AU2004237888A1 - Compositions and methods for treating cancer and hyperproliferative disorders - Google Patents
Compositions and methods for treating cancer and hyperproliferative disorders Download PDFInfo
- Publication number
- AU2004237888A1 AU2004237888A1 AU2004237888A AU2004237888A AU2004237888A1 AU 2004237888 A1 AU2004237888 A1 AU 2004237888A1 AU 2004237888 A AU2004237888 A AU 2004237888A AU 2004237888 A AU2004237888 A AU 2004237888A AU 2004237888 A1 AU2004237888 A1 AU 2004237888A1
- Authority
- AU
- Australia
- Prior art keywords
- growth factor
- composition
- peptide
- mice
- liposomes
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Granted
Links
- 239000000203 mixture Substances 0.000 title claims description 149
- 206010028980 Neoplasm Diseases 0.000 title claims description 135
- 238000000034 method Methods 0.000 title claims description 102
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 title claims description 53
- 201000011510 cancer Diseases 0.000 title claims description 45
- 230000003463 hyperproliferative effect Effects 0.000 title claims description 16
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 222
- 239000003102 growth factor Substances 0.000 claims description 183
- 239000002502 liposome Substances 0.000 claims description 147
- 230000002163 immunogen Effects 0.000 claims description 70
- 210000004027 cell Anatomy 0.000 claims description 68
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 claims description 58
- 229920000669 heparin Polymers 0.000 claims description 58
- 229960002897 heparin Drugs 0.000 claims description 58
- 108010073929 Vascular Endothelial Growth Factor A Proteins 0.000 claims description 48
- 150000001413 amino acids Chemical class 0.000 claims description 48
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 claims description 47
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 claims description 45
- 241001465754 Metazoa Species 0.000 claims description 44
- 150000002632 lipids Chemical group 0.000 claims description 42
- 239000002671 adjuvant Substances 0.000 claims description 41
- 230000033115 angiogenesis Effects 0.000 claims description 41
- 201000010099 disease Diseases 0.000 claims description 34
- GZQKNULLWNGMCW-PWQABINMSA-N lipid A (E. coli) Chemical compound O1[C@H](CO)[C@@H](OP(O)(O)=O)[C@H](OC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCCCC)[C@@H](NC(=O)C[C@@H](CCCCCCCCCCC)OC(=O)CCCCCCCCCCC)[C@@H]1OC[C@@H]1[C@@H](O)[C@H](OC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](NC(=O)C[C@H](O)CCCCCCCCCCC)[C@@H](OP(O)(O)=O)O1 GZQKNULLWNGMCW-PWQABINMSA-N 0.000 claims description 33
- 102000005962 receptors Human genes 0.000 claims description 33
- 108020003175 receptors Proteins 0.000 claims description 33
- 108010033276 Peptide Fragments Proteins 0.000 claims description 32
- 102000007079 Peptide Fragments Human genes 0.000 claims description 32
- 230000012010 growth Effects 0.000 claims description 32
- 241000282414 Homo sapiens Species 0.000 claims description 30
- 206010027476 Metastases Diseases 0.000 claims description 28
- 102000018233 Fibroblast Growth Factor Human genes 0.000 claims description 26
- 108050007372 Fibroblast Growth Factor Proteins 0.000 claims description 26
- 229940126864 fibroblast growth factor Drugs 0.000 claims description 21
- 230000028993 immune response Effects 0.000 claims description 21
- 208000035475 disorder Diseases 0.000 claims description 18
- 230000002209 hydrophobic effect Effects 0.000 claims description 18
- 206010029113 Neovascularisation Diseases 0.000 claims description 16
- 230000009401 metastasis Effects 0.000 claims description 15
- 239000003937 drug carrier Substances 0.000 claims description 14
- 108091003079 Bovine Serum Albumin Proteins 0.000 claims description 13
- 102000014914 Carrier Proteins Human genes 0.000 claims description 13
- 108010078791 Carrier Proteins Proteins 0.000 claims description 13
- 229920000642 polymer Polymers 0.000 claims description 13
- 206010012689 Diabetic retinopathy Diseases 0.000 claims description 11
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 claims description 9
- IPCSVZSSVZVIGE-UHFFFAOYSA-N hexadecanoic acid Chemical compound CCCCCCCCCCCCCCCC(O)=O IPCSVZSSVZVIGE-UHFFFAOYSA-N 0.000 claims description 9
- ILRRQNADMUWWFW-UHFFFAOYSA-K aluminium phosphate Chemical compound O1[Al]2OP1(=O)O2 ILRRQNADMUWWFW-UHFFFAOYSA-K 0.000 claims description 8
- 210000004369 blood Anatomy 0.000 claims description 8
- 239000008280 blood Substances 0.000 claims description 8
- 206010038933 Retinopathy of prematurity Diseases 0.000 claims description 7
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 claims description 7
- 229940098773 bovine serum albumin Drugs 0.000 claims description 7
- 201000011066 hemangioma Diseases 0.000 claims description 7
- 208000002780 macular degeneration Diseases 0.000 claims description 7
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 claims description 6
- 108010040721 Flagellin Proteins 0.000 claims description 6
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 claims description 6
- 108010058846 Ovalbumin Proteins 0.000 claims description 6
- 108010071390 Serum Albumin Proteins 0.000 claims description 6
- 102000007562 Serum Albumin Human genes 0.000 claims description 6
- 102000009843 Thyroglobulin Human genes 0.000 claims description 6
- 108010034949 Thyroglobulin Proteins 0.000 claims description 6
- 206010003246 arthritis Diseases 0.000 claims description 6
- 239000003085 diluting agent Substances 0.000 claims description 6
- POULHZVOKOAJMA-UHFFFAOYSA-N dodecanoic acid Chemical compound CCCCCCCCCCCC(O)=O POULHZVOKOAJMA-UHFFFAOYSA-N 0.000 claims description 6
- 239000003995 emulsifying agent Substances 0.000 claims description 6
- 108010074605 gamma-Globulins Proteins 0.000 claims description 6
- 239000000499 gel Substances 0.000 claims description 6
- 229940092253 ovalbumin Drugs 0.000 claims description 6
- 239000003755 preservative agent Substances 0.000 claims description 6
- 239000007787 solid Substances 0.000 claims description 6
- 239000003381 stabilizer Substances 0.000 claims description 6
- 229960002175 thyroglobulin Drugs 0.000 claims description 6
- 230000029663 wound healing Effects 0.000 claims description 6
- 208000010412 Glaucoma Diseases 0.000 claims description 5
- 201000004681 Psoriasis Diseases 0.000 claims description 5
- 229910052799 carbon Inorganic materials 0.000 claims description 5
- 125000004432 carbon atom Chemical group C* 0.000 claims description 5
- 239000002158 endotoxin Substances 0.000 claims description 5
- 229920006008 lipopolysaccharide Polymers 0.000 claims description 5
- 201000003142 neovascular glaucoma Diseases 0.000 claims description 5
- -1 polyoxypropylene copolymer Polymers 0.000 claims description 5
- 230000004862 vasculogenesis Effects 0.000 claims description 5
- 241000894006 Bacteria Species 0.000 claims description 4
- 241000588832 Bordetella pertussis Species 0.000 claims description 4
- 208000011231 Crohn disease Diseases 0.000 claims description 4
- 206010017076 Fracture Diseases 0.000 claims description 4
- 208000002260 Keloid Diseases 0.000 claims description 4
- 229920000057 Mannan Polymers 0.000 claims description 4
- 235000021314 Palmitic acid Nutrition 0.000 claims description 4
- 206010039710 Scleroderma Diseases 0.000 claims description 4
- 206010043189 Telangiectasia Diseases 0.000 claims description 4
- FHICGHSMIPIAPL-HDYAAECPSA-N [2-[3-[6-[3-[(5R,6aS,6bR,12aR)-10-[6-[2-[2-[4,5-dihydroxy-3-(3,4,5-trihydroxyoxan-2-yl)oxyoxan-2-yl]ethoxy]ethyl]-3,4,5-trihydroxyoxan-2-yl]oxy-5-hydroxy-2,2,6a,6b,9,9,12a-heptamethyl-1,3,4,5,6,6a,7,8,8a,10,11,12,13,14b-tetradecahydropicene-4a-carbonyl]peroxypropyl]-5-[[5-[8-[3,5-dihydroxy-4-(3,4,5-trihydroxyoxan-2-yl)oxyoxan-2-yl]octoxy]-3,4-dihydroxy-6-methyloxan-2-yl]methoxy]-3,4-dihydroxyoxan-2-yl]propoxymethyl]-5-hydroxy-3-[(6S)-6-hydroxy-2,6-dimethylocta-2,7-dienoyl]oxy-6-methyloxan-4-yl] (2E,6S)-6-hydroxy-2-(hydroxymethyl)-6-methylocta-2,7-dienoate Chemical compound C=C[C@@](C)(O)CCC=C(C)C(=O)OC1C(OC(=O)C(\CO)=C\CC[C@](C)(O)C=C)C(O)C(C)OC1COCCCC1C(O)C(O)C(OCC2C(C(O)C(OCCCCCCCCC3C(C(OC4C(C(O)C(O)CO4)O)C(O)CO3)O)C(C)O2)O)C(CCCOOC(=O)C23C(CC(C)(C)CC2)C=2[C@@]([C@]4(C)CCC5C(C)(C)C(OC6C(C(O)C(O)C(CCOCCC7C(C(O)C(O)CO7)OC7C(C(O)C(O)CO7)O)O6)O)CC[C@]5(C)C4CC=2)(C)C[C@H]3O)O1 FHICGHSMIPIAPL-HDYAAECPSA-N 0.000 claims description 4
- 229940037003 alum Drugs 0.000 claims description 4
- 150000001450 anions Chemical class 0.000 claims description 4
- 229960000633 dextran sulfate Drugs 0.000 claims description 4
- 210000002950 fibroblast Anatomy 0.000 claims description 4
- 230000011132 hemopoiesis Effects 0.000 claims description 4
- 210000001117 keloid Anatomy 0.000 claims description 4
- 208000032839 leukemia Diseases 0.000 claims description 4
- 230000005906 menstruation Effects 0.000 claims description 4
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical class OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 claims description 4
- 230000002107 myocardial effect Effects 0.000 claims description 4
- WQEPLUUGTLDZJY-UHFFFAOYSA-N n-Pentadecanoic acid Natural products CCCCCCCCCCCCCCC(O)=O WQEPLUUGTLDZJY-UHFFFAOYSA-N 0.000 claims description 4
- 230000016087 ovulation Effects 0.000 claims description 4
- 230000028742 placenta development Effects 0.000 claims description 4
- 208000009056 telangiectasis Diseases 0.000 claims description 4
- OYHQOLUKZRVURQ-NTGFUMLPSA-N (9Z,12Z)-9,10,12,13-tetratritiooctadeca-9,12-dienoic acid Chemical compound C(CCCCCCC\C(=C(/C\C(=C(/CCCCC)\[3H])\[3H])\[3H])\[3H])(=O)O OYHQOLUKZRVURQ-NTGFUMLPSA-N 0.000 claims description 3
- WRIDQFICGBMAFQ-UHFFFAOYSA-N (E)-8-Octadecenoic acid Natural products CCCCCCCCCC=CCCCCCCC(O)=O WRIDQFICGBMAFQ-UHFFFAOYSA-N 0.000 claims description 3
- LQJBNNIYVWPHFW-UHFFFAOYSA-N 20:1omega9c fatty acid Natural products CCCCCCCCCCC=CCCCCCCCC(O)=O LQJBNNIYVWPHFW-UHFFFAOYSA-N 0.000 claims description 3
- QSBYPNXLFMSGKH-UHFFFAOYSA-N 9-Heptadecensaeure Natural products CCCCCCCC=CCCCCCCCC(O)=O QSBYPNXLFMSGKH-UHFFFAOYSA-N 0.000 claims description 3
- 208000022211 Arteriovenous Malformations Diseases 0.000 claims description 3
- 208000003732 Cat-scratch disease Diseases 0.000 claims description 3
- 241000589989 Helicobacter Species 0.000 claims description 3
- 239000005639 Lauric acid Substances 0.000 claims description 3
- 239000005642 Oleic acid Substances 0.000 claims description 3
- ZQPPMHVWECSIRJ-UHFFFAOYSA-N Oleic acid Natural products CCCCCCCCC=CCCCCCCCC(O)=O ZQPPMHVWECSIRJ-UHFFFAOYSA-N 0.000 claims description 3
- 208000008469 Peptic Ulcer Diseases 0.000 claims description 3
- 206010037649 Pyogenic granuloma Diseases 0.000 claims description 3
- 235000021355 Stearic acid Nutrition 0.000 claims description 3
- 208000025865 Ulcer Diseases 0.000 claims description 3
- DTOSIQBPPRVQHS-PDBXOOCHSA-N alpha-linolenic acid Chemical compound CC\C=C/C\C=C/C\C=C/CCCCCCCC(O)=O DTOSIQBPPRVQHS-PDBXOOCHSA-N 0.000 claims description 3
- 235000020661 alpha-linolenic acid Nutrition 0.000 claims description 3
- 230000005744 arteriovenous malformation Effects 0.000 claims description 3
- QXJSBBXBKPUZAA-UHFFFAOYSA-N isooleic acid Natural products CCCCCCCC=CCCCCCCCCC(O)=O QXJSBBXBKPUZAA-UHFFFAOYSA-N 0.000 claims description 3
- 229960004488 linolenic acid Drugs 0.000 claims description 3
- KQQKGWQCNNTQJW-UHFFFAOYSA-N linolenic acid Natural products CC=CCCC=CCC=CCCCCCCCC(O)=O KQQKGWQCNNTQJW-UHFFFAOYSA-N 0.000 claims description 3
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 claims description 3
- OQCDKBAXFALNLD-UHFFFAOYSA-N octadecanoic acid Natural products CCCCCCCC(C)CCCCCCCCC(O)=O OQCDKBAXFALNLD-UHFFFAOYSA-N 0.000 claims description 3
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 claims description 3
- 235000021313 oleic acid Nutrition 0.000 claims description 3
- 208000011906 peptic ulcer disease Diseases 0.000 claims description 3
- 229920002503 polyoxyethylene-polyoxypropylene Polymers 0.000 claims description 3
- 239000008117 stearic acid Substances 0.000 claims description 3
- TUNFSRHWOTWDNC-HKGQFRNVSA-N tetradecanoic acid Chemical compound CCCCCCCCCCCCC[14C](O)=O TUNFSRHWOTWDNC-HKGQFRNVSA-N 0.000 claims description 3
- 231100000397 ulcer Toxicity 0.000 claims description 3
- 229910052782 aluminium Inorganic materials 0.000 claims description 2
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 claims description 2
- 208000021921 corneal disease Diseases 0.000 claims description 2
- 150000008574 D-amino acids Chemical class 0.000 claims 5
- 150000008575 L-amino acids Chemical class 0.000 claims 5
- 108060003552 hemocyanin Proteins 0.000 claims 5
- 150000004668 long chain fatty acids Chemical class 0.000 claims 2
- 108010042708 Acetylmuramyl-Alanyl-Isoglutamine Proteins 0.000 claims 1
- 125000004429 atom Chemical group 0.000 claims 1
- 230000001175 peptic effect Effects 0.000 claims 1
- 229920001451 polypropylene glycol Polymers 0.000 claims 1
- 241000699670 Mus sp. Species 0.000 description 142
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 120
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 description 113
- 102000004196 processed proteins & peptides Human genes 0.000 description 76
- 235000001014 amino acid Nutrition 0.000 description 41
- 229940024606 amino acid Drugs 0.000 description 40
- 239000012634 fragment Substances 0.000 description 40
- 229960005486 vaccine Drugs 0.000 description 37
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 36
- 108090000623 proteins and genes Proteins 0.000 description 33
- 210000002966 serum Anatomy 0.000 description 32
- 210000004072 lung Anatomy 0.000 description 31
- 102000004169 proteins and genes Human genes 0.000 description 30
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 29
- 235000018102 proteins Nutrition 0.000 description 29
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 28
- 238000002255 vaccination Methods 0.000 description 26
- 230000000694 effects Effects 0.000 description 23
- 230000004663 cell proliferation Effects 0.000 description 22
- 230000035755 proliferation Effects 0.000 description 22
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 21
- HEDRZPFGACZZDS-UHFFFAOYSA-N Chloroform Chemical compound ClC(Cl)Cl HEDRZPFGACZZDS-UHFFFAOYSA-N 0.000 description 20
- 210000002889 endothelial cell Anatomy 0.000 description 19
- 238000002474 experimental method Methods 0.000 description 18
- 238000011161 development Methods 0.000 description 17
- 230000018109 developmental process Effects 0.000 description 16
- 230000000890 antigenic effect Effects 0.000 description 15
- 238000005538 encapsulation Methods 0.000 description 15
- 230000002401 inhibitory effect Effects 0.000 description 15
- 230000009257 reactivity Effects 0.000 description 15
- 210000004881 tumor cell Anatomy 0.000 description 15
- 230000004614 tumor growth Effects 0.000 description 15
- CITHEXJVPOWHKC-UUWRZZSWSA-N 1,2-di-O-myristoyl-sn-glycero-3-phosphocholine Chemical compound CCCCCCCCCCCCCC(=O)OC[C@H](COP([O-])(=O)OCC[N+](C)(C)C)OC(=O)CCCCCCCCCCCCC CITHEXJVPOWHKC-UUWRZZSWSA-N 0.000 description 14
- 238000011731 BALB/cByJ (JAX™ mouse strain) Methods 0.000 description 14
- 238000004458 analytical method Methods 0.000 description 14
- 230000002491 angiogenic effect Effects 0.000 description 14
- 235000012000 cholesterol Nutrition 0.000 description 14
- 229960003724 dimyristoylphosphatidylcholine Drugs 0.000 description 14
- 229960005160 dimyristoylphosphatidylglycerol Drugs 0.000 description 14
- BPHQZTVXXXJVHI-AJQTZOPKSA-N ditetradecanoyl phosphatidylglycerol Chemical compound CCCCCCCCCCCCCC(=O)OC[C@H](COP(O)(=O)OC[C@@H](O)CO)OC(=O)CCCCCCCCCCCCC BPHQZTVXXXJVHI-AJQTZOPKSA-N 0.000 description 14
- 239000007924 injection Substances 0.000 description 14
- 238000002347 injection Methods 0.000 description 14
- 229910052757 nitrogen Inorganic materials 0.000 description 14
- 241000701447 unidentified baculovirus Species 0.000 description 14
- 210000004185 liver Anatomy 0.000 description 13
- 238000002360 preparation method Methods 0.000 description 13
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 12
- 241000699666 Mus <mouse, genus> Species 0.000 description 12
- 229960000583 acetic acid Drugs 0.000 description 12
- 230000003053 immunization Effects 0.000 description 12
- 230000005764 inhibitory process Effects 0.000 description 12
- 206010061289 metastatic neoplasm Diseases 0.000 description 12
- 230000002159 abnormal effect Effects 0.000 description 11
- 210000004204 blood vessel Anatomy 0.000 description 11
- 230000001413 cellular effect Effects 0.000 description 11
- 229940107161 cholesterol Drugs 0.000 description 11
- 239000008188 pellet Substances 0.000 description 11
- 150000003904 phospholipids Chemical class 0.000 description 11
- 239000000243 solution Substances 0.000 description 11
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Chemical compound O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 11
- 108010010803 Gelatin Proteins 0.000 description 10
- 230000021615 conjugation Effects 0.000 description 10
- 238000009472 formulation Methods 0.000 description 10
- 239000008273 gelatin Substances 0.000 description 10
- 229920000159 gelatin Polymers 0.000 description 10
- 235000019322 gelatine Nutrition 0.000 description 10
- 235000011852 gelatine desserts Nutrition 0.000 description 10
- 238000001727 in vivo Methods 0.000 description 10
- 210000001519 tissue Anatomy 0.000 description 10
- 238000002965 ELISA Methods 0.000 description 9
- 206010027458 Metastases to lung Diseases 0.000 description 9
- 238000003556 assay Methods 0.000 description 9
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 9
- 238000002513 implantation Methods 0.000 description 9
- 230000008595 infiltration Effects 0.000 description 9
- 238000001764 infiltration Methods 0.000 description 9
- 238000011081 inoculation Methods 0.000 description 9
- 239000002904 solvent Substances 0.000 description 9
- QGVQZRDQPDLHHV-DPAQBDIFSA-N (3s,8s,9s,10r,13r,14s,17r)-10,13-dimethyl-17-[(2r)-6-methylheptan-2-yl]-2,3,4,7,8,9,11,12,14,15,16,17-dodecahydro-1h-cyclopenta[a]phenanthrene-3-thiol Chemical compound C1C=C2C[C@@H](S)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 QGVQZRDQPDLHHV-DPAQBDIFSA-N 0.000 description 8
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 8
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Polymers OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 8
- UIIMBOGNXHQVGW-UHFFFAOYSA-M Sodium bicarbonate Chemical compound [Na+].OC([O-])=O UIIMBOGNXHQVGW-UHFFFAOYSA-M 0.000 description 8
- 241000700605 Viruses Species 0.000 description 8
- 230000002942 anti-growth Effects 0.000 description 8
- 210000003743 erythrocyte Anatomy 0.000 description 8
- 238000002649 immunization Methods 0.000 description 8
- 201000001441 melanoma Diseases 0.000 description 8
- 230000008569 process Effects 0.000 description 8
- 230000004044 response Effects 0.000 description 8
- 238000011282 treatment Methods 0.000 description 8
- 238000011746 C57BL/6J (JAX™ mouse strain) Methods 0.000 description 7
- 241000282412 Homo Species 0.000 description 7
- 241001529936 Murinae Species 0.000 description 7
- 239000002253 acid Substances 0.000 description 7
- 238000007792 addition Methods 0.000 description 7
- 230000005875 antibody response Effects 0.000 description 7
- 239000000427 antigen Substances 0.000 description 7
- 102000036639 antigens Human genes 0.000 description 7
- 108091007433 antigens Proteins 0.000 description 7
- 230000006378 damage Effects 0.000 description 7
- 210000000987 immune system Anatomy 0.000 description 7
- 239000012528 membrane Substances 0.000 description 7
- 210000004379 membrane Anatomy 0.000 description 7
- 239000000725 suspension Substances 0.000 description 7
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 6
- 238000012286 ELISA Assay Methods 0.000 description 6
- 239000000872 buffer Substances 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 230000014509 gene expression Effects 0.000 description 6
- 238000010348 incorporation Methods 0.000 description 6
- 208000015181 infectious disease Diseases 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 239000000463 material Substances 0.000 description 6
- 239000011159 matrix material Substances 0.000 description 6
- VLKZOEOYAKHREP-UHFFFAOYSA-N n-Hexane Chemical compound CCCCCC VLKZOEOYAKHREP-UHFFFAOYSA-N 0.000 description 6
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 6
- 238000011160 research Methods 0.000 description 6
- 238000004809 thin layer chromatography Methods 0.000 description 6
- 241000238631 Hexapoda Species 0.000 description 5
- 108010038512 Platelet-Derived Growth Factor Proteins 0.000 description 5
- 102000010780 Platelet-Derived Growth Factor Human genes 0.000 description 5
- 238000002835 absorbance Methods 0.000 description 5
- 230000000735 allogeneic effect Effects 0.000 description 5
- 230000015572 biosynthetic process Effects 0.000 description 5
- 238000001516 cell proliferation assay Methods 0.000 description 5
- 239000003814 drug Substances 0.000 description 5
- 239000012091 fetal bovine serum Substances 0.000 description 5
- 239000012530 fluid Substances 0.000 description 5
- 239000011888 foil Substances 0.000 description 5
- 210000004408 hybridoma Anatomy 0.000 description 5
- 230000036571 hydration Effects 0.000 description 5
