, at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or even at least 99%, amino acid sequence identity to a parent enzyme. In some embodiments, the nucleic acid hybridizes under stringent or very stringent conditions to a nucleic acid complementary to a nucleic acid having the sequence of a parent enzyme. Such hybridization conditions are described herein but are also well known in the art.
[0087] Nucleic acids may encode a "full-length" ("f" or "FL") enzyme, which includes a signal sequence, only the mature form of an enzyme, which lacks the signal sequence, or a truncated form of an enzyme, which lacks the N or C-terminus of the mature form. Preferrably, the nucleic acids are of sufficient length to encode an active enzyme.
[0088] A nucleic acid that encodes an enzyme can be operably linked to various promoters and regulators in a vector suitable for expressing the enzyme in host cells. Exemplary promoters .0 are from B. licheniformis amylase (LAT), B. subtilis (AmyE or AprE), and Streptomyces CeA. Such a nucleic acid can also be linked to other coding sequences, e.g., to encode a chimeric polypeptide.
3. Production of Enzymes of the Invention
[0089] The present enzymes can be produced in host cells, for example, by secretion or intracellular expression. A cultured cell material (e.g., a whole-cell broth) comprising an enzyme can be obtained following secretion of the enzyme into the cell medium. Optionally, the enzyme can be isolated from the host cells, or even isolated from the cell broth, depending on the desired purity of the final enzyme. A gene encoding an enzyme can be cloned and expressed according to methods well known in the art. Suitable host cells include bacterial, fungal (including yeast and filamentous fungi), and plant cells (including algae). Particularly useful host cells include Aspergillus niger, Aspergillus oryzae or Trichoderma reesei. Other host cells include bacterial cells, e.g., Bacillus subtilis or B. licheniformis, as well as Streptomyces.
[0090] The host cell further may express a nucleic acid encoding a homologous or heterologous glucoamylase, i.e., a glucoamylase that is not the same species as the host cell, or one or more other enzymes. The glucoamylase may be a variant glucoamylase, such as one of the glucoamylase variants disclosed in U.S. Patent No. 8,058,033 (Danisco US Inc.), for example. Additionally, the host may express one or more accessory enzymes, proteins or peptides. These may benefit liquefaction, saccharification, fermentation, SSF processes. Furthermore, the host cell may produce biochemicals in addition to enzymes used to digest the various feedstock(s). Such host cells may be useful for fermentation or simultaneous saccharification and fermentation processes to reduce or eliminate the need to add enzymes.
3.1. Vectors
[0091] A DNA construct comprising a nucleic acid encoding an enzyme can be constructed to be expressed in a host cell. Because of the well-known degeneracy in the genetic code, different polynucleotides that encode an identical amino acid sequence can be designed and made with routine skill. It is also well-known in the art to optimize codon use for a particular host cell. Nucleic acids encoding enzymes can be incorporated into a vector. Vectors can be transferred to a host cell using well-known transformation techniques, such as those disclosed below.
[0092] The vector may be any vector that can be transformed into and replicated within a host cell. For example, a vector comprising a nucleic acid encoding an enzyme can be transformed and replicated in a bacterial host cell as a means of propagating and amplifying the vector. The vector also may be transformed into an expression host, so that the encoding nucleic acids can be expressed as a functional enzyme. Host cells that serve as expression hosts can include .0 filamentous fungi, for example. The Fungal Genetics Stock Center (FGSC) Catalogue of Strains lists suitable vectors for expression in fungal host cells. See FGSC, Catalogue of Strains, University of Missouri, atwww.fgsc.net (last modified January 17, 2007). A representative vector is pJG153, a promoterless Cre expression vector that can be replicated in a bacterial host. See Harrison et al. (2011) Applied Environ. Microbiol. 77:3916-22. pJG153can be modified with routine skill to comprise and express a nucleic acid encoding an enzyme variant.
[0093] A nucleic acid encoding an enzyme can be operably linked to a suitable promoter, which allows transcription in the host cell. The promoter may be any DNA sequence that shows transcriptional activity in the host cell of choice and may be derived from genes encoding proteins either homologous or heterologous to the host cell. Exemplary promoters for directing the transcription of the DNA sequence encoding an enzyme, especially in a bacterial host, are the promoter of the lac operon of E. coli, the Streptomyces coelicolor agarase gene dagA or celA promoters, the promoters of the Bacillus licheniformis a-amylase gene (amyL), the promoters of the Bacillus stearothermophilus maltogenic amylase gene (amyM), the promoters of the Bacillus amyloliquefaciens a-amylase (amyQ), the promoters of the Bacillus subtilis xylA and xylB genes etc. For transcription in a fungal host, examples of useful promoters are those derived from the gene encoding Aspergillus oryzae TAKA amylase, Rhizomucor miehei aspartic proteinase, Aspergillus niger neutral a-amylase, A. niger acid stable a-amylase, A. niger glucoamylase, Rhizomucor mieheilipase, A. oryzae alkaline protease, A. oryzae triose phosphate isomerase, or A. nidulans acetamidase. When a gene encoding an enzyme is expressed in a bacterial species such as E. coli, a suitable promoter can be selected, for example, from a bacteriophage promoter including a T7 promoter and a phage lambda promoter. Examples of suitable promoters for the expression in a yeast species include but are not limited to the Gal 1 and Gal 10 promoters of Saccharomyces cerevisiae and the Pichia pastoris AOX1 or AOX2 promoters. cbhl is an endogenous, inducible promoter from T. reesei. See Liu et al. (2008) "Improved heterologous gene expression in Trichoderma reeseiby cellobiohydrolase I gene (cbhl) promoter optimization," Acta Biochim. Biophys. Sin (Shanghai) 40(2): 158-65.
[0094] The coding sequence can be operably linked to a signal sequence. The DNA encoding the signal sequence may be the DNA sequence naturally associated with the enzyme gene to be expressed or from a different Genus or species. A signal sequence and a promoter sequence comprising a DNA construct or vector can be introduced into a fungal host cell and can be derived from the same source. For example, the signal sequence is the cbhl signal sequence that is operably linked to a cbhl promoter.
[0095] An expression vector may also comprise a suitable transcription terminator and, in .0 eukaryotes, polyadenylation sequences operably linked to the DNA sequence encoding an enzyme. Termination and polyadenylation sequences may suitably be derived from the same sources as the promoter.
[0096] The vector may further comprise a DNA sequence enabling the vector to replicate in the host cell. Examples of such sequences are the origins of replication of plasmids pUC19, pACYC177, pUB110, pEl94, pAMB1, and plJ702.
[0097] The vector may also comprise a selectable marker, e.g., a gene the product of which complements a defect in the isolated host cell, such as the dalgenes from B. subtilis or B. licheniformis, or a gene that confers antibiotic resistance such as, e.g., ampicillin, kanamycin, chloramphenicol or tetracycline resistance. Furthermore, the vector may comprise Aspergillus selection markers such as amdS, argB, niaD and xxsC, hygromycin resistance, or the selection may be accomplished by co-transformation.
[0098] Intracellular expression may be advantageous in some respects, e.g., when using certain bacteria or fungi as host cells to produce large amounts of enzyme for subsequent enrichment or purification. Extracellular secretion of enzyme into the culture medium can also be used to make a cultured cell material comprising the isolated enzyme.
[0099] The expression vector typically includes the components of a cloning vector, such as, for example, an element that permits autonomous replication of the vector in the selected host organism and one or more phenotypically detectable markers for selection purposes. The expression vector normally comprises control nucleotide sequences such as a promoter, operator, ribosome binding site, translation initiation signal and optionally, a repressor gene or one or more activator genes. Additionally, the expression vector may comprise a sequence coding for an amino acid sequence capable of targeting the enzyme to a host cell organelle such as a peroxisome, or to a particular host cell compartment. Such a targeting sequence includes but is not limited to the sequence, SKL. For expression under the direction of control sequences, the nucleic acid sequence of the enzyme is operably linked to the control sequences in proper manner with respect to expression.
[00100] The procedures used to ligate the DNA construct encoding an enzyme, the promoter, terminator and other elements, respectively, and to insert them into suitable vectors containing the information necessary for replication, are well known to persons skilled in the art (see, e.g., Sambrook et aL., MOLECULAR CLONING: A LABORATORY MANUAL, 2 nded.,ColdSpring
Harbor, 1989, and 3 rded.,2001).
3.2. Transformation and Culture of Host Cells
[00101] An isolated cell, either comprising a DNA construct or an expression vector, is advantageously used as a host cell in the recombinant production of an enzyme. The cell may .0 be transformed with the DNA construct encoding the enzyme, conveniently by integrating the DNA construct (in one or more copies) in the host chromosome. This integration is generally considered to be an advantage, as the DNA sequence is more likely to be stably maintained in the cell. Integration of the DNA constructs into the host chromosome may be performed according to conventional methods, e.g., by homologous or heterologous recombination. Alternatively, the cell may be transformed with an expression vector as described above in connection with the different types of host cells.
