AU2017232129A1 - Specific biomarker set for non-invasive diagnosis of liver cancer - Google Patents
Specific biomarker set for non-invasive diagnosis of liver cancer Download PDFInfo
- Publication number
- AU2017232129A1 AU2017232129A1 AU2017232129A AU2017232129A AU2017232129A1 AU 2017232129 A1 AU2017232129 A1 AU 2017232129A1 AU 2017232129 A AU2017232129 A AU 2017232129A AU 2017232129 A AU2017232129 A AU 2017232129A AU 2017232129 A1 AU2017232129 A1 AU 2017232129A1
- Authority
- AU
- Australia
- Prior art keywords
- biomarker
- antibodies
- auto
- biomarkers
- conjugated
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 208000014018 liver neoplasm Diseases 0.000 title claims abstract description 31
- 239000000090 biomarker Substances 0.000 title claims description 102
- 201000007270 liver cancer Diseases 0.000 title abstract description 21
- 238000003745 diagnosis Methods 0.000 title abstract description 11
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 43
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 42
- 206010028980 Neoplasm Diseases 0.000 claims abstract description 30
- 238000000034 method Methods 0.000 claims abstract description 26
- 210000002966 serum Anatomy 0.000 claims abstract description 24
- 238000001514 detection method Methods 0.000 claims abstract description 18
- 108010092801 Midkine Proteins 0.000 claims abstract description 12
- 210000004027 cell Anatomy 0.000 claims abstract description 12
- 102000003973 Fibroblast growth factor 21 Human genes 0.000 claims abstract description 11
- 108090000376 Fibroblast growth factor 21 Proteins 0.000 claims abstract description 11
- 101000697529 Homo sapiens Stathmin-4 Proteins 0.000 claims abstract description 11
- 102100024535 Small ubiquitin-related modifier 4 Human genes 0.000 claims abstract description 11
- 102100028049 Stathmin-4 Human genes 0.000 claims abstract description 11
- 101100450337 Homo sapiens HDGFL2 gene Proteins 0.000 claims abstract description 10
- 101100177327 Homo sapiens HDGFL3 gene Proteins 0.000 claims abstract description 10
- 102100036679 Interleukin-26 Human genes 0.000 claims abstract description 10
- 101000853000 Homo sapiens Interleukin-26 Proteins 0.000 claims abstract description 9
- 101000945751 Homo sapiens Leukocyte cell-derived chemotaxin-2 Proteins 0.000 claims abstract description 8
- 102100034762 Leukocyte cell-derived chemotaxin-2 Human genes 0.000 claims abstract description 8
- 238000011002 quantification Methods 0.000 claims abstract description 7
- -1 SODI Proteins 0.000 claims abstract description 6
- 101100356682 Caenorhabditis elegans rho-1 gene Proteins 0.000 claims abstract 6
- 101000852559 Homo sapiens Thioredoxin Proteins 0.000 claims abstract 6
- 102000016776 Midkine Human genes 0.000 claims abstract 6
- 101100058550 Mus musculus Bmi1 gene Proteins 0.000 claims abstract 6
- 101150111584 RHOA gene Proteins 0.000 claims abstract 6
- 101710081624 Small ubiquitin-related modifier 4 Proteins 0.000 claims abstract 6
- 102100031001 Hepatoma-derived growth factor-related protein 2 Human genes 0.000 claims abstract 5
- 239000011324 bead Substances 0.000 claims description 51
- 206010073071 hepatocellular carcinoma Diseases 0.000 claims description 38
- 231100000844 hepatocellular carcinoma Toxicity 0.000 claims description 36
- 239000000107 tumor biomarker Substances 0.000 claims description 18
- 102000008221 Superoxide Dismutase-1 Human genes 0.000 claims description 14
- 108010021188 Superoxide Dismutase-1 Proteins 0.000 claims description 14
- 102100039435 C-X-C motif chemokine 17 Human genes 0.000 claims description 12
- 101000889048 Homo sapiens C-X-C motif chemokine 17 Proteins 0.000 claims description 12
- 239000004005 microsphere Substances 0.000 claims description 12
- 101800004490 Endothelin-1 Proteins 0.000 claims description 10
- 101000807354 Homo sapiens Ubiquitin-conjugating enzyme E2 C Proteins 0.000 claims description 10
- 102000013691 Interleukin-17 Human genes 0.000 claims description 10
- 108050003558 Interleukin-17 Proteins 0.000 claims description 10
- 102100037256 Ubiquitin-conjugating enzyme E2 C Human genes 0.000 claims description 10
- 239000002299 complementary DNA Substances 0.000 claims description 9
- 238000005406 washing Methods 0.000 claims description 6
- 239000013612 plasmid Substances 0.000 claims description 5
- 210000004881 tumor cell Anatomy 0.000 claims description 4
- 108010004729 Phycoerythrin Proteins 0.000 claims 15
- 102400000686 Endothelin-1 Human genes 0.000 claims 5
- 102100036407 Thioredoxin Human genes 0.000 claims 5
- 239000000203 mixture Substances 0.000 claims 4
- 150000001413 amino acids Chemical group 0.000 claims 2
- 101100450324 Arabidopsis thaliana HDG2 gene Proteins 0.000 claims 1
- 210000002919 epithelial cell Anatomy 0.000 abstract description 6
- 239000000427 antigen Substances 0.000 abstract description 5
- 108091007433 antigens Proteins 0.000 abstract description 5
- 102000036639 antigens Human genes 0.000 abstract description 5
- 238000005259 measurement Methods 0.000 abstract description 5
- 230000000295 complement effect Effects 0.000 abstract description 4
- 238000004519 manufacturing process Methods 0.000 abstract description 3
- 206010019695 Hepatic neoplasm Diseases 0.000 abstract description 2
- 238000002405 diagnostic procedure Methods 0.000 abstract description 2
- 238000004393 prognosis Methods 0.000 abstract description 2
- 210000005228 liver tissue Anatomy 0.000 abstract 1
- 239000003550 marker Substances 0.000 abstract 1
- 235000018102 proteins Nutrition 0.000 description 25
- 125000003275 alpha amino acid group Chemical group 0.000 description 16
- 230000014509 gene expression Effects 0.000 description 14
- 230000001580 bacterial effect Effects 0.000 description 11
- 238000001574 biopsy Methods 0.000 description 10
- 102100023635 Alpha-fetoprotein Human genes 0.000 description 9
- BQENDLAVTKRQMS-SBBGFIFASA-L Carbenoxolone sodium Chemical compound [Na+].[Na+].C([C@H]1C2=CC(=O)[C@H]34)[C@@](C)(C([O-])=O)CC[C@]1(C)CC[C@@]2(C)[C@]4(C)CC[C@@H]1[C@]3(C)CC[C@H](OC(=O)CCC([O-])=O)C1(C)C BQENDLAVTKRQMS-SBBGFIFASA-L 0.000 description 9
- 108010026331 alpha-Fetoproteins Proteins 0.000 description 9
- 210000001519 tissue Anatomy 0.000 description 9
- 102100030335 Midkine Human genes 0.000 description 8
- 239000006228 supernatant Substances 0.000 description 8
- 238000005119 centrifugation Methods 0.000 description 7
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 7
- 102100039389 Hepatoma-derived growth factor-related protein 3 Human genes 0.000 description 6
- 102000002933 Thioredoxin Human genes 0.000 description 6
- 239000000872 buffer Substances 0.000 description 6
- 230000006698 induction Effects 0.000 description 6
- 239000013642 negative control Substances 0.000 description 6
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 6
- 238000012360 testing method Methods 0.000 description 6
- 108060008226 thioredoxin Proteins 0.000 description 6
- 229940094937 thioredoxin Drugs 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 5
- 102100033902 Endothelin-1 Human genes 0.000 description 5
- 101000832643 Homo sapiens Small ubiquitin-related modifier 4 Proteins 0.000 description 5
- 238000001962 electrophoresis Methods 0.000 description 5
- 108010087917 rhoA GTP Binding Protein Proteins 0.000 description 5
- 102000009099 rhoA GTP Binding Protein Human genes 0.000 description 5
- 238000013461 design Methods 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 230000018109 developmental process Effects 0.000 description 4
- 230000000694 effects Effects 0.000 description 4
- 238000013537 high throughput screening Methods 0.000 description 4
- 210000004185 liver Anatomy 0.000 description 4
- 238000004949 mass spectrometry Methods 0.000 description 4
- 238000012544 monitoring process Methods 0.000 description 4
- 230000001105 regulatory effect Effects 0.000 description 4
- QFVHZQCOUORWEI-UHFFFAOYSA-N 4-[(4-anilino-5-sulfonaphthalen-1-yl)diazenyl]-5-hydroxynaphthalene-2,7-disulfonic acid Chemical compound C=12C(O)=CC(S(O)(=O)=O)=CC2=CC(S(O)(=O)=O)=CC=1N=NC(C1=CC=CC(=C11)S(O)(=O)=O)=CC=C1NC1=CC=CC=C1 QFVHZQCOUORWEI-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102000029749 Microtubule Human genes 0.000 description 3
- 108091022875 Microtubule Proteins 0.000 description 3
- UDSAIICHUKSCKT-UHFFFAOYSA-N bromophenol blue Chemical compound C1=C(Br)C(O)=C(Br)C=C1C1(C=2C=C(Br)C(O)=C(Br)C=2)C2=CC=CC=C2S(=O)(=O)O1 UDSAIICHUKSCKT-UHFFFAOYSA-N 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 230000008878 coupling Effects 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 238000005859 coupling reaction Methods 0.000 description 3
- 238000011156 evaluation Methods 0.000 description 3
- 238000011534 incubation Methods 0.000 description 3
- 210000004688 microtubule Anatomy 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 230000035945 sensitivity Effects 0.000 description 3
- 238000013207 serial dilution Methods 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 239000000243 solution Substances 0.000 description 3
- 238000010200 validation analysis Methods 0.000 description 3
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 2
- 238000011537 Coomassie blue staining Methods 0.000 description 2
- 102000004190 Enzymes Human genes 0.000 description 2
- 108090000790 Enzymes Proteins 0.000 description 2
- 102000058063 Glucose Transporter Type 1 Human genes 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 101000990990 Homo sapiens Midkine Proteins 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- 108010057466 NF-kappa B Proteins 0.000 description 2
- 102000003945 NF-kappa B Human genes 0.000 description 2
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 2
- 239000011542 SDS running buffer Substances 0.000 description 2
- 108091006296 SLC2A1 Proteins 0.000 description 2
- 210000001744 T-lymphocyte Anatomy 0.000 description 2
- XSQUKJJJFZCRTK-UHFFFAOYSA-N Urea Chemical compound NC(N)=O XSQUKJJJFZCRTK-UHFFFAOYSA-N 0.000 description 2
- 238000007792 addition Methods 0.000 description 2
- 208000002353 alcoholic hepatitis Diseases 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 230000033115 angiogenesis Effects 0.000 description 2
- 238000009534 blood test Methods 0.000 description 2
- 239000004202 carbamide Substances 0.000 description 2
- 230000015556 catabolic process Effects 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 230000012292 cell migration Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 230000007882 cirrhosis Effects 0.000 description 2
- 238000002591 computed tomography Methods 0.000 description 2
- 210000000172 cytosol Anatomy 0.000 description 2
- 238000006731 degradation reaction Methods 0.000 description 2
- 230000001419 dependent effect Effects 0.000 description 2
- 238000010586 diagram Methods 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000013399 early diagnosis Methods 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 239000006166 lysate Substances 0.000 description 2
