AUSTRALIA Patents Act 1990 COMPLETE SPECIFICATION Standard Patent Applicant: ID Biomedical Corporation Invention Title: HAEMOPHILUS INFLUENZAE ANTIGENS AND CORRESPONDING DNA FRAGMENTS The following statement is a full description of this invention, including the best method for performing it known to us: HAEMOPHILUS INFLUENZAE ANTIGENS AND CORRESPONDING DNA FRAGMENTS 5 FIELD OF THE INVENTION The present invention is related to polypeptides of Haemophilus influenzae and corresponding DNA fragments, which may be useful to prevent, diagnose and/or treat Haemophilus influenzae infections in individuals such as humans. 10 BACKGROUND OF THE INVENTION Haemophilus influenzae is a Gram-negative rod that is found in nature only as a human pathogen. Isolates of H. influenzae can 15 be subdivided int- encapsulated and non-encapsulated forms. Encapsulated strains express one of six structurally and antigenically distinct capsular polysaccharides that are designated, types "a" to "f". Non-encapsulated strains are defined by their failure to agglutinate with antisera against 20 the recognised H. influenzae capsular polysaccharides and are referred to as nontypeable. Nontypeable H. influenzae strains commonly colonise the upper respiratory tract, including the nasopharynx and the posterior 25 oropharynx. A number of surveys of healthy individuals indicate colonisation rates between 40% to 80% among both children and adults (Spinola S.M., Peacock J., Denny F.W., Smith D.L. and Cannon J.G. (1986) Epidemiology of colonisation by nontypeable Haemophilus influenzae in children : a longitudinal study. J. 30 Infect. Dis. 154 :100-109; Trottier S., Stenberg K. and Svanborg-Eden C. (1989) Turn over of nontypeable Haemophilus influenzae in the nasopharynges of healthy children. J. Clin. Microbiol. 27 :2175-2179) . Colonisation with a particular strain may persist for weeks or months with most individuals by 35 remaining asymptomatic throughout this period. The pathogenesis of disease due to nontypeable H. influenzae involves contiguous spread within the respiratory tract. Spread to adjacent areas is usually a consequence of abnormalities in either non-specific or specific host defences. So, nontypeable H. influenzae causes a variety of respiratory tract infections in children and adults including otitis, sinusitis, bronchitis and pneumonia. These infections may become chronic or recurrent in patients with 5 bronchitis or otitis. In fact, in infants and children, nontypeable H. influenzae is a frequent cause of acute otitis media and is commonly implicated in recurrent otitis media (Harabuchi Y., Fadden H., Yamanaka N., Duffy L., Wolf J., Krystofik D. and Tonawanda/Williamsville Pediatrics. (1994) 10 Nasopharyngeal colonisation with nontypeable Haemophilus influenzae and recurrent otitis media. J. Infect. Dis. 170 :862 866). In infants, nontypeable H. influenzae is responsible -for between 27% and 37% of the first episode of otitis media by the age of 1 year (Smith-Vaughan H.C., Sriprakash K.S., Mathews J.D. 15 and Kemp D.J. (1997) Nonencapsulated Haemophilus influenzae in aboriginal infants with otitis media : prolonged carriage of P2 porin variants and evidence for horizontal P2 gene transfer. Infect. Immun. 65 :1468-1474; Teele D.W., Klein J.O., Rosner B. and Greater Boston Otitis Media study Group. (1989) Epidemiology 20 of otitis media during the first seven years of life in children in Greater Boston : a prospective, cohort study. J. Infect. Dis. 160 :83-94) . Meningitis is sometimes caused by nontypeable H. influenzae and accounts for 1-3% of all cases. But, nontypeable H. influenzae is particularly prevalent in hosts with an 25 underlying disease which affects the innate mucosal immune system, such as chronic obstructive pulmonary disease (COPD) and cystic fibrosis (Murphy T.F. and Sethi S. (1992) Bacterial infection in chronic obstructive pulmonary disease. Am. Rev. Respir. Dis. 146 :1067-1083; St. Geme J.W. III. (1993) 30 Nontypeable Haemophilus influenzae disease epidemiology, pathogenesis and prospects for prevention. Infect. Agents Dis. 2 :1-16) . Nontypeable H. influenzae strains are found predominantly during exacerbations when the sputum becomes mucopurulent. Acute infective exacerbations of chronic 35 bronchitis play an important role in the morbidity and mortality of patients with chronic pulmonary diseases. 2 The etiologies of community-acquired pneumonia appear to have changed in the last decade. While Streptococcus pneumoniae remains the predominant pathogen, the proportion of cases involving other organisms has increased. H. influenzae is now 5 often reported as being the second most common cause of. pneumonia. Ten percent of H. influenzae pneumoniae cases develop into bacteremia. In developing countries pneumonia caused by nontypeable H. influenzae is apparently an important cause of morbidity and mortality in children. 10 Although several H. influenzae type b polysaccharide conjugated vaccines have been developed, these vaccines are ineffective against disease caused by other H. influenzae strains (Scheifele D.W., Jadavji T.P., Law B.J., Gold R., Macdonald N.E., Lebel 15 M.H., Mills E.L., Dery P., Halperin S.A., Morris R.F., Marchessault V. and Duclos P.J. (1996) Recent trends in pediatric Haemophilus influenzae type b infections in Canada. Can. Med. Assoc. J. 154 :1041-1047; Schulte E.E., Birkhead G.S., Kondracki S.F. and Morse D.L. (1994) Patterns of Haemophilus 20 influenzae type b invasive disease in New York State, 1987-991 : the role of vaccination requirements for .day-care attendance. Pediatrics 94 :1014-1016). The identification of conserved cross-protective antigens is critical for the development of a universal vaccine against H. influenzae infection and disease. 25 Outer membrane proteins such as P1, P2, P4, P6, PCP, OMP26 and D-15 have been identified or- are currently explored as potential vaccine antigens (Foxwell A.R., Kyd J.M. and Cripps A.W. (1998) Nontypeable Haemophilus influenzae : Pathogenesis and Prevention. Microbiol. Mol. Biol. Rev. 62 :294-308). Protein D 30 15 is the only conserved immunogen that has been described, in the scientific literature, as being capable of conferring protection against multiple serotypes and nontypeable strains. Therefore there remains an unmet need for H. influenzae 35 polypeptides that may be useful to prevent, diagnose and/or treat Haemophilus intluenzae infections in individuals such as humans. 3 It is to be understood that, if any prior art publication is referred to herein, such reference does not constitute an admission that the publication forms a part of the common general knowledge in the art, in australia or any other country. 5 SUMMARY OF THE INVENTION A first aspect provides a pharmaceutical composition comprising a pharmaceutically acceptable carrier or diluent and an isolated polypeptide selected from: (a) an isolated polypeptide comprising an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO:10; 10 (b) an isolated polypeptide comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 10; (c) an isolated polypeptide comprising an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO:10; (d) an isolated polypeptide comprising the amino acid sequence set forth in SEQ ID 15 NO:10; (e) an isolated polypeptide comprising an analog of the amino acid sequence of SEQ ID NO: 10, wherein the analog has fewer than 20 substitutions or deletions of amino acid residues of SEQ ID NO:10; (f) an isolated polypeptide that comprises an immunogenic fragment consisting of at least 20 15 contiguous amino acids from the amino acid sequence set forth in SEQ ID NO: 10, wherein the immunogenic fragment can elicit an immune response to Haemophilus influenzae; (g) the isolated polypeptide of (a), (b), (c), (d), or (e), wherein the N-terminal Met residue is deleted; and 25 (h) the isolated polypeptide of (a), (b), (c), (d), or (e), wherein the secretory amino acid sequence is deleted, wherein the isolated polypeptide can elicit an immune response to Haemophilus influenzae. A second aspect provides a pharmaceutical composition comprising (1) a pharmaceutically 30 acceptable carrier or diluent and (2) a chimeric polypeptide comprising: (a) a polypeptide analog of a polypeptide that consists of the amino acid sequence of SEQ ID NO:10, wherein the analog has fewer than 20 substitutions or deletions of amino acid residues of SEQ ID NO: 10; or 4 2761452_1 (GHMatters) P48946 AU-1 4-Aug-11 (b) an immunogenic fragment consisting of at least 15 contiguous amino acids from the amino acid sequence set forth in SEQ ID NO:10, wherein the chimeric polypeptide maintains an immunogenicity of a polypeptide consisting of the amino acid sequence set forth in SEQ ID NO:10. 