[00102] Examples of suitable bacterial host organisms are Gram positive bacterial species such as Bacillaceae including Bacillus subtilis, Bacillus licheniformis, Bacillus lentus, Bacillus brevis, Geobacillus (formerly Bacillus) stearothermophilus, Bacillus alkalophilus, Bacillus amyloliquefaciens, Bacillus coagulans, Bacillus lautus, Bacillus megaterium, and Bacillus thuringiensis; Streptomyces species such as Streptomyces murinus; lactic acid bacterial species including Lactococcus sp. such as Lactococcus lactis; Lactobacillus sp. including Lactobacillus reuteri; Leuconostoc sp.; Pediococcus sp.; and Streptococcus sp. Alternatively, strains of a Gram negative bacterial species belonging to Enterobacteriaceae including E. coli, or to Pseudomonadaceae can be selected as the host organism.
[00103] A suitable yeast host organism can be selected from the biotechnologically relevant yeasts species such as but not limited to yeast species such as Pichia sp., Hansenula sp., or Kluyveromyces, Yarrowinia, Schizosaccharomyces species or a species of Saccharomyces, including Saccharomyces cerevisiae or a species belonging to Schizosaccharomyces such as, for example, S. pombe species. A strain of the methylotrophic yeast species, Pichiapastoris, can be used as the host organism. Alternatively, the host organism can be a Hansenula species. Suitable host organisms among filamentous fungi include species of Aspergillus, e.g., Aspergillus niger, Aspergillus oryzae, Aspergillus tubigensis, Aspergillus awamori, or Aspergillus nidulans. Alternatively, strains of a Fusarium species, e.g., Fusarium oxysporum or of a Rhizomucor species such as Rhizomucor miehei can be used as the host organism. Other suitable strains include Thermomyces and Mucor species. In addition, Trichoderma sp. such as Trichoderma reeseican be used as a host. A suitable procedure for transformation of Aspergillus host cells includes, for example, that described in EP 238023. An enzyme expressed by a fungal host cell can be glycosylated, i.e., will comprise a glycosyl moiety. The glycosylation pattern can be the same or different as present in the wild-type enzyme. The type and/or degree of glycosylation may impart changes in enzymatic and/or biochemical properties.
[00104] It may be advantageous to delete genes from expression hosts, where the gene deficiency may be cured by the transformed expression vector. Known methods may be used .0 to obtain a fungal host cell having one or more inactivated genes. Gene inactivation may be accomplished by complete or partial deletion, by insertional inactivation or by any other means that renders a gene nonfunctional for its intended purpose, such that the gene is prevented from expression of a functional protein. Any gene from a Trichoderma sp. or other filamentous fungal host that has been cloned can be deleted, for example, cbhl, cbh2, egl, and eg/2 genes. Gene deletion may be accomplished by inserting a form of the desired gene to be inactivated into a plasmid by methods known in the art.
[00105] Introduction of a DNA construct or vector into a host cell includes techniques such as transformation; electroporation; nuclear microinjection; transduction; transfection, e.g., lipofection mediated and DEAE-Dextrin mediated transfection; incubation with calcium phosphate DNA precipitate; high velocity bombardment with DNA-coated microprojectiles; and protoplast fusion. General transformation techniques are known in the art. See, e.g., Sambrook et al. (2001), supra. The expression of heterologous protein in Trichoderma is described, for example, in U.S. Patent No. 6,022,725. Reference is also made to Cao et al. (2000) Science 9:991-1001 for transformation of Aspergillus strains. Genetically stable transformants can be constructed with vector systems whereby the nucleic acid encoding an enzyme is stably integrated into a host cell chromosome. Transformants are then selected and purified by known techniques.
[00106] The preparation of Trichoderma sp. for transformation, for example, may involve the preparation of protoplasts from fungal mycelia. See Campbell et al. (1989) Curr. Genet. 16: 53-56. The mycelia can be obtained from germinated vegetative spores. The mycelia are treated with an enzyme that digests the cell wall, resulting in protoplasts. The protoplasts are protected by the presence of an osmotic stabilizer in the suspending medium. These stabilizers include sorbitol, mannitol, potassium chloride, magnesium sulfate, and the like. Usually the concentration of these stabilizers varies between 0.8 M and 1.2 M, e.g., a 1.2 M solution of sorbitol can be used in the suspension medium.
[00107] Uptake of DNA into the host Trichoderma sp. strain depends upon the calcium ion concentration. Generally, between about 10-50 mM CaCl2 is used in an uptake solution. Additional suitable compounds include a buffering system, such as TE buffer (10 mM Tris, pH 7.4; 1 mM EDTA) or 10 mM MOPS, pH 6.0 and polyethylene glycol. The polyethylene glycol is believed to fuse the cell membranes, thus permitting the contents of the medium to be delivered into the cytoplasm of the Trichoderma sp. strain. This fusion frequently leaves multiple copies of the plasmid DNA integrated into the host chromosome.
[00108] Usually transformation of Trichoderma sp. uses protoplasts or cells that have been subjected to a permeability treatment, typically at a density of 105 to 10 7/mL, particularly 2x10/mL. A volume of 100 pL of these protoplasts or cells in an appropriate solution (e.g., 1.2 M sorbitol and 50 mM CaCl2) may be mixed with the desired DNA. Generally, a high .0 concentration of PEG is added to the uptake solution. From 0.1 to 1 volume of 25% PEG 4000 can be added to the protoplast suspension; however, it is useful to add about 0.25 volumes to the protoplast suspension. Additives, such as dimethyl sulfoxide, heparin, spermidine, potassium chloride and the like, may also be added to the uptake solution to facilitate transformation. Similar procedures are available for other fungal host cells. See, e.g., U.S. Patent No. 6,022,725.
3.3. Expression
[00109] A method of producing an enzyme may comprise cultivating a host cell as described above under conditions conducive to the production of the enzyme and recovering the enzyme from the cells and/or culture medium.
[00110] The medium used to cultivate the cells may be any conventional medium suitable for growing the host cell in question and obtaining expression of an enzyme. Suitable media and media components are available from commercial suppliers or may be prepared according to published recipes (e.g., as described in catalogues of the American Type Culture Collection).
[00111] An enzyme secreted from the host cells can be used in a whole broth preparation. In the present methods, the preparation of a spent whole fermentation broth of a recombinant microorganism can be achieved using any cultivation method known in the art resulting in the expression of an enzyme. Fermentation may, therefore, be understood as comprising shake flask cultivation, small- or large-scale fermentation (including continuous, batch, fed-batch, or solid state fermentations) in laboratory or industrial fermenters performed in a suitable medium and under conditions allowing the enzyme to be expressed or isolated. The term "spent whole fermentation broth" is defined herein as unfractionated contents of fermentation material that includes culture medium, extracellular proteins (e.g., enzymes), and cellular biomass. It is understood that the term "spent whole fermentation broth" also encompasses cellular biomass that has been lysed or permeabilized using methods well known in the art.
[00112] An enzyme secreted from the host cells may conveniently be recovered from the culture medium by well-known procedures, including separating the cells from the medium by centrifugation or filtration, and precipitating proteinaceous components of the medium by means of a salt such as ammonium sulfate, followed by the use of chromatographic procedures such as ion exchange chromatography, affinity chromatography, or the like.
[00113] The polynucleotide encoding an enzyme in a vector can be operably linked to a control sequence that is capable of providing for the expression of the coding sequence by the .0 host cell, i.e. the vector is an expression vector. The control sequences may be modified, for example by the addition of further transcriptional regulatory elements to make the level of transcription directed by the control sequences more responsive to transcriptional modulators. The control sequences may in particular comprise promoters.
[00114] Host cells may be cultured under suitable conditions that allow expression of an enzyme. Expression of the enzymes may be constitutive such that they are continually produced, or inducible, requiring a stimulus to initiate expression. In the case of inducible expression, protein production can be initiated when required by, for example, addition of an inducer substance to the culture medium, for example dexamethasone or IPTG or Sophorose. Polypeptides can also be produced recombinantly in an in vitro cell-free system, such as the TNTTM (Promega) rabbit reticulocyte system.
[00115] An expression host also can be cultured in the appropriate medium for the host, under aerobic conditions. Shaking or a combination of agitation and aeration can be provided, with production occurring at the appropriate temperature for that host, e.g., from about 25°C to about 75°C (e.g., 30°C to 45°C), depending on the needs of the host and production of the desired enzyme. Culturing can occur from about 12 to about 100 hours or greater (and any hour value there between, e.g., from 24 to 72 hours). Typically, the culture broth is at a pH of about 4.0 to about 8.0, again depending on the culture conditions needed for the host relative to production of an enzyme.