- 238000006703 hydration reaction Methods 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 238000001990 intravenous administration Methods 0.000 description 5
- 239000010410 layer Substances 0.000 description 5
- 210000000265 leukocyte Anatomy 0.000 description 5
- 230000007246 mechanism Effects 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 230000001394 metastastic effect Effects 0.000 description 5
- 229920000747 poly(lactic acid) Polymers 0.000 description 5
- 230000009467 reduction Effects 0.000 description 5
- 230000028327 secretion Effects 0.000 description 5
- 239000008223 sterile water Substances 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 230000001225 therapeutic effect Effects 0.000 description 5
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 4
- 102000004190 Enzymes Human genes 0.000 description 4
- 108090000790 Enzymes Proteins 0.000 description 4
- 229910004373 HOAc Inorganic materials 0.000 description 4
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 4
- 108010025020 Nerve Growth Factor Proteins 0.000 description 4
- 102000015336 Nerve Growth Factor Human genes 0.000 description 4
- 239000002870 angiogenesis inducing agent Substances 0.000 description 4
- 238000010171 animal model Methods 0.000 description 4
- 210000002469 basement membrane Anatomy 0.000 description 4
- 230000009260 cross reactivity Effects 0.000 description 4
- 239000010432 diamond Substances 0.000 description 4
- 235000014113 dietary fatty acids Nutrition 0.000 description 4
- 229930195729 fatty acid Natural products 0.000 description 4
- 239000000194 fatty acid Substances 0.000 description 4
- 150000004665 fatty acids Chemical class 0.000 description 4
- 239000012362 glacial acetic acid Substances 0.000 description 4
- 230000002440 hepatic effect Effects 0.000 description 4
- 239000007943 implant Substances 0.000 description 4
- 230000001965 increasing effect Effects 0.000 description 4
- JVTAAEKCZFNVCJ-UHFFFAOYSA-N lactic acid Chemical compound CC(O)C(O)=O JVTAAEKCZFNVCJ-UHFFFAOYSA-N 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 238000012986 modification Methods 0.000 description 4
- 230000004048 modification Effects 0.000 description 4
- 229940053128 nerve growth factor Drugs 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 230000001717 pathogenic effect Effects 0.000 description 4
- 108010091742 peptide F Proteins 0.000 description 4
- RJSZPKZQGIKVAU-UXBJKDEOSA-N peptide f Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CCCCN)NC(=O)CNC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCSC)NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C(C)C)C(C)C)C1=CC=CC=C1 RJSZPKZQGIKVAU-UXBJKDEOSA-N 0.000 description 4
- 108010005636 polypeptide C Proteins 0.000 description 4
- 230000002685 pulmonary effect Effects 0.000 description 4
- 238000000746 purification Methods 0.000 description 4
- 208000011581 secondary neoplasm Diseases 0.000 description 4
- 229910000030 sodium bicarbonate Inorganic materials 0.000 description 4
- 235000017557 sodium bicarbonate Nutrition 0.000 description 4
- 239000006228 supernatant Substances 0.000 description 4
- 230000005748 tumor development Effects 0.000 description 4
- 210000003462 vein Anatomy 0.000 description 4
- PCFGFYKGPMQDBX-FEKONODYSA-N 78355-50-7 Chemical compound C([C@@H](C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C(C)C)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)NCC(=O)NCC(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CC(C)C)C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=CC=C1 PCFGFYKGPMQDBX-FEKONODYSA-N 0.000 description 3
- 241000283707 Capra Species 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- 101001052035 Homo sapiens Fibroblast growth factor 2 Proteins 0.000 description 3
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 3
- 108090000723 Insulin-Like Growth Factor I Proteins 0.000 description 3
- 108010063738 Interleukins Proteins 0.000 description 3
- 102000015696 Interleukins Human genes 0.000 description 3
- 229930182816 L-glutamine Natural products 0.000 description 3
- 108010046938 Macrophage Colony-Stimulating Factor Proteins 0.000 description 3
- 102000007651 Macrophage Colony-Stimulating Factor Human genes 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 210000001744 T-lymphocyte Anatomy 0.000 description 3
- 108010009583 Transforming Growth Factors Proteins 0.000 description 3
- 102000009618 Transforming Growth Factors Human genes 0.000 description 3
- 150000007513 acids Chemical class 0.000 description 3
- HAXFWIACAGNFHA-UHFFFAOYSA-N aldrithiol Chemical compound C=1C=CC=NC=1SSC1=CC=CC=N1 HAXFWIACAGNFHA-UHFFFAOYSA-N 0.000 description 3
- 230000000259 anti-tumor effect Effects 0.000 description 3
- 230000004071 biological effect Effects 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 239000011575 calcium Substances 0.000 description 3
- 229910002091 carbon monoxide Inorganic materials 0.000 description 3
- 238000005119 centrifugation Methods 0.000 description 3
- 238000002512 chemotherapy Methods 0.000 description 3
- 230000001684 chronic effect Effects 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 238000004132 cross linking Methods 0.000 description 3
- 235000018417 cysteine Nutrition 0.000 description 3
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 3
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000003247 decreasing effect Effects 0.000 description 3
- 230000001419 dependent effect Effects 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 230000003511 endothelial effect Effects 0.000 description 3
- 238000007490 hematoxylin and eosin (H&E) staining Methods 0.000 description 3
- 238000010231 histologic analysis Methods 0.000 description 3
- 210000002865 immune cell Anatomy 0.000 description 3
- 230000006698 induction Effects 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 229940047122 interleukins Drugs 0.000 description 3
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 3
- 230000003902 lesion Effects 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 230000000684 melanotic effect Effects 0.000 description 3
- 229910052751 metal Inorganic materials 0.000 description 3
- 239000002184 metal Substances 0.000 description 3
- 238000002156 mixing Methods 0.000 description 3
- 230000017066 negative regulation of growth Effects 0.000 description 3
- 108020004707 nucleic acids Proteins 0.000 description 3
- 102000039446 nucleic acids Human genes 0.000 description 3
- 230000001575 pathological effect Effects 0.000 description 3
- 108010069653 peptide E (adrenal medulla) Proteins 0.000 description 3
- 239000008363 phosphate buffer Substances 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 229920001184 polypeptide Polymers 0.000 description 3
- 239000000843 powder Substances 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 230000002062 proliferating effect Effects 0.000 description 3
- 230000001681 protective effect Effects 0.000 description 3
- 206010039073 rheumatoid arthritis Diseases 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 239000007921 spray Substances 0.000 description 3
- 238000010561 standard procedure Methods 0.000 description 3
- 230000004936 stimulating effect Effects 0.000 description 3
- 238000001356 surgical procedure Methods 0.000 description 3
- 238000013268 sustained release Methods 0.000 description 3
- 239000012730 sustained-release form Substances 0.000 description 3
- 238000003786 synthesis reaction Methods 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 238000002560 therapeutic procedure Methods 0.000 description 3
- 230000002792 vascular Effects 0.000 description 3
- 239000003981 vehicle Substances 0.000 description 3
- OVXIMRGEBNSORH-UHFFFAOYSA-N 2-[[2-[2-[[2-[[1-[1-[5-amino-2-[[2-amino-3-(1h-indol-3-yl)propanoyl]amino]-5-oxopentanoyl]pyrrolidine-2-carbonyl]pyrrolidine-2-carbonyl]amino]-5-(diaminomethylideneamino)pentanoyl]amino]propanoylamino]-5-(diaminomethylideneamino)pentanoyl]amino]-3-methylp Chemical compound CCC(C)C(C(O)=O)NC(=O)C(CCCN=C(N)N)NC(=O)C(C)NC(=O)C(CCCN=C(N)N)NC(=O)C1CCCN1C(=O)C1N(C(=O)C(CCC(N)=O)NC(=O)C(N)CC=2C3=CC=CC=C3NC=2)CCC1 OVXIMRGEBNSORH-UHFFFAOYSA-N 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 2
- CURLTUGMZLYLDI-UHFFFAOYSA-N Carbon dioxide Chemical compound O=C=O CURLTUGMZLYLDI-UHFFFAOYSA-N 0.000 description 2
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 2
- 108010071942 Colony-Stimulating Factors Proteins 0.000 description 2
- 102000007644 Colony-Stimulating Factors Human genes 0.000 description 2
- 102000004127 Cytokines Human genes 0.000 description 2
- 108090000695 Cytokines Proteins 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 108010017080 Granulocyte Colony-Stimulating Factor Proteins 0.000 description 2
- 102000004269 Granulocyte Colony-Stimulating Factor Human genes 0.000 description 2
- 108010051696 Growth Hormone Proteins 0.000 description 2
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 2
- 208000031953 Hereditary hemorrhagic telangiectasia Diseases 0.000 description 2
- 101000851058 Homo sapiens Neutrophil elastase Proteins 0.000 description 2
- 108060003951 Immunoglobulin Proteins 0.000 description 2
- 102000004218 Insulin-Like Growth Factor I Human genes 0.000 description 2
- 108010002350 Interleukin-2 Proteins 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- 208000006552 Lewis Lung Carcinoma Diseases 0.000 description 2
- 239000000232 Lipid Bilayer Substances 0.000 description 2
- 208000024556 Mendelian disease Diseases 0.000 description 2
- 241000204031 Mycoplasma Species 0.000 description 2
- 241000283973 Oryctolagus cuniculus Species 0.000 description 2
- 101800005149 Peptide B Proteins 0.000 description 2
- 241000255969 Pieris brassicae Species 0.000 description 2
- 229920000954 Polyglycolide Polymers 0.000 description 2
- 108010057464 Prolactin Proteins 0.000 description 2
- 102100024819 Prolactin Human genes 0.000 description 2
- 102100038803 Somatotropin Human genes 0.000 description 2
- 241000256251 Spodoptera frugiperda Species 0.000 description 2
- 229930182558 Sterol Natural products 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 2
- 206010046851 Uveitis Diseases 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 239000012042 active reagent Substances 0.000 description 2
- 239000000443 aerosol Substances 0.000 description 2
- 125000003277 amino group Chemical group 0.000 description 2
- 230000003698 anagen phase Effects 0.000 description 2
- 230000001028 anti-proliverative effect Effects 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 239000012298 atmosphere Substances 0.000 description 2
- 229960002685 biotin Drugs 0.000 description 2
- 235000020958 biotin Nutrition 0.000 description 2
- 239000011616 biotin Substances 0.000 description 2
- 210000001124 body fluid Anatomy 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 230000005587 bubbling Effects 0.000 description 2
- 230000009702 cancer cell proliferation Effects 0.000 description 2
- 235000011089 carbon dioxide Nutrition 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 239000006285 cell suspension Substances 0.000 description 2
- 230000036755 cellular response Effects 0.000 description 2
- 239000007979 citrate buffer Substances 0.000 description 2
- 229940047120 colony stimulating factors Drugs 0.000 description 2
- 239000002299 complementary DNA Substances 0.000 description 2
- 229920001577 copolymer Polymers 0.000 description 2
- 210000004246 corpus luteum Anatomy 0.000 description 2
- 239000006071 cream Substances 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 239000008367 deionised water Substances 0.000 description 2
- 238000012217 deletion Methods 0.000 description 2
- 230000037430 deletion Effects 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 231100000673 dose–response relationship Toxicity 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 208000001780 epistaxis Diseases 0.000 description 2
- 239000013604 expression vector Substances 0.000 description 2
- 230000002349 favourable effect Effects 0.000 description 2
- 230000001497 fibrovascular Effects 0.000 description 2
- 238000001914 filtration Methods 0.000 description 2
- 238000004108 freeze drying Methods 0.000 description 2
- 239000000122 growth hormone Substances 0.000 description 2
- 229940088597 hormone Drugs 0.000 description 2
- 239000005556 hormone Substances 0.000 description 2
- 102000052502 human ELANE Human genes 0.000 description 2
- BHEPBYXIRTUNPN-UHFFFAOYSA-N hydridophosphorus(.) (triplet) Chemical compound [PH] BHEPBYXIRTUNPN-UHFFFAOYSA-N 0.000 description 2
- FDGQSTZJBFJUBT-UHFFFAOYSA-N hypoxanthine Chemical compound O=C1NC=NC2=C1NC=N2 FDGQSTZJBFJUBT-UHFFFAOYSA-N 0.000 description 2
- 230000036039 immunity Effects 0.000 description 2
- 230000005847 immunogenicity Effects 0.000 description 2
- 102000018358 immunoglobulin Human genes 0.000 description 2
- 238000011534 incubation Methods 0.000 description 2
- 230000001939 inductive effect Effects 0.000 description 2
- 208000014674 injury Diseases 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 238000007918 intramuscular administration Methods 0.000 description 2
- 239000007928 intraperitoneal injection Substances 0.000 description 2
- 230000009545 invasion Effects 0.000 description 2
- 229910052740 iodine Inorganic materials 0.000 description 2
- 239000011630 iodine Substances 0.000 description 2
- 206010023332 keratitis Diseases 0.000 description 2
- 239000004310 lactic acid Substances 0.000 description 2
- 235000014655 lactic acid Nutrition 0.000 description 2
- 208000037841 lung tumor Diseases 0.000 description 2
- 210000002751 lymph Anatomy 0.000 description 2
- 239000002609 medium Substances 0.000 description 2
- 150000002739 metals Chemical class 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 230000011278 mitosis Effects 0.000 description 2
- 230000014399 negative regulation of angiogenesis Effects 0.000 description 2
- 230000010046 negative regulation of endothelial cell proliferation Effects 0.000 description 2
- 244000052769 pathogen Species 0.000 description 2
- 108010091748 peptide A Proteins 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 239000006187 pill Substances 0.000 description 2
- 238000003825 pressing Methods 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- 230000000750 progressive effect Effects 0.000 description 2
- 229940097325 prolactin Drugs 0.000 description 2
- 230000000644 propagated effect Effects 0.000 description 2
- 238000001953 recrystallisation Methods 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 238000009877 rendering Methods 0.000 description 2
- 229920002477 rna polymer Polymers 0.000 description 2
- 239000004576 sand Substances 0.000 description 2
- 201000000306 sarcoidosis Diseases 0.000 description 2
- 210000004116 schwann cell Anatomy 0.000 description 2
- 238000012216 screening Methods 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- 210000004989 spleen cell Anatomy 0.000 description 2
- 150000003432 sterols Chemical class 0.000 description 2
- 235000003702 sterols Nutrition 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 208000006379 syphilis Diseases 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 150000003573 thiols Chemical class 0.000 description 2
- 230000000699 topical effect Effects 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000008733 trauma Effects 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 239000013598 vector Substances 0.000 description 2
- 238000003260 vortexing Methods 0.000 description 2
- 238000005406 washing Methods 0.000 description 2
- WWYNJERNGUHSAO-XUDSTZEESA-N (+)-Norgestrel Chemical group O=C1CC[C@@H]2[C@H]3CC[C@](CC)([C@](CC4)(O)C#C)[C@@H]4[C@@H]3CCC2=C1 WWYNJERNGUHSAO-XUDSTZEESA-N 0.000 description 1
- KIUKXJAPPMFGSW-DNGZLQJQSA-N (2S,3S,4S,5R,6R)-6-[(2S,3R,4R,5S,6R)-3-Acetamido-2-[(2S,3S,4R,5R,6R)-6-[(2R,3R,4R,5S,6R)-3-acetamido-2,5-dihydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-2-carboxy-4,5-dihydroxyoxan-3-yl]oxy-5-hydroxy-6-(hydroxymethyl)oxan-4-yl]oxy-3,4,5-trihydroxyoxane-2-carboxylic acid Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-DNGZLQJQSA-N 0.000 description 1
- KUHSEZKIEJYEHN-BXRBKJIMSA-N (2s)-2-amino-3-hydroxypropanoic acid;(2s)-2-aminopropanoic acid Chemical compound C[C@H](N)C(O)=O.OC[C@H](N)C(O)=O KUHSEZKIEJYEHN-BXRBKJIMSA-N 0.000 description 1
- PSLCKQYQNVNTQI-BHFSHLQUSA-N (2s)-2-aminobutanedioic acid;(2s)-2-aminopentanedioic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O.OC(=O)[C@@H](N)CCC(O)=O PSLCKQYQNVNTQI-BHFSHLQUSA-N 0.000 description 1
- XOYXESIZZFUVRD-UVSAJTFZSA-N (2s,3s,4r,5s,6s)-6-[(2r,3r,4r,5s,6r)-6-[(2r,3s,4r,5s,6r)-5-acetamido-6-[(2r,3r,4r,5s,6r)-4-acetyloxy-6-[(2r,3r,4r,5s,6r)-4-acetyloxy-6-[(2r,3r,4r,5s,6s)-4-acetyloxy-5-hydroxy-2-(hydroxymethyl)-6-methoxyoxan-3-yl]oxy-5-hydroxy-2-(hydroxymethyl)oxan-3-yl]ox Chemical compound CC(=O)O[C@@H]1[C@H](O)[C@@H](OC)O[C@H](CO)[C@H]1O[C@@H]1[C@@H](O)[C@@H](OC(C)=O)[C@H](O[C@@H]2[C@H]([C@@H](OC(C)=O)[C@H](O[C@@H]3[C@H]([C@@H](O)[C@H](O[C@@H]4[C@H]([C@@H](OC(C)=O)[C@H](O[C@@H]5[C@H]([C@@H](OC(C)=O)[C@H](O[C@@H]6[C@H]([C@@H](OC(C)=O)[C@H](O[C@@H]7[C@H]([C@@H](OC(C)=O)[C@H](OC)[C@@H](CO)O7)O)[C@@H](CO)O6)O)[C@H](O5)C(O)=O)O)[C@@H](CO)O4)O)[C@@H](CO)O3)NC(C)=O)[C@@H](CO)O2)O)[C@@H](CO)O1 XOYXESIZZFUVRD-UVSAJTFZSA-N 0.000 description 1
- KPYXMALABCDPGN-HYOZMBHHSA-N (4s)-5-[[(2s)-6-amino-1-[[(2s,3s)-1-[[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2s)-1-[[(2r)-1-[[2-[[2-[[(1s)-3-amino-1-carboxy-3-oxopropyl]amino]-2-oxoethyl]amino]-2-oxoethyl]amino]-1-oxo-3-sulfanylpropan-2-yl]amino]-4-methyl-1-oxopentan-2-yl]amino]-1-oxopropan-2-yl]a Chemical compound NC(=O)C[C@@H](C(O)=O)NC(=O)CNC(=O)CNC(=O)[C@H](CS)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)CC)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN)CC1=CC=C(O)C=C1 KPYXMALABCDPGN-HYOZMBHHSA-N 0.000 description 1
- BMGWZHWESYHXHC-UHFFFAOYSA-N 2-amino-3-methylpentanoic acid;2-amino-4-methylpentanoic acid Chemical compound CCC(C)C(N)C(O)=O.CC(C)CC(N)C(O)=O BMGWZHWESYHXHC-UHFFFAOYSA-N 0.000 description 1
- GHCZTIFQWKKGSB-UHFFFAOYSA-N 2-hydroxypropane-1,2,3-tricarboxylic acid;phosphoric acid Chemical compound OP(O)(O)=O.OC(=O)CC(O)(C(O)=O)CC(O)=O GHCZTIFQWKKGSB-UHFFFAOYSA-N 0.000 description 1
- TVZGACDUOSZQKY-LBPRGKRZSA-N 4-aminofolic acid Chemical compound C1=NC2=NC(N)=NC(N)=C2N=C1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 TVZGACDUOSZQKY-LBPRGKRZSA-N 0.000 description 1
- QWVRTSZDKPRPDF-UHFFFAOYSA-N 5-(piperidin-1-ylmethyl)-3-pyridin-3-yl-5,6-dihydro-2h-1,2,4-oxadiazine Chemical compound C1CCCCN1CC(N=1)CONC=1C1=CC=CN=C1 QWVRTSZDKPRPDF-UHFFFAOYSA-N 0.000 description 1
- SQDAZGGFXASXDW-UHFFFAOYSA-N 5-bromo-2-(trifluoromethoxy)pyridine Chemical compound FC(F)(F)OC1=CC=C(Br)C=N1 SQDAZGGFXASXDW-UHFFFAOYSA-N 0.000 description 1
- WOVKYSAHUYNSMH-RRKCRQDMSA-N 5-bromodeoxyuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(Br)=C1 WOVKYSAHUYNSMH-RRKCRQDMSA-N 0.000 description 1
- 102100028187 ATP-binding cassette sub-family C member 6 Human genes 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 206010001257 Adenoviral conjunctivitis Diseases 0.000 description 1
- 102400000068 Angiostatin Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 208000031295 Animal disease Diseases 0.000 description 1
- 206010003226 Arteriovenous fistula Diseases 0.000 description 1
- 206010003445 Ascites Diseases 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- 201000001320 Atherosclerosis Diseases 0.000 description 1
- 206010003645 Atopy Diseases 0.000 description 1
- 241001367049 Autographa Species 0.000 description 1
- 208000035143 Bacterial infection Diseases 0.000 description 1
- 206010044583 Bartonella Infections Diseases 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 201000004569 Blindness Diseases 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 241001227713 Chiron Species 0.000 description 1
- 229920001287 Chondroitin sulfate Polymers 0.000 description 1
- 208000005590 Choroidal Neovascularization Diseases 0.000 description 1
- 206010060823 Choroidal neovascularisation Diseases 0.000 description 1
- 208000002691 Choroiditis Diseases 0.000 description 1
- 206010009900 Colitis ulcerative Diseases 0.000 description 1
- 108010035532 Collagen Proteins 0.000 description 1
- 102000008186 Collagen Human genes 0.000 description 1
- 206010011017 Corneal graft rejection Diseases 0.000 description 1
- 206010055665 Corneal neovascularisation Diseases 0.000 description 1
- 206010013774 Dry eye Diseases 0.000 description 1
- 239000012983 Dulbecco’s minimal essential medium Substances 0.000 description 1
- 206010013975 Dyspnoeas Diseases 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 208000019878 Eales disease Diseases 0.000 description 1
- 241000725630 Ectromelia virus Species 0.000 description 1
- 201000009273 Endometriosis Diseases 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 108010041308 Endothelial Growth Factors Proteins 0.000 description 1
- UOACKFBJUYNSLK-XRKIENNPSA-N Estradiol Cypionate Chemical compound O([C@H]1CC[C@H]2[C@H]3[C@@H](C4=CC=C(O)C=C4CC3)CC[C@@]21C)C(=O)CCC1CCCC1 UOACKFBJUYNSLK-XRKIENNPSA-N 0.000 description 1
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 1
- 102100031706 Fibroblast growth factor 1 Human genes 0.000 description 1