- 238000002595 magnetic resonance imaging Methods 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- YBYRMVIVWMBXKQ-UHFFFAOYSA-N phenylmethanesulfonyl fluoride Chemical compound FS(=O)(=O)CC1=CC=CC=C1 YBYRMVIVWMBXKQ-UHFFFAOYSA-N 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 239000000310 rehydration solution Substances 0.000 description 2
- 108091008146 restriction endonucleases Proteins 0.000 description 2
- SQGYOTSLMSWVJD-UHFFFAOYSA-N silver(1+) nitrate Chemical compound [Ag+].[O-]N(=O)=O SQGYOTSLMSWVJD-UHFFFAOYSA-N 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- AVFYBUNTBGASMF-UHFFFAOYSA-N 1,1-bis(sulfanylidene)-3h-dithiole Chemical group S=S1(=S)SCC=C1 AVFYBUNTBGASMF-UHFFFAOYSA-N 0.000 description 1
- UMCMPZBLKLEWAF-BCTGSCMUSA-N 3-[(3-cholamidopropyl)dimethylammonio]propane-1-sulfonate Chemical compound C([C@H]1C[C@H]2O)[C@H](O)CC[C@]1(C)[C@@H]1[C@@H]2[C@@H]2CC[C@H]([C@@H](CCC(=O)NCCC[N+](C)(C)CCCS([O-])(=O)=O)C)[C@@]2(C)[C@@H](O)C1 UMCMPZBLKLEWAF-BCTGSCMUSA-N 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 208000007788 Acute Liver Failure Diseases 0.000 description 1
- 206010000804 Acute hepatic failure Diseases 0.000 description 1
- 229920000936 Agarose Polymers 0.000 description 1
- 102000004506 Blood Proteins Human genes 0.000 description 1
- 108010017384 Blood Proteins Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 108010012236 Chemokines Proteins 0.000 description 1
- 102000019034 Chemokines Human genes 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- 206010008909 Chronic Hepatitis Diseases 0.000 description 1
- 206010009208 Cirrhosis alcoholic Diseases 0.000 description 1
- 108050006400 Cyclin Proteins 0.000 description 1
- 102000016736 Cyclin Human genes 0.000 description 1
- 108010037462 Cyclooxygenase 2 Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 108020004414 DNA Proteins 0.000 description 1
- 229920000045 Dermatan sulfate Polymers 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- MYMOFIZGZYHOMD-UHFFFAOYSA-N Dioxygen Chemical compound O=O MYMOFIZGZYHOMD-UHFFFAOYSA-N 0.000 description 1
- 102000010180 Endothelin receptor Human genes 0.000 description 1
- 108050001739 Endothelin receptor Proteins 0.000 description 1
- 241000588724 Escherichia coli Species 0.000 description 1
- 206010016654 Fibrosis Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 229920002683 Glycosaminoglycan Polymers 0.000 description 1
- 229920002971 Heparan sulfate Polymers 0.000 description 1
- 241000724675 Hepatitis E virus Species 0.000 description 1
- 206010019728 Hepatitis alcoholic Diseases 0.000 description 1
- 102000017286 Histone H2A Human genes 0.000 description 1
- 108050005231 Histone H2A Proteins 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 108700005087 Homeobox Genes Proteins 0.000 description 1
- 101000827785 Homo sapiens Alpha-fetoprotein Proteins 0.000 description 1
- 101001083788 Homo sapiens Hepatoma-derived growth factor-related protein 2 Proteins 0.000 description 1
- 101001035685 Homo sapiens Hepatoma-derived growth factor-related protein 3 Proteins 0.000 description 1
- 101000961071 Homo sapiens NF-kappa-B inhibitor alpha Proteins 0.000 description 1
- 101150030333 Il12b gene Proteins 0.000 description 1
- 101710181612 Interleukin-26 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 102000004889 Interleukin-6 Human genes 0.000 description 1
- 102100040448 Leukocyte cell-derived chemotaxin 1 Human genes 0.000 description 1
- 101710125682 Leukocyte cell-derived chemotaxin 1 Proteins 0.000 description 1
- 102000043136 MAP kinase family Human genes 0.000 description 1
- 108091054455 MAP kinase family Proteins 0.000 description 1
- 102100039337 NF-kappa-B inhibitor alpha Human genes 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 108091008197 PRC1-like complexes Proteins 0.000 description 1
- 102000012425 Polycomb-Group Proteins Human genes 0.000 description 1
- 102100038280 Prostaglandin G/H synthase 2 Human genes 0.000 description 1
- 206010039491 Sarcoma Diseases 0.000 description 1
- 208000034189 Sclerosis Diseases 0.000 description 1
- 108091058545 Secretory proteins Proteins 0.000 description 1
- 102000040739 Secretory proteins Human genes 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- 208000021712 Soft tissue sarcoma Diseases 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical compound [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 1
- 108010017842 Telomerase Proteins 0.000 description 1
- 102100032938 Telomerase reverse transcriptase Human genes 0.000 description 1
- 239000007983 Tris buffer Substances 0.000 description 1
- 101710132695 Ubiquitin-conjugating enzyme E2 Proteins 0.000 description 1
- 101800001117 Ubiquitin-related Proteins 0.000 description 1
- 230000002159 abnormal effect Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 231100000836 acute liver failure Toxicity 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 208000010002 alcoholic liver cirrhosis Diseases 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- 230000019552 anatomical structure morphogenesis Effects 0.000 description 1
- 230000002491 angiogenic effect Effects 0.000 description 1
- 230000002424 anti-apoptotic effect Effects 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 230000003078 antioxidant effect Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 201000008274 breast adenocarcinoma Diseases 0.000 description 1
- 201000007476 breast mucinous carcinoma Diseases 0.000 description 1
- 238000011088 calibration curve Methods 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 230000009400 cancer invasion Effects 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000021164 cell adhesion Effects 0.000 description 1
- 230000013255 cell cycle cytokinesis Effects 0.000 description 1
- 230000006369 cell cycle progression Effects 0.000 description 1
- 230000030833 cell death Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000003915 cell function Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 230000001413 cellular effect Effects 0.000 description 1
- 230000007248 cellular mechanism Effects 0.000 description 1
- 239000005482 chemotactic factor Substances 0.000 description 1
- 210000001612 chondrocyte Anatomy 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 230000006020 chronic inflammation Effects 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 210000000805 cytoplasm Anatomy 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 230000018044 dehydration Effects 0.000 description 1
- 238000006297 dehydration reaction Methods 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- AVJBPWGFOQAPRH-FWMKGIEWSA-L dermatan sulfate Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@H](OS([O-])(=O)=O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O)[C@H](C([O-])=O)O1 AVJBPWGFOQAPRH-FWMKGIEWSA-L 0.000 description 1
- 229940051593 dermatan sulfate Drugs 0.000 description 1
- 238000010790 dilution Methods 0.000 description 1
- 239000012895 dilution Substances 0.000 description 1
- 229910001882 dioxygen Inorganic materials 0.000 description 1
- 150000004662 dithiols Chemical class 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 238000009509 drug development Methods 0.000 description 1
- 206010013864 duodenitis Diseases 0.000 description 1
- 239000003480 eluent Substances 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 208000010706 fatty liver disease Diseases 0.000 description 1
- 210000003754 fetus Anatomy 0.000 description 1
- 239000012530 fluid Substances 0.000 description 1
- 210000001650 focal adhesion Anatomy 0.000 description 1
- 239000011888 foil Substances 0.000 description 1
- 210000002196 fr. b Anatomy 0.000 description 1
- 210000003918 fraction a Anatomy 0.000 description 1
- 210000000540 fraction c Anatomy 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 102000034356 gene-regulatory proteins Human genes 0.000 description 1
- 108091006104 gene-regulatory proteins Proteins 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 239000012535 impurity Substances 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002401 inhibitory effect Effects 0.000 description 1
- 230000031146 intracellular signal transduction Effects 0.000 description 1
- 238000001155 isoelectric focusing Methods 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000012317 liver biopsy Methods 0.000 description 1
- 238000012423 maintenance Methods 0.000 description 1
- 230000007257 malfunction Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000001840 matrix-assisted laser desorption--ionisation time-of-flight mass spectrometry Methods 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 238000002844 melting Methods 0.000 description 1
- 230000008018 melting Effects 0.000 description 1
- 102000006240 membrane receptors Human genes 0.000 description 1
- 108020004084 membrane receptors Proteins 0.000 description 1
- 230000008880 microtubule cytoskeleton organization Effects 0.000 description 1
- 238000013508 migration Methods 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 230000002297 mitogenic effect Effects 0.000 description 1
- 230000000394 mitotic effect Effects 0.000 description 1
- 239000003607 modifier Substances 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 239000004570 mortar (masonry) Substances 0.000 description 1
- 210000004498 neuroglial cell Anatomy 0.000 description 1
- 210000002569 neuron Anatomy 0.000 description 1
- 230000000508 neurotrophic effect Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- LGQLOGILCSXPEA-UHFFFAOYSA-L nickel sulfate Chemical compound [Ni+2].[O-]S([O-])(=O)=O LGQLOGILCSXPEA-UHFFFAOYSA-L 0.000 description 1
- 229910000363 nickel(II) sulfate Inorganic materials 0.000 description 1
- 229910052757 nitrogen Inorganic materials 0.000 description 1
- 239000000101 novel biomarker Substances 0.000 description 1
- 210000004940 nucleus Anatomy 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 210000000963 osteoblast Anatomy 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 230000036542 oxidative stress Effects 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 238000006116 polymerization reaction Methods 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000002250 progressing effect Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 235000004252 protein component Nutrition 0.000 description 1
- 238000000751 protein extraction Methods 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 230000007115 recruitment Effects 0.000 description 1
- 238000006479 redox reaction Methods 0.000 description 1
- 238000009877 rendering Methods 0.000 description 1
- 230000001718 repressive effect Effects 0.000 description 1
- 229930002330 retinoic acid Natural products 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 150000003839 salts Chemical class 0.000 description 1
- 238000007789 sealing Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 229910001961 silver nitrate Inorganic materials 0.000 description 1
- 239000011537 solubilization buffer Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000012421 spiking Methods 0.000 description 1
- 230000006641 stabilisation Effects 0.000 description 1
- 238000011105 stabilization Methods 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 239000012536 storage buffer Substances 0.000 description 1
- 210000003518 stress fiber Anatomy 0.000 description 1