3.4. Identification of Enzyme Activity
[00116] To evaluate the expression of an enzyme in a host cell, assays can measure the expressed protein, corresponding mRNA, or enzyme activity. For example, suitable assays include Northern blotting, reverse transcriptase polymerase chain reaction, and in situ hybridization, using an appropriately labeled hybridizing probe. Suitable assays also include measuring enzyme activity in a sample, for example, by assays directly measuring products in the culture media. For example, glucose concentration may be determined using glucose reagent kit No. 15-UV (Sigma Chemical Co.) or an instrument, such as Technicon Autoanalyzer. a-amylase activity also may be measured by any known method, such as the PAHBAH or ABTS assays. Trehalase activity may be measured as described in the Examples section. Assays are also known in the art to measure other enzyme activities.
3.5. Methods for Enriching and Purifying Enzymes of the Invention
[00117] Fermentation, separation, and concentration techniques are well known in the art and conventional methods can be used in order to prepare a concentrated enzyme polypeptide-containing solution.
[00118] After fermentation, a fermentation broth is obtained, the microbial cells and various suspended solids, including residual raw fermentation materials, are removed by .0 conventional separation techniques in order to obtain an enzyme solution. Filtration, centrifugation, microfiltration, rotary vacuum drum filtration, ultrafiltration, centrifugation followed by ultra-filtration, extraction, or chromatography, or the like, are generally used.
[00119] It is desirable to concentrate an enzyme polypeptide-containing solution in order to optimize recovery. Use of unconcentrated solutions requires increased incubation time in order to collect the enriched or purified enzyme precipitate.
[00120] The enzyme containing solution is concentrated using conventional concentration techniques until the desired enzyme level is obtained. Concentration of the enzyme containing solution may be achieved by any of the techniques discussed herein. Exemplary methods of enrichment and purification include but are not limited to rotary vacuum filtration and/or ultrafiltration.
[00121] The enzyme solution is concentrated into a concentrated enzyme solution until the enzyme activity of the concentrated enzyme polypeptide-containing solution is at a desired level.
[00122] During fermentation, an enzyme polypeptide accumulates in the culture broth. For the isolation, enrichment, or purification of the desired enzyme, the culture broth is centrifuged or filtered to eliminate cells, and the resulting cell-free liquid is used for enzyme enrichment or purification. In one embodiment, the cell-free broth is subjected to salting out using ammonium sulfate at about 70% saturation; the 70% saturation-precipitation fraction is then dissolved in a buffer and applied to a column such as a Sephadex G-100 column, and eluted to recover the enzyme-active fraction. For further enrichment or purification, a conventional procedure such as ion exchange or affinity chromatography may be used.
[00123] For production scale recovery, enzyme polypeptides can be enriched or partially purified as generally described above by removing cells via flocculation with polymers. Alternatively, the enzyme can be enriched or purified by microfiltration followed by concentration by ultrafiltration using available membranes and equipment. However, for some applications, the enzyme does not need to be enriched or purified, and whole broth culture can be lysed and used without further treatment. The enzyme can then be processed, for example, into granules.
4. Compositions and Uses of Trehalases
[00124] The present trehalases are useful for a variety of industrial applications. For example, trehalases are useful in a starch conversion process, particularly in a saccharification and fermentation process of a starch that has undergone liquefaction. The desired end-product .0 may be any product that may be produced by the enzymatic conversion of the starch substrate. For example, the desired product may be a syrup rich in glucose and maltose, which can be used in other processes, such as the preparation of HFCS, or which can be converted into a number of other useful products, such as ascorbic acid intermediates (e.g., gluconate; 2-keto-L gulonic acid; 5-keto-gluconate; and 2,5-diketogluconate); 1,3-propanediol; aromatic amino acids (e.g., tyrosine, phenylalanine and tryptophan); organic acids (e.g., lactate, pyruvate, succinate, isocitrate, gluconic acid, and oxaloacetate); amino acids (e.g., serine, lysine, glutamic acid, and glycine); antibiotics; antimicrobials; enzymes; vitamins; and hormones.
[00125] The starch conversion process may be a precursor to, or simultaneous with, a fermentation process designed to produce alcohol for fuel or drinking (i.e., potable alcohol). One skilled in the art is aware of various fermentation conditions that may be used in the production of these end-products. Trehalases may also be useful in compositions and methods of food preparation. These various uses of trehalases are described in more detail below.
4.1. Preparation of Starch Substrates
[00126] Those of general skill in the art are well aware of available methods that may be used to prepare starch substrates for use in the processes disclosed herein. For example, a useful starch substrate may be obtained from tubers, roots, stems, legumes, cereals or whole grain. More specifically, the granular starch may be obtained from corn, cobs, wheat, barley, rye, triticale, milo, sago, millet, cassava, tapioca, sorghum, rice, peas, bean, banana, or potatoes. Corn contains about 60-68% starch; barley contains about 55-65% starch; millet contains about 75-80% starch; wheat contains about 60-65% starch; and polished rice contains 70-72% starch. Specifically contemplated starch substrates are corn starch and wheat starch. The starch from a grain may be ground or whole and includes corn solids, such as kernels, bran and/or cobs. The starch may also be highly refined raw starch or feedstock from starch refinery processes. Various starches also are commercially available. For example, corn starch is available from Cerestar, Sigma, and Katayama Chemical Industry Co. (Japan); wheat starch is available from Sigma; sweet potato starch is available from Wako Pure Chemical Industry Co. (Japan); and potato starch is available from Nakaari Chemical Pharmaceutical Co. (Japan).
[00127] The starch substrate can be a crude starch from milled whole grain, which contains non-starch fractions, e.g., germ residues and fibers. Milling may comprise either wet milling or dry milling or grinding. In wet milling, whole grain is soaked in water or dilute acid to separate the grain into its component parts, e.g., starch, protein, germ, oil, kernel fibers. Wet milling efficiently separates the germ and meal (i.e., starch granules and protein) and is especially suitable for production of syrups. In dry milling or grinding, whole kernels are ground .0 into a fine powder and often processed without fractionating the grain into its component parts. In some cases, oils from the kernels are recovered. Dry ground grain thus will comprise significant amounts of non-starch carbohydrate compounds, in addition to starch. Dry grinding of the starch substrate can be used for production of ethanol and other biochemicals. The starch to be processed may be a highly refined starch quality, for example, at least 90%, at least 95%, at least 97%, or at least 99.5% pure.
4.2. Gelatinization and Liquefaction of Starch
[00128] As used herein, the term "liquefaction" or "liquefy" means a process by which starch is converted to less viscous and shorter chain dextrins. Generally, this process involves gelatinization of starch simultaneously with or followed by the addition of an a-amylase, although additional liquefaction-inducing enzymes optionally may be added. In some embodiments, the starch substrate prepared as described above is slurried with water. The starch slurry may contain starch as a weight percent of dry solids of about 10-55%, about 20 45%, about 30-45%, about 30-40%, or about 30-35%. a-Amylase (EC 3.2.1.1) may be added to the slurry, with a metering pump, for example. The a-amylase typically used for this application is a thermally stable, bacterial a-amylase, such as a Geobacillus stearothermophilus a-amylase. The a-amylase is usually supplied, for example, at about 1500 units per kg dry matter of starch. To optimize a-amylase stability and activity, the pH of the slurry typically is adjusted to about pH 5.5-6.5 and about 1 mM of calcium (about 40 ppm free calcium ions) can also be added. Geobacillus stearothermophilus variants or other trehalases may require different conditions. Bacterial a-amylase remaining in the slurry following liquefaction may be deactivated via a number of methods, including lowering the pH in a subsequent reaction step or by removing calcium from the slurry in cases where the enzyme is dependent upon calcium.
[00129] The slurry of starch plus the a-amylase may be pumped continuously through a jet cooker, which is steam heated to 105°C. Gelatinization occurs rapidly under these conditions, and the enzymatic activity, combined with the significant shear forces, begins the hydrolysis of the starch substrate. The residence time in the jet cooker is brief. The partly gelatinized starch may be passed into a series of holding tubes maintained at 105-110°C and held for 5-8 min. to complete the gelatinization process ("primary liquefaction"). Hydrolysis to the required DE is completed in holding tanks at 85-95°C or higher temperatures for about 1 to 2 hours ("secondary liquefaction"). These tanks may contain baffles to discourage back mixing. As used herein, the term "minutes of secondary liquefaction" refers to the time that has elapsed from the start of secondary liquefaction to the time that the Dextrose Equivalent (DE) is measured. The slurry is then allowed to cool to room temperature. This cooling step can be 30 minutes to 180 minutes, or more. The liquefied starch typically is in the form of a slurry having a dry solids content (w/w) of about 10-50%; about 10-45%; about 15-40%; about 20-40%; about .0 25-40%; or about 25-35%.