- 102000020897 Formins Human genes 0.000 description 1
- 108091022623 Formins Proteins 0.000 description 1
- 101000993347 Gallus gallus Ciliary neurotrophic factor Proteins 0.000 description 1
- 208000012671 Gastrointestinal haemorrhages Diseases 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 208000028782 Hereditary disease Diseases 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 208000007514 Herpes zoster Diseases 0.000 description 1
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 description 1
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 description 1
- 201000002563 Histoplasmosis Diseases 0.000 description 1
- 101500025915 Homo sapiens Angiostatin Proteins 0.000 description 1
- 101000793686 Homo sapiens Azurocidin Proteins 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 206010051151 Hyperviscosity syndrome Diseases 0.000 description 1
- UGQMRVRMYYASKQ-UHFFFAOYSA-N Hypoxanthine nucleoside Natural products OC1C(O)C(CO)OC1N1C(NC=NC2=O)=C2N=C1 UGQMRVRMYYASKQ-UHFFFAOYSA-N 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 208000026350 Inborn Genetic disease Diseases 0.000 description 1
- 108090001117 Insulin-Like Growth Factor II Proteins 0.000 description 1
- 102000048143 Insulin-Like Growth Factor II Human genes 0.000 description 1
- 102000005755 Intercellular Signaling Peptides and Proteins Human genes 0.000 description 1
- 108010070716 Intercellular Signaling Peptides and Proteins Proteins 0.000 description 1
- 108010002386 Interleukin-3 Proteins 0.000 description 1
- 108090000978 Interleukin-4 Proteins 0.000 description 1
- 108010002616 Interleukin-5 Proteins 0.000 description 1
- 108090001005 Interleukin-6 Proteins 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- 108090001007 Interleukin-8 Proteins 0.000 description 1
- 108010002335 Interleukin-9 Proteins 0.000 description 1
- 229910021578 Iron(III) chloride Inorganic materials 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- 102000003855 L-lactate dehydrogenase Human genes 0.000 description 1
- 108700023483 L-lactate dehydrogenases Proteins 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 206010024612 Lipoma Diseases 0.000 description 1
- 208000016604 Lyme disease Diseases 0.000 description 1
- 206010025412 Macular dystrophy congenital Diseases 0.000 description 1
- 241001480512 Mammalian orthoreovirus 3 Species 0.000 description 1
- 241000702623 Minute virus of mice Species 0.000 description 1
- 208000024599 Mooren ulcer Diseases 0.000 description 1
- 241000701168 Murine adenovirus 1 Species 0.000 description 1
- 241000711466 Murine hepatitis virus Species 0.000 description 1
- 241000711941 Murine orthopneumovirus Species 0.000 description 1
- 241000711408 Murine respirovirus Species 0.000 description 1
- 206010062207 Mycobacterial infection Diseases 0.000 description 1
- HRNLUBSXIHFDHP-UHFFFAOYSA-N N-(2-aminophenyl)-4-[[[4-(3-pyridinyl)-2-pyrimidinyl]amino]methyl]benzamide Chemical compound NC1=CC=CC=C1NC(=O)C(C=C1)=CC=C1CNC1=NC=CC(C=2C=NC=CC=2)=N1 HRNLUBSXIHFDHP-UHFFFAOYSA-N 0.000 description 1
- 208000003788 Neoplasm Micrometastasis Diseases 0.000 description 1
- 102400000058 Neuregulin-1 Human genes 0.000 description 1
- 108090000556 Neuregulin-1 Proteins 0.000 description 1
- 102000002111 Neuropilin Human genes 0.000 description 1
- 108050009450 Neuropilin Proteins 0.000 description 1
- 108091028043 Nucleic acid sequence Proteins 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 208000010191 Osteitis Deformans Diseases 0.000 description 1
- 208000027868 Paget disease Diseases 0.000 description 1
- 241001111421 Pannus Species 0.000 description 1
- 208000004788 Pars Planitis Diseases 0.000 description 1
- 208000034038 Pathologic Neovascularization Diseases 0.000 description 1
- 206010035226 Plasma cell myeloma Diseases 0.000 description 1
- 208000002151 Pleural effusion Diseases 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 208000003971 Posterior uveitis Diseases 0.000 description 1
- 208000002158 Proliferative Vitreoretinopathy Diseases 0.000 description 1
- 208000010362 Protozoan Infections Diseases 0.000 description 1
- 201000004613 Pseudoxanthoma elasticum Diseases 0.000 description 1
- 201000002154 Pterygium Diseases 0.000 description 1
- 206010056342 Pulmonary mass Diseases 0.000 description 1
- 208000007135 Retinal Neovascularization Diseases 0.000 description 1
- 206010038848 Retinal detachment Diseases 0.000 description 1
- 206010038910 Retinitis Diseases 0.000 description 1
- 206010038934 Retinopathy proliferative Diseases 0.000 description 1
- 206010039705 Scleritis Diseases 0.000 description 1
- BQCADISMDOOEFD-UHFFFAOYSA-N Silver Chemical compound [Ag] BQCADISMDOOEFD-UHFFFAOYSA-N 0.000 description 1
- 208000021386 Sjogren Syndrome Diseases 0.000 description 1
- 102000013275 Somatomedins Human genes 0.000 description 1
- 108010090804 Streptavidin Proteins 0.000 description 1
- 238000000692 Student's t-test Methods 0.000 description 1
- 239000004830 Super Glue Substances 0.000 description 1
- 206010042971 T-cell lymphoma Diseases 0.000 description 1
- 208000018656 Terrien marginal degeneration Diseases 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 201000005485 Toxoplasmosis Diseases 0.000 description 1
- 102000004142 Trypsin Human genes 0.000 description 1
- 108090000631 Trypsin Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 1
- 201000006704 Ulcerative Colitis Diseases 0.000 description 1
- 206010064996 Ulcerative keratitis Diseases 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 102000009524 Vascular Endothelial Growth Factor A Human genes 0.000 description 1
- 208000010011 Vitamin A Deficiency Diseases 0.000 description 1
- 206010047663 Vitritis Diseases 0.000 description 1
- 206010052428 Wound Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 238000002679 ablation Methods 0.000 description 1
- 229960005327 acemannan Drugs 0.000 description 1
- 230000009471 action Effects 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 206010064930 age-related macular degeneration Diseases 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 229960003896 aminopterin Drugs 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 230000002788 anti-peptide Effects 0.000 description 1
- 238000011319 anticancer therapy Methods 0.000 description 1
- 230000030741 antigen processing and presentation Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 108010062796 arginyllysine Proteins 0.000 description 1
- 210000001367 artery Anatomy 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- 230000003305 autocrine Effects 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 208000022362 bacterial infectious disease Diseases 0.000 description 1
- 206010004145 bartonellosis Diseases 0.000 description 1
- 239000007640 basal medium Substances 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 239000000560 biocompatible material Substances 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 230000008033 biological extinction Effects 0.000 description 1
- 230000008827 biological function Effects 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000001775 bruch membrane Anatomy 0.000 description 1
- 244000309464 bull Species 0.000 description 1
- 229920005549 butyl rubber Polymers 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 230000005907 cancer growth Effects 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 210000000845 cartilage Anatomy 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 210000001175 cerebrospinal fluid Anatomy 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000012412 chemical coupling Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 150000001841 cholesterols Chemical class 0.000 description 1
- 210000001612 chondrocyte Anatomy 0.000 description 1
- 229940059329 chondroitin sulfate Drugs 0.000 description 1
- 208000037976 chronic inflammation Diseases 0.000 description 1
- 230000006020 chronic inflammation Effects 0.000 description 1
- 229920001436 collagen Polymers 0.000 description 1
- 229960005188 collagen Drugs 0.000 description 1
- 238000004440 column chromatography Methods 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 238000006482 condensation reaction Methods 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 210000004087 cornea Anatomy 0.000 description 1
- 201000000159 corneal neovascularization Diseases 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 230000021953 cytokinesis Effects 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000007547 defect Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000003412 degenerative effect Effects 0.000 description 1
- 229910003460 diamond Inorganic materials 0.000 description 1
- 238000004090 dissolution Methods 0.000 description 1
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 210000002257 embryonic structure Anatomy 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 206010014599 encephalitis Diseases 0.000 description 1
- 210000004696 endometrium Anatomy 0.000 description 1
- 210000003038 endothelium Anatomy 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 1
- 208000021373 epidemic keratoconjunctivitis Diseases 0.000 description 1
- 230000003628 erosive effect Effects 0.000 description 1
- 150000002148 esters Chemical class 0.000 description 1
- FGBJXOREULPLGL-UHFFFAOYSA-N ethyl cyanoacrylate Chemical compound CCOC(=O)C(=C)C#N FGBJXOREULPLGL-UHFFFAOYSA-N 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 210000003722 extracellular fluid Anatomy 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 208000030533 eye disease Diseases 0.000 description 1
- 230000008175 fetal development Effects 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 230000002496 gastric effect Effects 0.000 description 1
- 208000030304 gastrointestinal bleeding Diseases 0.000 description 1
- 238000001502 gel electrophoresis Methods 0.000 description 1
- 238000001415 gene therapy Methods 0.000 description 1
- 230000008570 general process Effects 0.000 description 1
- 239000011521 glass Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- PEDCQBHIVMGVHV-UHFFFAOYSA-N glycerol Substances OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 1
- 208000037824 growth disorder Diseases 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 230000002962 histologic effect Effects 0.000 description 1
- 230000036732 histological change Effects 0.000 description 1
- 230000003284 homeostatic effect Effects 0.000 description 1
- 239000000710 homodimer Substances 0.000 description 1
- 102000043635 human AZU1 Human genes 0.000 description 1
- 230000008348 humoral response Effects 0.000 description 1
- 208000013653 hyalitis Diseases 0.000 description 1
- 229920002674 hyaluronan Polymers 0.000 description 1
- 229960003160 hyaluronic acid Drugs 0.000 description 1
- 230000000887 hydrating effect Effects 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 125000001841 imino group Chemical group [H]N=* 0.000 description 1
- 230000009851 immunogenic response Effects 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 230000000415 inactivating effect Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000016507 interphase Effects 0.000 description 1
- 210000002977 intracellular fluid Anatomy 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000010253 intravenous injection Methods 0.000 description 1
- RBTARNINKXHZNM-UHFFFAOYSA-K iron trichloride Chemical compound Cl[Fe](Cl)Cl RBTARNINKXHZNM-UHFFFAOYSA-K 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 230000035984 keratolysis Effects 0.000 description 1
- 230000002197 limbic effect Effects 0.000 description 1
- 206010025135 lupus erythematosus Diseases 0.000 description 1
- 210000004880 lymph fluid Anatomy 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 230000001926 lymphatic effect Effects 0.000 description 1
- 230000000527 lymphocytic effect Effects 0.000 description 1
- 230000003211 malignant effect Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 208000027202 mammary Paget disease Diseases 0.000 description 1
- 208000037819 metastatic cancer Diseases 0.000 description 1
- 208000011575 metastatic malignant neoplasm Diseases 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 238000000386 microscopy Methods 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 230000000116 mitigating effect Effects 0.000 description 1
- 238000004264 monolayer culture Methods 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 230000036457 multidrug resistance Effects 0.000 description 1
- 208000027531 mycobacterial infectious disease Diseases 0.000 description 1
- 201000000050 myeloid neoplasm Diseases 0.000 description 1
- 208000001491 myopia Diseases 0.000 description 1
- 230000004379 myopia Effects 0.000 description 1
- 230000009826 neoplastic cell growth Effects 0.000 description 1
- 230000001613 neoplastic effect Effects 0.000 description 1
- 208000021971 neovascular inflammatory vitreoretinopathy Diseases 0.000 description 1
- 238000006386 neutralization reaction Methods 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 230000000414 obstructive effect Effects 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 230000011164 ossification Effects 0.000 description 1
- 201000008482 osteoarthritis Diseases 0.000 description 1
- 229940094443 oxytocics prostaglandins Drugs 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000007170 pathology Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 229940023041 peptide vaccine Drugs 0.000 description 1
- 210000003668 pericyte Anatomy 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 229910052698 phosphorus Inorganic materials 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000035790 physiological processes and functions Effects 0.000 description 1
- 210000002826 placenta Anatomy 0.000 description 1
- 210000002381 plasma Anatomy 0.000 description 1
- 229920003023 plastic Polymers 0.000 description 1
- 239000004033 plastic Substances 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 229920001308 poly(aminoacid) Polymers 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 108091033319 polynucleotide Proteins 0.000 description 1
- 102000040430 polynucleotide Human genes 0.000 description 1
- 239000002157 polynucleotide Substances 0.000 description 1
- 229920001282 polysaccharide Polymers 0.000 description 1
- 239000005017 polysaccharide Substances 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000006785 proliferative vitreoretinopathy Effects 0.000 description 1
- QQONPFPTGQHPMA-UHFFFAOYSA-N propylene Natural products CC=C QQONPFPTGQHPMA-UHFFFAOYSA-N 0.000 description 1
- 125000004805 propylene group Chemical group [H]C([H])([H])C([H])([*:1])C([H])([H])[*:2] 0.000 description 1
- 150000003180 prostaglandins Chemical class 0.000 description 1
- 210000002307 prostate Anatomy 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 208000023558 pseudoxanthoma elasticum (inherited or acquired) Diseases 0.000 description 1
- 238000010926 purge Methods 0.000 description 1
- WHMDPDGBKYUEMW-UHFFFAOYSA-N pyridine-2-thiol Chemical compound SC1=CC=CC=N1 WHMDPDGBKYUEMW-UHFFFAOYSA-N 0.000 description 1
- 125000004076 pyridyl group Chemical group 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000001959 radiotherapy Methods 0.000 description 1
- 239000003642 reactive oxygen metabolite Substances 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 238000002271 resection Methods 0.000 description 1
- 239000013557 residual solvent Substances 0.000 description 1
- 210000001525 retina Anatomy 0.000 description 1
- 230000004264 retinal detachment Effects 0.000 description 1
- 230000002207 retinal effect Effects 0.000 description 1
- 210000003583 retinal pigment epithelium Anatomy 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 201000004700 rosacea Diseases 0.000 description 1
- 238000002390 rotary evaporation Methods 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 210000000582 semen Anatomy 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 201000006476 shipyard eye Diseases 0.000 description 1
- 208000007056 sickle cell anemia Diseases 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 229910052709 silver Inorganic materials 0.000 description 1
- 239000004332 silver Substances 0.000 description 1
- 239000008247 solid mixture Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 239000000021 stimulant Substances 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 239000011550 stock solution Substances 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 238000010254 subcutaneous injection Methods 0.000 description 1
- 239000007929 subcutaneous injection Substances 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 230000002459 sustained effect Effects 0.000 description 1
- 230000009897 systematic effect Effects 0.000 description 1
- 201000000596 systemic lupus erythematosus Diseases 0.000 description 1
- 238000012353 t test Methods 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 229940124597 therapeutic agent Drugs 0.000 description 1
- 238000011285 therapeutic regimen Methods 0.000 description 1
- 125000003396 thiol group Chemical group [H]S* 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 238000012549 training Methods 0.000 description 1
- 150000003626 triacylglycerols Chemical class 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- 239000012588 trypsin Substances 0.000 description 1
- 230000005747 tumor angiogenesis Effects 0.000 description 1
- 102000003390 tumor necrosis factor Human genes 0.000 description 1
- 231100000588 tumorigenic Toxicity 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 210000003606 umbilical vein Anatomy 0.000 description 1
- 241000701366 unidentified nuclear polyhedrosis viruses Species 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 230000006459 vascular development Effects 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 230000008728 vascular permeability Effects 0.000 description 1
- 230000007332 vesicle formation Effects 0.000 description 1
- 229920002554 vinyl polymer Polymers 0.000 description 1
- 238000012800 visualization Methods 0.000 description 1
- 201000007790 vitelliform macular dystrophy Diseases 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/52—Cytokines; Lymphokines; Interferons
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
- A61K38/1858—Platelet-derived growth factor [PDGF]
- A61K38/1866—Vascular endothelial growth factor [VEGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/0012—Galenical forms characterised by the site of application
- A61K9/0019—Injectable compositions; Intramuscular, intravenous, arterial, subcutaneous administration; Compositions to be administered through the skin in an invasive manner
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K9/00—Medicinal preparations characterised by special physical form
- A61K9/10—Dispersions; Emulsions
- A61K9/127—Liposomes
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P1/00—Drugs for disorders of the alimentary tract or the digestive system
- A61P1/04—Drugs for disorders of the alimentary tract or the digestive system for ulcers, gastritis or reflux esophagitis, e.g. antacids, inhibitors of acid secretion, mucosal protectants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P15/00—Drugs for genital or sexual disorders; Contraceptives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P17/00—Drugs for dermatological disorders
- A61P17/06—Antipsoriatics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P19/00—Drugs for skeletal disorders
- A61P19/02—Drugs for skeletal disorders for joint disorders, e.g. arthritis, arthrosis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P27/00—Drugs for disorders of the senses
- A61P27/02—Ophthalmic agents
- A61P27/06—Antiglaucoma agents or miotics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/04—Antineoplastic agents specific for metastasis
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P37/00—Drugs for immunological or allergic disorders
- A61P37/02—Immunomodulators
- A61P37/04—Immunostimulants
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P7/00—Drugs for disorders of the blood or the extracellular fluid
- A61P7/06—Antianaemics
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/50—Fibroblast growth factor [FGF]
- C07K14/503—Fibroblast growth factor [FGF] basic FGF [bFGF]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
Landscapes
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- Organic Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Animal Behavior & Ethology (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Engineering & Computer Science (AREA)
- Immunology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Gastroenterology & Hepatology (AREA)
- Epidemiology (AREA)
- Dermatology (AREA)
- Ophthalmology & Optometry (AREA)
- Zoology (AREA)
- Toxicology (AREA)
- Hematology (AREA)
- Oncology (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Biophysics (AREA)
- Physical Education & Sports Medicine (AREA)
- Biochemistry (AREA)
- Cardiology (AREA)
- Endocrinology (AREA)
- Diabetes (AREA)
- Dispersion Chemistry (AREA)
- Rheumatology (AREA)
- Orthopedic Medicine & Surgery (AREA)
- Reproductive Health (AREA)
- Heart & Thoracic Surgery (AREA)
- Vascular Medicine (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Description
r 1
AUSTRALIA
Patents Act 1990 ENTREMED, INC.