- 230000004960 subcellular localization Effects 0.000 description 1
- 238000006467 substitution reaction Methods 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 230000017423 tissue regeneration Effects 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 238000000539 two dimensional gel electrophoresis Methods 0.000 description 1
- 238000010798 ubiquitination Methods 0.000 description 1
- 230000034512 ubiquitination Effects 0.000 description 1
- 238000002604 ultrasonography Methods 0.000 description 1
- 238000012285 ultrasound imaging Methods 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 230000006442 vascular tone Effects 0.000 description 1
- 239000005526 vasoconstrictor agent Substances 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
- 230000009385 viral infection Effects 0.000 description 1
- 230000003612 virological effect Effects 0.000 description 1
- 239000011534 wash buffer Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 210000001325 yolk sac Anatomy 0.000 description 1
Classifications
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
- G01N33/57488—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites involving compounds identifable in body fluids
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/531—Production of immunochemical test materials
- G01N33/532—Production of labelled immunochemicals
- G01N33/533—Production of labelled immunochemicals with fluorescent label
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/564—Immunoassay; Biospecific binding assay; Materials therefor for pre-existing immune complex or autoimmune disease, i.e. systemic lupus erythematosus, rheumatoid arthritis, multiple sclerosis, rheumatoid factors or complement components C1-C9
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57407—Specifically defined cancers
- G01N33/57438—Specifically defined cancers of liver, pancreas or kidney
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/53—Immunoassay; Biospecific binding assay; Materials therefor
- G01N33/574—Immunoassay; Biospecific binding assay; Materials therefor for cancer
- G01N33/57484—Immunoassay; Biospecific binding assay; Materials therefor for cancer involving compounds serving as markers for tumor, cancer, neoplasia, e.g. cellular determinants, receptors, heat shock/stress proteins, A-protein, oligosaccharides, metabolites
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/58—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances
- G01N33/582—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving labelled substances with fluorescent label
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6803—General methods of protein analysis not limited to specific proteins or families of proteins
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N33/00—Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
- G01N33/48—Biological material, e.g. blood, urine; Haemocytometers
- G01N33/50—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
- G01N33/68—Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
- G01N33/6863—Cytokines, i.e. immune system proteins modifying a biological response such as cell growth proliferation or differentiation, e.g. TNF, CNF, GM-CSF, lymphotoxin, MIF or their receptors
- G01N33/6869—Interleukin
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/56—Staging of a disease; Further complications associated with the disease
-
- G—PHYSICS
- G01—MEASURING; TESTING
- G01N—INVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
- G01N2800/00—Detection or diagnosis of diseases
- G01N2800/60—Complex ways of combining multiple protein biomarkers for diagnosis
Abstract
I: \aar\Interwoven\NRPortbl\DCC\AAR\ 5717839_ldocx-2l 09/2017 Abstract Cells within liver tumor mass comprise a unique set of proteins/tumor antigens when compared to the normal liver tissues epithelial cells juxtaposed to the tumor. The presence of tumor antigens couples the production of auto-antibodies against these tumor antigens. The present invention relates to the identification and elucidation of a protein set that can act as a novel marker set for liver cancer diagnosis and prognosis. Specifically, it relates to a kit that enables diagnostic and prognostic measurement of auto-antibodies in serum of liver cancer patients. The present invention provides a non-invasive, specific, sensitive and cost effective detection and quantification method by evaluating a set of validated liver cancer proteins/tumor antigens, which includes Bmi- 1, VCC 1, SUMO-4, RhoA, TXN, ET- 1, UBF2C, HDGF2, FGF21, LECT2, SODI, STMN4, Midkine, Il-17A or IL-26, to complement the conventional diagnostic methods.
Description
SPECIFIC BIOMARKER SET FOR NON-INVASIVE DIAGNOSIS OF LIVER CANCER
This application is a divisional of Australian Application No. 2014399919, the entire contents of which are incorporated herein by reference.
Copyright Notice/Permission A portion of the disclosure of this patent document contains material which is subject to copyright protection. The copyright owner has no objection to the facsimile reproduction by anyone of the patent document or the patent disclosure as it appears in the Patent and Trademark Office patent file or records, but otherwise reserves all copyright rights whatsoever. The following notice applies to the processes, experiments, and data as described below and in the drawings attached hereto: Copyright © 2014, Vision Global Holdings Limited, All Rights Reserved.
Cross-reference to Related Applications [0001] This application claims priority from the US non-provisional patent application serial number 14/321,867 filed July 2, 2014 and the US non-provisional patent application serial number 14/321,870 filed July 2, 2014, and the disclosure of which are incorporated herein by reference in their entirety.
Technical Field [0002] The present invention describes a detection and quantification method for a list of specific and novel Hepatocellular Carcinoma (HCC) tumor biomarkers, by measuring the corresponding auto-antibodies in liver cancer patients’ sera. The set of biomarkers comprises Bmil, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDGF2, FGF21, FECT2, SOD1, STMN4, Midkine, IF-17A and IF26. More specifically, this invention further describes a design of a high throughput and sensitive test kit readily available to take patients’ peripheral serum samples for detecting liver cancers early and in a non-invasive manner by measuring the auto-antibodies against at least one of the biomarkers selected from the biomarker set. The present invention further allows identification of signature biomarker patterns for staging, as well as the detection of recurrences during a monitoring period of post-chemotherapeutic treatment. The present invention would support automatic data analysis.
Background of Invention [0003] Hepatocellular carcinoma (HCC) is the second most prevalent cancer in China, which covers 5.7 % of the total population [1], Most HCC patients have rapid tumor progressing resulting in high mortality rate. In order to improve the overall survival, early diagnosis of the disease becomes essential. Currently, the most common way of detecting HCCs are blood tests that measure level of HCC tumor markers such as alpha fetoprotein (AFP). AFP is a plasma protein produced by yolk sac and liver during the development of fetus serving as a form of serum albumin. In normal condition, AFP level gradually decreases after birth and remain in low level in adults. Increased level of tumor markers indicates probability of liver cancers. However, the major problem of the AFP test is excessive false positive. It is because HCC is not the only cause for the AFP level elevation, but alcoholic hepatitis, chronic hepatitis or cirrhosis also associates with increase of AFP.
[0004] Despite AFP test is commonly suggested for diagnosis of liver cancers, its result is not conclusive. Suspected patients will need to go through ultrasound imaging, CT scans or contrast MRI scans for further confirmation. Liver biopsy will be taken to distinguish whether the tumor is benign or malignant. However, conventional detection of HCCs comes with several limitations: (a) About 20% of liver cancers does not produce elevated level of the commonly used HCC tumor markers [2], (b) Viral cirrhosis produces false positive results on the blood tests [3], (c)
Ultrasound is not able to detect small tumors [4], (d) CT scans require high radiation dose and are insensitive to tumors less than 1 cm [5], (e) MRI scans are expensive and the procedure is time consuming. Due to these limitations, there are needs to develop novel biomarkers screen with higher sensitivity and specificity for the purpose of early diagnosis of HCC and/or determining a prognosis of HCC to complement the conventional methods.
[0005] HCC tumor cells tend to produce a unique set of proteins when compared to the normal liver epithelial cells juxtaposed to the tumor. Evaluation of validated HCC tumor biomarkers has great potential to facilitate the diagnosis of HCC. However, not all biomarkers themselves can be found in serum or urine for convenient diagnosis. Alternatively, the auto-antibodies which are specifically against the biomarkers provide an opportunity to evaluate the expression of the biomarkers. It has been demonstrated in many cancers that the presence of tumor biomarkers couples the production of auto-antibodies against these tumor antigens [6-8], Detection on autoantibodies in patients’ sera would allow us to examine the presence of biomarkers more efficiently. Ideally, examination of auto-antibodies from peripheral blood would be a testament for detecting liver cancers early, and in a non-invasive manner. One common hurdle hindering clinical use of biomarkers is that they have not been validated after discovery. But once validated, such test would be cost effective and accurate. The design of the prototype also supports high-throughput screening. This may alleviate the cost required for conventional liver cancer diagnosis.
[0006] There follows a list of references that are occasionally cited in the specification. Each of the disclosures of these references is incorporated by reference herein in its entirety.
[1] Chen JG, Zhang SW. Liver cancer epidemic in China: past, present and future. Semin Cancer Biol. 2011; 21(1):59-69 [2] Okuda K, Peters RL. Human alpha-1 fetoprotein. Hepatocellular Carcinoma. 1976:353-67 [3] Lok AS, Lai CL. Alpha-fetoprotein monitoring in Chinese patients with chronic hepatitis E virus infection: role in the early detection of hepatocellular carcinoma. Hepatolog.y 1989;9:11 ΟΙ 15 [4] Colombo M, de Franchis R, Del Ninno E, Sangiovanni A, De Fazio C, Tommasini M, Donato MF, Piva A, Di Carlo V, Dioguardi N. Hepatocellular carcinoma in Italian patients with cirrhosis. N Engl J Med. 1991;325:675-80 [5] Sahani DV, Kalva SP. Imaging the Fiver. The Oncologist. 2004; 9 (4): 385-397 [6] Masutomi K, Kaneko S, Yasukawa M, Arai K, Murakami S, Kobayashi K. Identification of serum anti-human telomerase reverse transcriptase (hTERT) auto-antibodies during progression to hepatocellular carcinoma. Oncogene. 2002 Aug 29;21(38):5946-50.