5 A third aspect provides a method for prophylactic or therapeutic treatment of a Haemophilus influenzae infection in an individual, said method comprising administering the pharmaceutical composition of the first or third aspect to the individual. 10 A fourth aspect provides a method for inducing an immune response to Haemophilus influenzae comprising administering to an individual the pharmaceutical composition of the first or third aspect. A fifth aspect provides use of: 15 (a) an isolated polypeptide comprising an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO:10; (b) an isolated polypeptide comprising an amino acid sequence at least 90% identical to the amino acid sequence set forth in SEQ ID NO: 10; (c) an isolated polypeptide comprising an amino acid sequence at least 95% identical to 20 the amino acid sequence set forth in SEQ ID NO: 10; (d) an isolated polypeptide comprising the amino acid sequence set forth in SEQ ID NO:10; (e) an isolated polypeptide comprising an analog of the amino acid sequence of SEQ ID NO:10, wherein the analog has fewer than 20 substitutions or deletions of amino acid 25 residues of SEQ ID NO: 10; (f) an isolated polypeptide that comprises an immunogenic fragment consisting of at least 15 contiguous amino acids from the amino acid sequence set forth in SEQ ID NO: 10, wherein the immunogenic fragment can elicit an immune response to Haemophilus influenzae; 30 (g) the isolated polypeptide of (a), (b), (c), (d), or (e), wherein the N-terminal Met residue is deleted; or (h) the isolated polypeptide of (a), (b), (c), (d), or (e), wherein the secretory amino acid sequence is deleted, 4a 2781452_1 (GHMatters) P48OWAU I 4-Aug-11 in the manufacture of a medicament for prophylactic or therapeutic treatment of Haemophilus influenzae bacterial infection in an individual susceptible to Haemophilus influenzae infection, wherein the isolated polypeptide can elicit an immune response to Haemophilus influenzae. 5 A sixth aspect provides use of: (a) an isolated polypeptide comprising an amino acid sequence at least 85% identical to the amino acid sequence set forth in SEQ ID NO: 10; (b) an isolated polypeptide comprising an amino acid sequence at least 90% identical to 10 the amino acid sequence set forth in SEQ ID NO:10; (c) an isolated polypeptide comprising an amino acid sequence at least 95% identical to the amino acid sequence set forth in SEQ ID NO: 10; (d) an isolated polypeptide comprising the amino acid sequence set forth in SEQ ID NO: 10; 15 (e) an isolated polypeptide comprising an analog of the amino acid sequence of SEQ ID NO: 10, wherein the analog has fewer than 20 substitutions or deletions of amino acid residues of SEQ ID NO: 10; (f) an isolated polypeptide that comprises an immunogenic fragment consisting of at least 15 contiguous amino acids from the amino acid sequence set forth in SEQ ID NO: 10, 20 wherein the immunogenic fragment can elicit an immune response to Haemophilus influenzae; (g) the isolated polypeptide of (a), (b), (c), (d), or (e), wherein the N-terminal Met residue is deleted; or (h) the isolated polypeptide of (a), (b), (c), (d), or (e), wherein the secretory amino acid 25 sequence is deleted, in the manufacture of a medicament for inducing an immune response to Haemophilus influenzae, wherein the isolated polypeptide can elicit an immune response to Haemophilus influenzae. 30 Disclosed herein is an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 4b 2701452_ 1 (GHMattm) P48960 AU 1 4-Aug-11 Also disclosed are polypeptides which comprise an amino acid sequence selected from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. Also disclosed are polypeptides encoded by polynucleotides of the disclosure, 5 pharmaceutical compositions, vectors comprising polynucleotides of the disclosure operably linked to an expression control region, as well as host cells transfected with said vectors and processes of producing polypeptides comprising culturing said host cells under conditions suitable for expression. 10 BRIEF DESCRIPTION OF THE DRAWINGS Figure 1 represents the DNA sequence of BVH-NTHI I gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 1. Figure 2 represents the deduced amino acid sequence of the full-length BVH-NTHII from 15 nontypeable H. influenzae strain 12085; SEQ ID NO: 2. Figure 3 represents the DNA sequence of BVH-NTHI2 gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 3. 20 Figure 4 represents the deduced amino acid sequence of the full-length BVH-NTHI2 from nontypeable H. influenzae strain 12085; SEQ ID NO: 4. 4c 2761452_1 (GHMaItr) P48966 AU.1 4-Aug-11 Figure 5 represents the DNA sequence of BVH-NTHI3 gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 5. Figure 6 represents the deduced amino acid sequence of the full 5 length BVH-NTHI3 from nontypeable H. influenzae strain 120.85; SEQ ID NO: 6. Figure 7 represents the DNA sequence of BVH-NTHI4 gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 7. 10 Figure 8 represents the deduced amino acid sequence of the full length BVH-NTHI4 from nontypeable H. influenzae strain 12085; SEQ ID NO: 8. 15 Figure 9 represents the DNA sequence of BVH-NTHI5 gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 9. Figure 10 represents the deduced amino acid sequence of the full-length BVH-NTHI5 from nontypeable H. influenzae strain 20 12085; SEQ ID NO: 10. Figure 11 represents the DNA sequence of BVH-NTHI6 gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 11. 25 Figure 12 represents the deduced amino acid sequence of the full-length BVH-NTHI6 from nontypeable H. influenzae strain 12085; SEQ ID NO: 12. Figure 13 represents the DNA sequence of BVH-NTHI7 gene from 30 nontypeable H. influenzae strain 12085; SEQ ID NO: 13. Figure 14 represents the deduced amino acid sequence of the full-length BVH-NTHI7 from nontypeable H. influenzae strain 12085; SEQ ID NO: 14. 35 Figure 15 represents the DNA sequence of BVH-NTHI8 gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 15. 5 Figure 16 represents the deduced amino acid sequence of the full-length BVH-NTHI8 from nontypeable H. influenzae strain 12085; SEQ ID NO: 16. 5 Figure 17 represents the DNA sequence of BVH-NTHI9 gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 17. Figure 18 represents the deduced amino acid sequence of the full-length BVH-NTHI9 from nontypeable H. influenzae strain 10 12085; SEQ ID NO: 18. Figure 19 represents the DNA sequence of BVH-NTHI10 gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 19. 15 Figure 20 represents the deduced amino acid sequence of the full-length BVH-NTHI10 from nontypeable H. influenzae strain 12085; SEQ ID NO: 20. Figure 21 represents the DNA sequence of BVH-NTHIll gene from 20 nontypeable H. influenzae strain 12085; SEQ ID NO: 21 Figure 22 represents the deduced amino acid sequence of the full-length BVH-NTHI11 from nontypeable H. influenzae strain 12085; SEQ ID NO: 22. 25 Figure 23 represents the DNA sequence of BVH-NTHI12 gene from nontypeable H. influenzae strain 12085; SEQ ID NO: 23 Figure 24 represents the deduced amino acid sequence of the 30 full-length BVH-NTHI12 from nontypeable H. influenzae strain 12085; SEQ ID NO: 24. Figure 25 depicts the comparison of the predicted amino acid sequences of the BVH-NTHI1 open reading frames from 12085, 35 10095, A18, and A108 _H. influenzae by using the program Clustal W from MacVector sequence analysis software (version 6.5). Underneath the alignment, there is a consensus line where (*) 6 characters represent identical amino acid residues and (.) represent conserved amino acid residues. DETAILED DESCRIPTION OF THE INVENTION 5 Disclosed herein are purified and isolated polynucleotides, which encode H. influenzae polypeptides which may be used to prevent, treat, and/or diagnose H. influenzae infection. Also disclosed are twelve separate preferred polynucleotides, each individually and separately defined by one SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 and 23. Also disclosed are twelve separate polypeptides, each individually and separately defined by one 10 of SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. Those skilled in the art will appreciate that the disclosure includes polynucleotides that encode analogs such as mutants, variants, homologues and derivatives of such polypeptides, as described herein in the present patent application. The disclosure also includes RNA molecules corresponding to the DNA molecules of the disclosure. In addition to the DNA and RNA molecules, the disclosure 15 includes the corresponding polypeptides and monospecific antibodies that specifically bind to such polypeptides. Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 20 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 25 Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 85% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 30 Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 90% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 7 2547150_1 (GManM) 27-Jan-11 Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 5 Also disclosed is an isolated polynucleotide encoding a polypeptide comprising a sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. Also disclosed are polynucleotides encoding an epitope bearing portion of a polypeptide 10 having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. Also disclosed are polynucleotides encoding an epitope bearing portion of a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. 15 Also disclosed are epitope bearing portions of a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. Also disclosed are epitope bearing portions of a polypeptide having a sequence chosen from 20 SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 70% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. 25 Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 80% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. 30 Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 85% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10,12, 14, 16, 18, 20, 22 and 24. 8 2547150_1 (GHMattera) 27-Jan-11 Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 90% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. 5 Also disclosed is an isolated polynucleotide encoding a polypeptide having at least 95% identity to a second polypeptide comprising a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. Also disclosed is an isolated polynucleotide encoding a polypeptide comprising a sequence 10 chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. Also disclosed are polynucleotides encoding an epitope bearing portion of a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. 15 In a further embodiment, the present disclosure also relates to polynucleotides encoding a polypeptide capable of generating antibodies having binding specificity for a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 20 In a further embodiment, the present disclosure also relates to polynucleotides encoding a polypeptide capable of generating antibodies having binding specificity for a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. The percentage of homology is defined as the sum of the percentage of identity plus the 25 percentage of similarity or conservation of amino acid type. One can use a program such as the CLUSTAL program to compare amino acid sequences. This program compares amino acid sequences and finds the optimal alignment by inserting spaces in either sequence as appropriate. It is possible to calculate amino acid identity or 30 similarity (identity plus conservation of amino acid type) for an optimal alignment. A program like BLASTx will align the longest stretch of similar sequences and assign a value to the fit. It is thus possible to obtain a comparison where several regions of similarity are 9 2547150_1 (GHMatters) 27-Ja I1I found, each having a different score. Both types of identity analysis are contemplated in the present disclosure. In a further embodiment, the polypeptides in accordance with the present disclosure are 5 antigenic. 10 2547150_1 (GHMatters) 27-Jan-1I In a further embodiment, the polypeptides in accordance with the present invention are immunogenic. 5 In a further embodiment, the polypeptides in accordance with the present invention can elicit an immune response in an individual. In a further embodiment, the present invention also relates to 10 polypeptides which are able to raise antibodies having binding specificity to the polypeptides of the present invention as defined above. In a further embodiment, the present invention also relates to 15 polypeptides capable of generating antibodies having binding specificity for a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 20 In a further embodiment, the present invention also relates to polypeptides capable of generating antibodies having binding specificity for a polypeptide having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. 25 An antibody that "has binding specificity" is an antibody that recognises and binds the selected polypeptide but which does not substantially recognise and bind other molecules in a sample, e.g., a biological sample. Specific binding can be measured using an ELISA assay in which the selected polypeptide is used 30 as an antigen. In accordance with the present invention, "protection" in the biological studies is defined by a significant increase in the survival curve, rate or period. Statistical analysis using the 35 Log rank test to compare survival curves, and Fisher exact test to compare survival rates and numbers of days to death, respectively, might be useful to calculate P values and determine whether the difference between the two groups is 11 statistically significant. P values of 0.05 are regarded as not significant. Also disclosed are antigenic/immunogenic fragments of the polypeptides of the disclosure, or of analogs thereof. 5 The fragments of the present disclosure should include one or more such epitopic regions or be sufficiently similar to such regions to retain their antigenic/immunogenic properties. Thus, for fragments according to the present disclosure the degree of identity is perhaps irrelevant, since they may be 100% identical to a particular part of a polypeptide or analog 10 thereof as described herein. Also disclosed are fragments having at least 10 contiguous amino acid residues from the polypeptide sequences of the present disclosure. In one embodiment, at least 15 contiguous amino acid residues. In one embodiment, at least 20 contiguous amino acid residues. 15 The key issue, once again, is that the fragment retains the antigenic/immunogenic properties. The skilled person will appreciate that fragments, analogs or derivatives of the polypeptides of the disclosure will also find use in the context of the present disclosure, i.e. as antigenic/immunogenic material. Thus, for instance polypeptides which include one or more 20 additions, deletions, substitutions or the like are encompassed by the present disclosure. As used herein, "fragments", "analogs" or "derivatives" of the polypeptides of the disclosure include those polypeptides in which one or more of the amino acid residues are substituted with a conserved amino acid residue (preferably conserved) and which may be natural or 25 unnatural. In one embodiment, derivatives and analogs of polypeptides of the disclosure will have about 70% identity with those sequences illustrated in the figures or fragments thereof. That is, 70% of the residues are the same. In a further embodiment, polypeptides will have greater than 80% identity. In a further embodiment, polypeptides will have greater than 90% identity. In a further embodiment, polypeptides will have greater than 95% identity. In a 30 further embodiment, polypeptides will have greater than 99% identity. In a further embodiment, analogs of polypeptides of the disclosure will have fewer than about 20 amino acid residue substitutions, modifications or deletions and more preferably less than 10. 12 25471501 (GHMaft..)27-Jan.11 In one embodiment, derivatives and analogs of polypeptides of the disclosure will have about 70% homology with those sequences illustrated in the figures or fragments thereof. In a further embodiment, derivatives and analogs of polypeptides will have greater than 80% homology. In a further embodiment, derivatives and analogs of polypeptides will have 5 greater than 90% homology. In a further embodiment, derivatives and analogs of polypeptides will have greater than 95% homology. In a further embodiment, derivatives and analogs of polypeptides will have greater than 99% homology. In a further embodiment, derivatives and analogs of derivatives and analogs of polypeptides of the disclosure will have fewer than about 20 amino acid residue substitutions, modifications or deletions and more 10 preferably less than 10. Also disclosed are polypeptides having at least 70% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 15 Also disclosed are polypeptides having at least 80% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 20 Also disclosed are polypeptides having at least 85% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16,18, 20, 22 and 24 or fragments or analogs thereof. Also disclosed are polypeptides having at least 90% identity to a second polypeptide having 25 an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. Also disclosed are polypeptides having at least 95% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 30 24 or fragments or analogs thereof. Also disclosed are polypeptides comprising a sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof 13 25471501 (GHMattes) 27-Jan-I1 Also disclosed are polypeptides characterized by a sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof. 5 Also disclosed are polypeptides having at least 70% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. Also disclosed are polypeptides having at least 80% identity to a second polypeptide having 10 an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. Also disclosed are polypeptides having at least 85% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 15 24. Also disclosed are polypeptides having at least 90% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. 