[00130] In particular embodiments, starch liquifaction is performed at a temperature range of 90-115°C, for the purpose of producing high-purity glucose syrups, HFCS, maltodextrins, etc.
4.3. Saccharification
[00131] The liquefied starch can be saccharified into a syrup rich in lower DP (e.g., DP1 + DP2) saccharides, using a-amylases, optionally in the presence of other enzyme(s). The exact composition of the products of saccharification depends on the combination of enzymes used, as well as the type of granular starch processed. Advantageously, the syrup obtainable using the provided trehalases may contain a weight percent of DP2 of the total oligosaccharides in the saccharified starch exceeding 30%, e.g., 45% - 65% or 55% - 65%. The weight percent of (DP1 + DP2) in the saccharified starch may exceed about 70%, e.g., 75% - 85% or 80% - 85%. The amylases also produce a relatively high yield of glucose, e.g., DP1 > 20%, in the syrup product.
[00132] Whereas liquefaction is generally run as a continuous process, saccharification is often conducted as a batch process. Saccharification typically is most effective at temperatures of about 60-65°C and a pH of about 4.0-4.5, e.g., pH 4.3, necessitating cooling and adjusting the pH of the liquefied starch. Saccharification may be performed, for example, at a temperature between about 40°C, about 50°C, or about 55C to about 600C or about 650C. Saccharification is normally conducted in stirred tanks, which may take several hours to fill or empty. Enzymes typically are added either at a fixed ratio to dried solids as the tanks are filled or added as a single dose at the commencement of the filling stage. A saccharification reaction to make a syrup typically is run over about 24-72 hours, for example, 24-48 hours. When a maximum or desired DE has been attained, the reaction is stopped by heating to 850C for 5 min., for example. Further incubation will result in a lower DE, eventually to about 90 DE, as accumulated glucose re-polymerizes to isomaltose and/or other reversion products via an enzymatic reversion reaction and/or with the approach of thermodynamic equilibrium. When using an amylase, saccharification optimally is conducted at a temperature range of about 300C to about 750C, e.g., 450C - 750C or 470C - 740C. The saccharifying may be conducted over a pH range of about pH 3 to about pH 7, e.g., pH 3.0 - pH 7.5, pH 3.5 - pH 5.5, pH 3.5, pH 3.8, or pH 4.5.
[00133] An amylase may be added to the slurry in the form of a composition. Amylase can be added to a slurry of a granular starch substrate in an amount of about 0.6 - 10 ppm ds, e.g., 2 ppm ds. An amylase can be added as a whole broth, clarified, enriched, partially purified, or purified enzyme. The specific activity of the amylase may be about 300 U/mg of enzyme, for example, measured with the PAHBAH assay. The amylase also can be added as .0 a whole broth product.
[00134] An amylase may be added to the slurry as an isolated enzyme solution. For example, an amylase can be added in the form of a cultured cell material produced by host cells expressing an amylase. An amylase may also be secreted by a host cell into the reaction medium during the fermentation or SSF process, such that the enzyme is provided continuously into the reaction. The host cell producing and secreting amylase may also express an additional enzyme, such as a glucoamylase. For example, U.S. Patent No. 5,422,267 discloses the use of a glucoamylase in yeast for production of alcoholic beverages. For example, a host cell, e.g., Trichoderma reeseior Aspergillus niger, may be engineered to co-express an amylase and a glucoamylase, e.g., HgGA, TrGA, or a TrGA variant, during saccharification. The host cell can be genetically modified so as not to express its endogenous glucoamylase and/or other enzymes, proteins or other materials. The host cell can be engineered to express a broad spectrum of various saccharolytic enzymes. For example, the recombinant yeast host cell can comprise nucleic acids encoding a glucoamylase, an alpha-glucosidase, an enzyme that utilizes pentose sugar, an a-amylase, a pullulanse, an isoamylase, and/or an isopullulanase. See, e.g., WO 2011/153516 A2.
4.4. Isomerization
[00135] The soluble starch hydrolysate produced by treatment with amylase can be converted into high fructose starch-based syrup (HFSS), such as high fructose corn syrup (HFCS). This conversion can be achieved using a glucose isomerase, particularly a glucose isomerase immobilized on a solid support. The pH is increased to about 6.0 to about 8.0, e.g., pH 7.5 (depending on the isomerase), and Ca" is removed by ion exchange. Suitable isomerases include SWEETZYME@, IT (Novozymes A/S); G-ZYME@IMGI, and G-ZYME@ G993, KETOMAX@, G-ZYME@G993, G-ZYME@G993 liquid, and GENSWEET@IGI. Following isomerization, the mixture typically contains about 40-45% fructose, e.g., 42% fructose.
4.5. Fermentation
[00136] The soluble starch hydrolysate, particularly a glucose rich syrup, can be fermented by contacting the starch hydrolysate with a fermenting organism typically at a temperature around 32°C, such as from 30°C to 35°C for alcohol-producing yeast. The temperature and pH of the fermentation will depend upon the fermenting organism. EOF products include metabolites, such as citric acid, lactic acid, succinic acid, monosodium glutamate, gluconic acid, sodium gluconate, calcium gluconate, potassium gluconate, itaconic acid and other carboxylic acids, glucono delta-lactone, sodium erythorbate, lysine and other amino acids, omega 3 fatty acid, butanol, isoprene, 1,3-propanediol, pyruvate, 2,3-butanediol .0 and other biomaterials.
[00137] Ethanologenic microorganisms include yeast, such as Saccharomyces cerevisiae and bacteria, e.g., Zymomonas moblis, expressing alcohol dehydrogenase and pyruvate decarboxylase. The ethanologenic microorganism can express xylose reductase and xylitol dehydrogenase, which convert xylose to xylulose. Improved strains of ethanologenic microorganisms, which can withstand higher temperatures, for example, are known in the art and can be used. See Liu et al. (2011) Sheng Wu Gong Cheng Xue Bao 27:1049-56. Commercial sources of yeast include ETHANOL RED@ (LeSaffre); THERMOSACC@ (Lallemand); RED STAR@ (Red Star); FERMIOL@ (DSM Specialties); and SUPERSTART@ (Alltech). Microorganisms that produce other metabolites, such as citric acid and lactic acid, by fermentation are also known in the art. See, e.g., Papagianni (2007) Biotechnol. Adv. 25:244 63; John et al. (2009) Biotechnol. Adv. 27:145-52.
[00138] The saccharification and fermentation processes may be carried out as an SSF process. Fermentation may comprise subsequent enrichment, purification, and recovery of ethanol, for example. During the fermentation, the ethanol content of the broth or "beer" may reach about 8-18% v/v, e.g., 14-15% v/v. The broth may be distilled to produce enriched, e.g.,
96% pure, solutions of ethanol. Further, C02 generated by fermentation may be collected with a C02 scrubber, compressed, and marketed for other uses, e.g., carbonating beverage or dry ice production. Solid waste from the fermentation process may be used as protein-rich products, e.g., livestock feed.
[00139] As mentioned above, an SSF process can be conducted with fungal cells that express and secrete amylase continuously throughout SSF. The fungal cells expressing amylase also can be the fermenting microorganism, e.g., an ethanologenic microorganism. Ethanol production thus can be carried out using a fungal cell that expresses sufficient amylase or trehalase so that less or no enzyme has to be added exogenously. The fungal host cell can be from an appropriately engineered fungal strain. Fungal host cells that express and secrete other enzymes, in addition to amylase, or trehalase also can be used. Such cells may express glucoamylase and/or a pullulanase, phytase, apha-glucosidase, isoamylase, beta-amylase cellulase, xylanase, other hemicellulases, protease, beta-glucosidase, pectinase, esterase, redox enzymes, transferase, or other enzyme.
[00140] A variation on this process is a "fed-batch fermentation" system, where the substrate is added in increments as the fermentation progresses. Fed-batch systems are useful when catabolite repression may inhibit the metabolism of the cells and where it is desirable to have limited amounts of substrate in the medium. The actual substrate concentration in fed-batch systems is estimated by the changes of measurable factors such as .0 pH, dissolved oxygen and the partial pressure of waste gases, such as C02. Batch and fed batch fermentations are common and well known in the art.