[7] Karanikas V, Khalil S, Kerenidi T, Gourgoulianis KI, Germenis AE. Anti-survivin antibody responses in lung cancer. Cancer Fett. 2009 Sep 18;282(2):159-66.
[8] Wang YQ, Zhang HH, Fiu CF, Xia Q, Wu H, Yu XH, Kong W. Correlation between autoantibodies to survivin and MUC1 variable number tandem repeats in colorectal cancer. Asian Pac J Cancer Prev. 2012; 13(11):5557-62.
Summary of Invention [0007] In the present invention, a detection and quantification method measuring the autoantibodies against a list of specific tumor biomarker aiming for diagnosing and staging cancers is provided. Comparing to the normal liver epithelial cells, HCC tumor cells tend to produce a unique set of proteins. The evaluation of the unique protein set, biomarkers, will complement the conventional diagnostic methods and facilitate early detection of cancers.
[0008] By using a Two-Dimensional/Mass Spectrometry based method, a set of liver cancer biomarkers from paired patients’ biopsies (tumor biopsy versus juxtaposed normal tissue) is identified in the present invention comprising Bmil, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDGF2, FGF21, FECT2, SOD1, STMN4, Midkine, IF-17A and IF26.
[0009] Specificity and accuracy of this set of liver caner biomarkers are then validated and taken together for diagnosis of liver cancers. In the present invention, proteins of the listed biomarkers are expressed from cDNA clones, purified and coupled to fluorescent microsphere beads with different emission wavelengths. Auto-antibodies present in patients’ sera against the proteins immunologically bind to the protein-bead conjugate. The auto-antibodies subsequently interact with PE-conjugated secondary antibodies. The specific fluorescence signal of the microsphere beads serves as an identifier for the conjugated biomarkers. By measuring the fluorescent intensity given by the PE-conjugated secondary antibodies at the complex, it allows the detection and quantification of the auto-antibodies. Since the auto-antibodies are produced in the patients’ sera in proportion to the abundance of the biomarkers at HCC tumor cells, the higher fluorescent intensity resulted from higher concentration of auto-antibodies indicates the higher expression of the corresponding biomarkers. The lowest detection limit of each biomarker to the total serum auto-antibodies is about 0.15 ng/mL.
[0010] Comparing to sera from healthy subjects, the level of auto-antibodies against the target biomarkers is at a higher concentration in cancer patient. Moreover, comparing different sera from liver cancer patients at different stages, signature patterns for staging may be generated. Thus, the present invention allows the non-invasive evaluation of the targeted liver cancer biomarker. This enables the detection of HCC at early stages and the identification of signature biomarker patterns for staging, as well as the detection of recurrences during a monitoring period of post-chemotherapeutic treatment.
Brief Description of the Drawings [0011] Embodiments of the present invention are described in more detail hereinafter with reference to the drawings, in which: [0012] FIG. 1 shows the difference in protein expression pattern between tumor biopsy and juxtaposed normal tissue by two-dimensional/mass spectrometry leading to the identification of 15 specific biomarkers up-regulated in liver cancer; arrows indicate location of spots identified on a 2-D gel of the mass spectrometry.
[0013] FIG. 2 shows the set of 15 validated liver cancer biomarkers and their corresponding molecular weight targeted and measured in the present invention.
[0014] FIG. 3 shows the workflow of expressing the biomarkers from cDNA clones.
[0015] FIG. 4 shows the workflow of purification of the biomarkers expressed from E. coli.
[0016] FIG. 5 shows the workflow of measuring the auto-antibodies by BioPlex system.
[0017] FIG. 6 shows the conjugation of biomarker protein to BioPlex bead.
[0018] FIG. 7 shows illustration of the complex of biomarker-BioPlex bead conjugate immunoreacting with primary antibody and PE-conjugated secondary antibody.
[0019] FIG. 8 shows the gel electrophoresis of the DNA insert released from plasmid cut by restriction enzymes Hindlll and BamHl.
[0020] FIG. 9 shows the Coomassie Blue stained SDS-PAGE verifying the IPTG induction of (a) Bmil, (b) SOD1, (c) IL-17A, (d) TXN and (e) Midkine biomarkers.
[0021] FIG. 10 shows the elution profile of (a) Bmil, (b) SOD-1 and (e) IL-17A in AKTA.
[0022] FIG. 11 shows the Coomassie Blue stained SDS-PAGE verifying the purification of Elis-tagged (a) Bmil, (b) SOD-1 and (d) IL-17A biomarkers; Fraction A is bacteria without IPTG induction; Fraction B is bacteria with IPTG induction; Fraction C is bacterial lysate.
[0023] FIG. 12 shows the standard curve showing the fluorescence intensity against the concentration of anti-Bmil antibody.
[0024] FIG. 13 is a schematic diagram showing the design of the test: Patient serum containing auto-antibodies are mixed to a well containing 15 types of beads corresponding to the 15 biomarkers of the biomarker set, followed by the addition of PE-conjugated secondary antibody.
Definitions [0025] The term “biomarker” refers to the protein uniquely expressed or up-regulated in the tumor comparing to the normal epithelial cells.
[0026] The term “biomarker set” refers to the specific combination of the biomarkers identified from paired patients’ biopsies (tumor biopsy versus juxtaposed normal tissue) and is the target of the measurement in the present invention.
[0027] The term “auto-antibodies” refers to the anti-bodies produced by the patient body coupling to the expression of the tumor biomarker and it is present in the circulation and can be collected in the peripheral serum.
[0028] Bmil (Polycomb Ring Finger) is a protein component of a Polycomb Group (PcG) multiprotein PRC 1-like complex. It is responsible for maintaining the transcriptionally repressive state of many genes, including Hox genes, throughout development. The regulation is via monoubiquitination of histone H2A 'Lys-119', which modifies histone and remodels chromatin, rendering the expression.
[0029] VCC1 or CXCL17 (Chemokine (C-X-C Motif) Ligand 17) has an essential role in angiogenesis and possibly in the development of tumors. It is also suggested that it is a housekeeping chemokine regulating the recruitment of non-activated blood monocytes and immature dendritic cells into tissues. It may also play a role in the innate defense against infections. Malfunction of VCC1 is associated with duodenitis and cholera.
[0030] SUMO-4 (Small Ubiquitin-Like Modifier 4) belongs to the family of small ubiquitin-related modifiers and located in the cytoplasm. It covalently attaches to the target protein, IKBA, in order to control its subcellular localization, stability, or activity. This eventually leads to a negative regulation of NF-kappa-B-dependent transcription of the IL12B gene.
[0031] RhoA (Ras Homo log Family Member A) regulates the signaling pathway linking plasma membrane receptors to the assembly of focal adhesions and actin stress fibers. It also involves in microtubule-dependent signaling essential during cell cycle cytokinesis, and other signaling pathways involved in stabilization of microtubules and cell migrations and adhesion.
[0032] TXN (Thioredoxin) forms homodimer and is involved in redox reactions through the reversible oxidation of its active center dithiol to a disulfide and catalyzes dithiol-disulfide exchange reactions. It has been reported to be associated with breast mucinous carcinoma.
[0033] ET-1 (Endothelin 1) is a potent vasoconstrictor produced by vascular endothelial cells. It binds to endothelin receptors widely expressed in all tissues, including non-vascular structure like epithelial cells, glia, and neurons. Apart from the main role in maintenance of vascular tone, it is also suggested to have co-mitogenic activity and potentiate the effects of other growth factors.
[0034] UBE2C (Ubiquitin-Conjugating Enzyme E2C) belongs to the family of E2 ubiquitin-conjugating enzyme. This is one of the three enzymes involved in ubiquitination, which is an important cellular mechanism for targeting abnormal proteins for degradation. More specifically, UBE2C is required for the targeted degradation of mitotic cyclins and for cell cycle progression. Thus, it is believed that this protein may be also involved in cancer progression.
[0035] HDGF2 is called hepatoma-derived growth factor 2. This protein which is highly expressed in a variety of tumors has been reported to play a pivotal role in the development and progression of several tumors. Although the mechanism is yet to be identified, it is suggested that HDGF2 has mitogenic, angiogenic, neurotrophic and antiapoptotic activity.
[0036] FGF21 (Fibroblast Growth Factor 21) is a family member of the FGF family which is involved in vary biological processes including embryonic development, cell growth, morphogenesis, tissue repair, tumor growth and invasion. More specifically, FGF21 stimulates glucose update in differentiated adipocytes via the induction of glucose transporter SLC2A1/GLUT1 expression. It has been found that FGF21 is associated with fatty liver disease.
[0037] LECT2 (Leukocyte Cell Derived Chemotaxin 1) is a secretory protein acts as a chemotactic factor to neutrophils and stimulates the growth of chondrocytes and osteoblasts. This protein is associated with acute liver failure.
[0038] SOD1 (Superoxide Dismutase 1) is a Cu/Zn-containing antioxidant enzyme responsible for destroying free superoxide radicals into molecular oxygen and hydrogen peroxide in the cytosol, the nucleus, and the intermembrane space of the mitochondria. It is important for maintaining low levels of superoxide in the cytosol, thus protecting the cell from oxidative stress and subsequent cell death.
[0039] STMN4 (Stathmin-Like 4) is a small regulatory protein which is believed to have a role in relaying integrating diverse intracellular signaling pathways, which in turn, controls cell proliferation, differentiation and functions. It is also shown that this protein contributes to the control of microtubule dynamics by inhibiting the polymerization of microtubules and/or favoring their depolymerization.
[0040] Midkine or NEGF2 (Neurite Growth-Promoting Factor 2) is a secretory growth factor that binds heparin and responsive to retinoic acid. Midkine promotes cell growth, migration and angiogenesis, in particular during tumorigenesis. It has already been demonstrated to be associated with breast adenocarcinoma and soft tissue sarcoma.
[0041] IL-17A (Interleukin 17A) is a proinflammatory cytokine produced by the activated T cells. It regulates the activity of NF-kappaB and mitogen-activated protein kinases, stimulates the expression of IL6 and cyclooxygenase-2, and enhances the production of nitric oxide. Several chronic inflammation and sclerosis are usually associated with IL-17A elevation.
[0042] IL-26 (Interleukin 26) belongs to the IL-10 cytokine family and is produced by the activated T cells and targets epithelial cells for signal transduction. It binds strongly to glycosaminoglycans such as heparin, heparan sulphate, and dermatan sulfate on cellular surfaces which act similarly to coreceptors in order to enrich IL-26 on the surface of producer and target cells.