20 Also disclosed are polypeptides having at least 95% identity to a second polypeptide having an amino acid sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. 25 Also disclosed are polypeptides comprising a sequence chosen from: SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24. Also disclosed are polypeptides characterized by a sequence chosen from: SEQ ID NOs: 2, 4, 6,8,10, 12,14, 16, 18,20,22 and 24. 30 These substitutions are those having a minimal influence on the secondary structure and hydropathic nature of the polypeptide. Preferred substitutions are those known in the art as conserved, i.e. the substituted residues share physical or chemical properties such as 14 2547150_1 (GHMattem) 27-Jan11l hydrophobicity, size, charge or functional groups. These include substitutions such as those described by Dayhoff, M. in Atlas of Protein Sequence and Structure 5, 1978 and by Argos, P. in EMBO J. 8, 779-785, 1989. For example, amino acids, either natural or unnatural, belonging to one of the following groups represent conservative changes: 5 ala, pro, gly, gln, asn, ser, thr, val; cys, ser, tyr, thr; val, ile, leu, met, ala, phe; lys, arg, orn, his; and phe, tyr, trp, his. 10 The preferred substitutions also include substitutions of D-enantiomers for the corresponding L-amino acids. 15 25471501 (GHMattSr) 27-Jen-11 Preferably, a fragment, analog or derivative of a polypeptide of the invention will comprise at least one antigenic region i.e. at least one epitope. 5 In an alternative approach, the analogs could be fusion polypeptides, incorporating moieties which render purification easier, for example by effectively tagging the desired polypeptide. It may be necessary to remove the "tag" or it may be 10 the case that the fusion polypeptide itself retains sufficient antigenicity to be useful. Thus, what is important for analogs, derivatives and fragments is that they possess at least a degree of the 15 antigenicity/immunogenic of the protein or polypeptide from which they are derived. Also included are polypeptides which have fused thereto other compounds which alter the biological or pharmacological 20 properties of the polypeptide, i.e., polyethylene glycol (PEG) to increase half-life, leader or secretory amino acid sequences for ease of purification, prepro- and pro- sequences and (poly) saccharides. 25 Furthermore, in those situations where amino acid regions are found to be polymorphic, it may be desirable to vary one or more particular amino acids to more effectively mimic the different epitopes of the different H. influenzae strains. 30 Moreover, the polypeptides of the present invention can be modified by terminal -NH 2 acylation (e.g. by acetylation or thioglycolic acid amidation, terminal carboxy amidation, e.g. with ammonia or methylamine) to provide stability, increased hydrophobicity for linking or binding to a support or other 35 molecule. 16 Also contemplated are hetero and homo polypeptide multimers of the polypeptide fragments and analogues. These polymeric forms include, for example, one or more polypeptides that have been cross-linked with cross-linkers such as avidin/biotin, 5 glutaraldehyde or dimethylsuperimidate. Such polymeric forms also include polypeptides containing two or more tandem or inverted contiguous sequences, produced from multicistronic mRNAs generated by recombinant DNA technology. 10 In a further embodiment, the present invention also relates to chimeric polypeptides which comprise one or more polypeptides or fragments or analogs or derivatives thereof as defined in the figures of the present application. 15 In a further embodiment, the present invention also relates to chimeric polypeptides comprising two or more polypeptides having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24 or fragments or analogs thereof; provided that the polypeptides are linked as to formed a chimeric polypeptide. 20 In a further embodiment, the present invention also relates to chimeric polypeptides comprising two or more polypeptides having a sequence chosen from SEQ ID NOs: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22 and 24; provided that the polypeptides are linked as 25 to formed a chimeric polypeptide. In order to achieve the formation of antigenic polymers (i.e. synthetic . multimers) , polypeptides may be utilized having bishaloacetyl groups, nitroarylhalides, or the like, where the 30 reagents being specific for thio groups. Therefore, the link between two mercapto groups of the different peptides may be a single bound or may be composed of a linking group of at least two, typically at least four and not more than 16, but usually not more than about 14 carbon atoms. 35 In a particular embodiment, polypeptide fragments or analogs of the invention do not contain a methionine (Met) starting 17 residue. Preferably, polypeptides will not incorporate a leader or secretory sequence (signal sequence). The signal portion of a polypeptide of the disclosure may be determined according to established molecular biological techniques. In general, the polypeptide of interest may be isolated from Haemophilus culture and subsequently sequenced to determine 5 the initial residue of the mature protein and therefore the sequence of the mature polypeptide. The following Table A describes the signal sequences of the polypeptides of the disclosure as described in the Figures. Polypeptide SEQ ID NO Secretion signal BVH-NTHII 2 MPVIRQWFYDSLTGEQTKMKKFAGLITASFVA BVH-NTHI2 4 MKKLLKISAVSAALLSAPMMA BVH-NTHI3 6 MLMKLKATLTLAAATLVLAA BVH-NTHI4 8 MMNRRHFIQIGATSILALSANRFAMA BVH-NTHI5 10 MKKIILTLSLGLLTAWSAQI BVH-NTHI6 12 no secretion signal BVH-NTHI7 14 MKKFLIAILLLILILAGAA BVH-NTHI8 16 MKMKKFILKSFLLATLGCVAFASMAQA BVH-NTHI9 18 MTMFKKISVLFFTLILAGCSSWS BVH-NTHI10 20 MSILLQGERFKKRLMPILLSMALAGCSNLLG BVH-NTHIl 1 22 MIRKLMKTPPFFTALFASAIFTLSVSQGVLG BVH-NTHI2 24 MKLKQLFAITAIA 10 Also disclosed are (i) a composition of matter containing a polypeptide of the disclosure, together with a carrier, diluent or adjuvant; (ii) a pharmaceutical composition comprising a polypeptide of the disclosure and a carrier, diluent or adjuvant; (iii) a vaccine comprising a polypeptide of the disclosure and a carrier, diluent or adjuvant; (iv) a method for inducing an 15 immune response against Haemophilus, in an individual, by administering to the individual, an immunogenically effective amount of a polypeptide of the disclosure to elicit an immune response, e.g., a protective immune response to Haemophilus; and particularly, (v) a method for preventing and/or treating a Haemophilus infection, by administering a prophylactic or therapeutic amount of a polypeptide of the disclosure to an individual in need. 18 2547150_1 (GHMatler) 27-.Ja-11 Before immunization, the polypeptides of the disclosure can also be coupled or conjugated to carrier proteins such as tetanus toxin, diphtheria toxin, hepatitis B virus surface antigen, poliomyelitis virus VP 1 antigen or any other viral or bacterial toxin or antigen or any suitable 5 proteins to stimulate the development of a stronger immune response. This coupling or conjugation can be done chemically or genetically. A more detailed description of peptide carrier conjugation is available in Van Regenmortel, M. H. V., Briand J. P., Muller S., Plau6 S., «Synthetic Polypeptides as antigens in Laboratory Techniques in Biochemistry and Molecular Biology, Vol. 19 (ed.) Burdou, R. H. & Van Knippenberg P. H. (1988), Elsevier 10 New York. Also disclosed are pharmaceutical compositions comprising one or more Haemophilus polypeptides of the disclosure in a mixture with a pharmaceutically acceptable carrier, diluent or adjuvant. Suitable adjuvants include (1) oil-in-water emulsion formulations such as 15 MF59TM, SAFTM, RibiTM; (2) Freund's complete or incomplete adjuvant; (3) salts i.e.