[00141] Continuous fermentation is an open system where a defined fermentation medium is added continuously to a bioreactor, and an equal amount of conditioned medium is removed simultaneously for processing. Continuous fermentation generally maintains the cultures at a constant high density where cells are primarily in log phase growth. Continuous fermentation permits modulation of cell growth and/or product concentration. For example, a limiting nutrient such as the carbon source or nitrogen source is maintained at a fixed rate and all other parameters are allowed to moderate. Because growth is maintained at a steady state, cell loss due to medium being drawn off should be balanced against the cell growth rate in the fermentation. Methods of optimizing continuous fermentation processes and maximizing the rate of product formation are well known in the art of industrial microbiology.
4.6. Compositions
[00142] Trehalases of the invention are used in fermentation of various starch substrates. Trehalases may be used in fermentation of a liquefact. Trehalase may also be used in simultaneous saccharification and fermentation (SSF). Trehalases may be used at a suitable pH, temperature and time. Use of a trehalase may improve the health of the yeast in fermentation media as evidenced by increased ethanol production and/or continued degradation of trehalose as evidenced by lower DP2 levels or trehalose levels. Certain fungal trehalases may be more effective for such functionalities. Trehalases may be used at any desired concentrations, e.g., from about 0.1 g/g to 1 mg/g of DS in the fermentation. Preferred concentrations include 0.1, 0.2, 0.25, 0.5, 1.0, 2, 4, 6, 8, 10, 20, 50, 100 g/g of DS in the fermentation.
[00143] Trehalases may be combined with a glucoamylase (EC 3.2.1.3), e.g., a Trichoderma glucoamylase or variant thereof. An exemplary glucoamylase is Trichoderma reeseiglucoamylase (TrGA) and variants thereof that possess superior specific activity and thermal stability. See U.S. Published Applications Nos. 2006/0094080, 2007/0004018, and 2007/0015266 (Danisco US Inc.). Suitable variants of TrGA include those with glucoamylase activity and at least 80%, at least 90%, or at least 95% sequence identity to wild-type TrGA. a amylases advantageously increase the yield of glucose produced in a saccharification process catalyzed by TrGA.
[00144] Alternatively, the glucoamylase may be another glucoamylase derived from plants (including algae), fungi, or bacteria. For example, the glucoamylases may be Aspergillus niger G1 or G2 glucoamylase or its variants (e.g., Boel et al. (1984) EMBO J. 3:1097-1102; WO 92/00381; WO 00/04136 (Novo Nordisk A/S)); and A. awamoriglucoamylase (e.g., WO 84/02921 (Cetus Corp.)). Other contemplated Aspergillus glucoamylase include variants with .0 enhanced thermal stability, e.g., G137A and G139A (Chen et al. (1996) Prot. Eng. 9:499-505); D257E and D293E/Q (Chen et al. (1995) Prot. Eng. 8:575-582); N182 (Chen et al. (1994) Biochem. J. 301:275-281); A246C (Fierobe et al. (1996) Biochemistry, 35: 8698-8704); and variants with Pro residues in positions A435 and S436 (Li et al. (1997) Protein Eng. 10:1199 1204). Other contemplated glucoamylases include Talaromyces glucoamylases, in particular derived from T. emersonii (e.g., WO 99/28448 (Novo Nordisk A/S), T. leycettanus (e.g., U.S. Patent No. RE 32,153 (CPC International, Inc.)), T. duponti, or T. thermophilus (e.g., U.S. Patent No. 4,587,215). Contemplated bacterial glucoamylases include glucoamylases from the genus Clostridium, in particular C. thermoamylolyticum (e.g., EP 135138 (CPC International, Inc.) and C. thermohydrosulfuricum (e.g., WO 86/01831 (Michigan Biotechnology Institute)). Suitable glucoamylases include the glucoamylases derived from Aspergillus oryzae, such as a glucoamylase shown in SEQ ID NO:2 in WO 00/04136 (Novo Nordisk A/S). Also suitable are commercial glucoamylases, such as AMG 200L; AMG 300 L; SAN TM SUPER and AMG TM E (Novozymes); OPTIDEX@300 and OPTIDEX L-400 (Danisco US Inc.); AMIGASETM and AMIGASE TMPLUS (DSM); G-ZYME@ G900 (Enzyme Bio-Systems); and G-ZYME@G990 ZR (A. niger glucoamylase with a low protease content). Still other suitable glucoamylases include Aspergillus fumigatus glucoamylase, Talaromyces glucoamylase, Thielavia glucoamylase, Trametes glucoamylase, Thermomyces glucoamylase, Athelia glucoamylase, or Humicola glucoamylase (e.g., HgGA). Glucoamylases typically are added in an amount of about 0.1 - 2 glucoamylase units (GAU)/g ds, e.g., about 0.16 GAU/g ds, 0.23 GAU/g ds, or 0.33 GAU/g ds.
[00145] Other suitable enzymes that can be used with trehalases include a phytase, protease, pullulanase, P-amylase, isoamylase, a different a-amylase, alpha-glucosidase, cellulase, xylanase, other hemicellulases, beta-glucosidase, transferase, pectinase, lipase, cutinase, esterase, redox enzymes, or a combination thereof. For example, a debranching enzyme, such as an isoamylase (EC 3.2.1.68), may be added in effective amounts well known to the person skilled in the art. A pullulanase (EC 3.2.1.41), e.g., PROMOZYME@, is also suitable. Pullulanase typically is added at 100 U/kg ds. Further suitable enzymes include proteases, such as fungal and bacterial proteases. Fungal proteases include those obtained from Aspergillus, such as A. niger, A. awamori, A. oryzae; Mucor (e.g., M. miehe); Rhizopus; and Trichoderma.
[00146] P-Amylases (EC 3.2.1.2) are exo-acting maltogenic amylases, which catalyze the hydrolysis of 1,4-a-glucosidic linkages into amylopectin and related glucose polymers, thereby releasing maltose. P-Amylases have been isolated from various plants and microorganisms. See Fogarty et aL. (1979) in PROGRESS ININDUSTRIAL MICROBIOLOGY, Vol. 15, pp. 112-115. These P-Amylases have optimum temperatures in the range from 40C to 65°C and optimum pH in the range from about 4.5 to about 7.0. Contemplated P-amylases include, but are not limited to, P-amylases from barley SPEZYME@ BBA 1500, SPEZYME DBA, .0 OPTIMALTTM ME, OPTIMALTTMBBA (Danisco US Inc.); and NOVOZYM TMWBA (Novozymes A/S).
[00147] Compositions comprising the present trehalases may be aqueous or non aqueous formulations, granules, powders, gels, slurries, pastes, etc., which may further comprise any one or more of the additional enzymes listed, herein, along with buffers, salts, preservatives, water, co-solvents, surfactants, and the like. Such compositions may work in combination with endogenous enzymes or other ingredients already present in a slurry, water bath, washing machine, food or drink product, etc., for example, endogenous plant (including algal) enzymes, residual enzymes from a prior processing step, and the like.
EXAMPLES Example 1: Materials and Methods
[00148] Liquefactions. All of the following lab-based fermentations were completed with liquefact samples collected from industrial fuel ethanol plants. Liquefacts were collected at the plant and brought back to labs for immediate freezing and storage. On the day of fermentation use, liquefact is brought up to fermentation temperature in a water-bath. Prior to fermentation, the liquefact pH was adjusted to the starting pH (4.8) of fermentation using sulfuric acid.
Because these liquefacts were from fuel ethanol plants, a significant portion of backset (also known as thin stillage) had been used to generate these liquefact samples. This addition of backset may have resulted in industry-wide fermentations starting off with measureable trehalose levels.
[00149] Fermentations:
[00150] Simultaneous saccharification and fermentation (SSF), or fermentation experiments were conducted by long-standing internal protocols using 100g-scale fermentations. . All fermentation comparisons were done with triplicate (n=3) 100g-scale flask conditions and data displayed herein are averages of those triplicate fermentations. Fermentations were conducted within temperature controlled (either 32°C isotemp or 36°C ramp temperature profiles) shaker incubators (150rpm shaking). Before enzyme dosing, 600ppm urea and 0.1% yeast (typically dry-pitched) were also added to the liquefact. All trehalase dosing was carried out at the beginning of the fermentation along with the DISTILLASE@ SSF (an enzyme blend comprising glucoamylase from GENENCOR) dosing. For Example 2 only, for equal dilution comparisons, trehalase dosing included the enzyme of interest plus a volume of water necessary to equalize the total dosing volume to 670iL (the largest volume needed to obtain 8ug/gDS TrnT (EH)).