COMPLETE SPECIFICATION STANDARD PATENT Invention Title: Compositions and methodsfor treating cancer and hyperproliferative disorders The following statement is a full description of this invention including the best method of performing it known to us:- 1A COMPOSITIONS AND METHODS FOR TREATING CANCER AND HYPERPROLIFERATIVE
DISORDERS
00 This is a divisional of AU 33972/00 (776473), the entire contents of which are 00 oO incorporated herein by reference.
TECHNICAL FIELD SThe present invention relates to methods and compositions for preventing or reducing cancers in humans or animals. More particularly, the present invention relates to immunogenic compositions comprising growth factors, active firagments thereof, antibodies specific for growth factors, and methods of use thereof.
BACKGROUND OF THE INVENTION While many cancers are treatable by chemotherapeutic agents, a significant number of cancers are intrinsically drug resistant and others acquire resistance during or following chemotherapy. Cancers frequently are resistant to more than one type of drug. This phenomenon is called multidrug resistance or MDR. Consequently, there is a great need for compositions and methods that can be used in addition to, or as alternatives to, chemotherapy for the treatment of cancer.
A major clinical problem of cancer is metastasis. By the time that the primary tumor is identified and localized, seed cells often have escaped and migrated or metastasized to other organs in the body where they establish secondary tumors. Surgical procedures are rarely sufficient to cure a cancer because even after the primary tumor is removed multiple secondary tumors survive and proliferate. Consequently, there exists an C. ~immediate and pressing need for techniques of eradicating secondary tumors that already exist.
Cancer cells that escape the primary tumor are usually carried in the venous and lymphatic circulation until they lodge in a downstream capillary bed or lymph node. However, only 1 in 10,000 of the 00 cancer cells that escape the primary tumor survive to establish a secondary 00 tumor. Successful cancer cells are those that find a favorable environment Cc for survival and growth. The favorable environment include hormones and growth-promoting factors. Stimulating factors include local growth factors, hormones produced by the host, and autostimulating growth factors produced by the tumor cells themselves. Consequently, there is an immediate and pressing need for techniques capable of preventing or inhibiting metastasis of cancer and the formation of secondary tumors.
Additionally, many other hyperproliferative disorders exist.
Hyperproliferative disorders are caused by non-cancerous nonneoplastic) cells that overproduce in response to a particular growth factor.
Examples of such hyperproliferative disorders include diabetic retinopathy, psoriasis, endometriosis, macular degenerative disorders and benign growth disorders such as prostate enlargement and lipomas.
It is known that many new cancers are initiated, and existing cancers and hyperproliferative disorders stimulated, by growth factors that affect either the cancer cell itself, or normal tissue around the cancer that facilitate survival of the cancer cell angiogenesis factors). There is a direct correlation between the circulating level of certain growth factors and cancer proliferation. A potential method of treatment would be to regulate the level of circulating growth factors in a patient to prevent cancer initiation or recurrence, and to reduce or eliminate existing cancers. What is needed, therefore, are compositions that remove the target growth factors from circulation or inhibit the growth-promoting activity of growth factors.
Cellular proliferation is a normal ongoing process in all living organisms and is one that involves numerous factors and signals that are delicately balanced to maintain regular cellular cycles. The general process of cell division is one that consists of two sequential processes: nuclear division (mitosis), and cytoplasmic division (cytokinesis). Because organisms are continually growing and replacing cells, cellular proliferation is a central process that is vital to the normal functioning of almost all biological processes. Whether or not mammalian cells will grow and divide is determined by a variety of feedback control mechanisms, which include Sthe availability of space in which a cell can grow, and the secretion of specific stimulatory and inhibitory factors in the immediate environment.
When normal cellular proliferation is disturbed or somehow 00 disrupted, the results can affect an array of biological functions. Disruption 00 00of proliferation could be due to a myriad'of factors such as the absence or C€ overabundance of various signaling chemicals, growth factors or presence of altered environments. Some disorders characterized by abnormal cellular proliferation include cancer, abnormal development of embryos, improper ,1 ~formation of the corpus luteum, difficulty in wound healing as well as malfunctioning of inflammatory and immune responses.
Cancer is characterized by abnormal cellular proliferation.
Cancer cells exhibit a number of properties that make them dangerous to the host, often including an ability to invade other tissues and to induce capillary ingrowth, which assures that the proliferating cancer cells have an adequate supply of blood. One of the defining features of cancer cells is that they respond abnormally to control mechanisms that regulate the division of normal cells and continue to divide in a relatively uncontrolled fashion until they kill the host.
Angiogenesis and angiogenesis related diseases are closely affected by cellular proliferation and therefore cytokines and growth factors.
As used herein, the term "angiogenesis" means the generation of new blood vessels into a tissue or organ. Under normal physiological conditions, humans or animals undergo angiogenesis only in very specific restricted situations. For example, angiogenesis is normally observed in wound healing, fetal and embryonal development and formation of the corpus luteum, endometrium and placenta. The term "endothelium" is defined herein as a thin layer of flat cells that lines serous cavities, lymph vessels, and blood vessels. These cells are defined herein as "endothelial cells". The term "endothelial inhibiting activity" means the capability of a molecule to inhibit angiogenesis in general. The inhibition of endothelial cell proliferation also results in an inhibition of angiogenesis.
Both controlled and uncontrolled angiogenesis are thought to proceed in a similar manner. Endothelial cells and pericytes, surrounded by a basement membrane, form capillary blood vessels. Angiogenesis -4begins with the erosion of the basement membrane by enzymes released by endothelial cells and leukocytes. The endothelial cells, which line the lumen of blood vessels, then protrude through the basement membrane.
Angiogenic stimulants induce the endothelial cells to migrate through the eroded basement membrane. The migrating cells form a "sprout" off the 00 g parent blood vessel, where the endothelial cells undergo mitosis and 0 proliferate. The endothelial sprouts merge with each other to form capillary Sloops, creating the new blood vessel.
Persistent, unregulated angiogenesis occurs in a multiplicity of disease states, tumor metastasis and abnormal growth by endothelial cells Sand supports the pathological damage seen in these conditions. The diverse pathological disease states in which unregulated angiogenesis is present have been grouped together as angiogenic-dependent, angiogenicassociated, or angiogenic-related diseases. These diseases are a result of abnormal or undesirable cell proliferation, particularly endothelial cell proliferation.
The hypothesis that tumor growth is angiogenesisdependent was first proposed in 1971 by Judah Folkman Engl. Jour.
Med. 285:1182 1186, 1971). In its simplest terms the hypothesis proposes that expansion of tumor volume beyond a certain phase requires the induction of new capillary blood vessels. For example, pulmonary micrometastases in the early prevascular phase in mice would be undetectable except by high power microscopy on histological sections.
Further indirect evidence supporting the concept that tumor growth is angiogenesis dependent is found in U.S. Patent Nos. 5,639,725, 5,629,327, 5,792,845, 5,733,876, and 5,854,205, all of which are incorporated herein by reference.
Recent research in the field of angiogenesis has led to a current paradigm suggesting that phenotypic changes accompanying tumorassociated angiogenesis are mediated by an angiogenic switch. In the homeostatic state, a balance between inhibitors and stimulators of angiogenesis is maintained. In contrast, during neoplasia, there is a shift in this balance toward the angiogenic phenotype. This switch can be mediated by either an upregulation of endogenous angiogenic stimulatoors, such as fibroblast growth factor, vascular endothelial growth factor, or interleukins,
O
O
or the down regulation of angiogenic inhibitors, such as angiostatin or endostatin proteins.
One example of a disease mediated by angiogenesis is ocular neovascular disease. This disease is characterized by invasion of new blood vessels into the structures of the eye such as the retina or cornea.
oO It is the most common cause of blindness and is involved in approximately 00 twenty eye diseases. In age-related macular degeneration, the associated Cvisual problems are caused by an ingrowth of chorioidal capillaries through defects in Bruch's membrane with proliferation of fibrovascular tissue beneath the retinal pigment epithelium. Angiogenic damage is also CI associated with diabetic retinopathy, retinopathy of prematurity, corneal graft rejection, neovascular glaucoma and retrolental fibroplasia. Other diseases associated with corneal neovascularization include, but are not limited to, epidemic keratoconjunctivitis, Vitamin A deficiency, contact lens overwear, atopic keratitis, superior limbic keratitis, pterygium keratitis sicca, sjogrens, acne rosacea, phylectenulosis, syphilis, Mycobacteria infections, lipid degeneration, chemical bums, bacterial ulcers, fungal ulcers, Herpes simplex infections, Herpes zoster infections, protozoan infections, Kaposi sarcoma, Mooren ulcer, Terrien's marginal degeneration, mariginal keratolysis, rheumatoid arthritis, systemic lupus, polyarteritis, trauma, Wegener's sarcoidosis, Scleritis, Steven's Johnson disease, and periphigoid radial keratotomy.
Diseases associated with retinal/choroidal neovascularization include, but are not limited to, diabetic retinopathy, macular degeneration, sickle cell anemia, sarcoid, syphilis, pseudoxanthoma elasticum, Paget's disease, vein occlusion, artery occlusion, carotid obstructive disease, chronic uveitis/vitritis, mycobacterial infections, Lyme's disease, systemic lupus erythematosis, retinopathy of prematurity, Eales disease, Bechet's disease, infections causing a retinitis or choroiditis, presumed ocular histoplasmosis, Best's disease, myopia, optic pits, Stargart's disease, pars planitis, chronic retinal detachment, hyperviscosity syndromes, toxoplasmosis, trauma and post-laser complications. Other diseases include, but are not limited to, diseases associated with rubeosis (neovascularization of the angle) and diseases caused by the abnormal proliferation of fibrovascular or fibrous tissue including all forms of proliferative vitreoretinopathy.
O
O
O Another disease in which angiogenesis is believed to be involved is rheumatoid arthritis. The blood vessels in the synovial lining of Sthe joints undergo angiogenesis. In addition to forming new vascular networks, the endothelial cells release factors and reactive oxygen species that lead to pannus growth and cartilage destruction. The factors involved in 00 oo angiogenesis may actively contribute to, and help maintain, the chronically 00 inflamed state of rheumatoid arthritis.
n Factors associated with angiogenesis may also have a role in osteoarthritis. The activation of the chondrocytes by angiogenic-related factors contributes to the destruction of. the joint. At a later stage, the C angiogenic factors would promote new bone formation. Therapeutic intervention that prevents the bone destruction could halt the progress of the disease and provide relief for persons suffering with arthritis.
Chronic inflammation may also involve pathological angiogenesis. Such disease states as ulcerative colitis and Crohn's disease show histological changes with the ingrowth of new blood vessels into the inflamed tissues. Bartonellosis, a bacterial infection found in South America, can result in a chronic stage that is characterized by proliferation of vascular endothelial cells. Another pathological role associated with angiogenesis is found in atherosclerosis. The plaques formed within the lumen of blood vessels have been shown to have angiogenic stimulatory activity.
One of the most frequent angiogenic diseases of childhood is the hemangioma. In most cases, the tumors are benign and regress without intervention. In more severe cases, the tumors progress to large cavernous and infiltrative forms and create clinical complications. Systemic forms of hemangiomas, the hemangiomatoses, have a high mortality rate.
Therapy resistant hemangiomas exist that cannot be treated with therapeutics currently in use.
Angiogenesis is also responsible for damage found in hereditary diseases such as Osler-Weber-Rendu disease, or hereditary hemorrhagic telangiectasia. This is an inherited disease characterized by multiple small angiomas, tumors of blood or lymph vessels. The angiomas are found in the skin and mucous membranes, often accompanied by epistaxis (nosebleeds) or gastrointestinal bleeding and sometimes with pulmonary or hepatic arteriovenous fistula.
-I-
Thus it is clear that cellular proliferation, particularly endothelial cell proliferation, plays a major role in the pathology and growth and development of metastasis in cancer. If this abnormal or undesirable proliferation activity could be repressed, inhibited, or eliminated, then the tumor, although present, would not grow. In the disease state, prevention of 00 abnormal or undesirable cellular proliferation and angiogenesis could avert 00 the damage caused by the invasion of the new microvascular system.
Cc Therapies directed at control of the cellular proliferative processes could lead to the abrogation or mitigation of these diseases.
What is needed therefore, are compositions and methods which can inhibit abnormal or undesirable cellular proliferation related to tumors. The compositions should be able to overcome the activity of endogenous growth factors in premetastatic tumors and prevent the dissemination of cancerous cells thereby inhibiting the development of disease and the growth of tumors. The compositions should also be able to modulate the formation of capillaries in angiogenic processes. Finally, the compositions and methods for inhibiting cellular proliferation should preferably be non-toxic and produce few side effects.
SUMMARY OF THE INVENTION The present invention generally comprises methods and compositions for preventing or treating cancers. More particularly, the present invention involves immunogenic growth factor-containing compositions comprising growth factors, or active fragments thereof optionally combined with delivery vehicles. Though not wishing to be bound by the following theory, the compositions of the present invention may elicit either a cellular or immune response that results in the prevention and reduction of cancer.
The present invention provides a method of vaccinating a human or animal against growth factors that are associated with specific cancer types and hyperproliferative disorders. Certain cancers are associated with only one growth factor whereas other cancers are regulated by several growth factors. For example, certain T cell lymphomas produce the growth factor IL-2, which stimulates proliferation by autocrine action; other tumors produce factors that promote angiogenesis and stimulate q 0growth of metastatic cancer lesions by inducing vascularization of tissue at the site of metastases.
The growth factor-containing compositions of the present invention may optionally comprise delivery or carrier vehicles such as liposomes or vesicles having portions of growth factor, growth factor 00 fragments, synthetic peptides of certain epitopes of growth factors, or 00 00 modified growth factor fragments presented on their external surfaces. In c ~an alternative embodiment, a growth factor, or immunogenic fragment thereof, may be partially or totally encapsulated within a carrier such as a liposome. In another alternative embodiment of the present invention, the growth factors or active portions thereof may be transported to desired sites by delivery mechanisms comprising the use of colloidal metals such as colloidal gold. The above described compositions are useful as vaccines to induce immunity against growth factors which otherwise are recognized as "self" by the immune system and are not naturally antigenic. The compositions are further useful in therapeutic regimens for reducing the proliferation of tumor cells. Though not wishing to be bound by the.
following theory, it is thought that the resulting circulating antibodies bind growth factor and thereby prevent the initiation of cancer proliferation, reduce existing cancer, or inhibit the spread of cancers.
The present invention also comprises isolated and recombinant antibodies specific for growth factors. Isolated antibodies are produced by, and purified from humans' or animals with strong immune systems, and injected into humans or animals with weak or non-functional immune systems in need of such circulating antibodies. Thus, according to the present invention, cancers are reduced or inhibited either by active immunization of an individual using antigenic growth factor-containing compositions, or by passive immunization via administering an antibody or a group of antibodies specific for growth factor epitopes. Additionally, patients are immunized with the growth factor composition prior to the initiation or recurrence after treatment of cancer.
Accordingly, it is an object of the present invention to provide methods and compositions for reducing cancer and inhibiting tumor growth in a human or animal having cancer.
-9- It is another object of the present invention to provide methods and compositions for treating and preventing the occurrence or Sspread of cancer.
It is a further object of the present invention to provide methods and compositions for reducing cancer and inhibiting tumor growth 00 in a human or animal having cancer by eliciting an active cellular and/or 00 humoral response in the host.
Cc Another object of the present invention is to provide methods and compositions for reducing and preventing the occurrence of hyperproliferative disorders.
It is yet another object of the present invention to provide methods and compositions for vaccinating a human or animal against selected growth factors.
It is yet another object of the present invention to provide methods and compositions for passively immunizing a human or animal against selected growth factors.
Another object of the present invention is to provide growth factor-containing compositions that are antigenic and elicit an immune response against growth factor in humans or animals.
Another object of the present invention is to provide a vaccine composition comprising a growth factor that is non-immunogenic in a human or animal to be immunized with the composition, and a carrier wherein the growth factor is presented on the surface of the carrier such that the composition is rendered immunogenic for the growth factor when administered into the human or animal.
It is yet another object of the present invention to provide a growth factor containing composition wherein the growth factor comprises fibroblast (FGF), interleukins, kerotinocyte growth factor, colony stimulating factors, epidermal .growth factor (EGF), vascular endothelial growth factor (VEGF), transforming growth factors, Schwann cell-derived growth factor, nerve growth factor (NGF), platelet-derived growth factor (PDGF), insulin-like growth factors 1 and 2 (IGF-1 and IGFglial growth factor, tumor necrosis factors, prolactin, growth hormone and/or active fragments thereof.
Yet another object of the present invention is to provide growth factor peptide fragments modified with antigenic moieties to 0 0 increase an individual's response to growth factor and methods of use thereof.
0It is yet another object of the present invention to provide growth factor containing compositions wherein the carrier for the growth factor comprises a liposome.
OO
00 OO It is another object of the present invention to provide 0 0 growth factor containing compositions wherein the carrier for the growth C factor comprises a colloidal metal.
Another object of the present invention is to provide growth factor containing compositions wherein the carrier is a baculovirus-derived vesicle.
It is still another object of the present invention to provide growth factor peptide fragment-containing compositions in combination with pharmaceutically acceptable adjuvants to stimulate the immune response.
It is yet another object of the present invention to provide compositions and methods for treating diseases and processes that are mediated by angiogenesis including, but not limited to, hemangioma, solid tumors, blood borne tumors, leukemia, metastasis, telangiectasia, psoriasis, scleroderma, pyogenic grariuloma, myocardial angiogenesis, Crohn's disease, plaque neovascularization, arteriovenous malformations, corneal diseases, rubeosis, neovascular glaucoma, diabetic retinopathy, retrolental fibroplasia, arthritis, diabetic neovascularization, macular degeneration, wound healing, peptic ulcer, Helicobacter related diseases, fractures, keloids, vasculogenesis, hematopoiesis, ovulation, menstruation, placentation, and cat scratch fever.
Another object of the present invention is to provide antigrowth factor antibodies useful for passively immunizing a human or animal against growth factor.
Yet another object of the present invention is to provide growth factor containing compositions that may be administered intramuscularly, intravenously, transdermally, orally, or subcutaneously.
These and other objects, features and advantages of the present invention will become apparent after a review of the following detailed description of the disclosed embodiment and the appended claims.
r -11- 0 BRIEF DESCRIPTION OF THE FIGURES 0Figure IA is a graph showing the results of an experiment conducted to demonstrate inhibition of the growth of experimental lung metastases. Mice pretreated with either L(HBD) (bFGF peptide from the 00 heparin-binding domain conjugated to liposomes), L(RBD) (receptor 00 binding domain of bFGF conjugated to liposomes), L(LA) (empty r- liposomes) or PBS were challenged with 5X10' BI6BL6 tumor cells i.v.
Fourteen days following innoculation mice were sacrificed, lungs removed and surface pulmonary metastases counted using a dissecting microscope.
N Tumor growth was evident in all groups assayed. Mice treated with L(HBD) demonstrated 96% inhibition of surface pulmonary metastases.
Figure IB is a graph showing the results of an experiment conducted to demonstrate the inhibition of LLC-LM experimental metastases. Mice pretreated with the L(HBD) or L(LA) were challenged with 5 X 105 LLC-LM tumor cells i.v. Seventeen days following inoculation mice were sacrificed, lungs removed and lung weight assessed.
Mice treated with L(HBD) inhibited the development of pulmonary metastases by 9S%.
Figure 2 is a photograph comparing the differences in surface B 6BL6 metastases in the lungs from mice treated with liposomal lipid A ((control) top row) and mice treated with a bFGF peptide from the heparin-binding domain (bottom row).
Figure 3 is a photograph comparing the effect of vaccination using a peptide from the heparin-binding domain of bFGF on mouse lung to the effect of control vaccination on pulmonary B16BL6 growth and development.
Figure 4 is a graph showing the reactivity of serum from mice vaccinated with the heparin binding domain peptide of bFGF with whole bFGF (open square), heparin binding domain peptide bFGF (open diamond), and in comparison to normal mouse serum (NMS) (open circle).