AIK(SO
4
)
2 , AlNa(SO 4
)
2 , AlNH 4
(SO
4
)
2 , Al(OH) 3 , AIPO 4 , silica, kaolin; (4) saponin derivatives such as StimulonTM or particles generated therefrom such as ISCOMs (immunostimulating complexes); (5) cytokines such as interleukins, interferons, macrophage colony stimulating factor (M-CSF), tumor necrosis factor (TNF); (6) other substances such as 20 carbon polynucleotides i.e. poly IC and poly AU, detoxified cholera toxin (CTB) and E. coli heat labile toxin for induction of mucosal immunity. A more detailed description of adjuvant is available in a review by M. Z. I Khan et al. in Pharmaceutical Research, vol. 11, No. I (1994) pp 2
-
1 1, and also in another review by Gupta et al., in Vaccine, Vol. 13, No. 14, pp 12 6 3
-
12 7 6 (1995) and in WO 99/24578. Preferred adjuvants include QuilA T M , QS2I
TM
, 25 Alhydrogel T M and Adjuphos
TM
. 19 2547150_1 (GHMates) 27-Jn-11 Pharmaceutical compositions of the invention may be administered parenterally by injection, rapid infusion, nasopharyngeal absorption, dermoabsorption, or buccal or oral. 5 Pharmaceutical compositions of the invention are used for the treatment or prophylaxis of Haemophilus infection and/or diseases and symptoms mediated by Haemophilus infection as described in P.R. Murray (Ed, in chief),E.J. Baron, M.A. Pfaller, F.C. Tenover and R.H. Yolken. Manual of Clinical 10 Microbiology, ASM Press, Washington, D.C. seventh edition, 1999, p1481-1482 which are herein incorporated by reference. In one embodiment, pharmaceutical compositions of the present invention are used for the treatment or prophylaxis of otitis media (acute or recurrent), sinusitis, bronchitis, pneumonia, meningitis and 15 bacteremia. In one embodiment, pharmaceutical compositions of the invention are used for the treatment or prophylaxis of Haemophilus infection and/or diseases and symptoms mediated by Haemophilus infection. In a further embodiment, the Haemophilus infection is Haemophilus Influenzae. In a further embodiment, 20 the Haemophilus infection is Nontypeable Haemophilus Influenzae. In a further embodiment, the Haemophilus infection is Typeable Haemophilus Influenzae. As used in the present application, the term "individual" 25 include mammal. In a further embodiment, the mammal is human. In a particular embodiment, pharmaceutical compositions are administered to those individuals at risk of H. influenzae infection such as infants, elderly and immunocompromised 30 individuals. Pharmaceutical compositions are preferably in unit dosage form of about 0.001 to 100 pg/kg (antigen/body weight) and more preferably 0.01 to 10 pg/kg and most preferably 0.1 to 1 jg/kg 1 35 to 3 times with an interval of about 1 to 6 week intervals between immunizations. 20 Pharmaceutical compositions are preferably in unit dosage form of about 0.1 pig to 10 mg and more preferably lpg to 1 mg and most preferably 10 to 100 Vig 1 to .3 times with an interval of about 1 to 6 week intervals between immunizations. 5 In one embodiment. polynucleotides are those illustrated in SEQ ID Nos : 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 and 23 which may include the open reading frames (ORF), encoding the polypeptides of the invention. 10 In a further embodiment, polynucleotides are those illustrated in SEQ ID NO: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21, 23 encoding polypeptides of the invention. 15 It will be appreciated that the polynucleotide sequences illustrated in the figures may be altered with degenerated codons yet still encode the polypeptide of the invention. Accordingly the present invention further provides polynucleotide herein above described (or the complement 20 sequence thereof) having 50% identity between sequences. In one embodiment, at least 70% identity between sequences. In one. embodiment, at least 75% identity between sequences. In one embodiment, at least 80% identity between sequences. In one embodiment, at least 85% identity between sequences. In one 25 embodiment, at least 90% identity between sequences. In a further embodiment, polynucleotides are hybridizable under stringent conditions, i.e. having at least 95% identity. In a further embodiment, more than 97% identity. 30 Suitable stringent conditions for hybridation can be readily determined by one of skilled in the art (see for example Sambrook et al., (1989) Molecular cloning : A Laboratory Manual, 2nd ed, Cold Spring Harbor, N.Y.; Current Protocols in Molecular Biology, (1999) Edited by Ausubel F.M. et al., John Wiley & 35 Sons, Inc., N.Y.). 21 In a further embodiment, the present invention provides polynucleotides that hybridize under stringent conditions to either (a) a DNA sequence encoding a polypeptide or 5 (b) the complement of a DNA sequence encoding a polypeptide; wherein said polypeptide comprises SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24, or fragments or analogs thereof. In a further embodiment, the present invention provides 10 polynucleotides that hybridize under stringent conditions to either (a) a DNA sequence encoding a polypeptide or (b) the complement of a DNA sequence encoding a polypeptide; wherein said polypeptide comprises at least 10 contiguous amino 15 acid residues from a polypeptide comprising SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24 or fragments or analogs thereof. In a further embodiment, the present invention provides 20 polynucleotides that hybridize under stringent conditions to either (a) a DNA sequence encoding a polypeptide or (b) the complement of a DNA sequence encoding a polypeptide; wherein said polypeptide comprises SEQ ID NO: 2, 4, 6, 8, 10, 25 12, 14, 16, 18, 20, 22, 24. In a further embodiment, the present invention provides polynucleotides that hybridize under stringent conditions to either 30 (a) a DNA sequence encoding a polypeptide or (b) the complement of a DNA sequence encoding a polypeptide; wherein said polypeptide comprises at least 10 contiguous amino acid residues from a polypeptide comprising SEQ ID NO: 2, 4, 6, 8, 10, 12, 14, 16, 18, 20, 22, 24. 35 As will be readily appreciated by one skilled in the art, polynucleotides include both DNA and RNA. 22 Also disclosed are polynucleotides complementary to the polynucleotides described in the present application. Also disclosed are polynucleotides encoding polypeptides of the disclosure, or fragments or 5 analogs thereof, that may be used in a DNA immunization method. That is, they can be incorporated into a vector which is replicable and expressible upon injection thereby producing the antigenic polypeptide in vivo. For example polynucleotides may be incorporated into a plasmid vector under the control of the CMV promoter which is functional in eukaryotic cells. Preferably, the vector is injected intramuscularly. 10 Also disclosed is a process or method of manufacturing for producing polypeptides of the disclosure by recombinant techniques by expressing a polynucleotide encoding said polypeptide in a host cell and recovering the expressed polypeptide product. Alternatively, the polypeptides can be produced according to established synthetic chemical techniques, i.e. 15 solution phase or solid phase synthesis of oligopeptides which are ligated to produce the full polypeptide (block ligation). General methods for obtention and evaluation of polynucleotides and polypeptides are described in the following references : Sambrook et al., (1989) Molecular cloning: A 20 Laboratory Manual, 2 nd ed, Cold Spring Harbor, N. Y.; Current Protocols in Molecular Biology, (1999) Edited by Ausubel F. M. et al., John Wiley & Sons, Inc., N. Y.; PCR Cloning Protocols, from Molecular Cloning to Genetic Engineering, (1997) Edited by White B. A., Humana Press, Totowa, New Jersey, 490 pages; Protein Purification, Principles and Practices, (1993) Scopes R. K., Springer-Verlag, N. Y., 3 rd Edition, 380 pages; Current 25 Protocols in Immunology, (1999) Edited by Coligan J. E. et al., John Wiley & Sons Inc., N. Y., are herein incorporated by reference. 