[00151] Sample preparation:
[00152] Fermentation broths were sampled into 2mL tubes for subsequent 3min .0 13000rpm centrifugations. A 0.500mL supernatant aliquot was pipetted into glass tube followed by a 50pL 1M sulfuric acid addition to deactivate GA activity. After 5 minute incubations, the fermentation sample was diluted to 1Ox dilution with DI water. This procedure is an internal standard protocol of sampling for organic acid HPLC analysis that not only deactivates the enzymes before analysis, but also purposefully provides a background sulfuric acid comparable to the HPLC mobile phase level. An approximate 1mL aliquot of this sample preparation was filtered using 0.22m nylon syringe filter and placed into an HPLC sample vial.
[00153] For trehalose determination by the ion chromatography method of high performance anion exchange with pulsed amperometric detection (HPAEC-PAD), a separate 0.500mL aliquot from the above 1Ox diluted sample preparation was diluted an additional 10 fold in 9mM NaOH (to neutralize the acid added earlier to kill enzyme activity). This 100x dilution sample was filtered using a 0.22um nylon syringe filter into a 2mL IC vial for HPAEC PAD analysis.
[00154] Organic Acid HPLC Separations Column: Phenomenex@ RezexTM Organic Acid (ROA), 300 x 7.80 mm Guard column: Phenomenex@ SecurityGuardTM Carbo-H cartridges. Column temperature: 650C Mobile phase: 0.01N sulfuric acid.
Flow rate: 0.6 or 0.7 mL/min Injection volume: 20 L Detection: differential refractive index held at 40°C
[00155] Advanced Carbohydrate Separations using HPAE-PAD: Instrument: Dionex@ ICS-5000 Column: Dionex@ CarboPac PA20, 250 x 4 mm. Guard column: Dionex@ CarboPac PA20G, 50 x 4 mm. Column temperature: 350 C Mobile phase: gradient elution with 10mM and 200mM NaOH MP concentrations (made from 50% soln) Gradient: initial 1mM NaOH isocratic for 5min followed by a single-stage gradient to 33mM with subsequent regeneration and equilibration Flow rate: 0.5 mL/min Injection volume: 10 L Detection: post-column gold electrochemical cell (4-step pulsed amperometric mode)
[00156] Trehalase dosing levels were based on total protein levels by Bradford assay. TraT #9, shake-flask, 772 g/mL total protein, Endo-H treated; TrnT #22, shake-flask, 369 g/mL total protein, Endo-H treated; TaaT #24, shake-flask, 914ig/mL total protein, Endo-H treated; Megazyme trehalase Specific activity: 150 U/mg(40°C, pH 5.5), 2100 U/mL. .0 Example 2: Trehalase activity from Trichoderma cellulase enzyme preparation
[00157] Fermentations were performed as described above for 55 hours (hr). Samples tested were as follows: 1. SSF (control); 2. SSF with added benchmark trehalase (prokaryotic trehalase from MEGAZYMES; cat. E-TREH); 3. SSF with 250iL cellulosic enzyme mixture from T. reesei strain (TRIO). Levels of trehalose, DP1, DP2 and ethanol (EtOH) were quantitiated at the end of fermentation (EOF) time point of 55 hr and are shown in Table 1. TABLE 1 Sample DP1 (%wt/v) DP2 (%wt/v) EtOH (%wt/v) SSF 0.05 0.47 16.41 SSF +
benchmark 0.11 0.26 16.55 trehalase SSF + T. reesei cellulosic 0.05 0.16 16.76 enzyme mixture
[00158] A greater than 0.3% wt/v increase in ethanol production was seen from T. reesei cellulosic enzyme mixture (TRIO) dosed fermentations as compared to the control (16.76% wt/v versus 16.41% wt/v). Further, a greater than 0.2% wt/v increase in ethanol production was seen from T. reesei cellulosic enzyme mixture (TRIO) dosed fermentations as compared to the benchmark trehalase (16.76% wt/v versus 16.55% wt/v). This improved yield appears to be attributable to a decrease in DP2 levels, of which trehalose is a constituent. This indicates that the T. reesei cellulosic enzyme mixture contains trehalase activity (data not shown). This result further indicates that the trehalase enzyme(s) in the T. reesei cellulosic enzyme has improved stability and/or activity as compared to the benchmark trehalase.
Example 3: Production of T. reesei (extracellular) trehalase and neutral (cytosolic) trehalase (TraT and TrnT, respectively)
[00159] Sequences for each Trehalase candidate are available as Neutral (cytosolic) trehalase GH37 (tre2) = JGI PID 123226 = Genbank EGR46144.1; amino acid sequence: mpplfslaal Igtailtihs nvahalying sviapcdspi ychgdilrei elahpfsdsktfvdmpakrp Iseiqtafan lpkprndss lqtflasyfa daggeliqvp ranlttnptflskindtvie qfvtqvidiw pdltrryagd aavkncsscp nsfipvnrtf vvaggrfrepyywdsywive gllrtggafv giarntidnf ldfierfgfv pngarlyyln rsqpplsrmvkvyidhtnd tailrralpl Ivkehefwtr nrtvdvrvnn ktyvInqyav qntqprpesfredfqtannr syyaasgiiy patkplnesq ieelyanlas gaesgndyta rwladpsdamrdvyfplrsl nnkdivpvdl nsilygnela iaqfynqtgn ttaarewssl aanrsasiqavfwnetlfsy fdynltsssq niyvpldkda valdrqtapp gkqvlfhvgq fypfwtgaapeylrnnpfav trifdrvksy Idtrpggipa snvntgqqwd qpnvwpphmh ilmeslnsvpatfseadpay qdvrnlslrl gqrydftfc twratggsts etpkqgltd qdvgimfekyndnstnaagg ggeyqvvegf gwtngvllwt adtfgsqlkr pqcgnimagh .0 papskrsavqldmwdasrvk kfgrraegrm gtlhaw (SEQ ID NO: 1)
[00160] Acid (extracellular) trehalase GH65 (trel) = JGI PID 123456 = Genbank EGR45658.1 (JGI - Joint Genorne Institute). Amino acid sequence: mrstvtsaaa llsllqlvsp vhgttlvdrv tkclsrhdgs daeshfsknv yktdfagvtwdednwlstt qlkqgafear gsvangylgi nvasvgpffe vdteedgdvi sgwplfsrrqsfatvagfwd aqpqmngtnf pwlsqygsdt aisgiphwsg lvldlgggty ldatvsnktishfrstydyk agvlswsykw tpkgnkgsfd isyrlfankl hvnqavvdmq vtasknvqasivnvldgfaa vrtdfvesge dgsaifaavr pngvanvtay vyaditgsgg vnlssrkivhnkpyvhanas siaqavpvkf aagrtvrvtk fvgaassdaf knpkqvakka aaaglsngytkslkahveew atvmpessvd sfadpktgk padshivdsa iiavtntyyl lqntvgkngikavdgapvnv dsisvgglts dsyagqifwd adlwmqpglv aahpeaaeri tnyrlarygqakenvktaya gsqnetffsa saavfpwtsg rygnctatgp cwdyeyhlng digislvnqwvvngdtkdfe knlfpvydsv aqlygnllrp nktswtltnm tdpdeyanhv daggytmpliaetlqkansf rqqfgieqnk twndmasnvl vlrengvtle ftamngtavv kqadvimtyplsygtnysa qdalndldyy ankqspdgpa mtyaffsiva neispsgcsa ytyaqnafkpyvrapfyqis eqliddasvn ggthpaypfl tghggahqvv Ifgylglrlv pddvihiepnlppqipylry rtfywrgwpi sawsnythtt Israagvaal egadqrfark pitihagpeqdptayrlpvk gsvvipnkqi gsqqtyagnl vqchaasspn dyvpgqfpia avdgatstkwqpasadkvss itvsldkedv gsvsgfhfd waqappvnat vifhdealad patalasahkhnskyttvts Itnielsdpy vstkdlnaia ipignttnvt Ishpvaasry asllivgnqgldpvdvkakn gtgatvaewa ifghgkehsg kpsshskrrl nvrtaatlsn prsfmrrrl (SEQ ID NO: 2)
[00161] Amplified from Genomic DNA, cloned into a standard Trichoderma expression vector in E.coli, sequenced, digested and gel purified out the bacterial DNA, PCR amplified the exempt expression cassette. Performed PEG transformation of the exempt trehalase into LVS EndoT Delete strain and plated on VOGELs plates. Transformants appeared after 3-4 days. Picked approximately 100 transformants of each stable trehalase. Transferred each stable transformant to 24-well plate and allowed to grow 6 days at 28°C in Aachen media. Screened broth of transformants by protein expression (SDS-PAGE gels) and activity (MEGAZYMES trehalase activity assay). Top transformants were inoculated into 250mL shake flasks in duplicate in Aachen medium as well as in slow-release microtiter plates in NREL media. Cultures were allowed to grow at 28°C for 6 days. Broth samples were checked by activity assay/SDS-Page for highest activity/expression. Top transformants were selected for 14L evaluation. Final top Trehalase candidate selected: LVS-ETD T.reesei acid trehalase #23.