Figure 5 is a graph showing the reactivity of serum from mice vaccinated with the receptor binding domain peptide of bFGF with whole bFGF (open square), receptor binding domain peptide (open diamond), and NMS (open circle).
-12- Figure 6A shows histological analysis of gelatin sponges removed from mice vaccinated with PBS controls, LLA controls, heparin 0binding domain peptide of bFGF and receptor binding domain peptide of bFGF. As further described in Example 9, in order to determine if vaccination against the bFGF molecule has an effect on bFGF-induced 0 vascularization, gelatin sponges containing recombinant human bFGF were 0 implanted onto the left lobe of the liver of mice following vaccination with Sthe liposomal lipid A controls, liposomes containing the heparin binding domain peptide, liposome containing the receptor binding domain peptide, or PBS. Figures 6B-6D show histological results of experiments C conducted to demonstrate the inhibition of FGF-2-induced angiogenesis.
Gelatin sponges containing FGF-2 were implanted onto the livers of mice pretreated with the L(HBD), L(RBD), or L(LA). Fourteen days following implantation, sponges were removed and sectioned for histology. (Figures 6B and 6C) Hematoxylin and eosin staining of sponges from mice treated with L(LA) or L(RBD) revealed cellular infiltration and neovascularization. H&E staining of sponges from mice treated with L(HBD) revealed a marked decrease in cellular infiltration and neovascularization.
Figure 7 shows histological analysis of gelatin sponges removed from mice vaccinated with PBS controls, LLA controls, liposomes containing heparin binding domain peptide of bFGF and liposomes containing receptor binding domain peptide of bFGF. As further described in Example 9, in order to determine if vaccination could inhibit angiogenesis induced by a tumor, gelatin sponges containing B16BL6 melanoma cells were implanted onto the liver of mice following vaccination with control liposomes (liposomal lipid liposomes linked to the heparin binding domain peptide, liposomes linked to the receptor binding domain peptide, or
PBS.
Figure 8 shows bFGF stimulated proliferation of HUVEC in the presence of bFGF peptides: control peptide (closed circle), heparin binding domain peptide of bFGF (open circle), and receptor binding domain peptide of bFGF (open square).
Figure 9 shows reproducibility of the effect shown in Figure 8: bFGF stimulated proliferation of HUVEC in the presence of bFGF
I
O
O
0 peptides, heparin binding domain peptide of bFGF (open circle), and receptor binding domain peptide of bFGF (open square).
SFigure 10 is a bar graph demonstrating the comparative effects of the heparin binding domain peptide of bFGF (HEP) or receptor binding domain peptide of bFGF (REC) on the growth of BI6BL6 tumor 00 00 cells in vitro.
00 Figure 11 is a bar graph .showing the inhibition of growth C. and development of LLC-LM metastases in mice vaccinated with the liposomes containing heparin binding domain peptide of bFGF.
Figures 12(a) and 12(b) provide graphs showing anti-bFGF C titer in serum from mice vaccinated with bFGF-liposomes or control liposomes. The data presented by the graphs represents reactivity of serum from groups of 5 vaccinated mice that was collected on day 35, pooled, serially diluted, and analyzed for reactivity to whole bFGF by measuring absorbance in an ELISA assay.
Figures 13 is a graph showing anti-bFGF titers in serum from individual mice vaccinated with bFGF-liposomes. As discussed in Example 11, C57BI/6J mice were vaccinated with liposomes containing bFGF according to the protocol outlined in the methods section. Serum from individual mice labeled B1-B5 was collected on day 35, serially diluted, and analyzed for reactivity to whole bFGF by measuring absorbance in an ELISA assay. Reactivity of serum from mice vaccinated with the liposome control was not different from the NMS. Data shown corresponds to methods and protocols of Example 11 as follows: NMS (open square with dot), mouse 1 (solid diamond), mouse 2 (solid square with white dot), mouse 3 (open diamond); mouse 4 (solid square), and mouse 5, (open square).
Figure 14 is a graph showing primary tumor size in mice vaccinated with bFGF or control liposomes 14 days after challenge. As discussed in Example 11, Balb/cByJ mice were vaccinated with liposomes containing bFGF (bFGF) or liposomes without bFGF (control) according to the protocol outlined in the methods section. On day 35 mice were challenged with 1 x 106 LLC-LM subcutaneously in the back. The data shown represent tumor volumes measured 14 days after challenge for each of 5 mice in each vaccination group.
-14- 0 SFigure 15 is a bar graph showing primary tumor size in mice vaccinated with bFGF or control liposomes 14 days after challenge. As Sdiscussed in Example 11, groups of 5 Balb/cByJ mice were vaccinated with liposomes containing bFGF (bFGF Liposome), nothing (Ctrl Liposome), or treated with PBS (PBS), according to the protocol outlined in the methods 00 section. On day 35 mice were challenged with 1 x 106 LLC-LM 00 subcutaneously in the back. The data shown is the mean tumor volume IS.D. of the mean measured 14 days after challenge for each of the three vaccination groups.
Figures are graphs demonstrating the C immunoreactivity of test peptides to autologous peptide fragments of VEGF. As discussed in Example 13, Balb/cByJ mice were vaccinated with liposomes containing VEGF peptides 1-3 incorporated in the liposome by conjugation according to the protocols outlined in the present invention.
Serum from individual mice was collected on day 35, serially diluted, and analyzed for reactivity to autologous peptide fragments of VEGF by measuring absorbance in an ELISA assay. The NMS control demonstrates the reactivity of serum from non-vaccinated mice and is not different from the reactivity of serum from mice vaccinated with a liposome control.
Figures 17(a) and 17(b) are graphs showing immunoreactivity of test peptides to autologous peptide fragments of VEGF. As discussed in Example 13, Balb/cByJ mice were vaccinated with liposomes containing VEGF peptides 2 and 3, incorporated in the liposome by simple encapsulation according to the protocols outlined in the present invention. Serum from individual mice was collected on day 35, serially diluted, and analyzed for reactivity to autologous peptide fragments of VEGF by measuring absorbance in an ELISA assay. The NMS control demonstrates the reactivity of serum from non-vaccinated mice and is not different from the reactivity of serum from mice vaccinated with a liposome control.
Figure 18 provides a graph comparing the inhibitory effects on the growth and development of B 16BL6 experimental metastasis in mice vaccinated with lipid liposomal A, VEGF peptide SEQ ID. NO: 6 and heparin binding domain peptide of bFGF.
Figure 19 provides a graph comparing the inhibitory effects of peptides corresponding to the heparin binding domain or the receptor ¢-13 binding domain of FGF-2 as applied to HUVECs in the presence of FGF-2 in a 72hr proliferation assay. Both the heparin binding and the O\ receptor binding domain peptides inhibited HUVEC proliferation on a dose dependent manner. Each point represents the mean one standard deviation.
00 00 Figure 20 is a graph showing the results of an experiment 0 0 conducted to demonstrate induction of an antibody response to the FGF-2 r- Cc heparin binding domain peptide. Mice were treated every two weeks for six weeks with FGF-2 peptides covalently conjugated to liposome vesicles.
Serum from mice treated with the heparin binding domain peptide reacted to the FGF-2 heparin binding domain peptide and the native FGF-2 molecule in an ELISA. This serum did not show immunoreactivity to the receptor binding domain peptide or other VEGF(A).
Figures 21 a-c show inhibition of B16BL6 tumor growth and angiogenesis in hepatic sponge implants. Gelatin sponges containing X 104 B16BL6 tumor cells were implanted onto the liver of mice pretreated with L(HBD), L(RBD), or L(LA). Fourteen days following implantation sponges were removed and sectioned for histology. H&E staining of sponges removed from mice treated with L(LA)(a) or L(RBD)(b) revealed B16BL6 tumor growth and neovascularization, while sponges removed from mice treated with L(HBD) (c)contained an abundance of red blood cells lacking defined structures surrounding them.
DETAILED DESCRIPTION OF THE PRESENT INVENTION The present invention may be understood more readily by reference to the following detailed description of specific embodiments included herein. Although the present invention has been described with reference to specific details of certain embodiments thereof, it is not intended that such details should be regarded as limitations upon the scope of the invention. The entire text of the references mentioned herein are hereby incorporated in their entireties by reference including U.S. Patent Application Serial Nos. 09/266,453 and 09/264,213, United States Provisional Application Serial No. 60/077,460 and United States Patent No.
5,919,459.
The present invention comprises methods and compositions for preventing or reducing cancer and hyperproliferative disorders in a -16human or animal. The immunogenic growth factor-containing compositions of the present invention include, but are not limited to, growth Sfactor containing carriers, such as liposomes and vesicles, immunogenic growth factors and peptide fragments thereof, immunogenic growth factor peptide fragments combined with adjuvants, modified growth factor peptide 00 fragments, modified growth factor peptide fragments combined with 00 00 adjuvants, carriers containing growth factor peptide fragments, and carriers CC containing modified growth factor peptide fragments. Still further, the present invention comprises antibodies and other cellular responses directed against, and specific for, growth factors. The present invention also includes ribonucleic acid sequences that code for the above proteins and the use of the ribonucleic acid sequences to transfect animals or humans to introduce the antigenic protein into the system and thereby causing the body to mount an immune response to an antigenic growth factor.
Definitions The terms "an" and "the" as used herein are defined to mean one or more and include the plural unless the context is inappropriate.
The terms "antibody" or "antibodies" as used herein include monoclonal antibodies, polyclonal, chimeric, single chain, bispecific, simianized, and humanized antibodies as well as Fab fragments, including the products of an Fab immunoglobulin expression library.
The term "antigen" refers to an entity or fragment thereof which can induce an immune response in a animal. The term includes immunogens and regions responsible for antigenicity or antigenic determinants, As used herein, the term "soluble" means partially or completely dissolved in an aqueous solution.
As employed herein, the phrase "biological activity" refers to the functionality, reactivity, and specificity of compounds that are derived from biological systems or those compounds that are reactive to them, or other compounds that mimic the functionality, reactivity, and specificity of these compounds. Examples of suitable biologically active compounds include enzymes, antibodies, antigens and proteins.
The term "bodily fluid," as used herein, includes, but is not limited to, saliva, gingival secretions, cerebrospinal fluid, gastrointestinal
-II-
Sfluid, mucous, urogenital secretions, syriovial fluid, blood, serum, plasma, urine, cystic fluid, lymph fluid, ascites, pleural effusion, interstitial fluid, intracellular fluid, ocular fluids, seminal fluid, mammary secretions, and vitreal fluid, and nasal secretions.
The phrase "consisting essentially of' is used herein to 00 00 exclude any elements that would substantially alter the essential properties 00 of the peptides to which the phrase refers. Thus, the description of a CC) peptide "consisting essentially of excludes any amino acid substitutions, additions, or deletions that would substantially alter the biological activity of that peptide.
(K The term "peptides," are chains of amino acids (typically Lamino acids) whose alpha carbons are linked through peptide bonds formed by a condensation reaction between the carboxyl group of the alpha carbon of one amino acid and the amino group of the alpha carbon of another amino acid. The terminal amino acid at one end of the chain the amino terminal) has a free amino group, while the terminal amino acid at the other end of the chain the carboxy terminal) has a free carboxyl group. As such, the term "amino terminus" (abbreviated N-terminus) refers to the free alpha-amino group on the amino acid at the amino terminal of the peptide, or to the alpha-amino group (imino group when participating in a peptide bond) of an amino acid at any other location within the peptide. Similarly, the term "carboxy terminus" (abbreviated C-terminus) refers to the free carboxyl group on the amino acid at the carboxy terminus of a peptide, or to the carboxyl group of an amino acid at any other location within the peptide.
Typically, the amino acids making up a peptide are numbered in order, starting at the amino terminal and increasing in the direction toward the carboxy terminal of the peptide. Thus, when one amino acid is said to "follow" another, that amino acid is positioned closer to the carboxy terminal of the peptide than the preceding amino acid.
The term "residue" refers to an amino acid (D or L) or an amino acid mimetic incorporated in a oligopeptide by an amide bond or amide bond mimetic. As such, the amino acid may be a naturally occurring amino acid or, unless otherwise limited, may encompass known analogs of natural amino acids that function in a manner similar to the naturally occurring amino acids amino acid mimetics). Moreover, an amide -18- 0 bond mimetic includes peptide backbone modifications well known to those skilled in the art.
Furthermore, one of skill will recognize that, as mentioned above, individual substitutions, deletions or additions which alter, add or delete a single amino acid or a small percentage of amino acids (typically 00 less than more typically less than in an encoded sequence are 00 conservatively modified variations where the alterations result in the c substitution of an amino acid with a chemically similar amino acid.
Conservative substitution tables providing functionally similar amino acids are well known in the art. The following six groups each contain amino CN acids that are conservative substitutions for one another: 1) Alanine Serine Threonine 2) Aspartic acid Glutamic acid 3) Asparagine Glutamine 4) Arginine Lysine Isoleucine Leucine Methionine Valine and; 6) Phenylalanine Tyrosine Tryptophan The phrases "isolated" or "biologically pure" refer to material which is substantially or essentially free from components which normally accompany it as found in its native state. Thus, the peptides described herein do not contain materials normally associated with their in situ environment. Typically, the isolated, antiproliferative peptides described herein are at least about 80% pure, usually at least about 90%, and preferably at least about 95% as measured by band intensity on a silver stained gel.
Protein purity or homogeneity may be indicated by a number of methods well known in the art, such as polyacrylamide gel electrophoresis of a protein sample, followed by visualization upon staining.
For certain purposes high resolution will be needed and HPLC or a similar means for purification utilized.
When the proteins and peptides of the present invention are relatively short in length less than about 50 amino acids), they are often synthesized using standard chemical peptide synthesis techniques.
Solid phase synthesis in which the C-terminal amino acid of the sequence is attached to an insoluble support followed by sequential addition of the remaining amino acids in the sequence is a preferred method z -19- Sfor the chemical synthesis of the antiproliferative peptides described herein.
Techniques for solid phase synthesis are known to those skilled in the art.
Alternatively, the antigenic peptides described herein are synthesized using recombinant nucleic acid methodology. Generally, this involves creating a nucleic acid sequence that encodes the peptide, placing 00 oO the nucleic acid in an expression cassette under the control of a particular 00 promoter, expressing the peptide in a host, isolating the expressed peptide or polypeptide and, if required, renaturing the peptide. Techniques sufficient to guide one of skill through such procedures are found in the S 10 literature.
CI Once expressed, recombinant peptides can be purified according to standard procedures, including ammonium sulfate precipitation, affinity columns, column chromatography, gel electrophoresis and the like. Substantially pure compositions of about 50 to homogeneity are preferred, and 80 to 95% or greater homogeneity are most preferred for use as therapeutic agents.
One of skill in the art will recognize that after chemical synthesis, biological expression or purification, the immunogenic peptides may possess a conformation substantially different than the native conformations of the constituent peptides. In this case, it is often necessary to denature and reduce the immunogenic peptide and then to cause the peptide to re-fold into the preferred conformation. Methods of reducing and denaturing proteins and inducing re-folding are well known to those of skill in the art.
As used herein, the term "growth factor" refers to growth factors, and polypeptide angiogenesis factors, and modified derivatives and active peptide fragments thereof. The term "growth factor" comprises: Fibroblast growth factor (FGF); Interleukins 1-12 (IL-la, P, IL-2, IL-3, IL-4, IL-5, IL-6, IL-7, IL-8, IL-9, L-10, IL-11, IL-12); Kerotinocyte growth factor; Colony stimulating factors such as, Granulocyte Colony Stimulating Factor (G-CSF), Macrophage Colony Stimulating Factor (M-CSF or CSF-1), and GM-CSF; Epidermal Growth Factor (EGF);
I
0 0 Vascular Endothelial Growth Factor (VEGF, otherwise known as Vascular Permeability Factor); O Transforming Growth Factor a (TGF-a); Transforming Growth Factor 01 through 05 (TGF-3); Schwann cell-derived Growth Factor; 00 Nerve Growth Factor (NGF); 0 Platelet-derived Growth Factor (PDGF); SInsulin-like Growth Factors 1 and 2 (IGF-1 and IGF-2); Glial Growth Factor; Tumor Necrosis Factor a and p TNF-P); Prolactin; Prostaglandins; and Growth hormone As used herein, the term "immunogenic" refers to substances which elicit or enhance the production of antibodies, T-cells and other reactive immune cells directed against an endogenous growth factor and contribute to an immune response in humans or animals.
An individual may have circulating antibodies directed against endogenous growth factors yet the individual does not experience an immune response against the growth factor. Thus, the term "nonimmunogenic" as used herein refers to endogenous growth factor in its native state which normally elicits no, or only minimal levels of, circulating antibodies, T-cells, or reactive immune cells, and which normally does not elicit in the individual an immune response against itself. An immune response occurs when an individual produces sufficient antibodies, T-cells and other reactive immune cells against administered growth factor compositions of the present invention to moderate or alleviate the cancer or hyperproliferative disorder to be treated.
The term "carrier" as used herein means a structure in which growth factor or a growth factor fragment can be incorporated into or can be associated with, thereby presenting or exposing growth factor or part of the growth factor to the immune system of a human or animal and rendering the growth factor-carrier composition antigenic for endogenous growth factor(s). The term "carrier" further comprises methods of delivery wherein growth factor or growth factor fragment compositions may be -21- Stransported to desired sites by delivery mechanisms. One example of such a delivery system utilizes colloidal metals such as colloidal gold (see 0PCT/US94/03177 filed March 18, 1994).
In addition, the term "carrier" further comprises vaccine delivery mechanisms known to those skilled in the art including, but not 00 limited to, keyhole limpet hemocyanin (KLH), bovine serum albumin (BSA) 00 00 and other adjuvants. It is also to be understood that the antigenic growth r- factor-containing compositions of the present invention can further comprise adjuvants, preservatives, diluents, emulsifiers, stabilizers, and other components that are known and used in vaccines of the prior art. Any adjuvant system known in the art can be used in the composition of the present invention. Such adjuvants include, but are not limited to, Freund's incomplete adjuvant, Freund's complete adjuvant, polydispersed B-(1,4) linked acetylated mannan ("Acemannan"), TITERMAX® (polyoxyethylenepolyoxypropylene copolymer adjuvants from CytRx Corporation), modified lipid adjuvants from Chiron Corporation, saponin derivative adjuvants from Cambridge Biotech, killed Bordetella pertussis, the lipopolysaccharide (LPS) of gram-negative bacteria, large polymeric anions such as dextran sulfate, and inorganic gels such as alum, aluminum hydroxide, or aluminum phosphate.
Carrier proteins that can be used in the antigenic growth factor-containing compositions of the present invention include, but are not limited to, maltose binding protein "MBP"; bovine serum albumin "BSA"; keyhole lympet hemocyanin "KLH"; ovalbumin; flagellin; thyroglobulin; serum albumin of any species; gamma globulin of any species; syngeneic cells; syngeneic cells bearing Ia antigens; and polymers of D- and/or Lamino acids.
Further, the term "effective amount" refers to the amount of growth factor which, when administered to a human or animal, elicits an immune response, prevents cancer, causes a reduction in cancer or inhibits the spread and proliferation of cancer. The effective amount is readily determined by one of skill in the art following routine procedures.
For example, the immunogenic growth factor compositions of the present invention may be administered parenterally or orally in a range of approximately 1.0 pLg to 1.0 mg per patient, though this range is not intended to be limiting. The actual amount of growth factor -22- 0 composition required to elicit an immune response will vary for each individual patient depending on the immunogenicity of the growth factor Scomposition administered, the condition being treated and on the immune response of the individual. Consequently, the specific amount administered to an individual will be determined by routine experimentation and based 00 00 upon the training and experience of one skilled in the art.
00 The growth factor-containing compositions of the present CC invention are used to produce antibodies directed against portions of growth factors rendered immunogenic by their presentation in the carrier.
Composition comprising growth factors combined with carriers may be Cl administered directly to patients in order to elicit an immune response.
Alternatively anti-growth factor antibodies may be administered to individuals to passively immunize them against growth factors and thereby prevent the initiation of cancer growth, reduce existing cancer or inhibit the proliferation of cancer.
In one embodiment, the present invention encompasses growth factor inserted into carriers, such as membranous carriers, so as to present on the carrier surface portions of growth factor. The growth factor normally is not immunogenic because it is recognized by the immune system as "self." However, introducing the growth factor to a host system in a carrier, for example by inserting portions of growth factor into the surface of liposomes alters the presentation of the growth factor to the immune system, rendering it immunogenic.
Immunogenic growth factor-containing liposomes may be made by reconstituting liposomes in the presence of purified or partially purified growth factor. Additionally, growth factor peptide fragments may be reconstituted into liposomes. The present invention also includes growth factor and growth factor peptide fragments modified so as to increase their antigenicity. For example, antigenic moieties and adjuvants may be attached to or admixed with the growth factor. Examples of antigenic moieties and adjuvants include, but are not limited to, lipophilic muramyl dipeptide derivatives, nonionic block polymers, aluminum hydroxide or aluminum phosphate adjuvant, and mixtures thereof.