Detailed Description of Invention [0043] In the following description, the biomarker/biomarkers, the corresponding embodiments of the detection/validation/identification/quantification methods are set forth as preferred examples. It will be apparent to those skilled in the art that modifications, including additions and/or substitutions, may be made without departing from the scope and spirit of the invention. Specific details may be omitted so as not to obscure the invention; however, the disclosure is written to enable one skilled in the art to practice the teachings herein without undue experimentation.
[0044] In the present invention, the set of liver tumor biomarkers for detection and quantification of liver cancer is first identified by two-dimensional/mass spectrometry resolving the difference in the pattern of proteins expression between the paired patients’ biopsies (tumor biopsy versus juxtaposed normal tissue) (FIG. 1). The biomarkers are validated by immunohistochemical staining on paraffin-sectioned HCC blocks, and Western Blotting in HCC patients’ sera. This results in a finalized list of 15 biomarkers to be evaluated in the present invention for the liver cancer diagnosis purpose (FIG. 2).
[0045] Based on the amino acid sequences of the targeted biomarkers, commercially synthesized cDNA clones are employed for the expression of the biomarker set (FIG. 3). Proteins expressed from the cDNA clones are then subjected to a series of steps of purifications (FIG. 4). The purified biomarkers are subsequently conjugated via stable amide bonds with BioPlex beads (FIGS. 5, 6), a type of fluorescent microsphere beads and available in a panel which give unique fluorescent signals individually for identification at a multiplex set up. The biomarkers on the beads are recognized by the specific primary antibodies, which are subsequently bound by an anti-human secondary antibody conjugated with PE (FIG. 7). Thus the BioPlex machine simultaneously measures two signals from the complex. The fluorescence given by the BioPlex beads serves as an identifier, while the signal from the PE indicates the presence of the biomarker in the complex. This also helps differentiating the biomarker-bead conjugates bound by the anti-body cascade from those with no immuno-reactivity with antibodies.
[0046] To prove the significance of the biomarkers in the present invention, the cDNA clones are confirmed by restriction enzyme cut (FIG. 8). The transformed bacteria is induced by IPTG to express the biomarker proteins. The protein expression verified by SDS-PAGE and Coomassie Blue staining reveals the protein bands (FIG. 9 a-e). The His-tagged Bmil, SOD1 and IL-17A proteins are purified by AKTA (FIG. 10 a-c) and then verified by SDS-PAGE and Coomassie Blue staining (FIG. 11 a-c).
[0047] Sensitivity of the test is measured by spiking in a serial dilution of the antibodies. The lowest concentration of the antibody added that can give signal suggests the sensitivity of that particular biomarker. Meanwhile a standard curve is constructed showing the fluorescence intensity of the PE against the serial dilutions of the antibodies (FIG. 12). The standard curve will be used for estimating the concentration of the biomarker specific auto-antibodies in the patient sera by comparing the PE intensity.
[0048] In the present invention, a multiplex of 15 different Bioplex beads individually giving unique fluorescence are conjugated with the biomarker set and preloaded in the wells of a plate (FIG. 13). To a well, patient serum containing auto-antibodies is loaded and allowed to interact with the biomarker conjugates. The PE-conjugated secondary antibodies are then added and bind to the auto-antibodies. In the machine, the excess secondary antibodies are washed away, the complex comprising the biomarker-bead conjugate and cascade of antibodies are measured individually. The unique fluorescence signal of the Bioplex bead identifies the biomarkers, while the PE signal from the same complex indicates the presence of the auto-antibodies as the primary antibody (FIG. 7). Taken together, the measurement will suggest the presence of auto-antibodies and the relative concentration in the presents’ sera.
[0049] In a standard randomized trial design, the mean of the relative level of auto-antibodies between the healthy group and patients diagnosed with liver cancer is compared. Student T test is used to analyze the variation significance. The significant difference indicates that the biomarker is specific for liver cancer. After the verification trials, ranges of the concentration of biomarker specific auto-antibodies will be obtained for the liver cancer positive and negative patients and serve as reference point for the future diagnosis. Meanwhile, expression pattern of the autoantibodies is also compared between liver cancer patients of different stages. The signature patterns of the biomarker expressions will indicate the HCC staging.
[0050] Taken together, the measurement of the relative auto-antibodies level and the expression pattern of the biomarkers, the present invention represents a different avenue to complement conventional liver cancer diagnosis. The present invention further enables non-invasive detection of auto-antibodies against the validated targets in patients’ sera of the present invention, identifying the extent and the characteristics of the disease. Apart from early detection for stage I liver cancers, the present invention also enables the generation of signature patterns for staging, and the detection of recurrences during a monitoring period of post-mastectomy or postchemotherapeutic treatment.
Examples [0051] The following examples are provided by way of describing specific embodiments of this invention without intending to limit the scope of this invention in any way.
[0052] Example la [0053] Protein extraction from patients’ biopsies [0054] 500 mg of the paired patients’ biopsies (tumor biopsy versus juxtaposed normal tissue) are collected and washed with PBS. The tissues are frozen by submerging into liquid nitrogen and immediately homogenized with pestle and mortar. To the homogenized samples, lysis solution (8M Urea, 4% CHAPS, 2% IPG Buffer, 0.2mg/ml PMSF) is added, then vortex for at least 5 min until the tissues are completely dispersed. The lysates are then clarified by centrifugation at 14,000 rpm for 10 minutes at 4 °C. The supernatants are further cleaned up by 2D Clean Up kit (Amersham) to remove the salt and impurities. The pellets are resuspended with minimum volume of Rehydration Solution (No DTT & IPG Buffer added). The protein concentrations are then measured by Bio-Rad protein assay and aliquots of 200 g/per tube are stored at -70 °C.
[0055] Example lb [0056] Resolving proteins by two-dimensional electrophoresis [0057] To 1 ml rehydration stock solution, 2.8 mg DTT, 5 μΐ pharmalyte or IPG Buffer, and 2 μΐ bromophenol blue are added. 50 - 100 pg of protein sample is added to the 13 cm Immobiline Dry Strip (IPG strip) containing 250 μΐ of rehydration solution. After removing the protective cover, the IPG strip is positioned in the strip holder with the gel side facing down, and overlaid with Cover Fluid to prevent dehydration during electrophoresis. The strip is then placed on to Ettan IPGphor (Amersham) for isoelectric focusing (first dimensional electrophoresis).
[0058] After the first-dimensional electrophoresis, the IPG strip is equilibrated with equilibrate solution (6 M Urea 2 % SDS, 50 mM Tris HC1 pH 6.8, 30 % Glycerol, 0.002 % Bromophenol blue, 100 mg DTT per 10 ml buffer and 250 mg IAA per 10 ml buffer), and then washed with lx SDS running Buffer for 4 - 5 times. The IPG strip is placed on top of the second-dimension gel and overlaid with sealing solution (0.5 % Low Melting agarose, 0.002 % Bromophenol Blue in 1 x SDS running Buffer). The second-dimensional electrophoresis is then carried out at 30 mA for first 15 min followed by 60 mA for 3 - 4 h.
[0059] Upon the completion of the second dimensional electrophoresis, the gel is removed from the cassette, fixed and stained with silver nitrate. 15 spots representing 15 up-regulated proteins are identified (FIG. 1). To identify the proteins (FIG. 2), the silver stained gel slices are destained and trypsinized to release the protein from the gel for MALDI-TOF analysis.