Example 4: Comparison of TraT and TrnT stability/activity during fermentation to TaaT and benchmark trehalase
[00162] Comprehensive fermentation performance views for trehalose dynamics for each set of trehalase dosing sets are shown in Figures 1 (TraT), 2 (TrnT) and 3 (TaaT; Trichoderma atroviride trehalase). Each of these comparisons also included the control and benchmark (MEGAZYMES) fermentations. The trehalose time profile for the control was as expected, with .0 a small initial decrease in trehalose followed by an almost equal increase latter in fermentation. These trehalose dynamics within this control could have been either due to natural fluxes in and out of the yeast cells and/or trace levels of background trehalases known to exist.
[00163] When comparing trehalase-dosed fermentations, complete trehalose hydrolysis was seen for the 22 hour sampling time. However, later time points in fermentation revealed significant differences in performance. Specifically, for both the Trichoderma reeseitrehalases, the trehalose levels remained low throughout the entire course of the fermentation (Figures 1 and 2). However, the Trichoderma atroviride profiles showed significant increases in the extracellular trehalose levels at later time points. Since trehalose levels were initially reduced to below detectable limits in all samples, this significant rise in trehalose levels towards the end of fermentation was evidence of TaaT stability/activity issues. This trehalase application stability issue was also apparent for the benchmark (Megazyme) trehalase (shown in each of Figures 1, 2, and 3; dotted line; note the marked increase in trehalose at later time points in fermentation).
Example 5: Effect of adding TraT in EtOH fermentation
[00164] Based on the results above, the addition of TraT to fermentations was assessed for its effectiveness in improving the production of ethanol in fermentations. Fermentations were set up as described above in Example 1 with (1) no added trehalase (control), (2) with 0.5 g/g DS TraT added at the beginning of fermentation, or (3) with 0.25pg/g DS TraT added at the beginning of fermentation. Fermentations were performed for 72 hours with samples taken at 0, 24, 32, 48, 56, and 72 hours. The fermentations were run at 36C temperature ramp, not only to be more indicative of a fermentation plant conditions, but also to provide a more stressed environment for the yeast cells.
[00165] As shown in Figure 4, the addition of either 0.5 ig/g DS or 0.25 ig/g DS TraT at the beginning of fermentation results in reduced trehalose levels throughout the fermentation as compared to the control (no trehalase added). The peak trehalose level observed in the TraT samples (32 hr time point) was about 0.2%wt/v as compared to about 0.35%wt/v in the control (48 hr timepoint). DP2 levels were also measured for these time points and are shown in Figure 5. DP2 levels decreased in all the samples, however, the decrease was more pronounced for the fermentations treated with trehalase TraT.
[00166] Figure 6 shows that the EtOH levels (%v/v) at EOF (72 hr) for the TraT containing fermentations were significantly higher than the control fermentation (no added trehalase). It is noted that the increase in EtOH observed is more than would be expected based solely on the increased consumption of glucose by the yeast that is derived from trehalose hydrolysis by trehalase. For example, if a 0.2% wt/v trehalose level in the extracellular supernatant environment is completely hydrolyzed by the end of fermentation, a .0 0.14%v/v increase in ethanol would be expected. However, greater ethanol increases were seen in these experiments. Specifically, heat ramped fermentations showed a 0.22% wt/v reduction in trehalose over control (Figure 4, 0.5 g/g DS TraT), and therefore a 0.12%v/v ethanol increase is expected. Instead, an approximate 50% larger than expected increase was measured (~0.28%v/v ethanol increase; Figure 6, 0.5 g/g DS TraT). This data also shows that the EOF DP2 level is not the absolute determining factor for the amount of ethanol increase due to trehalase treatment. Even though both doses show a similar 72hr EOF trehalose level, the higher dose that kept trehalose levels lower throughout SSF showed the largest increase in ethanol production.
[00167] With regard to this finding, additional lab scale fermentation data show that addition of trehalase to SSF keeps the fermentative yeast active for longer during fermentation for extra ethanol conversion. Specifically, the addition of trehalase at the start of fermentation allows the yeast to reach higher EOF ethanol levels than control fermentations (see Figures 7 and 8).
Example 6 The effect of trehalase treatment on the levels of trehalose in subsequent fermentations
[00168] The fermentations were carried out as described above. However, after the first fermentation with atrehalase treatment, the backsets from those fermentations were used in preparing the subsequent fermentation reactions. The amount of trehalose was measured at various timepoints. Thedata isshown in the Table below andFigure 9.As can be seen, the trehalose profiles take afew fermentations to come down to lower levels. Furthermore, the trehalose profiles after ending atrehalasetrial show thelonger-lasting effects ofreducing trehalose. Not wishing to bebound by the theory, it ispossible that both of these effects are due to the time required to re-equilibrate the backset trehalose levels, as supported by the size and rate of the particular fuel ethanol plant from which this data wasgenerated.
hou dcvse .. .... .... ....................... . .. .....XX..... X. X. X:. .. .. .. .. .. .. .. ... .
.. .. .. ......... 10XXX :::::: ...... 10. . . * -....... ...... 10 GxffXrm ............ ..10. ........ ..... ...... ........ .0 .. ......0 .. .... .... ... ... ... 1 0. .. .. .. .... .. .... .. .. .. .. .. ......................... .
.. ..... 4. . .......... .
..00169]. Whilprefrredmbodmensoftepreentivenionhvebenshonan descrbedhrein.twilbeobioustthosskiledintearthatschembdimetsar providedbywaofexampleon.Nueosvrainscags.nsbsiuinsilo occurtothosskilledinteartwithoutepartingfrmtheinventin.Itshouldeunderstoo 15 thatvariusalternatiestotheemboimentsofthenventiondesribedhereinanbeemploye inpracticingtheinvention..................Itisintendedthatthefollowingclaimsdefinethescopeofthe. inventionandthatmethodsandstructureswithinthescopeoftheseclaimsandtheir..................... equivalentsbecoveredthereby.... ..................... .................. ::: .. .. ... .. 3. .
[001701 Where the terms "comprise", "comprises", "comprised" or "comprising" are used in this specification, they are to be interpreted as specifying the presence of the stated features, integers, steps or components referred to, but not to preclude the presence or addition of one or more other feature, integer, step, component or group thereof.