The present invention further encompasses growth factor fragments modified with hydrophobic moieties, such as palmitic acid, that facilitate insertion into the hydrophobic lipid bilayer of a carrier.
-23- Hydrophobic moieties of the present invention may be fatty acids, triglycerides and phospholipids wherein the fatty acid carbon back bones has at least 10 carbon atoms. Most preferable are lipophilic moieties having fatty acids with a carbon backbone of at least approximately 14 carbon atoms and up to approximately 24 carbon atoms. The most preferred 00 00 hydrophobic moieties have a carbon backbone of at least 14 carbon atoms.
00 Examples of hydrophobic moieties include, but are not limited to, palmitic CC acid, stearic acid, myristic acid, lauric acid, oleic acid, linoleic acid, and linolenic acid. The most preferred hydrophobic moiety is palmitic acid.
Immunogenic compositions containing growth factor, modified growth factor, and peptide fragments thereof are administered to a human or animal to induce immunity to said growth factor. The immunized human or animal develops circulating antibodies against growth factor which bind to growth factor, thereby reducing or inactivating its ability to stimulate cancer cell proliferation.
Liposomes with growth factor inserted into the membrane, as well as other immunogenic compositions containing growth factor, also are used to produce a panel of monoclonal or polyclonal antibodies that are specific for growth factor. Antibodies are made by methods well known to those of ordinary skill in the art. Anti-growth factor antibodies bind growth factor when administered to individuals, reducing the effective circulating concentration of growth factor. Consequently, growth factordependent proliferation of cancer is preven'ted, reduced or inhibited.
The growth factor-containing compositions and anti-growth factor antibodies are administered to a human or animal by any appropriate means, preferably by injection. For example, growth factor reconstituted in liposomes is administered by subcutaneous injection. Whether internally produced or provided from external sources, the circulating anti-growth factor antibodies bind to growth factor and reduce or inactivate its ability to stimulate cancer cell proliferation.
Liposomes that can be used in the compositions of the present invention include those known to one skilled in the art. Any of the standard lipids useful for making liposomes may be used. Standard bilayer and multi-layer liposomes may be used to make compositions of the present invention. While any method of making liposomes known to one skilled in the art may be used, the most preferred liposomes are made according to the 0 method of Alving et al., Infect. Immun. 60:2438-2444, 1992, hereby incorporated by reference. The liposome can optionally contain an 0adjuvant. A preferred adjuvant is detoxified lipid A, such as monophosphoryl or diphosphoryl lipid A.
When the vesicles are liposomes, the growth factor generally 00 OO has a hydrophobic tail that inserts into the liposome membrane as it is 0 formed. Additionally, growth factor can be modified to contain a MC hydrophobic tail so that the growth factor can be inserted into the liposome.
For example, the growth factor gene is fused to a oligonucleotide sequence coding for a hydrophobic tail. The modified gene is inserted and expressed C in an expression system, using methods known in the art, yielding a growth factor fusion protein having a hydrophobic tail. Alternatively, growth factor is exposed on the surface of previously formed liposomes by chemical attachment or electroinsertion.
When the vesicles are baculovirus-derived vesicles, recombinant growth factor is expressed on the membrane of the insect cell as a natural consequence of processing by the infected insect host cell. As with the liposome embodiment described above, growth factor may be modified so that the recombinantly expressed protein contains a hydrophobic portion to facilitate insertion into the vesicle membrane.
Growth Factor Antibodies The antibodies provided herein are monoclonals or polyclonal antibodies having binding specificity for growth factors such as bFGF and VEGF, and antigenic peptides and fragments thereof. Preferred antigenic fragments comprise peptides having amino acid sequences set forth in SEQ ID NOS: 1-9. Most preferred antibodies are monoclonal antibodies, due to their higher specificity for the antigen. The antibodies are antigen specific and exhibit minimal or no crossreactivity with other growth factor proteins or peptides.
The monoclonal antibodies of the present invention are prepared by immunizing an animal, such as a mouse or rabbit, with a whole growth factor (such as bFGF) or immunogenic fragment thereof (such as the heparin binding domain peptide of bFGF). Spleen cells are harvested from the immunized animals and hybridomas generated by fusing sensitized spleen cells with a myeloma cell line, such as murine SP2/O Smyeloma cells (ATCC, Manassas, VA). The cells are induced to fuse by the addition of polyethylene glycol. Hybridomas are chemically selected by 0 plating the cells in a selection medium containing hypoxanthine, aminopterin and thymidine (HAT).
Hybridomas are subsequently screened for the ability to 00 OO produce monoclonal antibodies against specific growth factors or related 0 proteins and fragments. Growth factors and related proteins and peptides mC used for screening purposes are obtained from analyzed specimens.
Alternatively, desired growth factors may comprise recombinant peptides made according to methods known to those skilled in the art. Hybridomas N producing antibodies that bind to the growth factors or protein fragments thereof, are cloned, expanded and stored frozen for future production. The preferred hybridoma produces a monoclonal antibody having the IgG isotype, more preferably the IgGI isotype.
The polyclonal antibodies are prepared by immunizing animals, such as mice or rabbits with growth factors or protein fragments thereof as described above. Blood sera is subsequently collected from the animals, and antibodies in the sera screened for binding reactivity against the growth factor or protein fragments, preferably the antigens that are reactive with the monoclonal antibody described above.
Peptides or Protein Fragments Growth factors, peptides or fragments thereof, containing immunogenic regions can be produced from the proteins described above and tested for immunogenic activity using techniques and methods known to those skilled in the art. For example, full length recombinant bFGF (rbFGF) can be produced using the Baculovirus gene expression system.
Full length proteins can be cleaved into individual domains or digested using various methods such as, for example, the method described by Enjyoji et al. (Biochemistry 34:5725-5735 (1995)). In accordance with the method of Enjyoji et al., rbFGF is treated with a digestion enzyme, human neutrophil elastase, and the digest purified using a heparin column. Human neutrophil elastase cleaves bFGF into several fragments: one containing the heparin binding domain and the other containing the receptor binding domain. To produce additional fragments, the protein is preferably treated with a digestion compound, hydroxylamine, according to the method of -26- Balian et al. (Biochemistry 11:3798-3806 (1972)), and the digest purified using a heparin column.
SAlternatively, fragments are prepared by digesting the entire protein, or large fragments thereof exhibiting immunogenic activity, to remove one amino acid at a time. Each progressively shorter fragment is 00 then tested for immunogenic activity. Similarly, fragments of various 00 00 lengths may be synthesized and tested for immunogenic activity. By Cc increasing or decreasing the length of a fragment, one skilled in the art may determine the exact number, identity, and sequence of amino acids within the protein that are required for immunogenic activity using routine digestion, synthesis, and screening procedures known to those skilled in the art.
Desired peptides and peptide fragments may also be obtained from commercial sources such as Infinity Biotech Research and Resources (Upland, PA), or Research Genetics (Huntsville, AL).
With the increasing recognition that the progressive growth and development of a primary tumor and metastatic lesions is.
dependent on angiogenesis, considerable effort has focused on the potential therapeutic manipulation of the angiogenic compartment of a tumor. In this regard, a rationale for targeting a specific immune response to appropriate epitopes on the FGF molecule for the endogenous control of tumor growth was developed. Peptides derived from the functional domains of FGF were screened for the ability to competitively inhibit FGF stimulated proliferation of endothelial cells. Peptides that blocked endothelial cell proliferation, but not tumor cell proliferation in vitro, were selected as target antigens, covalently linked to limpid vesicles containing lipid A as an adjuvant, and used to vaccinate mice in an attempt to generate a specific immune response directed toward the angiogenic stimulator, FGF. Employing this liposome technology, the inventors of the present invention, have demonstrated that vaccination of mice with the heparin binding domain, but not the receptor binding domain, resulted in inhibition of angiogenesis in vivo and a marked decrease in the growth and development of two murine tumors in experimental metastasis models. Therefore, a reversal of the angiogenic phenotype in malignant cancers might be achieved through the inhibition of positive regulators of vascular development.
-27- C- The molecular characterization of basic and acidic fibroblast growth factors (FGFs) has confirmed the existence of two classes of O closely related angiogenic factors. Acidic and basic FGFs (hereafter aFGF and bFGF) have been identified in many molecular forms that are products of proteolytic processing at homologous sites. FGFs are associated with
OO
00 OO numerous physiological functions such as reproduction, growth, and 0 0 development. The identification of specific functional domains in the primary structure of bFGF has been examined by Baird et al. (Proc. Natl.
Acad. Sci. USA 85 (1988)), which is in herein incorporated by reference.
Basic fibroblast growth factor (bFGF) is an important NC1 stimulator of angiogenesis implicated in neoplastic progression. As demonstrated by Examples 1-15, two synthetic peptides, one derived from the heparin-binding domain, the other from the receptor binding domain of bFGF inhibited bFGF stimulated HUVEC proliferation in vitro. C57BL/6J mice were separately vaccinated with the synthetic peptides covalently conjugated to liposomal vesicles containing lipid A. Serum analysis revealed an antibody response in mice immunized with the heparin-binding domain peptide but no antibody response in mice vaccinated with control liposomes or receptor binding domain peptides conjugated to liposomes.
To determine if vaccination affects of bFGF stimulated responses in vivo, gelatin sponges containing bFGF were implanted onto livers of vaccinated mice. Histological analysis of the sponges showed absence of cellular infiltration and neovascularization of the sponges in mice vaccinated with heparin-binding domain peptide. Accordingly, growth factor vaccines comprising immunogenic, particularly heparin-binding domain peptides of bFGF, may be used to stimulate an immune response that correlates with inhibition of a bFGF stimulated in vivo response.
Vascular endothelial growth factor (VEGF) is a major regulator of angiogenesis and is involved in processes including vasculogenesis and vascular permeability. VEGF is a 40-45K homodimer and has an amino acid sequence that, in a limited fashion, is similar to that of platelet-derived growth factor (see Soker et al. Cell, 92:735-745 (1998) which is incorporated herein in its entirety). As demonstrated in Example 14, previously unidentified immunogenic fragments of VEGF may be administered to elicit an active immune response in a host resulting in the inhibition of growth of a tumor and reduction of cancer.
In accordance with the novel findings disclosed herein, growth factors such as bFGF peptides and or VEGF peptides, may be utilized in compositions suitable for treating hyperproliferative disorders such as angiogenesis-related disease and particularly cancer.
The active fragment is preferably a fragment containing an 00 immunogenic portion of a whole growth factor, or immunogenic peptides 00 thereof. Preferably, the immunogenic proteins or fragments useful for the c present invention comprise bFGF, VEGF and immunogenic fragments thereof. More preferably, the immunogenic fragment comprise peptides having the amino acid set forth in SEQ ID NOS: 1-9. Most preferably, the immunogenic peptide comprises the fragment having SEQ ID NO: 1.
Immunogenic fragments useful for the present invention comprise: Peptide A:
YCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEEGVVSIKGV
(SEQ ID NO: 1) Peptide B: SNNYNTYRSRKYSSWYVALKR (SEQ ID NO: 2) Peptide C CRTKPEKCDKPRR (SEQ. ID NO: 3) Peptide D CECRPKKDRTKPEKCDKPRR (SEQ. ID NO: 4) Peptide E APTTEGEQKSHEVIKFMDVYC (SEQ. ID NO: Peptide F
CERRKHLFVQTCKCSCKNTDSRCKARQLENERTCRCDKPRR
(SEQ. ID NO: 6) Peptide G CNDEGLESVPTEESNITMQIMRIKPH (SEQ. ID NO: 7) Peptide H CNDEGLESVPTEE (SEQ. ID NO: 8) Peptide I CEESNITMQIMRIKPH (SEQ. ID NO: 9) Peptide J:
YCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEERGVVSIKGV
(SEQ ID NO: -29- 0 Formulations SThe naturally occurring or synthetic protein, peptide, or Sprotein fragment, containing all or an active portion of an immunogenic protein or peptide can be prepared in a physiologically acceptable 00 formulation, such as in a pharmaceutically acceptable carrier, using known 00 00 techniques. For example, the protein, peptide or protein fragment is ~combined with a pharmaceutically acceptable excipient to form a therapeutic composition.
Alternatively, the gene for the protein, peptide, or protein Sfragment, containing all or an active portion of the immunogenic peptide, may be delivered in a vector for continuous administration using gene therapy techniques. The vector may be administered in a vehicle having specificity for a target site, such as a tumor.
The compositions of the present invention may be administered in the form of a solid, liquid or aerosol. Examples of solid compositions include pills, creams, and implantable dosage units. Pills may be administered orally. Therapeutic creams may be administered topically.
Implantable dosage units may be administered locally, for example, at a tumor site, or may be implanted for systematic release of the therapeutic composition, for example, subcutaneously. Examples of liquid compositions include formulations adapted for injection intramuscularly, subcutaneously, intravenously, intra-arterially, and formulations for topical and intraocular administration. Examples of aerosol formulations include inhaler formulations for administration to the lungs.
The compositions may be administered by standard routes of administration. In general, the composition may be administered by topical, oral, rectal, nasal or parenteral (for example, intravenous, subcutaneous, or intramuscular) routes. 'In addition, the composition may be incorporated into sustained release matrices such as biodegradable polymers, the polymers being implanted in the vicinity of where delivery is desired, for example, at the site of a tumor. The method includes administration of a single dose, administration of repeated doses at predetermined time intervals, and sustained administration for a predetermined period of time.
A sustained release matrix, as used herein, is a matrix made of materials, usually polymers which are degradable by enzymatic or 0\ acid/base hydrolysis or by dissolution. Once inserted into the body, the matrix is acted upon by enzymes and body fluids. The sustained release matrix desirably is chosen by biocompatible materials such as liposomes, 00 OO polylactides (polylactide acid), polyglycolide (polymer of glycolic acid), 00 polylactide co-glycolide (copolymers of lactic acid and glycolic acid), C polyanhydrides, poly(ortho)esters, polypeptides, hyaluronic acid, collagen, chondroitin sulfate, carboxylic acids, fatty acids, phospholipids, polysaccharides, nucleic acids, polyamino acids, amino acids such CN phenylalanine, tyrosine, isoleucine, polynucleotides, polyvinyl propylene, polyvinylpyrrolidone and silicone. A preferred biodegradable matrix is a matrix of one of either polylactide, polyglycolide, or polylactide coglycolide (co-polymers of lactic acid and glycolic acid).
The dosage of the composition will depend on the condition being treated, the particular composition used, and other clinical factors such as weight and condition of the patient, and the route of administration.
The composition may be administered in combination with other compositions and procedures for the treatment of diseases. For example, unwanted cell proliferation may be treated conventionally with surgery, radiation or chemotherapy in combination with the administration of the composition, and additional doses of the composition may be subsequently administered to the patient to stabilize and inhibit the growth of any residual unwanted cell proliferation.
Diseases and Conditions to be Treated The methods and compositions described herein are useful for treating human and animal diseases and processes mediated by abnormal or undesirable cellular proliferation, particularly abnormal or undesirable endothelial cell proliferation, including, but not limited to, hemangioma, solid tumors, leukemia, metastasis, telangiectasia psoriasis scleroderma, pyogenic granuloma, myocardial angiogenesis, plaque neovascularization, coreal diseases, rubeosis, neovascular glaucoma, diabetic retinopathy, retrolental fibroplasia, arthritis, diabetic neovascularization, macular degeneration, wound healing, peptic ulcer, fractures, keloids, vasculogenesis, hematopoiesis, ovulation, menstruation, -31-
O
S aand placentation. The method and composition are particularly useful for treating angiogenesis-related disorders and diseases by inhibiting \angiogenesis.
The methods and compositions described herein are particularly useful for treating cancer, arthritis, macular degeneration, and 00 00 diabetic retinopathy. Administration of the compositions to a human or 00 animal having prevascularized metastasized tumors is useful for preventing C the growth or expansion of such tumors.
The compositions and methods of the present invention are further illustrated by the following non-limiting examples, which are not to C1 be construed in any way as imposing limitations upon the scope thereof.
On the contrary, it is to be clearly understood that resort may be had to various other embodiments, modifications, and equivalents thereof which, after reading the description herein, may suggest themselves to those skilled in the art without departing from the spirit of the present invention and/or the scope of the appended claims.
EXAMPLE 1 Construction Of Growth Factor-Containing Recombinant Baculovirus The baculovirus expression vector is constructed as described in Webb, N.R. et al. (1989) Proc. Natl. Acad. Sci. USA 86, 7731- 7735, hereby incorporated by reference. A recombinant baculovirus containing cDNA encoding full-length growth factor under transcriptional regulation of the polyhedron promoter is produced by co-transfecting recombinant pAc-growth factor DNA with wild type Autographa califomica nuclear polyhedrosis virus (AcMNPV) DNA by calcium phosphate precipitation.
EXAMPLE 2 Expression And Purification Of Growth Factor The occlusion-negative viruses from Example I are plaquepurified and propagated in Spodoptera frugiperda 9 (Sf-9) cells. Infected Sf-9 cells are propagated in monolayers or suspension as described in Webb, N.R. et al. (1989) Proc. Natl. Acad. Sci. USA 86, 7731-7735.
Briefly, Sf9 cells are cultured at 27C in TNMFH medium, described by -32- Summers, M.D. and Smith, (1987) A Manual of Methods for Baculovirus Expression Vectors and Insect Cell Culture Procedures (Texas Agricultural Experiment Station, College Station, TX), Bull. 1555, Ssupplemented with 10% v/v heat-inactivated fetal bovine serum. Extraction and purification of the recombinantly expressed growth factor is performed 00 standard methods.
00 SEXAMPLE 3 Preparation Of Growth Factor-Containing Liposomes Purified growth factor is electroinserted (Mouneime, et Sal., 1990, Biochen., hereby incorporated by reference) or reconstituted into liposomes by standard methods known in the art. Incorporation of growth factors or fractions thereof into liposomes can include: rehydration of lyophilized liposomes of known lipid components in the presence of an aqueous solution of growth Sfactor (or growth factor fragments) to make single- or multilamellar liposomes with growth factor contained in the lumen.
of the liposome or trapped in the aqueous layer between lipid membranes of the multi-lamellar vesicles; electroinsertion of the growth factor or fractions thereof into reconstituted liposomes, wherein the growth factor would reside in the lumen or between lipid membranes; reconstitution of prepared liposomes of known composition with lyophilized fragments of the growth factor, each fragment containing a hydrophobic tail which inserts directly into the liposome lipid bilayer such that the peptide fragment is exposed on the external surface of the liposome; conjugation of active reagents to liposomal surfaces; and any other method of reconstitution or combination of active reagents that results in the production of an immune response (humoral or cellular) directed to a growth factor, fractions thereof, or synthetic peptides that mimic the composition and activity of a growth factor.
O
O
o EXAMPLE 4 Preparation Of Growth Factor-Containing Baculovirus Vesicles Growth factor-containing vesicles are produced as follows. Insectderived vesicles containing recombinant growth factor in their membranes 00 0O are obtained using a baculovirus-infected insect cell. More particularly, 00 Spodoptera frugiperda IPLB-Sf21-AE clonal isolate 9 (designated Sf9) Cr- insect cells are cultured and infected with recombinant baculovirus containing a cDNA encoding the full-length growth factor as described more fully in Webb et al., Proc. Natl. Acad. Sci., 86:7731-35 (1989), and N in U.S. Patent Nos. 4,745,051 and 4,879,236 both to Smith et al., which are hereby incorporated by reference. Approximately 0.8 x 106 Sf9 cells are seeded into a 1 liter Spinner flask containing Excell media (JRH Scientific, Woodland, CA 95695). The cells are incubated at 27 0 C, 50% 02 atmosphere. When the cells achieve a density of 3.5 to 4.0 million cells/ml, baculovirus containing recombinant growth factor is added at a multiplicity of 400-600 virus/cell to the media. Vesicle production commences about 24 hours after baculovirus infection. Peak vesicle formation is achieved approximately 72 hours after initial baculovirus infection. Flask contents are collected and centrifuged at approximately 1200 rpm to remove cells and debris. The supernatant containing vesicles are collected and subjected to centrifugation on 50% Percoll containing 0.1 M of sodium bicarbonate pH 8.3 at 20,000 RPM for 30 min using fixed-angle rotor. The double band is collected below an interphase between Percoll and cell culture medium and suspension is centrifuged in swing-bucket rotor at 20,000 RPM for 30 min.
Two bands may be observed at the top and the bottom of the gradient with densities of 1.05 g/ml for vesicles and 1.06 g/ml for baculovirus particles.
The vesicles have growth factor presented on their external surfaces and may be used for immunization. The vesicles are washed three times with 0.1 M sodium bicarbonate pH 8.3 using centrifugation at 20,000 RPM for min and resuspended in the same buffer.
-34- 0 EXAMPLE Immunization With Growth Factor-Containing Compositions 0\ Immunogenic growth factor-containing compositions, comprising liposomes or baculovirus-derived vesicles, are injected into a human or animal at a dosage of 1-5000 gtg per kg body weight. Antibody 00 OO titers against growth factor are determined by ELISA, using the recombinant 00 protein and horse-radish peroxidase-conjugated goat anti-human or animal C immunoglobulins, or other serologic techniques (sandwich ELISA), or biologic activity assays (such as neutralization of natural or synthetic cytokines or growth factor assays or competition assays) as presently exist or as developed specifically for individual growth factors. Booster injections are administered as needed to achieve levels of protective antibodies sufficient to reduce or neutralizb the activity of growth factors in vivo. Neutralizing titers and appropriate antibody isotypes are determined in experimental animals challenged with appropriate cancer cells.