[0060] Example 2a (SEQ ID NO.l) [0061] Amino acid sequence of Bmil
[0062] MHRTTRIKITELNPHLMCVLCGGYFIDATTIIECLHSFCKTCIVRYLETSKYCPICD VQVHKTRPLLNIRSDKTLQDIVYKLVPGLFKNEMKRRRDFYAAHPSADAANGSNEDRG EVADEDKRIITDDEIISLSIEFFDQNRLDRKVNKDKEKSKEEVNDKRYLRCPAAMTVMHL RKFLRSKMDIPNTFQIDVMYEEEPLKDYYTLMDIAYIYTWRRNGPLPLKYRVRPTCKRM
KISHQRDGLTNAGELESDSGSDKANSPAGGIPSTSSCLPSPSTPVQSPHPQFPHISSTMNGT
SNSPSGNHQSSFANRPRKSSVNGSSATSSG
[0063] Example 2b (SEQ ID NO.2) [0064] Amino acid sequence of VCC1
[0065] MKVLISSLLLLLPLMLMSMVSSSLNPGVARGHRDRGQASRRWLQEGGQECECK DWFLRAPRRKFMTVSGLPKKQCPCDHFKGNVKKTRHQRHHRKPNKHSRACQQFLKQC QLRSFALPL
[0066] Example 2c (SEQ ID NO.3) [0067] Amino acid sequence of SUMO-4
[0068] MANEKPTEEVKTENNNHINLKVAGQDGSVVQFKIKRQTPLSKLMKAYCEPRGLS VKQIRFRFGGQPISGTDKPAQLEMEDEDTIDVFQQPTGGVY
[0069] Example 2d (SEQ ID NO.4)
[0070] Amino acid sequence of RhoA
[0071 ] MAAIRKKLVIVGDGACGKTCLLIVFSKDQFPEVYVPTVFENYVADIEVDGKQVE LALWDTAGQEDYDRLRPLSYPDTDVILMCFSIDSPDSLENIPEKWTPEVKHFCPNVPIILV GNKKDLRNDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSAKTKDGVREVFE M ATRAALQ ARRGKKKS GCL VL
[0072] Example 2e (SEQ ID NO.5)
[0073] Amino acid sequence of TXN
[0074] MVKQIESKTAFQEALDAAGDKLVVVDFSATWCGPCKMIKPFFHSLSEKYSNVIF FEVDVDDCQDVASECEVKCMPTFQFFKKGQKVGEFSGANKEKFEATINEFV
[0075] Example 2f (SEQ ID NO.6) [0076] Amino acid sequence of ET-1
[0077] MDYLLMIFSLLFVACQGAPETAVLGAELSAVGENGGEKPTPSPPWRLRRSKRCS CSSLMDKECVYFCHLDIIWVNTPEHVVPYGLGSPRSKRALENLLPTKATDRENRCQCAS QKDKKCWNFCQAGKELRAEDIMEKDWNNHKKGKDCSKLGKKCIYQQLVRGRKIRRSS EEHLRQTRSETMRN S VKS SFHDPKLKGNPSRERYVTHNRAHW
[0078] Example 2g (SEQ ID NO.7)
[0079] Amino acid sequence of UBE2C
[0080] MASQNRDPAATSVAAARKGAEPSGGAARGPVGKRLQQELMTLMMSGDKGISA FPESDNLFKWVGTIHGAAGTVYEDLRYKLSLEFPSGYPYNAPTVKFLTPCYHPNVDTQG NICLDILKEKWSALYDVRTILLSIQSLLGEPNIDSPLNTHAAELWKNPTAFKKYLQETYSK QVTSQEP
[0081] Example 2h (SEQ ID NO.8) [0082] Amino acid sequence of HDGF2
[0083] MARPRPREYKAGDLVFAKMKGYPHWPARIDELPEGAVKPPANKYPIFFFGTHET AFLGPKDLFPYKEYKDKFGKSNKRKGFNEGLWEIENNPGVKFTGYQAIQQQSSSETEGE GGNTADASSEEEGDRVEEDGKGKRKNEKAGSKRKKSYTSKKSSKQSRKSPGDEDDKDC KEEENKSSSEGGDAGNDTRNTTSDLQKTSEGT
[0084] Example 2i (SEQ ID NO.9) [0085] Amino acid sequence of FGF21
[0086] MDSDETGFEHSGLWVSVLAGLLLGACQAHPIPDSSPLLQFGGQVRQRYLYTDDA QQTEAHLEIREDGTVGGAADQSPESLLQLKALKPGVIQILGVKTSRFLCQRPDGALYGSL HFDPEACSFRELLLEDGYNVYQSEAHGLPLHLPGNKSPHRDPAPRGPARFLPLPGLPPAL PEPPGILAPQPPDVGSSDPLSMVGPSQGRSPSYAS
[0087] Example 2j (SEQ ID NO.IO) [0088] Amino acid sequence of LECT2
[0089] MFSTKALLLAGLISTALAGPWANICAGKSSNEIRTCDRHGCGQYSAQRSQRPHQ G VD VLC S AGST V Y APFT GMIV GQEKP Y QNKN AINN G VRISGRGF C VKMF YIKPIKYKGP IKKGEKLGTLLPLQKVYPGIQSHVHIENCDSSDPTAYL
[0090] Example 2k (SEQ ID NO.ll) [0091] Amino acid sequence of SOD1
[0092] MATKAVCVLKGDGPVQGIINFEQKESNGPVKVWGSIKGLTEGLHGFHVHEFGDN TAGCTSAGPHFNPLSRKHGGPKDEERHVGDLGNVTADKDGVADVSIEDVISLSGDHCII GRTLVVHEKADDLGKGGNEESTKTGNAGSRLACGVIGIAQ
[0093] Example 21 (SEQ ID NO.12) [0094] Amino acid sequence of STMN4
[0095] MTLAAYKEKMKELPLVSLFCSCFLADPLNKSSYKYEADTVDLNWCVISDMEVIE LNKCTSGQSFEVILKPPSFDGVPEFNASLPRRRDPSLEEIQKKLEAAEERRKYQEAELLKH
LAEKREHEREVIQKAIEENNNFIKMAKEKLAQKMESNKENREAHLAAMLERLQEKDKH
AEEVRKNKELKEEASR
[0096] Example 2m (SEQ ID NO.13) [0097] Amino acid sequence of Midkine
[0098] MQHRGFLLLTLLALLALTSAVAKKKDKVKKGGPGSECAEWAWGPCTPSSKDCG V GFREGTCGAQT QRIRCRVPCNWKKEF GADCKYKFEN WGACDGGT GTKVRQGTLKKA RYNAQCQETIRVTKPCTPKTKAKAKAKKGKGKD
[0099] Example 2n (SEQ ID NO. 14)
[00100] Amino acid sequence of IL-17A
[00101] MTPGKTSLVSLLLLLSLEAIVKAGITIPRNPGCPNSEDKNFPRTVMVNLNIH NRNTNTNPKRSSDYYNRSTSPWNLHRNEDPERYPSVIWEAKCRHLGCINADGNVDYHM N S VPIQQEILVLRREPPHCPNSFRLEKILV S V GCTC VTPIVHHVA
[00102] Example 2o (SEQ ID NO.15) [00103] Amino acid sequence of IL-26
[00104] ML VNFILRC GLLL VTL SL AIAKHKQ S SFTKS C YPRGTL S Q AVD AL YIKAA WLKATIPEDRIKNIRLLKKKTKKQFMKNCQFQEQLLSFFMEDVFGQLQLQGCKKIRFVE DFHSLRQKLSHCISCASSAREMKSITRMKRIFYRIGNKGIYKAISELDILLSWIKKLLESSQ
[00105] Example 3a [00106] Expression of biomarker set [00107] His tagged plasmids containing cDNA inserts encoding the biomarker set is transformed into DH5 competent cells (301, FIG. 3). Single colony is picked and allowed to grow in bacterial culture (302). The number of plasmid is expanded and extracted from the bacteria by miniprep. The plasmid is further transformed into BL21DE3 or BL21DE3pLysS competent cells. Transformed bacteria are selected and grew in 2 X 100 ml LB medium. When the bacterial culture reaches the optical density of 0.06, 200 μΜ of IPTG is added to 100 ml bacterial culture (303). Another 100 ml of bacterial culture without IPTG is used as negative control. The bacterial cultures are incubated at 30 °C with shaking. 500 μΐ of the bacterial cultures are saved and stored at -20 °C 3 h after the incubation and in the next morning after incubating overnight.
[00108] Bacterial cultures with and without IPTG induction are mixed together in a 500 ml centrifuge bottle. Bacterial cells are collected by centrifugation at 9000 rpm for 20 min at 4 °C (304). 500 μΐ of supernatant is saved as another negative control and the remaining supernatant is discarded. The bacterial cultures and negative controls collected in different points are run on a SDS-PAGE to resolve the protein (305). The gel is then stained with Coomassie Blue overnight. After destaining the gel, the protein induction can be confirmed by checking the size and comparing with the negative controls.
[00109] Example 3b [00110] Protein purification for biomarker set [00111] The bacterial cell pellets are resuspended in 10 ml solubilization buffer by vortex at room temperature. Keeping the resuspended cells in 50 ml centrifuge tube on ice, the cells are completely lysed by sonication at amplitude 70 % 10 rounds of 30 s with interval of 30 s (401, FIG. 4). The lysed cells are centrifuged at 10,000 rpm for 1 h at 4 °C (402). Supernatants are transferred into dialysis tubing and submerged in 1 L unfiltered starting buffer for 4 - 6 h at 4 °C with constant stirring (403). Dialysis is continued with another 1 L starting buffer overnight. The supernatant is further filtered with 0.22 pm filter disc and syringe. To the AKTA machine equipped with 0.1M Nickel sulfate charged HiTrap chelating column (404), filtered samples are loaded (405). A program is set at the AKTA machine that the eluent is collected in fractions automatically (406). Proteins purified from different fractions are checked by SDS-PAGE analysis (407).
[00112] Example 4a [00113] Protein coupling with Bio-Plex beads [00114] The purified proteins of the biomarker set are coupled with Bio-Plex beads (BioRad) (501) according to the manufacturer’s manual. In brief, uncoupled bead is vortexed for 30 s and then sonicated for 15 s. 1,250,000 beads are collected in a reaction tube by centrifugation of 100 μΐ bead at maximum speed for 4 min. After washing with 100 μΐ bead wash buffer by centrifugation, the beads are resuspended in 80 μΐ bead activation buffer. To the beads 10 μΐ 50 mg/ml freshly prepared S-NHS and 10 μΐ 50 mg/ml freshly prepared ED AC are added, followed by 20 min incubation in dark at room temperature (FIG. 6). The beads are then washed with 150 μΐ PBS twice.
[00115] To the washed beads, 10 pg proteins are added and the total volume is topped up with PBS to 500 μΐ, and allowed to incubate for 2 h with shaking in dark. Supernatant is removed after centrifugation at maximum speed for 4 min. 250 μΐ blocking buffer is added to the beads and shook in dark for 30 min, followed by centrifugation at maximum speed for 4 min and removal of supernatant. The beads are briefly washed and then resuspended in the storage buffer for storage at 4 °C. The numbers of the beads are counted with a hemocytometer.
[00116] Example 4b [00117] Validation of protein-bead coupling [00118] To a HTS 96 well plate, 50 μΐ of conjugated Bio-Plex beads (100 beads / μΐ) is added to react with primary followed by secondary antibodies (502). A serial dilution of the commercially available primary anti-bodies against the biomarker set is prepared as 8,000, 4,000, 1,000, 250, 62.5, 15.625, 3.906, 0.977, 0.244 and 0.061 ng/ml. 50 μΐ of each dilution is added to each well. Two negative controls are performed by excluding the primary antibodies, and both primary and secondary antibodies in the wells. The plate is then sealed with a foil and kept on a shaker for 30 min at 350 rpm, avoiding exposure to light.
[00119] After incubation, the beads are washed three times with 150 μΐ PBS. 50 μΐ of PE- conjugated secondary antibody (8,000 ng/ml) is added into each well except negative controls. The plate is sealed again and incubated in dark for 30 min with shaking. Excess antibodies are then washed away by PBS. The Bio-Plex machine is calibrated with the calibration kit and validation kit. After the HTS plate is loaded to the machine, signals from both the Bio-Plex beads and the PE conjugated at the secondary antibodies (503) are measured (schematic diagram is shown in FIG. 7). A calibration curve is generated by Logistic-5PL.
[00120] Example 4c: [00121] Collection of serum samples and measurement of auto-antibodies by BioPlex system [00122] Whole-blood samples are clotted by standing at 37 °C for 1 h. Sera containing the auto-antibodies is collected at the supernatant after centrifugation at lOOOg room temperature for 10 min. The serum samples are diluted with PBS when necessary. To a HTS plate preloaded with
Bioplex beads conjugated with biomarker set, the serum samples are loaded and incubated for 30 min with shaking (FIG. 13). Similar to the steps described in Example 4b, to the PBS washed beads, 50 μΐ of PE-conjugated secondary antibody (8000 ng/ml) is added, followed by shaking for another 30 min. After three rounds of washing, the plate is loaded to the Bio-Plex machine and the fluorescence signal is measured (504). The concentration of the auto-antibodies can then be calculated from the standard curves.