23 2547150_1 (GHMalters) 27-Jan11 For recombinant production, host cells are transfected with vectors which encode the polypeptides of the invention, and then cultured in a nutrient media modified as appropriate for activating promoters, selecting transformants or amplifying the 5 genes. Suitable vectors are those that are viable and replicable in the chosen host and include chromosomal, non-chromosomal and synthetic DNA sequences e.g. bacterial plasmids, phage DNA, baculovirus, yeast plasmids, vectors derived from combinations of plasmids and phage DNA. The polypeptide sequence may be 10 incorporated in the vector at the appropriate site using restriction enzymes such that it is operably linked to an expression control region comprising a promoter, ribosome binding site (consensus region or Shine-Dalgarno sequence), and optionally an operator (control element). One can select 15 individual components of the expression control region that are appropriate for a given host and vector according to established molecular biology principles (Sambrook et al., (1989) Molecular Cloning : A Laboratory manual, 2 nd ed., Cold Spring Harbor, N.Y.; Current Protocols in Molecular Biology, (1999) Edited by Ausubel 20 F.M. et al., John Wikey & Sons, Inc., N.Y., incorporated herein by reference). Suitable promoters include but are not limited to LTR or SV40 promoter, E.coli lac, tac or trp promoters and the phage lambda PL promoter. Vectors will preferably incorporate an origin of replication as well as selection markers i.e. 25 ampicilin resistance gene. Suitable bacterial vectors include pET, pQE70, pQE60, pQE-9, pD10 phagescript, psiX174, pbluescript SK, pbsks, pNH8A, pNH16a, pNH18A, pNH46A, ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 and eukaryotic vectors pBlueBacIII, pWLNEO, pSV2CAT, pOG44, pXT1, pSG, pSVK3, pBPV, pMSG and pSVL. 30 Host cells may be bacterial i.e. E.coli, Bacillus subtilis, Streptomyces; fungal i.e. Aspergillus niger, Aspergillus nidulins; yeast i.e. Saccharomyces or eukaryotic i.e. CHO, COS. Upon expression of the polypeptide in culture, cells are 35 typically harvested by centrifugation then disrupted by physical or chemical means (if the expressed polypeptide is not secreted into the media) and the resulting crude extract retained to 24 to isolate the polypeptide of interest. Purification of the polypeptide from culture media or lysate may be achieved by established techniques depending on the properties of the polypeptidei.e. using ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography hydrophobic interaction 5 chromatography, hydroxylapatite chromatography and lectin chromatography. Final purification may be achieved using HPLC. The polypeptide may be expressed with or without a leader or secretion sequence. In the former case, the leader may be removed using post-translational processing (see US 4 431 10 739, US 4 425 437 and US 4 338 397 incorporated herein by reference) or be chemically removed subsequent to purifying the expressed polypeptide. Also disclosed are the Haemophilus polypeptides of the disclosure may be used in a diagnostic test for H. influenzae infection, in particular for H. influenzae infection. Several 15 diagnostic methods are possible, for example detecting Haemophilus organismn in a biological sample, the following procedure may be followed: a. obtaining a biological sample from an individual; b. incubating an antibody or fragment thereof reactive with an Haemophilus polypeptide of the disclosure with the biological sample to form a mixture, and 20 c. detecting specifically bound antibody or bound fragment in the mixture which indicates the presence of Haemophilus. Alternatively, a method for the detection of antibody specific to an H. influenzae antigen in a biological sample containing or suspected of containing said antibody may be performed as 25 follows: a. obtaining a biological sample from an individual; b. incubating one or more H. influenzae polypeptides of the disclosure or fragments thereof with the biological sample to form a mixture; and c. detecting specifically bound antigen or bound fragment in the mixture which indicates 30 the presence of antibody specific to H. influenzae. One of skill in the art will recognize that this diagnostic test may take several forms, including an immunological test such as an enzyme-linked immunoadsorbent assay (ELISA), 25 25471501 (GHMatter) 27-Jan- II a radioimmunoassay or a latex agglutination assay, essentially to determine whether antibodies specific for the polypeptides are present in an organism. Also disclosed is a method for prophylactic or therapeutic treatment of otitis media, sinusitis, 5 bronchitis, pneumonia and meningitis and bacteremia comprising administering to an individual a therapeutic or prophylactic amount of a composition of the invention. Also disclosed is a method for prophylactic or therapeutic treatment of Haemophilus influenzae bacterial infection in an individual susceptible to Haemophilus influenzae 10 infection comprising administering to said individual a therapeutic or prophylactic amount of a composition of the invention. In a further embodiment, Haemophilus influenzae is Nontypeable Haemophilus influenzae. In a further embodiment, Haemophilus influenzae is Typeable Haemophilus influenzae. 15 Also disclosed is a method for diagnostic of otitis media, sinusitis, bronchitis, pneumonia and meningitis and bacteremia comprising administering to an individual a therapeutic or prophylactic amount of a composition of the invention. Also disclosed is a method for diagnostic of Haemophilus influenzae bacterial infection in an 20 individual susceptible to Haemophilus influenzae infection comprising administering to said individual a therapeutic or prophylactic amount of a composition of the invention. In a further embodiment, Haemophilus influenzae is Nontypeable Haemophilus influenzae. In a further embodiment, Haemophilus influenzae is Typeable Haemophilus influenzae. 25 Also disclosed is use of a pharmaceutical composition of the disclosure for the prophylactic or therapeutic treatment of Haemophilus infection comprising administering to said individual a prophylactic or therapeutic amount of the composition. The Haemophilus polypeptides of the disclosure may be used in a kit comprising the 30 polypeptides of the disclosure for detection of diagnosis of Hameophilus infection. 26 2547150_1 (GHMatlers) 27-Jan-I The DNA sequences encoding polypeptides of the disclosure may also be used to design DNA probes for use in detecting the presence of H. influenzae in a biological sample suspected of containing such bacteria. The detection method of this disclosure comprises: a. obtaining the biological sample from an individual; 5 b. incubating one or more DNA probes having a DNA sequence encoding a polypeptide of the disclosure or fragments thereof with the biological sample to form a mixture; and c. detecting specifically bound DNA probe in the mixture which indicates the presence of H. influenzae bacteria. 10 The DNA probes of this disclosure may also be used for detecting circulating H. influenzae (i.e. H. influenzae nucleic acids) in a sample, for example using a polymerase chain reaction, as a method of diagnosing H. influenzae infections. The probe may be synthesized using conventional techniques and may be immobilized on a solid phase or may be labelled with a 15 detectable label. A preferred DNA probe for this application is an oligomer having a sequence complementary to at least about 6 contiguous nucleotides of the H. influenzae polypeptides of the disclosure. Another diagnostic method for the detection of H. influenzae in an individual comprises: 20 a. labelling an antibody reactive with a polypeptide of the disclosure or fragment thereof with a detectable label; b. administering the labelled antibody or labelled fragment to the individual; and c. detecting specifically bound labelled antibody or labelled fragment in the individual which indicates the presence of H. influenzae. 25 Also disclosed is use of the Haemophilus polypeptides of the disclosure as immunogens for the production of specific antibodies for the diagnosis and in particular the treatment of H. influenzae infection. Suitable antibodies may be determined using appropriate screening methods, for example by measuring the ability of a particular antibody to passively protect 30 against H. influenzae infection in a test model. One example of an animal model is the mouse model described in the example herein. The antibody may be a whole antibody or an antigen-binding fragment thereof and may belong to any immunoglobulin class. The antibody or fragment may be of animal origin, specifically of mammalian origin and more 27 2547150_ 1 (GHMattes) 27-Jan-1 specifically of murine, rat or human origin. It may be a natural antibody or a fragment thereof, or if desired, a recombinant antibody or antibody fragment. The term recombinant antibody or antibody fragment means antibody or antibody fragment which was produced using molecular biology techniques. The antibody or antibody fragments may be polyclonal 5 or preferably monoclonal. It may be specific for a number of epitopes associated with the H. influenzae polypeptides but is preferably specific for one. Also disclosed is use of a pharmaceutical composition of the invention for the prophylactic or therapeutic treatment of Haemophilus infection comprising administering to said individual a 10 prophylactic or therapeutic amount of the composition. 