EXAMPLE 6 Preparation And Isolation OfAnti-Growth Factor Antibodies Individuals with strong immune systems are immunized as described in Example 5. After a high titer of anti-growth factor antibody has been achieved the IgG fraction is isolated from blood and is used to passively immunize an individual as described in Example 7 below.
EXAMPLE 7 Passive Immunization Anti-growth factor antibodies isolated from the species to be passively immunized are administered by intravenous injection as a dosage level of approximately 0.5-50 mg per kg body weight. Dosage and frequency of administration are determined in experimental animals challenged with different tumor types and are adjusted for the specific type of tumor and the particular individual being treated. Important considerations are the aggressiveness of the tumor, propensity for metastatic spread, target organ for metastases, target organ vascularization/availability of tissue access for antibodies, and the stage of tumor development. While it may be true that a standard regimen can be determined that will be
O
universally protective, it may also be that effective therapy will be achieved only with individualized criterion based on tumor type.
EXAMPLE 8 Preparation of Peptide Conjugated Liposomes as 00 O0 Anti-bFGF Vaccine 00 The following methods and protocols were used for the C preparation of anti-growth factor vaccines, particularly anti-bFGF vaccine.
Selection of Peptides cN Peptides selected for use in the present invention may comprise whole growth factor proteins, or immunogenic fragments thereof.
For this example, an immunogenic peptide was selected from bFGF amino acid sequence.
Incorporation of FGF Peptides into Liposomes Liposomes consisting of dimyristoyl-glycero-3 [phosphorac-(l-glycerol)] (DMPG), dimyristoyl-glycero-3-phosphocholine (DMPC), cholesterol (Avanti Polar Lipids, Alabaster, AL), pyridyl dithiocholesterol (PDS-Chol), and lipid A (List Biological Laboratories, Inc.
Campbell, CA) were prepared in a molar ratio of 1:9:7.5:1, containing Lipid A. Lipids were mixed in a round bottom flask and solvent was removed by rotary evaporation. Multilamellar vesicles were prepared by hydrating the dried lipids in 6.4 ml of sterile water (BioWhittaker, Walkersville, MD) containing 2 mg of either the heparin binding domain peptide or the receptor binding domain peptide of FGF-2. Liposome formulations were incubated overnight at room temperature (RT) with gentle orbital shaking, lyophilized and resuspended in 2.135 ml 0.1M citrate phosphate buffer pH 5.6. Two hundred microliters of respective peptides were added to each liposome preparation, followed by incubation for 16 hr at RT on the orbital shaker. Liposomes were centrifuged at 15,000 rpm for mm at 4°C. For injection, liposomes were resuspended to a final volume of 5 ml nonpyrogenic Mg 2 and Ca 2 free PBS. Quantitation of peptide association with the liposome was achieved by amino acid analysis (MA BioServices, Rockville, MD).
-i0- 0 0 SGroups -8 total groups for the initial immunization -3 groups immunized with compositions comprising liposomes with conjugated peptides -3 groups immunized with compositions comprising liposomes with 00 OO peptides passively encapsulated 00 -1 liposomes with buffer only, lipids used for conjugated liposomes C) -1 liposomes with buffer only, lipids used from passively encapsulated -all contain lipid A 22 gLg lipid A/mole phospholipid C Immunization Treatment of Mice The animal model used for the present example consisted of Balb/CyJ mice. Five mice for each of the eight groups were used.
Specific pathogen free 5-to 7- week old C57BL/6J male mice were purchased from The Jackson Laboratory (Bar Harbor, ME).
Mice were housed in a specific pathogen free facility. In conducting the research in this report the investigators adhered to the Guide for Laboratory Animals and Care of the Institute of Laboratory Animal Resources, National Academy of Sciences, National Research Council. Cohorts of mice were treated three times at two week intervals with liposomes containing either the heparin binding domain peptide (L(HBD)) or the receptor binding domain peptide (L(RBD)) (O.lml, intramuscular). Each liposome injection delivered lIpmol phospholipid, 200pg Lipid A, and 30pg of peptide. Control groups included liposomes without conjugated peptide and PBS. Thirteen days following the last injection, mice were bled from the lateral tail vein and serum was collected for analysis of antibody. The following day mice were either challenged with tumor cells or challenged with FGF-2 or B 6BL6 impregnated sponges (liver implant).
Liposomes MLV for conjugated peptides containing mole ratios of: DMPC:DMPG:CHOL:PDS-CHOL:MLA of 9:1:7.4:2:0.02(10 mol PDS-CHOL) MLV for passive encapsulation DMPC:DMPG:CHOL:MLA of 9:1:7.5:0.02 -37- O Dose Target doses comprise approximately 10-50 jig peptide plus 100 jg MLA. In sufficient quantities for three injections per mouse for a full course.
00 Materials 00 00 100-ml round-bottom flasks, 24/40 joints, depyrogenate, ml Oakridge tubes. All materials suitably sterilized and autoclaved.
Lipid Aliquotting (per group) with a total of 8 groups) O Lipid [Stock] mM mol ml Stock Mol Ratio DMPC 90 204 2.27 9 DMPG 10 23 2.3 1 CHOL 75 170 2.27 7.4 PDS-CHOL 20 44 2.2 2 (20mM=10.26 mg PDS-Chol/ml) MLA added at 22 gg/jpmol; Lot #4013B from List Biologicals, Inc.
Assuming 100 gg MLA per injection, enough for approximately injections; Assuming approximately 50% peptide encapsulation using 1.5 mg total peptide and 10 lig per injection, enough for approximately 50 injections.
#MLA at 1 mg/vial is dissolved with chloroform:methanol, 1:1, approximately Iml/vial and pooled.
Preparation of Pyridyldithio-Cholesterol (PDS-Chol) for Surface Conjugation of Cysteine-Terminal Peptides to Liposomes In order to render relatively nonimmunogenic peptides more immunogenic, surface conjugation of cysteine-terminal peptides derived from VEGF amino acid sequences to liposomes was carried out. PDS- Chol is a thiol-reactive cholesterol analogue that binds free thiols. The peptides possess amino- or carboxyl-terminal thiols that will bind PDS- Chol in an aqueous liposome environment. The peptides are conjugated to multilamellar vesicles (MLV; liposomes) both inside and outside the MLV, thus favoring a depo, or slow release effect for antigen presentation.
The methods used comprise modifications of Carlsson, et al.
-38- 0 0 Day One 1. 1.772 g (44 mmol) thiocholesterol (Aldrich Chem., #13,611-5) 0dissolved in 2.6 ml chloroform. 13x100 mm glass screw-cap tube used and Ocomposition kept under nitrogen. Composition nearly completely soluble; slightly opalescent with mixing lines.
00 2. 1.982 g (9.0 mmol) 2',2'dipyridyldisulfide PDS) (Aldrithiol-2; 00 Aldrich Chem., Milwaukee, Wisconsin) placed in a 25-ml vaccine vial and r- 5.6 ml chloroform:glacial acetic acid, 100:1, v:v. added. Stir bar added and composition mixed until dissolved minutes).
3. Thiocholesterol added dropwise at a rate of approximately 30 drops Sper minute, to the vigorously mixing PDS. Yellow color evolved.
4. Immediately following thiocholesterol addition, vial purged with nitrogen, sealed, covered with aluminum foil, and mixed overnight at room temperature.
Day Two Solvent evaporated with a stream of nitrogen with vial in a warm water bath. Dried to a viscous oil. Acetic acid apparent by smell.
6. Composition transferred to a 250 ml round-bottom flask for recrystallization using chloroform to wash out the reaction vial.
7. Composition rotary evaporated to remove chloroform resulting in viscous bright yellow oil. Nitrogen stream reapplied to remove residual solvent.
8. Composition recrystallized by adding 50 ml ~56 0 C ethanol.
Swirled to dissolve. Sample was completely soluble. Turned to an emulsion upon sitting at room temperature (-20 minutes). Placed on ice for approximately 1 hour. Large white crystals formed.
9. Placed at -20 0 C for two days to complete crystallization. Appeared to be a large amount crystallized product. Large white/yellow crystals.
Day 10. Recovered by filtration and washing with ice cold (dry ice) ethanol.
Desiccated for approximately 4 hours and obtained weight. Structure confirmed by IR and NMR.
11. TLC in hexane:ethyl acetate:diethyl ether:glacial acetic acid, 9:1:1:0.1, v:v.
0 00 00 o -39- PDA-Chol PDS Thio-cholesterol Rf's 0.74 0.22 0.92 Day 18 12. Second round of recrystallization using 100 ml ethanol at 63 0 C. Sit at room temperature for approximately 2 hours and then placed at -20 0 C for 2 days.
TLC RF'S Solvent System: Hexane:ehthyl acetat:diethyl ether:glacial acetic acid, 9:1:1:0.1, v:v PDS-CHOL PDS Thio-Cholesterol TLC 0.74 0.22 0.92 TLC 0.63 0.14 0.97 Previous Synth.
Analytical Plates: 0.84 0.31 0.97 1mm Thick 0.55 n/a n/a Prep-TLC Purity Check TLC 0.63 0.18 Analytical Plates Stock Solution: Made to 20 mM 512.77 10.26 mg/ml chloroform.
Weight vs. Absorbance Assay is based on the DTT-release of 2-thiopyridone, which absorbs strongly at 343nm. Extinction coefficient is 7.0/mM at 343 nm.
1. 3 separate samples of PDS-Cholesterol weighed out in 13 x 100 tubes.
2. 2.5 mM (1.282 gm/ml) stocks in ethanol for PDS-Chol and 2-PDS (2-Aldrithiol-2M; Aldrich).
3. PDS-chol diluted in ethanol and 2-PDS in 0.1M sodium bicarbonate to 0.125 mM. Molecular weight PDS-Chol 512.77.
4. 50 mM (7.72 mg/ml) dithiothreitol in 0.1M sodium bicarbonate prepared.
0 0 Results Analysis using functional group-specific sprays: Sterol Spray: Ferric chloride spray: specific for sterols: positive for suspected PDS-cholesterol and thiocholesterol, negative for 2-PDS.
Iodine vapor: Showed 90-95% purity (estimated) 00 Surface Conjugation of Peptides: Method (Use biosafety cabinet for 00 manipulations) Ccn Pay I 1. Aliquotted lipids into depyrogenated 100-mI round bottom flasks, in the following order; lipid A in 1:1 chloroform:methanol, DMPC, DMPG, c and cholesterol.
2. Rotary evaporated to remove bulk solvent. Bath was 42 0 C. Flask rotation was set at 160 rpm. Started at -22 mm Hg vacuum until bulk solvent evaporated and then increased vacuum to 25 mm Hg and ran for minutes. Blew nitrogen into flask and stoppered until flasks were ready for desiccation.
3. Covered flask openings with filter paper and desiccated under.
vacuum for 3 hours.
4. While lipid was desiccating, deoxygenated sterile water by nitrogen bubbling through a sterile plugged 5 ml pipette for 20 minutes. Also prepared 10 ml 10 mM acetic acid and filter sterilize. Stock HOAc is 17.5 N. Added 20 microliters of stock HOAc to 35 ml water to give 10mM. pH was 3.4. Nitrogen bubbled to deoxygenate and filter sterilized with a 0.22 micron syringe filter.
5. Completely dissolved peptides to 5 mg/ml sterile 10 mM acetic acid.
Peptide information is listed in the table below: Peptide Expt. Manuf. Physical State BFGF Research Fluffy White Powder Genetics, Huntsville, Alabama -41- Solubilities The white powder dissolved completely; practically immediately.
06. Added 0.2 ml the 5 mg/ml peptide solution (1 mg) to 6.4 ml deoxygenated DIW and mixed gently. This is the peptide hydration solution.
00 7. Added the peptide hydration solution to the desiccated lipid. Purged 00 flask with nitrogen and glass-stoppered and sealed with parafilm.
17- 8. Bath sonicated to resuspend the lipid. A milky suspension resulted.
Vortexed briefly.
9. Placed on orbital shaker, covered with foil and rotated overnight at setting 3.25 at room temperature.
Day 2 Transferred the preps to a sterile 20 ml vaccine vials and lyophilized for 3 days.
Day 3 11. Prepared 0.1 M citrate/phosphate buffer, pH 5.6 (C/P buffer): Dissolve 1.921 g citric acid in 100 ml DIW dissolve 5.37 g dibasic odium phosphate-7-hydrate in 100 ml DIW (CC Mix 21 ml "A" and 29 ml and add 50 ml DIW. Deoxygenate by nitrogen bubbling and filter sterilize.
12. Pre-form the liposomes by adding 2.135 ml sterile C/P buffer, purging vial with nitrogen and vortexing vigorously for 1-2 minutes.
Suspension was relatively even. Lyophilization may be the limiting factor, due to large ratio of fluid:vial capacity.
13. Dissolved completely each peptide to 10 mg/ml in sterile, degassed mM acetic acid. Powder was immediately soluble, solids dissolved completely in about 1 minute with swirling.
14. Added 0.2 ml the 10 mg/ml peptide/HOAc solution (2 mg) to the pre-formed vesicles, purged the vial with nitrogen, seal, and cover with foil.
15. Mixed on orbital shaker at setting 6 overnight at room temperature.
Day 4 16. First spin: Washed out vial sequentially with two 1-ml aliquots of PBS and then 0.5 ml PBS for a total of 2.5 ml of sterile PBS to the lipid.
I-ml plastic pipettes are best to use for transferring. Total volume of prep wag 5 ml. Measured a lipid pellet by volume and found it to be 1.5 ml.
Used sterile PBS and autoclaved Qakridge tubes.
S17. Centrifuged in Sorvall high-speed in SS-34 rotor at 15,000 rpm, 0 C, 30 minutes.
18. Carefully pipetted off supernatant and stored frown. Tubes labeled Ist Spin. Total volume of 5 ml; lipid volume of 1.5 ml; so -3.5 ml is aqueous and should be used for the calculation, using each peptide stock as 00 00 the standard in a BCA assay.
00 19. Second Spin: Added -5 ml PBS to pellet and vortexed to Scompletely re-suspend the pellet. Added a total of 30 ml PBS and inverted to mix.
20. Centrifuged in Sorvall high-speed in SS-34 rotor at 15,000 rpm, 4C, 30 minutes.
21. Decanted supernatant into 50-ml tubes labeled second spin and stored frozen. The control pellets were looser in both groups. Peptide pellets were tight and supernatants clear.
22. Added -1 ml PBS to pellet and carefully resuspended pellet to an even suspension. Transferred to a 5-ml sterile snap-cap tube. Used enough PBS to make the total suspension 5 ml.
23. Assay for phosphorous; for incorporation by BCA (use each peptide as its own standard). Use 10 mg/ml frozen peptide stocks.
Injections Optimal=100 p. i.p. containing 100 gg Lipid A and 10 Lg peptide Method for Simple encapsulation of peptides: Day I 1. Aliquotted lipids into depyrogenated 100-ml round bottom flasks, in the following order: lipid A in 1:1 chloroform:methanol, DMPC, DMPG, and cholesterol.
2. Rotary evaporated to remove bulk solvent. Start at -22 mm Hg vacuum until bulk solvent evaporates and then increase vacuum to 25 mm Hg and run for 5 minutes.
3. Desiccated under vacuum for at 2 hours.
4. Hydrated lipid as follows; Added 4.5 ml sterile water to lipid and bath sonicated to suspend lipid. A relatively even suspension resulted. Let stand at room temperature for 2 hours.
Transferred to 10-ml vaccine vials. Washed out the rotary flask with successive 1 ml aliquots of sterile water. Sealed vials with sterile butyltype rubber vaccine vial septa and parafilm.
6. Vials were frozen on dry ice for 30 minutes.
-43- 7. #20 sterile hypodermic needles were placed through the septa to allow air flow for lyophilization.
8. Vials were placed in lyophilizer. 2 days should be sufficient to lyophilize the lipid.
Day 2 00 9. Concentrated peptide solutions (10 mg/ml) in 10 mM HOAc 00 prepared. 0.5 ml necessary for 5 mg total peptide Once dissolved, peptide ¢C solution diluted into 2 ml sterile, room temperature PBS.
The 4.5 ml peptide solutions then added to the lyophilized lipid and the vials vortexed vigorously for 2 minutes. This gave a final concentration 1 with respect to phospholipid of -100 mM.
11. Vials were placed at 40 C for -24 hours to allow encapsulation.
Day 3 12. Lipid transferred to 35-ml sterile Oakridge tubes for centrifugation.
Used 1-ml pipette for the transfer. Used two 1-ml aliquots of cold PBS to wash out vials. Total volume of the prep was 7 mis. Pellet volume was measured to be -1.5 ml.
13. Centrifuged in Sorvall High-speed in SS-34 rotor for 30 minutes at 15,000 rpm, 40 C.
14. Supematant pipetted off and stored frozen as 1st Spin. 15. -5 ml PBS added to pellet and vortexed to resuspend pellet evenly. PBS added to a total of 30 ml and centrifuged as above.
16. Pellet resuspended with PBS and transferred to 5-ml snap-cap tubes to a total of 5 mis.
17. Assay for phosphorous and peptide encapsulation.
EXAMPLE 9 In Vivo Studies for Demonstrating the Effect of bFGF Heparin Binding Domain Peptide Vaccination Two peptides from the functional domain of the bFGF molecule were analyzed for the ability to block bFGF stimulated endothelial cell proliferation in vivo. Peptide A is a 44 amino acid peptide corresponding to the heparin-binding domain of bFGF with the sequence:
YCKNGGFFLRIHPDGRVDGVREKSDPHIKLQLQAEEGVVSIKGV
(SEQ ID NO: I).
-44- 0 Peptide B is a 21 amino acid peptide and corresponds to the receptor binding domain with the sequence SNNYNTYRSRKYSSWYVALKR (SEQ ID NO: 2).
Peptides A and B were synthesized by Infinity Technology, Inc. (Upland PA) and were hydrated in 10mM acetic acid to a concentration 00 00 of 10mg/ml for use in proliferation assays and liposome formulations.
00 Both peptides A and B were incorporated into lipid A rC containing liposomes and used separately in a vaccination protocol.
Peptides were conjugated to liposomes according to the methods and S 10 protocols described above in Example 8. Mice were immunized and N boosted twice, bled and pooled serum analyzed for anti-peptide antibody titer and crossreactivity to bFGF by ELISA.
The comparison of titers and crossreactivity for serum from mice vaccinated with whole bFGF or with the liposomal heparin binding domain peptide of bFGF vaccine is shown in Figure 4 and a comparison of the titers and crossreactivity for serum from mice vaccinated with whole bFGF or the liposomal receptor binding domain peptide of bFGF vaccine is shown in Figure Following the vaccination protocol, mice were challenged with bFGF impregnated sponges and neovascularization assessed after 14 days, the results are shown in Figure 6.
Gelfoam Sponge Model ofAngiogenesis As previously described by Watanabe et al. Am. J. Path., 150: 1869-1880, gelfoam sponges (Upjohn, Kalamazoo, MI) were dissected into squares of 5mmand hydrated in PBS for 24hrs at room temperature.
Following hydration, sponges were blotted dry on sterile gauze and rehydrated in 80il of a solution containing FGF-2 [8ng/ml], and Gelfoam sponges were incubated for 1 hr at 37°C prior to implantation onto the liver of mice.
Mice were anaesthetized with metafane and a small incision was made on the ventral region of the mouse to expose the liver. Gelfoam sponges were fixed onto the left lobe of the liver with cyanoacrylate adhesive and wounds were closed with surgical staples. Fourteen days following implantation, mice were sacrificed, sponges were removed from the liver, and fixed in 10% buffered formalin for histologic analysis.
0 Experimental Pulmonary Metastasis Models B16BL6 tumor cells in.exponential growth phase were harvested by a short trypsinization (0.25% DIFCO trypsin and 0.02% EDTA for 1 minute at 37C), washed and resuspended to 2.5 x 10' cells/ml 0 in Ca 2 Mg 2 free PBS. Mice were injected with 0.2ml of the cell 00 suspension (5x104 tumor cells/mouse) via the lateral tail vein with a 27r- gauge needle. Fourteen days following inoculation, mice were sacrificed and lungs were removed and fixed in formalin. Surface pulmonary metastases were counted with a dissecting microscope (Olympus, 3X).
C LLC-LM tumor cells in exponential growth phase were harvested using a cell scraper, washed and resuspended to 1 x 10' cells/mi in Ca 2 Mg 2 free PBS. Mice were injected with 0.2ml of the cell suspension via the lateral tail vein with a 27-gauge needle. Seventeen days following inoculation, mice were sacrificed and lungs were removed, weighed, and fixed in 10% buffered formalin.
Histological Analysis Lungs and gelfoam sponges were fixed in 10% buffered formalin. Tissues were embedded in paraffin by routine methods, sectioned at 6jpm, and stained with hematoxylin and eosin by Molecular Histology Labs, Inc. (Gaithersburg, MD). Photomicrographs were obtained using an Olympus 1X70 microscope.