[00123] The foregoing description of the present invention has been provided for the purposes of illustration and description. It is not intended to be exhaustive or to limit the invention to the precise forms disclosed. Many modifications and variations will be apparent to the practitioner skilled in the art.
[00124] The embodiments are chosen and described in order to best explain the principles of the invention and its practical application, thereby enabling others skilled in the art to understand the invention for various embodiments and with various modifications that are suited to the particular use contemplated. It is intended that the scope of the invention be defined by the following claims and their equivalence.
Industrial Applicability [00125] The presently claimed method and kit comprising the 15 identified biomarkers can not only be used to identify and quantify the presence of auto-antibodies in the patents’ sera in order to detect and/or stage the liver cancer, but are also useful in drug development targeting these markers for specifically treating the liver cancer.
Throughout this specification, unless the context requires otherwise, the word "comprise" or variations such as "comprises" or "comprising", will be understood to imply the inclusion of a stated element or integer or method step or group of elements or integers or method steps but not the exclusion of any element or integer or method step or group of elements or integers or method steps.
The reference in this specification to any prior publication (or information derived from it), or to any matter which is known, is not, and should not be taken as an acknowledgement or admission or any form of suggestion that the prior publication (or information derived from it) or known matter forms part of the common general knowledge in the field of endeavour to which this specification relates.
Claims (16)
- CLAIMS:1. A method for measuring the presence of hepatocellular carcinoma (HCC) biomarkers in a subject suspected of having HCC, the method comprising: (a) obtaining a serum sample from the subject suspected of having HCC and measuring the serum for the presence of primary auto-antibodies (primary biomarker auto antibodies) against a set of biomarkers, wherein the set of biomarkers comprises Bmi-1, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDGF2, FGF21, LECT2, SOD1, STMN4, Midkine, IL-17A and IL-26; (b) detecting the presence of the HCC biomarkers in the subject suspected of having HCC, the method comprising the steps of: (i) mixing the serum sample with a set of biomarker conjugates to allow the primary biomarker auto antibodies, if present in the serum sample, to bind to the set of biomarker conjugates and washing away any unbound antibodies; wherein the set of biomarker conjugates comprises each of the biomarkers in the set of biomarkers conjugated via an amide bond to a unique fluorescent microsphere bead, wherein each unique fluorescent microsphere bead associated with a specific particular biomarker in the set of biomarkers has a different emission wavelength for each biomarker, wherein the biomarker conjugates are capable of being bound by a specific primary biomarker auto antibody present in the subject's serum sample, (ii) adding to the mixture formed in step (i) anti-human secondary antibodies conjugated with phycoerythrin (PE), which are capable of binding primary biomarker auto antibodies; and allowing the anti-human secondary antibodies conjugated with PE to bind to specific primary antibodies bound to biomarker conjugates to form a fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade, and washing away unbound antibodies; and (iii) measuring the mixture formed in step (ii) for the presence fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade to determine whether the subjects' serum contained primary biomarker auto antibodies.
- 2. The method of Claim 1 wherein the unique fluorescent signal from the microsphere beads serves to identify which biomarker in the set of biomarkers is present and wherein the signal from the PE indicates the presence of the biomarker conjugate.
- 3. The method of Claim 2, wherein fluorescent intensity given by the PE-conjugated secondary antibodies in the fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade is measured to allow the detection and quantification of the primary biomarker auto antibodies.
- 4. The method of Claim 1, wherein the set of biomarkers consists of BMi-1, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDG2, FGF21, LECT2, SOD1, STMN4, Midkine, II-17A and IL-26.
- 5. A method for measuring the presence fo hepatocellular carcinoma (HCC) biomarkers in a plurality of subjects having HCC at different stages, the method comprising: (a) obtaining a serum sample from a plurality of subjects having HCC at different stages and measuring the serum for the presence of primary auto-antibodies (primary biomarker auto antibodies) against a set of biomarkers, wherein the set of biomarkers comprises Bmi-1, VCC1, SUMO-4, RhoA, TXN, ET-1, UBF2C, HDGF2, FGF21, LECT2, SOD1, STMN4, Midkine, IL-17A and IL-26; (b) detecting the presence of the HCC biomarkers in the plurality of subjects having HCC at different stages, the method comprising the steps of: (i) mixing the serum sample with a set of biomarker conjugates to allow the primary biomarker auto antibodies, if present in the serum sample, to bind to the set of biomarker conjugates and washing away any unbound antibodies; wherein the set of biomarker conjugates comprises each of the biomarker sin the set of biomarkers conjugated via an amide bond to a unique fluorescent microsphere bead, wherein each unique fluorescent microsphere bead associated with a specific particular biomarker in the set of biomarkers has a different emission wavelength for each biomarker, wherein the biomarker conjugates are capable of being bound by a specific primary biomarker auto antibody present in the subject's serum sample, (ii) adding to the mixture formed in step (i) anti-human secondary antibodies conjugated with phycoerythrin (PE), which are capable of binding primary biomarker auto antibodies; and allowing the anti-human secondary antibodies conjugated with PE to bind to specific primary antibodies bound to biomarker conjugates to form fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade, and washing away unbound antibodies; and (iii) measuring the mixture formed in step (ii) for the presence fluorescent bead-biomarker-auto antibody-PE conjugated antibody cascade to determine whether the plurality of subjects' serum contained primary biomarker auto antibodies.
- 6. The method of Claim 1, wherein the set of proteins comprises at least one of the amino acid sequences of SEQ ID NOs:l to 15.
- 7. The method of Claim 1, wherein the plurality of tumor biomarkers comprises at least one of Bmi-1, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDGF2, GFG21, LECT2, SOD1, STMN4, Midkine, I1-17A and IL-26.
- 8. The method of Claim 1, wherein the tumor cells comprises cells from hepatocellular carcinoma (HCC) tumor.
- 9. The method of Claim 1, wherein each of the fluorescent microsphere beads has a unique fluorescent emission wavelength specific for each of the proteins corresponding to the presence of a specific tu8mor biomarker while the PE signal generated by the PE-conjugated secondary antibody bound to the protein-bead conjugate of each of the proteins for the specific tumor biomarker is an indicator of the presence of the auto-antibody so produced in patients' sera and the fluorescent intensity of the PE signal is proportional to the abundance of the specific tumor biomarker.
- 10. The method of Claim 1, wherein each of the tumor biomarkers present in the autoantibodies is as low as about 0.15 ng/mL.
- 11. A kit for diagnosing and staging liver cancers by detecting and quantifying autoantibodies from patients against a plurality of tumor biomarkers, the kit comprising a set of proteins expressed from cDNA clones, purified and coupled to fluorescent microsphere beads with different emission wavelengths to form a protein-bead conjugate for immunologically binding the auto-antibodies and subsequently being targeted by PE-conjugated secondary antibody such that fluorescent signal and intensity are measured to determine level of autoantibodies in the patients compared with normal subjects.
- 12. The kit of Claim 11, wherein the set of proteins comprises at least one of the amino acid sequences of SEQ ID NOs:l to 15.
- 13. The kit of Claim 11, wherein the set of tumor biomarkers comprises at least one of Bmi-1, VCC1, SUMO-4, RhoA, TXN, ET-1, UBE2C, HDGF2, GFG21, LECT2, SOD1, STMN4, Midkine, I1-17A and IL-26.
- 14. The kit of Claim 11, wherein each of the cDNA clones comprises a His tagged plasmid containing a corresponding cDNA insert of the protein to be expressed in a competent cell for being coupled to the fluorescent microsphere beads with different emission wavelengths in order to form the protein-bead conjugate for immunologically binding the auto-antibodies and subsequently being targeted by PE-conjugated secondary antibody.
- 15. The kit of Claim 11, wherein a multiplex of different fluorescent microsphere beads individually giving unique fluorescence are conjugated with the set of proteins so expressed and purified to form the protein-bead conjugate, and said protein-bead conjugate is preloaded in wells of a container, and to each well, patients' serum containing auto-antibodies is loaded and allowed to interact with the protein-bead conjugate, followed by adding the PE-conjugated secondary antibodies to bind to the auto-antibodies, then any excess secondary antibodies are washed away and a complex comprising the protein-bead conjugate and cascade of the antibodies are measured individually, wherein the unique fluorescence signal of the protein-based conjugate identifies the presence of a specific tumor biomarker, while the PE signal from the secondary antibody of the complex indicates the presence of the auto-antibodies and the relative concentration of said tumor biomarker in the patients' sera.
- 16. The kit of Claim 11, wherein each of the tumor biomarkers present in the autoantibodies is as low as about 0.15 ng/mL.