28 2547150_ (GHMatr)27-Jar-11 Unless otherwise defined, all technical and scientific terms used herein have the same meaning as commonly understood by one of ordinary skill in the art to which this invention belong. All publications, patent applications, patents and other references 5 mentioned herein are incorporated by reference in their entirety. In case of conflict, the present specification including definitions, will control. In addition, the materials, methods, and examples are illustrative only and not intended to be limiting. 10 ISOLATION OF NONTYPEABLE H. INFLUENZAE (NTHI) POLYPEPTIDES AND IDENTIFICATION OF GENES ENCODING THESE POLYPEPTIDES 15 ISOLATION OF SURFACE-EXPOSED NTHI POLYPEPTIDES Bacterial strains Nontypeable H. influenzae clinical isolates 12085 and 10095 were provided by D.M. Granoff (St-Louis, Missouri) and B-20, A18, 20 A108, C-98, C-26 and B-31 by the Centre de Recherche en Infectiologie du Centre Hospitalier de l'Universit6 Laval. Nontypeable H. influenzae 12085 was isolated from the blood of a child with lower respiratory tract infection in Pakistan. 25 Escherichia coli DH5mc (GIBCO BRL, Burlington, Ontario) was used as the host strain for recombinant DNA. E. coli XL1-Blue MRF' (Stratagene, LaJolla, California) was used as the host strain for infection with lambda ZAP Express phage vector. E. coli XLOLR (Stratagene) was used as the host strain for infection 30 with in vivo excised filamentous lambda ZAP Express. Antisera Mice antisera was produced following three-week intervals subcutaneous immunization with outer membrane proteins in 35 presence of complete or incomplete Freund adjuvants (Cedarlane Laboratories Ltd, Hornby, Canada) . Sera was collected 21 days after the tertiary immunization. 29 Four human antisera were selected on the basis of their reactivity by ELISA and Western blotting on heat-killed nontypeable H. influenzae 12085. 5 H. influenzae library construction and screening Nontypeable H. influenzae 12085 DNA was extracted using a genomic extraction Kit (QIAgen). DNA was partially digested with Tsp509I and ligated to EcoRI digested X-ZAP Express phage arms 10 (Stratagene) . The ligation was packaged in vitro with Gigapack extracts according to the manufacturer's recommendations (Stratagene). Recombinant phage were plated on E. coli XL1-Blue MRF' at density of 2.5 x 104 PFU/150 mm (diameter) plate. Following eight hours of incubation, the plates were overlaid 15 with nitrocellulose disks and the resulting lifts were processed for immunoblotting with human and mice sera. Positive clones were picked up and plaque-purified. Recombinant pBK-CMV plasmids coding for the Haemophilus genes of interest were recovered from the purified bacteriophage using ExAssist filamentous helper 20 phage and the lambda-resistant strain E. coli XLOLR by in vivo excision. Identification of antigens SDS-PAGE and immunoblot analysis of lysates of these recombinant 25 E. coli showed that each clone expressed one or more polypeptides that reacted with human or mice antisera. DNA sequencing and sequence analysis The genomic clones were sequenced with the Taq DyeDeoxy 30 Terminator Cycle Sequencing Kit (Applied Biosystem, Foster City, California) . Several internal primers were designed to sequence further into the cloned inserts. Sequence assembly was performed using Sequencher software (Gene Codes Corporation, Ann Arbor, Michigan) and sequence analysis was performed with McVector 35 software (Oxford Molecular Ltd., Campbell, California). 30 In the claims which follow and in the preceding description of the invention, except where the context requires otherwise due to express language or necessary implication, the word "comprise" or variations such as "comprises" or "comprising" is used in an inclusive sense, i.e. to specify the presence of the stated features but not to preclude the presence or addition 5 of further features in various embodiments of the invention. EXAMPLE 1 This example illustrates the cloning of nontypeable H. influenzae genes into an expression vector. 10 The coding regions of nontypeable H. influenzae genes BVH-NTHII to BVH-NTHIl2 (SEQ ID NOs: 1, 3, 5, 7, 9, 11, 13, 15, 17, 19, 21 and 23) were amplified by PCR (DNA Thermal Cycler GeneAmp PCR system 2400 Perkin Elmer, San Jose, CA) from genomic DNA of nontypeable H. influenzae strain 12085 by using the following oligonucleotide primers that 15 contained base extensions for the addition of restriction sites Ncol (CCATGG), Ndel (CATATG), Sall (GTCGAC) or Xhol (CTCGAG) (Table 1). PCR products were purified from agarose gels by using a QIAquick gel extraction kit from QIAgen following the manufacturer's instructions (Chatsworth, CA), and digested with appropriate restriction endonucleases (Pharmacia Canada Inc, Baie d'Urf6, Canada). The pET vectors (Novagen, 20 Madison, Wisconsin) were digested likewise and purified from agarose gels using a QlAquick gel extraction kit from QIAgen (Chatsworth, California). The digested PCR products were ligated to the enzyme-restricted pET expression vector. The ligated products were transformed into E. coli strain DH5a [$80dlacZAM 15 A (lacZYA-argF) U169 endAl recA I hsdR 17 (r-m,+) deoR thi- 1 supE44 KgyrA96 relA 1] (Gibco BRL, Gaithersburg, 25 Maryland) according to the method of Simanis (Hanahan D. (1985) In: DNA Cloning. D. M. Glover, ed., IRL Press, Washington D.C. vol. 1 pp. 109-135). Recombinant gene-containing plasmids (rpET) were purified using a QiAgen kit (Chatsworth, California) and DNA inserts were sequenced (Taq Dye Deoxy Terminator Cycle Sequencing kit, ABI, Foster City, California). 30 Table 1. List of oligonucleotide primers for DNA cloning. PCR Restri Cloning Seq. Nucleotide Primer Sequence 5'-3' ction vector ID. position* set sites Strain 31 2547150_1 (GHMatlr) 27-Jan-11 HAMJ342- 25 CAAGGCGTTTTCATATG 1-1137 NdeI pET21-b+ CCTGTCATTCGGCAGG Tuner (DE CTAATTGACCTCGAGTT XhoI 3) HAMJ343 26 TTGCTGCTTTTAATTCT TGATAATATTG HAMJ345- 27 GTAAGGAAACATACATA 1-1005 NdeI pET21-b+ TGAAAAAACTTTTAAAA ATTAGTG BL21 (DE3 TTAGAGACTCGAGTTTA XhoI HAMJ344 28 GCTAAACATTCTATGTA GCTATC HAMJ348- 29 CCTAACATTGACATATG 1-1647 NdeI pET21-b+ CTTATGAAACTAAAAGC AACA AD494 (DE 3) HAMJ349 30 TCAATATCTCGAGTTTA XhoI CCATCAACACTCACACC HAMJ346- 31 CTAATAAGGAAAACCAT 1-1971 NdeI pET21-b+ ATGATGAACAGACGTCA TTTTATTC Tuner (DE 3) GACCTAGCTCGAGTTTA XhoI HAMJ399 32 GATAAATCAATTTGATA CACTG HAMJ376- 33 CATAAGGAGTAACATAT 1-480 NdeI pET21-b+ GAAAAAAATTATTTTAA CATTATC Tuner (DE 3) GTGCAGATTCTCGAGTT XhoI HAMJ377 34 TTTTATCAACTGAA HAMJ460- 35 CTGGACAGACCATATGC 2-936 NdeI pET21-b+ CTTCTGATTTAGTCGC Tuner (DE CTAAATTGAGCTCGAGA 3) HAMJ461 36 TTAGTTTTTAATTTACT XhoI cc 32 HAMJ458- 37 CTTTCTTATAGCATATG 1-1041 NdeI pET21-b+ AAGAAATTTTTAATTGC GATT Tuner (DE 3)pLysS CTTCCGCACTCGAGTTT XhoI HAMJ459 38 GGCATTTTTC HAMJ477- 39 GGAAGGAGCTAGCATGA 1-939 NheI pET21-b+ AAATGAAAAAATTTATT C Tuner(DE HAMJ478 40 TTGATACTCTCGAGTTT XhoI ATTAAAATACTG HAMJ481- 41 CTTTAATCACATATGAC 1-534 NdeI pET21-b+ TATGTTTAAAAAAATCT CTG CACCAATCTCGAGTTTA XhoI HAMJ482 42 GATGTACAGGCTT HAMJ78- 43 ACCCGCATGGCTGTTCA 75-1728 Ncol pET32-c+ AATCTACTTGGTAG AD494 (DE ACTCGTCGACTTAGTTT 3) HAMJ79 44 GCAACTGGTACAAT SalI HAMJ414- 45 GATTAGGGAAAACATAT 1-3336 NdeI pET21-b+ GATTAGGAAACTTATGA A HAMJ415 46 CCATAATTTGCTCGAGT XhoI TTTTTTACATCAAC HAMJ450- 47 GGAAGGAGCTAGCATGA 1-816 NheI pET21-b+ AATTAAAACAACTTTTT G Tuner (DE HAMJ411 48 GTGCGGTAGCTCGAGCC XboI 3) AACCTTTTAC * Nucleotide position indicates the result of the cloning, i.e. the length ant the position in Figure 1 of the PCR products. 