Claims (1)
- Claims1. A method of increasing the production of ethanol from a liquefact in a fermentation reaction,comprising:a) fermenting the liquefact with a glucoamylase, a fermenting organism and atrehalase; andb) recovering ethanol and other desired fermentation products at the end of thefermentation, wherein the trehalase-treated fermentation yields increased ethanol compared tothe fermentation reaction that is not treated with a trehalase.2. A method of decreasing the final concentrations of DP2 in a fermentation product,comprising:a) fermenting a liquefact with a glucoamylase, a fermenting organism and atrehalase; andb) recovering the desired fermentation products at the end of the fermentationwherein the DP2 concentrations are reduced compared to a fermentation not treated with atrehalase.3. The method of any one of claims 1 or 2 wherein the glucoamylase is TrG4 variant, SEQ IDNO: 3.4. The method of claims 1 to 3, wherein the trehalase is from a eukaryote.5. The method of claim 4, wherein the trehalase is from a filamentous fungi.6. The method of claim 5, wherein the filamentous fungi is Trichoderma.7. The method of any one of claims 1 to 6, wherein the trehalase is an acid trehalase.8. The method of any one of claims 1 to 6, wherein the trehalase is neutral trehalase.9. The method of any one of claims 1 to 8, wherein the trehalase is added at a concentration ofabout 0.1 g/g DS to about 1000 g/g DS of liquefact.10. The method of claim 9, wherein the trehalase is added at a concentration of about 0.25tg/gDS to about 100 g/g DS of liquefact.11. The method of claim 10, wherein the trehalase is added at a concentration of about 0.5gg/gDS to about 10 g/g DS of liquefact.12. A method of increasing production of ethanol from a liquefact in a fermentation reaction,comprising:a) fermenting the liquefact with a glucoamylase, a fermenting organism and afermentation-stabe trehalase; andb) recovering ethanol and other desired fermentation products at the end of thefermentation, wherein the trehalase-treated fermentation yields increased ethanol compared tothe fermentation that is not treated with a trehalase.13. A method of extending ethanol production time-wise, by a fermenting organism in afermentation reaction comprising adding a trehalase at the start of the fermentation14. A method of extending ethanol production time-wise, by a fermenting organism in afermentation reaction comprising adding a trehalase during the fermentation.15. The method of any one of claims 12 to 14. wherein the gluccamyalse is TrG4 variant, SEQID NO: 3.18. The method of any one of claims 12 to 14, wherein the trehalase is added at aconcentration of about 0.1 g/g DS to about 1000 g/g DS in the fermentation medium.17. The method of claim 16, wherein the trehalase is added at a concentration of about 0.25gg/g DS to about 100 jig/g DS in the fermentation medium.18. The method of claim 17, wherein the trehalase is added at a concentration of about 0.5 gg/gDS to about 10apg/g DS in the fermentation medium.19. A method of improving ethanol production in a fermentation reaction comprising maintainingtrehalose levels below a threshold level throughout the fermentation reacton, wheren the threshold level is below twice the trehalose concentration at the start of the fermentation(%wtI/v).20- A method of improving ethanol production in fermentation reaction comprising addingtrehalase to the fermentation reaction, thereby maintaining trehalose levels below a thresholdlevel throughout the fermentation reaction, wherein the threshold lever Is below half thetrehalose concentration that would have been present during fermentation if no trehalase wasadded to the process {%wt/v).21. The method of any one ofthe above claims, further comprisingadditional enzymes,selected from the group consisting of acyl transferases, alpha-amylases, p-amylases, alpha galactosidases, arabinosidases, aryl esterases, beta-galactosidases. carrageenases,catalases, cellobiohydrolases, cellulases, chondroitinases, cutinases, endo-beta-1, 4glucanases, endo-p-mannanases, esterases, exo-mannanases, galactanases, glucoamylases,hernicellulases, hyaluronidases.keralinases, laccases, lactases, ligninases, lipases,lipoxygenases, mannanases, oxidases, pectate lyases, pectin acetyl esterases, pectinases,pentosanases, peroxidases, phenoloxidases, phosphatases, phospholipases, phytases,polygalacturnases, proteases, pullulanases, reductases, rhamnogalacturonases, Gglucanases, tannases, transglutaminases, xylan aoetyl-eslerases, xylanases, xyloglucanases,and xylosidases.22. An improved fermentation process for ethanol production, comprising use of a backset orthin stillage that has trehalose levels lower than0.05%wt/v.23. An improved fermentation process for ethanol production, comprising use of a backset orthin stillage n the fermentation reaction that has trehaose [evels lower than 0.1%wtv.24. A method for improving ethanol production in a fermentation reaction by removing trehalosefrom the backset.25. A method for improving ethanol production in a fermentation reaction comprising liquefactand backset by removing trehalose; comprising use of a trehalase in fermentation reaction,wherein trehalose levels are lower than 0.01%w/v of the fermentation reaction.26. A method for improving ethanol production in a fermentation reaction by removing trehalosefrom the liquefaction comprising backset, comprising removal of trehalose rn backset bytreatment with a trehalase, wherein Irehalose levels are lower than 0.05%w/v of the Lackset.27. The method of any one of claims 1 to 6,wherein the increase in ethanol productioncomprises 0.1%(v/v) or greater, 0-15%(v/v) or greater, 0.2% (v/v) or greater. 0.25% (vv) orgreater, 0.3% (v/v) or greater: 0.4% (v/v) or greater, 1 0% or greater compared to thefermentation that is not treated with a trehalase.28. A method of increasing the production of ethanol from a liquefact in a fermentation reaction,comprising:a) fermenting the liquefact with one or more amylases, a fermenting organism anda trehalase; andb) recovering ethanol and other desired fermentation products at the end of thefermentation, wherein the trehalase-treated fermentation yields increased ethanol compared tothe fermentation reaction that is not treated with a trehalase.29. The method of claim 28, wherein the one or more amylases are selected from an alphaamylase, a beta-amylase, a glucoamylase or a maltogenic arnylase.of 13of 13of 13of 13of 13of 13of 13of 13of 13of 13of 13of 13of 13
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
AU2022202136A AU2022202136A1 (en) | 2013-10-28 | 2022-03-29 | Trehalase in fermentations |
Applications Claiming Priority (6)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US201361896601P | 2013-10-28 | 2013-10-28 | |
US61/896,601 | 2013-10-28 | ||
AU2014342553A AU2014342553A1 (en) | 2013-10-28 | 2014-10-28 | Trehalase in fermentations |
AU2018208775A AU2018208775A1 (en) | 2013-10-28 | 2018-07-30 | Trehalase in fermentations |
AU2020204527A AU2020204527A1 (en) | 2013-10-28 | 2020-07-07 | Trehalase in fermentations |
AU2022202136A AU2022202136A1 (en) | 2013-10-28 | 2022-03-29 | Trehalase in fermentations |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2020204527A Division AU2020204527A1 (en) | 2013-10-28 | 2020-07-07 | Trehalase in fermentations |
Publications (1)
Publication Number | Publication Date |
---|---|
AU2022202136A1 true AU2022202136A1 (en) | 2022-04-14 |
Family
ID=63142280
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2018208775A Abandoned AU2018208775A1 (en) | 2013-10-28 | 2018-07-30 | Trehalase in fermentations |
AU2020204527A Abandoned AU2020204527A1 (en) | 2013-10-28 | 2020-07-07 | Trehalase in fermentations |
AU2022202136A Abandoned AU2022202136A1 (en) | 2013-10-28 | 2022-03-29 | Trehalase in fermentations |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU2018208775A Abandoned AU2018208775A1 (en) | 2013-10-28 | 2018-07-30 | Trehalase in fermentations |
AU2020204527A Abandoned AU2020204527A1 (en) | 2013-10-28 | 2020-07-07 | Trehalase in fermentations |
Country Status (1)
Country | Link |
---|---|
AU (3) | AU2018208775A1 (en) |
Families Citing this family (2)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
WO2020100062A1 (en) * | 2018-11-13 | 2020-05-22 | Lallemand Hungary Liquidity Management Llc | Combined expression of trehalose producing and trehalose degrading enzymes |
CN109906842B (en) * | 2018-12-13 | 2022-03-11 | 于凯波 | Application of hypersensitive protein complex enzyme preparation in preventing and treating huanglongbing |
-
2018
- 2018-07-30 AU AU2018208775A patent/AU2018208775A1/en not_active Abandoned
-
2020
- 2020-07-07 AU AU2020204527A patent/AU2020204527A1/en not_active Abandoned
-
2022
- 2022-03-29 AU AU2022202136A patent/AU2022202136A1/en not_active Abandoned
Also Published As
Publication number | Publication date |
---|---|
AU2020204527A1 (en) | 2020-07-30 |
AU2018208775A1 (en) | 2018-08-16 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CN105722989B (en) | Trehalase in fermentation | |
EP2297313B1 (en) | Variant alpha-amylases from bacillus subtilis and methods of use, thereof | |
US10364444B2 (en) | Saccharomyces cerevisiae yeast strains and methods of use thereof | |
EP2291526B1 (en) | Saccharification enzyme composition with Bacillus subtilis alpha-amylase | |
JP5463146B2 (en) | Starch hydrolysis using phytase with alpha-amylase | |
EP2461702B1 (en) | Alpha-amylase blend for starch processing and method of use thereof | |
EP2561083B1 (en) | Use of Humicola grisea glucoamylase in an SSF process at neutral pH | |
MX2014006464A (en) | Processes for producing fermentation products. | |
EP3063282A1 (en) | Processes for producing fermentation products | |
US20160010128A1 (en) | Method of using alpha-amylase from aspergillus terreus and pullulanase for saccharification | |
JP7069201B2 (en) | Thermal stability glucoamylase and its usage | |
US20150240223A1 (en) | Method of using alpha-amylase from talaromyces emersonii for saccharification | |
US20230023446A1 (en) | Processes for producing fermentation products | |
WO2015066669A1 (en) | Proteases in corn processing | |
AU2022202136A1 (en) | Trehalase in fermentations | |
EP2417255A2 (en) | Production of maltotetraose syrup using a pseudomonas saccharophila maltotetraohyfrolase variant | |
US20160040202A1 (en) | Method of using alpha-amylase from aspergillus fumigatus and pullulanase for saccharification | |
WO2015094714A1 (en) | Proteases in grain processing | |
WO2015021601A1 (en) | Simultanenous liquifaction and malto-saccharification | |
WO2014093125A1 (en) | Method of using alpha-amylase from aspergillus fumigatus and isoamylase for saccharification | |
CN111989400B (en) | Alpha-amylase, compositions and methods | |
US20200277632A1 (en) | Glucoamylase and methods of use, thereof | |
WO2015066667A1 (en) | Proteases in wheat processing | |
AU2014342553A1 (en) | Trehalase in fermentations |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
MK5 | Application lapsed section 142(2)(e) - patent request and compl. specification not accepted |