Priority Applications (1)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| AU2017232129A AU2017232129B2 (en) | 2014-07-02 | 2017-09-21 | Specific biomarker set for non-invasive diagnosis of liver cancer |
Applications Claiming Priority (7)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| US14/321,867 | 2014-07-02 | ||
| US14/321,870 US9885718B2 (en) | 2014-07-02 | 2014-07-02 | Specific biomarker set for non-invasive diagnosis of liver cancer |
| US14/321,867 US9506925B2 (en) | 2014-07-02 | 2014-07-02 | Specific biomarker set for non-invasive diagnosis of liver cancer |
| US14/321,870 | 2014-07-02 | ||
| AU2014399919A AU2014399919B2 (en) | 2014-07-02 | 2014-07-31 | Specific biomarker set for non-invasive diagnosis of liver cancer |
| PCT/US2014/049038 WO2016003479A1 (en) | 2014-07-02 | 2014-07-31 | Specific biomarker set for non-invasive diagnosis of liver cancer |
| AU2017232129A AU2017232129B2 (en) | 2014-07-02 | 2017-09-21 | Specific biomarker set for non-invasive diagnosis of liver cancer |
Related Parent Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| AU2014399919A Division AU2014399919B2 (en) | 2014-07-02 | 2014-07-31 | Specific biomarker set for non-invasive diagnosis of liver cancer |
Publications (2)
| Publication Number | Publication Date |
|---|---|
| AU2017232129A1 true AU2017232129A1 (en) | 2017-10-12 |
| AU2017232129B2 AU2017232129B2 (en) | 2018-10-25 |
Family
ID=55019816
Family Applications (2)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| AU2014399919A Active AU2014399919B2 (en) | 2014-07-02 | 2014-07-31 | Specific biomarker set for non-invasive diagnosis of liver cancer |
| AU2017232129A Ceased AU2017232129B2 (en) | 2014-07-02 | 2017-09-21 | Specific biomarker set for non-invasive diagnosis of liver cancer |
Family Applications Before (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| AU2014399919A Active AU2014399919B2 (en) | 2014-07-02 | 2014-07-31 | Specific biomarker set for non-invasive diagnosis of liver cancer |
Country Status (13)
| Country | Link |
|---|---|
| EP (1) | EP3164711A4 (en) |
| JP (2) | JP2017520763A (en) |
| KR (1) | KR102086788B1 (en) |
| CN (2) | CN105319362B (en) |
| AU (2) | AU2014399919B2 (en) |
| CA (1) | CA2939912C (en) |
| HK (2) | HK1248803A1 (en) |
| MY (2) | MY179845A (en) |
| NZ (1) | NZ722492A (en) |
| SG (1) | SG11201606106SA (en) |
| TW (1) | TWI700493B (en) |
| UY (1) | UY36200A (en) |
| WO (1) | WO2016003479A1 (en) |
Families Citing this family (8)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| CN106383231B (en) * | 2016-09-02 | 2020-03-17 | 四川大学 | Marker combination for diagnosing liver cancer and application thereof |
| KR102175265B1 (en) | 2019-03-13 | 2020-11-06 | 충남대학교산학협력단 | Biomarker composition comprising TXNDC7 for diagnosis or predicting prognosis of hepatocellular carcinoma |
| CN110646615B (en) * | 2019-08-27 | 2021-07-13 | 南方医科大学 | Biological marker and treatment target of hepatic fibrosis and application thereof |
| WO2023282916A1 (en) | 2021-07-09 | 2023-01-12 | Guardant Health, Inc. | Methods of detecting genomic rearrangements using cell free nucleic acids |
| CN113502328A (en) * | 2021-05-27 | 2021-10-15 | 深圳市人民医院 | Application of reagent for detecting expression level of marker in sample in preparation of kit for detecting or diagnosing breast cancer |
| CN113777295B (en) * | 2021-09-15 | 2024-03-19 | 江南大学 | High-sensitivity quantum dot probe for detecting tumor marker PD-L1, preparation method and application |
| CN113956344A (en) * | 2021-10-14 | 2022-01-21 | 江南大学 | Novel FGF analogue for treating liver cancer and application thereof |
| CN114113611B (en) * | 2021-12-13 | 2023-07-14 | 郑州大学 | Biomarker for liver cancer diagnosis and detection kit |
Family Cites Families (15)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US6449562B1 (en) * | 1996-10-10 | 2002-09-10 | Luminex Corporation | Multiplexed analysis of clinical specimens apparatus and method |
| US6893844B1 (en) * | 1998-09-22 | 2005-05-17 | Long Yu | DNA encoding a new human hepatoma derived growth factor and producing method thereof |
| US7387881B2 (en) * | 2001-09-19 | 2008-06-17 | The Regents Of The University Of Michigan | Detection and treatment of cancers of the liver |
| US20040241653A1 (en) * | 2001-12-31 | 2004-12-02 | Elena Feinstein | Methods for identifying marker genes for cancer |
| GB0228900D0 (en) * | 2002-12-11 | 2003-01-15 | Ml Lab Plc | Cancer Immunotherapy |
| JP3960614B2 (en) * | 2003-08-31 | 2007-08-15 | 株式会社イムノディア | Anti-peptide antibody measurement method and vaccine candidate selection method for peptide vaccine |
| GB0406215D0 (en) * | 2004-03-19 | 2004-04-21 | Procure Therapeutics Ltd | Prostate stem cell |
| CA2567987A1 (en) * | 2004-06-18 | 2005-12-29 | Gabriele Pestlin | Use of protein pdx1 as a marker for breast cancer |
| JP5211315B2 (en) * | 2006-07-25 | 2013-06-12 | 国立大学法人愛媛大学 | Tumor marker, tumor diagnostic kit, and method for measuring tumor marker |
| CN101796415B (en) * | 2007-08-10 | 2014-03-12 | 学校法人兵库医科大学 | Novel liver cancer marker |
| US8512963B2 (en) * | 2009-11-25 | 2013-08-20 | The Johns Hopkins University | Detection and quantitation of full-length thioredoxin (TRX) and truncated thioredoxin (TRX 80) in complex samples |
| US9523680B2 (en) * | 2010-06-30 | 2016-12-20 | Ambergen, Inc. | Global Proteomic screening of random bead arrays using mass spectrometry imaging |
| JP5493130B2 (en) * | 2010-08-25 | 2014-05-14 | 国立大学法人山口大学 | Autoantibody detection method |
| WO2012115885A1 (en) * | 2011-02-22 | 2012-08-30 | Caris Life Sciences Luxembourg Holdings, S.A.R.L. | Circulating biomarkers |
| WO2013049704A2 (en) * | 2011-09-28 | 2013-04-04 | Armune Biosciences, Inc. | Method and system of particle-phage epitope complex |
-
2014
- 2014-07-31 CA CA2939912A patent/CA2939912C/en active Active
- 2014-07-31 MY MYPI2017001446A patent/MY179845A/en unknown
- 2014-07-31 NZ NZ72249214A patent/NZ722492A/en unknown
- 2014-07-31 EP EP14896556.9A patent/EP3164711A4/en not_active Withdrawn
- 2014-07-31 AU AU2014399919A patent/AU2014399919B2/en active Active
- 2014-07-31 SG SG11201606106SA patent/SG11201606106SA/en unknown
- 2014-07-31 MY MYPI2016002278A patent/MY195045A/en unknown
- 2014-07-31 JP JP2016571689A patent/JP2017520763A/en active Pending
- 2014-07-31 KR KR1020167032783A patent/KR102086788B1/en active IP Right Grant
- 2014-07-31 WO PCT/US2014/049038 patent/WO2016003479A1/en active Application Filing
- 2014-07-31 TW TW103126171A patent/TWI700493B/en active
-
2015
- 2015-07-01 UY UY0001036200A patent/UY36200A/en unknown
- 2015-07-01 CN CN201510379493.9A patent/CN105319362B/en active Active
- 2015-07-01 CN CN201710545890.8A patent/CN107478842B/en active Active
-
2016
- 2016-06-13 HK HK18107745.3A patent/HK1248803A1/en unknown
- 2016-06-13 HK HK16106781.2A patent/HK1224370A1/en unknown
-
2017
- 2017-09-21 AU AU2017232129A patent/AU2017232129B2/en not_active Ceased
-
2020
- 2020-06-22 JP JP2020106731A patent/JP2020160082A/en not_active Withdrawn
Also Published As
| Publication number | Publication date |
|---|---|
| CA2939912C (en) | 2019-04-16 |
| TW201602579A (en) | 2016-01-16 |
| CN107478842B (en) | 2020-10-16 |
| WO2016003479A1 (en) | 2016-01-07 |
| UY36200A (en) | 2016-01-29 |
| CN105319362B (en) | 2018-07-13 |
| MY195045A (en) | 2023-01-04 |
| NZ722492A (en) | 2019-09-27 |
| CN105319362A (en) | 2016-02-10 |
| KR102086788B1 (en) | 2020-03-09 |
| TWI700493B (en) | 2020-08-01 |
| SG11201606106SA (en) | 2016-08-30 |
| CA2939912A1 (en) | 2016-01-07 |
| JP2020160082A (en) | 2020-10-01 |
| EP3164711A1 (en) | 2017-05-10 |
| HK1224370A1 (en) | 2017-08-18 |
| EP3164711A4 (en) | 2018-05-23 |
| AU2014399919B2 (en) | 2019-10-24 |
| KR20170021234A (en) | 2017-02-27 |
| AU2017232129B2 (en) | 2018-10-25 |
| HK1248803A1 (en) | 2018-10-19 |
| JP2017520763A (en) | 2017-07-27 |
| CN107478842A (en) | 2017-12-15 |
| MY179845A (en) | 2020-11-18 |
| AU2014399919A1 (en) | 2016-08-11 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| AU2017232129B2 (en) | Specific biomarker set for non-invasive diagnosis of liver cancer | |
| JP6075881B2 (en) | Breast cancer biomarkers | |
| CN109975549B (en) | Application of tumor-derived IgG in diagnosis or prognosis of pancreatic cancer | |
| US20200386761A1 (en) | Specific biomarker set for non-invasive diagnosis of liver cancer | |
| JP5265140B2 (en) | Ovarian cancer detection method and detection kit | |
| JP6361943B2 (en) | Pancreatic cancer diagnostic kit comprising an antibody that specifically binds to complement factor B protein and an antibody that specifically binds to sugar chain antigen 19-9 protein | |
| US10620209B2 (en) | Specific biomarker set for non-invasive diagnosis of liver cancer | |
| JP6639408B2 (en) | Method for detecting arteriosclerosis and cancer using deoxyhypusine synthase gene as an index | |
| EP3129785B1 (en) | Diagnosis of cancer by detecting dimeric il-18 | |
| US9885718B2 (en) | Specific biomarker set for non-invasive diagnosis of liver cancer | |
| RU2438135C1 (en) | Immunocytochemical estimation method for proliferative lymphocyte state by expression behaviour of c-terminal b23/nucleophosmin protein fragment in indirect immunofluorescence test | |
| KR101649591B1 (en) | Novel biomarker for diagnosing acute leukemia | |
| JP7432578B2 (en) | Cancer markers and their uses | |
| JP2021175978A (en) | Marker for pancreatic cancer and intraductal papillary mucinous tumors | |
| JP5358808B2 (en) | Tumor marker, tumor diagnostic kit, method for measuring tumor marker and tumor diagnostic method | |
| CN111323590B (en) | Application of anti-TIF 1 gamma-IgA and anti-TIF 1 gamma-IgG serving as combined diagnostic markers in lung cancer diagnosis | |
| US10066020B2 (en) | Methods of detecting cancer | |
| Fontana et al. | Combination immune checkpoint blockade in advanced untreated gastroesophageal adenocarcinoma: Seeking biomarkers for durable benefit | |
| Rauch et al. | Al logenic antibody mediated identification of head and neck cancer antigens | |
| JP2012225822A (en) | Diagnostic, treatment method of colon cancer using apc-binding protein eb1 |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| FGA | Letters patent sealed or granted (standard patent) | ||
| MK14 | Patent ceased section 143(a) (annual fees not paid) or expired |