33 EXAMPLE 2 This example describes the PCR amplification and sequencing of BVH-NTHIl gene from other nontypeable H. influenzae strains and the evaluation of the level of molecular conservation of this 5 gene. The respective coding regions of nontypeable H. influenzae gene BVH-NTHI1 from these strains were amplified by PCR (DNA Thermal Cycler GeneAmp PCR system 2400 Perkin Elmer, San Jose, CA) from 10 genomic DNA using the following oligos: HAMJ342 (5' CAAGGCGTTTTCATATGCCTGTCATTCGGCAGG -3'); HAMJ343 (5' CTAATTGACCTCGAGTTTTGCTGCTTTTAATTCTTGATAATATTG -3'). PCR products were purified from agarose gels using a QIAquick gel extraction kit from QIAgen following the manufacturer's instructions 15 (Chatsworth, CA) and the DNA inserts were sequenced (Taq Dye Deoxy Terminator Cycle Sequencing kit, ABI, Foster City, CA). The length of PCR fragments generated for all these eight strains was identical. Pairwise comparisons of nucleotides and predicted amino acid sequences from four of these strains 20 (12085, 10095, A18 and A108) revealed 99% identity as shown in Figure 25. EXAMPLE 3 This example illustrates the production and purification of 25 recombinant nontypeable H. influenzae BVH-NTHI1 polypeptide. The recombinant pET21-b+ plasmid with BVH-NTHI1 gene corresponding to the SEQ ID NO: 1 was used to electrotransform (Gene Pulser II apparatus, BIO-RAD Labs, Mississauga, Canada) E. 30 coli strain Tuner(DE3) [ F~ ompT, hsdS (rb,mb), gal, dcn, lacYI (DE3)] (Novagen, Madison, Wisconsin) . Within this E. coli strain, the T7 promotor controlling expression of the recombinant polypeptide is specifically recognized by the T7 RNA polymerase (present on the XDE3 prophage) whose gene is under 35 the control of the lac promotor which is inducible by isopropyl 8-d-thio-galactopyranoside (IPTG). The transformant Tuner (DE3) /rpET21 was grown at 37 0 C with agitation at 250 rpm in 34 LB broth (peptone lOg/L, yeast extract 5g/L, NaCl 10g/L) containing 100 pg/ml of carbenicillin (Sigma-Aldrich Canada Ltd., Oakville, Canada), until the Aoo reached a value of 0.5. In order to induce the production of nontypeable H. influenzae 5 BVH-NTHIl-HiseTag recombinant polypeptide, the cells were incubated for 3 additional hours at 30 0 C in presence of IPTG at a final concentration of 1 mM. Induced cells from a 500 ml culture were pelleted by centrifugation and frozen at -70*C. 10 The purification of the recombinant polypeptides from the soluble cytoplasmic fraction of IPTG-induced Tuner(DE3) /rpET21 was done by affinity chromatography based on the properties of the HiseTag sequence (6 consecutive histidine residues) to bind to divalent cations (Ni 2 *) immobilized on the HisoBind metal 15 chelation resin. Briefly, the pelleted cells obtained from a 500 mL IPTG-induced culture was resuspended in lysis buffer (20 mM Tris, 500 mM NaCl, 5 mM imidazole, pH 7.9) containing 1 mM of phenylmethylsulfonyl fluoride (PMSF; Sigma), sonicated and centrifugated at 16,000 X g for 30 min to remove debris. The 20 supernatant was deposited on a Ni-NTA agarose column (QIAgen, Mississauga, Ontario, Canada) . The nontypeable H. influenzae BVH-NTHIl-HiseTag recombinant polypeptide was eluted with 250 mM imidazole-500mM NaCl-20 mM Tris pH 7.9. Removal of salt and imidazole from the sample was performed by dialysis against PBS 25 at 4 0 C. The quantity of recombinant polypeptide obtained from the soluble fraction of E. coli was estimated by MicroBCA (Pierce, Rockford, Illinois). EXAMPLE 4 30 This example illustrates the analysis of the immunogenicity and the protective ability of mice against nontypeable H. influenzae infection following immunization with BVH-NTHI1. Groups of 5 female BALB/c mice (Charles River, Ontario, Canada) 35 were immunized intranasally three times at two-week intervals with 25 pg of affinity purified BVH-NTHIl-HiseTag recombinant 35 polypeptide in presence of the E. coli heat-labile toxin adjuvant (LT; 1 ig; Cedarlane Laboratories Ltd, Hornby, Canada) or, as a control, with adjuvant alone in PBS. Blood samples were collected from the orbital sinus on the day prior to each 5 immunization and 14 days following the third (day 42) injection. Antibody titers were determined by ELISA on heat-killed and outer membrane vesicules of the nontypeable H. influenzae strain 12085. The secondary antibody used was a goat anti-mouse IgG + IgM (H+L) (Fc specific) conjugated to alcaline phosphatase 10 (Jackson Immunoresearch Labs, Mississauga, Ontario) . The reactive titer of an antiserum was defined as the reciprocal of the dilution showing a two-fold increase in absorbance over that obtained with the pre-immune serum sample. To investigate whether immune responses elicited by BVH-NTHIl were functionally 15 significant, in vivo protective efficacy was evaluated 14 days later in mice challenged intrapulmonarily with approximately 2 x 105 CFU of the nontypeable H. influenzae strain 12085. Samples of the nontypeable H. influenzae challenge inoculum were plated on chocolate agar plates to verify the challenge dose. To 20 measure the effectiveness of vaccination in limiting in vivo growth of nontypeable H.' influenzae, mice were killed by an intraperitoneal injection of sodium pentobarbital (Euthanyl Tm ) 5 h after infection. Bronchoalveolar lavages were assessed for bacterial clearance by plating of serial dilutions for bacterial 25 count determination. Mice injected with adjuvant only were used as negative controls. Results of- the immunogenicity study (Table 2) showed that the level of specific antibodies in serum of immunized animals rose 30 by around 1000-fold relative to control serum. The mean titer measured on OMP and heat-killed samples diverged by only one .dilution, confirming that the BVH-NTHIl polypeptide really represents a surface-exposed antigen. 36 Table 2. Effect of systemic immunization on NTHI-directed antibody levels in serum NTHI 12085 ELISA titer Control Immune Outer membrane 200 184 320 polypeptides Heat-killed 360 368 640 a) Serum samples were collected from immune and control mice on day 42 of the immunization regimen. 5 Results of the protection study (Table 3) showed that strain 12085 readily multiplied in the lungs of the control animals such that by 5 hours postchallenge, the number of viable nontypeable H. influenzae cells had increased by 200%. In 10 contrast, substantial pulmonary clearance of strain 12085 by the BVH-NTHIl-immunized mice was clearly evident, whereas only 35% of the original number of organisms deposit in the lungs of the immune animals were recovered by 5-hour postchallenge. 15 Table 3. Effect of systemic immunization on pulmonary clearance of nontypeable H_._ influenza 12085a BALB/c Mice Nontypeable H. influenzae 12085 (x 104) CFU 0 h 5 h Control 4,6 9,2 Immunized nd 3.2" a) Each value represents a mean of five animals at each time. b) **P < 0.0098 calculated according to the unpaired t test with Welch's correction and compared to control. 20 EXAMPLE 5 This example illustrates the recognition of recombinant polypeptides from nontypeable H. influenzae strain 12085 by human sera and by antisera from protected mice. 25 A standard Western blot technique was used to investigate whether purified recombinant polypeptides were recognized by 37 human sera. In addition, antisera from mice immunized with outer membrane proteins preparations were tested against the purified recombinant polypeptides. Mice immunized with these preparations demonstrated increased pulmonary clearance following a challenge 5 with nontypeable H. influenzae strain 12085. For the preparation of antigens, purified recombinant polypeptides were treated with sample buffer containing SDS and 2-mercaptoethanol for 5 min at 100 0 C. Polypeptides were resolved by SDS-PAGE according to the method of Laemmli, U.K. (1970) Cleavage of structural proteins 10 during the assembly of the head of the bacteriophage T4. Nature, 227 :680-685. After SDS-PAGE, the polypeptides were transferred electrophoretically from the gel to nitrocellulose paper by the method (Towbin, H., Staehelin, T. and Gordon, J. (1979) Electrophoretic transfer of protein from polyacrylamide gels to 15 nitrocellulose sheets : procedure and some applications. Proc. Natl. Acad. Sci. USA, 76 :4350-4354) and probed with human or mouse antisera. The detection of antigens reactive with the antibodies was performed by indirect enzyme-irmmunoassay using conjugated anti-mouse or anti-human immunoglobulins and a color 20 substrate. Results in Table 4 show that most polypeptides have already been seen by the human immune system. As vaccine candidates, these polypeptides thus have a potential to induce a strong immune response in humans. Moreover, most polypeptides were recognized by sera from protected mice. The serum 25 reactivities correlate to increased pulmonary clearance in the mouse model of infection. Table 4. Reactivities of normal human sera and antisera from protected mice with nontypeable H. influenzae 12085 recombinant 30 polypeptides. Seq. Polypeptide Serum reactivitya Pulmonary ID. Human Mouse clearance (%)b 2 BVH-NTHI1 ++ +++ 65 4 BVH-NTHI2 + +++ 36 6 BVH-NTHI3 + ++ 56 8 BVH-NTHI4 ++ +++ 98 10 BVH-NTHI5 - ++ ndc 16 BVH-NTHI8 - + nd 18 BVH-NTHI9 I ++ ++ nd 38 20 BVH-NTHI10 + + 44 24 BVH-NTHI12 ++++ - 20 a) The number of +'s indicates the reaction intensity The <-> sign indicates No reaction b) Mice were immunised with the respective recombinant polypeptides and pulmonary clearance was measured as in 5 Example 4 c) nd, not done The entire disclosure in the complete specification of our Australian Patent Application No. 2002211999 is by this cross-reference incorporated into the present specification. 39