Statistical Analysis Results were analyzed for statistical significance using the two tailed Students' t-test.
In order to determine if generation of antibody to the bFGF molecule has an effect on bFGF-induced vascularization, gelatin sponges containing recombinant human bFGF were implanted onto the left lobe of the liver of mice following vaccination with the liposomal lipid A controls, liposomes containing the heparin binding domain peptide, liposome containing the receptor binding domain peptide, or PBS. Fourteen days following implantation, the sponges were removed. Vascularity and leukocyte infiltration were assessed histologically. Well defined blood vessels containing red blood cells were evident in sponges removed from -46- 0 mice vaccinated with control preparations (liposomal lipid A and PBS) as well as those removed from mice vaccinated with liposomes containing Sreceptor binding domain peptides of bFGF (Figures In addition, there was an abundant amount of cellular infiltration, consisting of white blood cells and fibroblasts. Sponges removed from mice vaccinated with the receptor 00 binding domain looked similar to the controls. In contrast, histological 00 analysis of sponges removed from mice vaccinated with the heparin binding domain peptide revealed lack of cellular infiltration and neovascularization induced by bFGF. Although red blood cells were present in the histological sections of the sponge taken from mice vaccinated with the heparin binding NC domain peptide, they lacked well defined structures surrounding them.
Delivery of the HBD and the RBD in Liposome Vesicles: Induction of an Antibody Response The peptides from the two functional domains of FGF-2, the HBD and the RBD, were covalently conjugated to and encapsulated in liposome vesicles containing the potent adjuvant Lipid A and used to treat mice every two weeks for six weeks. Each inoculation delivered Ijmol phospholipid, 200p.g Lipid A, and 30g peptide. Following treatment, mice were bled and sera was pooled for analysis of serum immunoreactivity to native FGF-2, the HBD peptide, and the RBD peptide in an ELISA format.
Immunoreactivity was measured in mice treated with the liposomal formulation containing the HBD peptide (L(HBD)) of FGF-2. This antibody reacted against both the HBD peptide and the parent FGF-2 molecule, with endpoint titers of 1:10,000. and 1:5,000, respectively (Figure In contrast, sera collected from mice treated with the RBD peptide conjugated to liposomes (L(RBD)) or from mice treated with liposomes lacking a conjugated peptide did not show immunoreactivity to the receptor binding domain peptide, the heparin binding domain peptide or the intact FGF-2 molecule. As expected, all mice treated with a liposome preparation containing the lipid A adjuvant, developed an antibody titer to lipid A (endpoint dilution of serum: 1:30,000) (data not shown).
To assess the specificity of the antibody generated in response to inoculation of L(HBD), sera from treated animals were assayed for immunoreactivity to another heparin binding molecule: vascular -47o endothelial growth factor (VEGF). When assayed in an ELISA format, serum from L(HBD) treated mice did not bind VEGF (Figure 0 Inhibition of B16-BL6 induced Angiogenesis and Tumor Growth in Hepatic Sponge Implants 00 In order to determine if vaccination could inhibit 00 angiogenesis induced by a tumor, gelatin sponges were implanted containing B 6BL6 melanoma cells onto the liver of mice following vaccination with control liposomes (liposomal lipid liposomes linked to the heparin binding domain peptide, liposomes linked to the receptor binding domain peptide, or PBS. Fourteen days following implantation, the sponges were removed and vascularity and leukocyte infiltration were examined histologically. Sponges removed from mice vaccinated with liposomal lipid A and PBS contained viable and proliferating B16BL6 tumor cells. In addition, neovascularization i.e. well-defined blood vessels containing red blood cells were evident inr these sponges. Moreover, there was an abundant cellular infiltration, consisting of white blood cells and fibroblasts into these sponges. In contrast, histologic analysis of sponges removed from mice treated with the liposomes containing the FGF heparin binding domain peptides revealed a decreased cellular infiltration and a lack of neovascularization induced by FGF (Figure 3d). While red blood cells were present in the histologic sections of the sponges taken from mice treated with liposomes containing the FGF heparin binding domain peptides. A similar effect was seen in sponges removed from mice vaccinated with liposomes containing the receptor binding domain.
Vaccination with the heparin binding domain peptide blocked neovascularization and caused ablation of tumor growth and development in the sponge. Similar to findings from sponges containing bFGF, there was a tremendous amount of red blood cells lacking defined structures surrounding them, there was a lack of well defined capillary structures and a marked paucity of endothelial cells.
Results of these experiments are provided in Figures 6 and 0 0 Inhibition of BJ6BL6 induced angiogenesis and tumor growth in hepatic sponge implants The gel sponge model of angiogenesis can also be used to evaluate angiogenesis induced by a tumor. Gelatin sponges containing 5 x 10 4 B16BL6 melanoma cells were implanted onto the livers of mice 00 vaccinated with L(LA), L(HBD), L(RBD) or PBS. Fourteen days following 0 implantation, the sponges were removed and examined histologically.
Ce Sponges removed from mice treated with L(LA), L(RBD) and PBS contained B16BL6 tumor cells (Figures 21a-c). Neovascularization into these sponges was abundant as evidenced by endothelial cells forming C defined capillary structures containing red blood cells. In contrast, sponges from mice treated with L(HBD) had no evidence neovascularization and B 16BL6 tumor growth was inhibited as well. Again, while red blood cells were observed, there were no vascular or endothelial structures surrounding them.
EXAMPLE In Vivo Studies for Demonstrating the Effect of bFGF Heparin Binding Domain Peptide on Lung Metastases on Mice In order to test the effectiveness of bFGF peptide from the heparin-binding domain for inhibiting cancer, groups of 10 mice were vaccinated, boosted, and challenged with B 6B16 murine melanoma by the intravenous route. Peptides A and B as described in Example 9, were conjugated to liposomes according to the methods and protocols described above and particularly in Example 8.
Fourteen days after the mice were vaccinated, boosted, and challenged with B16B16 murine melanoma, the animals were sacrificed and the lungs were removed and numbers of melanotic tumor nodules on the surface were counted (Figure IA). Figure IA shows the mean number of lung metastases in mice vaccinated with bFGF peptide from the heparinbinding domain conjugated to liposomes, mice vaccinated with a peptide from the receptor binding domain conjugated to liposomes, mice vaccinated with empty liposomes, and unvaccinated mice (PBS controls). Figure 2 shows the differences in surface metastases in the lungs from the control group (liposomal lipid A, top row) and the lungs from the vaccinated group (heparin-binding domain peptide, bottom row).
O
O
As demonstrated by the results of this experiment, and shown in Figure IA, the administration of compositions comprising the Sheparin binding domain peptide of bFGF significantly reduces the mean number of lung metastases and is therefore an effective anti-tumor composition.
00 00 Treatment with L(HBD) resulted in 96% inhibition of 00 macroscopic B 1 6BL6 metastases in the lungs when compared to lungs of c mice treated with L(LA), L(RBD), or PBS. Mice treated with either L(LA), L(RBD), or PBS had large melanotic lesions that encompassed the entire surface of the lungs. Histologic analysis of lung tissue from L(HBD) CI treated mice revealed few tumors that were less than ten cell layers thick.
Control lungs contained numerous melanotic foci greater than 10 cell layers thick.
Confirmation of the anti-tumor effects was achieved with a second model of experimental metastatic disease. Seventeen days following intravenous challenge with LLC-LM, two mice in the control groups succumbed to progressive tumor burden, while the remaining control mice.
exhibited labored breathing and decreased mobility. All groups were sacrificed on day 17, lungs were removed and tumor burden was assessed by measuring lung weights. Mice that received L(LA) had a considerable tumor burden confined to the lungs, whereas mice treated with L(HBD) exhibited a significant decrease in tumor burden 10 )(Figure IB).
EXAMPLE 11 Effect of Growth Factor and Liposome Vaccine Compositions on Tumor Volume and Size Compositions comprising bFGF-liposomes were administered to tumor bearing mice in order to monitor the effect of such compositions on tumor size.
Materials and Methods A. Preparation of Vaccines Comprising Liposomes The liposomes used in these studies were made according to the method of Verma et al. Infect Immun 60(6):2438-2444 (1992). The vaccine was prepared by combining lipids, dimyristoylphosphatidylcholine (DMPC), dimyristoylphosphatidylglycerol (DMPG), cholesterol (CHOL), 0 and Lipid A at a mole ratio of DMPC:DMPG:CHOL:LA, 9:1:7.5:1 (mol:mol) in pyrogen-free rotary evaporator flasks. Flasks were desiccated 0at least 2 hours under high vacuum. The lipids were hydrated in sterile water for 2 hours at room temperature. The hydration concentration used was 50mM with respect to phospholipid. The samples were then 00 lyophilized. Recombinant human bFGF was encapsulated into the 00 00 liposomes by dissolving in PBS and combining with the lyophilized lipid.
r. The mixture was vortexed vigorously to ensure resuspension of lipid and incubated at 4'C for 2 days. The amount of vaccine injected was determined by the amount of protein desired per dose. For mice, and perhaps for man, Sthe adjuvant lipid A is generally preferred for a vigorous response. For these studies, the dose of adjuvant was 200 gg per injection per gmol total phospholipid and antigen dose was 10 ig bFGF per injection.
Concentration of liposomes is given as total phospholipid, total DMPG and DMPC; liposome (vaccine) final concentration was 10 mM phospholipid. Maximum efficacious doses may vary and studies to address this are ongoing.
B. Immunization Schedule C57BL/6J or Balb/cByJ- mice, 6-8 weeks old, were immunized by intraperitoneal injection of liposomes containing bFGF at day 0, day 14, and day 21. Serum was collected at day 0, day 14, day 21, and day 35. Serum was analyzed for anti-bFGF activity by ELISA.
Control groups 'of mice included uninjected mice that had been bled for titers and mice inoculated with liposomes alone and similarly bled for antibFGF titers.
C. Analysis of Vaccine Efficacy a. Antisera from vaccinated mice was analyzed for antibFGF activity by ELISA assay.
b. Two tumor models were used for analysis of anti-tumor therapeutics: B16F10, a highly tumorigenic melanoma that induces macroscopic lung tumors 14 days after intravenous inoculation of 106 cells in C57BL/6J mice; and Lewis lung carcinoma-low metastatic (LLC-LM) developed by M. O'Reilly at Children's Hospital. Further, efficacy of the vaccination protocol as an anti-cancer therapy was evaluated in both allogeneic and syngeneic systems; the former being highly immunogenic tumors, the latter being non-immunogenic.
-51- Groups of mice that were vaccinated, unvaccinated, and control liposome (no bFGF) vaccinated, were challenged with B 6F10 Sintravenously and analyzed at 14 days for lung tumors. Numbers of tumors visible by stereomicroscopy at 4x magnification were determined for each group.
00 Efficacy of the anti-bFGF vaccine was analyzed on both 00 primary tumor growth and subsequent development of metastatic disease using the LLC-LM model. Fourteen days after the last boost, mice were challenged with 106 LLC-LM (taken directly from tumor bearing mice).
Tumor volume was measured at 14-21 days after inoculation and compared N between the groups. At that time (14-21 days after tumor inoculation) tumors were resected from half of the group, the other half underwent sham operation. Fourteen days following surgery mice were sacrificed, lungs excised and weighed, and lung metastases counted using a stereomicroscope.
Results Preliminary data derived from bFGF-liposome-vaccinated and control liposome-vaccinated Balb/cByJ mice indicated that bFGF vaccine stimulated an anti-bFGF antibody response. Anti-bFGF titers ranged from 1:12,800 to 1:30,000 for vaccinated Balb/cByJ mice in two separate experiments (Figures 10A and 10B). Similarly, C57BL/6J mice responded to vaccination with anti-bFGF titers of 1:10,000 to 1:50,000 measured in individual mice (Figure 13).
Immune Balb/cByJ mice were challenged with LLC-LM (allogeneic system) and primary tumor development assessed over a 21 day period. The mean tumor volume in control liposome-vaccinated mice was 830 mm 3 compared with 290 mm 3 in similarly challenged bFGFliposome-vaccinated mice on day 14 following tumor implantation (Figure 14). In this experiment the T/C=0.35 (T/C refers to the number of lung nodules in the vaccinated group divided by the number of nodules in the control vaccine (liposomes only, no peptides)); a 65% reduction in tumor size relative to the controls.
In a second experiment with LLC-LM in vaccinated and unvaccinated Balb/cByJ mice, the mean tumor volume in control liposomevaccinated mice was 229 mm 3 compared with 111 mm 3 in similarly -52challenged bFGF-liposome-vaccinated mice on day 14 following tumor implantation (Figure 15). For this experiment the T/C=0.48; a 52% Sreduction in tumor size.
The Balb/cByJ mouse is allogeneic for LLC-LM and tumor sizes in all groups were smaller than those observed in syngeneic C57BL/6J 00 mice. Thus, the next set of experiments were performed with vaccinated 00 C57BL/6J mice challenged with: LLC-LM (primary tumor development Sand metastatic disease assessed); or B16F10 (numbers of metastases determined); both syngeneic models.
As shown in Figure 13, C57BL/6J mice responded to C vaccination with production of bFGF antibodies. To assess the protective efficacy of the induced bFGF antibodies in a syngeneic tumor system, vaccinated mice were challenged with LLC-LM and primary tumor growth and subsequent metastatic disease was assessed. In this syngeneic system vaccination and the resulting circulating bFGF antibodies response to bFGF did not alter the growth of primary LLC-LM in C57BL/6J mice.
Vaccinated mice underwent surgical resection of the primary tumor to assess the extent of metastatic disease following removal of the primary tumor. In the LLC-LM model of metastatic disease, removal of the primary tumor leads to rapid growth of metastatic tumor in the lungs with a concomitant increase in lung weight. Vaccination had no effect on development of metastases following primary tumor removal, as assessed by the lung weight measured 14 days after primary tumor removal.
Finally, C57BL/6J mice were vaccinated and challenged with B16F10 by intravenous route to assess vaccine efficacy in a syngeneic model of experimental metastasis. Anti-bFGF titers in vaccinated mice were 1:16,000 but numbers of B16FIO metastases in the lungs of bFGFliposome vaccinated mice were not different from the numbers of metastases in the lungs of mice vaccinated with the control liposome preparation or control mice (inoculated with PBS).
Conclusion The data generated by the present experiment demonstrate that a vaccine composition comprising a growth factor, particularly fibroblast growth factor, can be effectively used to prevent or reduce a cancerous tumor, particularly an allogeneic cancerous tumor or one that is i
O
O ¢-JJ highly immunogenic. As shown in both parts of the experiment, mice which were immunized with fibroblast growth factor incorporated into a 0liposome and challenged with an allogeneic tumor experienced an average O of 65% and 52% reduction in tumor size relative to controls which were immunized with the control vaccine. Furthermore, antibody titers in mice OO receiving the vaccine compositions containing growth factors were 00 significantly higher than mice that did not receive the vaccines.
Example 12 Effect of the Heparin Binding Domain Peptide ofbFGF Son the Growth of B16BL6 or HUVEC Tumor Cells In Vitro As demonstrated in Example 9, the heparin binding domain peptide of bFGF exhibited an inhibitory effect on bFGF stimulated HUVEC proliferation in vivo. The same effect was not seen when incubated with the tumor cells in vitro.
Cell Lines Human umbilical vein endothelial cells (HUVECs; Clonetics, Walkersville, MD) were maintained in endothelial cell growth medium (EGM-2, Clonetics, Walkersville, MD), supplemented with 1% Lglutamine (Biowhittaker, Walkersville, MD) and bovine brain extract in 2 cell-culture flasks at 37°C, in moist air, 10% CO 2 The B16BL6 variant line of the B16-F10 melanoma was obtained from the National Cancer Institute-Central Repository (Frederick, MD). Tumor cells were grown in DMEM (BioWhittaker, MD.) supplemented with 5% heat inactivated fetal bovine serum and L-glutamine (BioWhittaker, Walkersville, MD), as monolayer cultures at 37°C in a humidified atmosphere of 5% C0 2 /95% air. The cells were passaged at confluency and used between passages 6 and 18. The B16BL6 were certified free of mycoplasma and the following pathogenic murine viruses: reovirus type 3, pneumonia virus of mice, K virus, Theiler's encephalitis virus, Sendai virus, minute virus of mice, mouse adenovirus, mouse hepatitis virus, lymphocytic choriomenengitis virus, ectromelia virus, and lactate dehydrogenase virus.
The Lewis lung carcinoma-low metastatic (LLC-LM) cell line was a kind gift from Dr. Judah Folkman (Children's Hospital, Boston) S-54-
O
o and were certified free of the same mycoplasma and pathogenic murine viruses mentioned above. LLC-LM were maintained in DMEM supplemented with 10% heat inactivated fetal bovine serum and 1% SL-glutamine.
0 0 Proliferation Assays 00 HUVECs at passage 2-5 were washed with PBS and trypsinized with a 0.05% solution of trypsin-versene mixture S(BioWhittaker, Walkersville, Cells were suspended in endothelial cell basal medium, (EBM-2, Clonetics, Walkersville, MD.) supplemented with 2% heat inactivated fetal bovine serum (Hyclone, Logan, UT) and 2 mM L-glutamine at a concentration of 2.5 X 104 cells/ml, plated in 96 well culture plates (Costar, Cambridge, MA) and incubated for 24 hours at 37C in 5% CO 2 Cells were incubated with either the FGF-2 peptides, a 22 amino acid control peptide at 1, 10, and 10Og/ml, or media alone for 20 mm, then stimulated with 10 ng/ml of human recombinant FGF-2 (R&D Systems, Minneapolis, MN) or media alone for 72 hr. Cell proliferation was measured by BrdU incorporation using an ELISA assay (Boehringer Mannheim, Indianapolis, TN) according to the manufacturers instructions.
Proliferation assays with the B16BL6 or LLC-LM was done in the following manner. Cells were suspended in Dulbecco's minimal essential medium (DMEM, BioWhittaker, MD.) supplemented with Fetal Bovine Serum, 1% L-glutamine at a concentration of 2 X 104 cells/mi, plated in 24 well (500 Wl/ml) culture plates (Costar, Cambridge, MA) and incubated for 4 hours at 37 0 C in 5% CO 2 FGF-2 peptides were added at 1,10,100 gig/ml and incubated for 20 min. Following incubation, FGF-2 was added to the wells for 48hrs, Cell proliferation was measured by cell counts utilizing a coulter counter (Coulter, Columbia, MD).
In an alternative method, B16BL6 melanoma cells were plated at 10,000 cells/well in a 24 well plate and incubated overnight.
Various concentrations of the heparin binding peptide were added to the wells, followed by addition of media containing 5ng/ml bFGF. bFGF added in the absence of peptide did not increase proliferation of B16BL6 beyond that of the media control. In addition, no significant effect on the growth of B16BL6 cells was observed when incubated with the heparin binding peptide, as determined by cell counts. The results are provided in Figure 10. This example provides methods useful for selecting peptides \useful for the methods and compositions of the present invention.
Inhibition of Endothelial Cell Proliferation 00 To further assess the inhibitory activity of the 44 amino acid 0 peptide which corresponds to the heparin binding domain of FGF-2 (HBD) m (SEQ ID NO:1) and to analyze an additional functional domain of FGF-2, the receptor binding domain (RBD), these peptides at concentrations of 1,10, or 100 gg/ml were coincubated with 5ng/ml of FGF-2 in a HUVEC N proliferation assay. Addition of FGF-2 alone stimulates proliferation of HUVECs in comparison to cells incubated without the growth factor. Both the HBD and the RBD peptides inhibited FGF-2-induced proliferation of HUVECs in a dose dependent fashion with inhibitory concentrations
(IC
50 of 70 and 20 pg/ml, respectively (Figure 19). A 22 amino acid control peptide corresponding to a defined region of human angiostatin had no inhibitory effect on FGF-2 induced proliferation of HUVECs.
Example 13 Inhibition of Growth and Development of LLC-LM Metastases in Mice Vaccinated with the Heparin Binding Domain Peptide of bFGF Efficacy of vaccination in mice with the heparin binding domain peptide bFGF in a.liposome format was determined using the LLC- LM experimental metastatic model.
Mice were vaccinated with the heparin binding domain peptide of bFGF in a liposome format using the same vaccination regimen as in the B16BL6 experiments above (3 inoculations two weeks apart).
Two weeks following the final boost, mice were intravenously challenged with LLC-LM. At day 17, the control (no treatment) mice began to succumb to the tumor burden in the lung. All groups were sacrificed.
Lungs were removed and analyzed based on lung weight. Normal lung weight was subtracted out of the treated and non-treated groups to determine the T/C. Vaccination with the heparin binding domain peptide inhibited the growth and development of LLC-LM experimental metastasis by 94% when compared to control. These lungs have been photographed -56- 0 and will be assessed histologically. As demonstrated by the results in Figure I1, the growth and development of metastases was significantly 0inhibited in mice vaccinated with the heparin binding domain peptide.
EXAMPLE 14 00 Immunogenicity of Growth Factor Comprising 00 Vaccine Compositions Determination of Antibody Titer and Specificity Pooled serum was obtained from mice treated with either N L(HBD), L(RBD), L(LA), or PBS. Anti-FGF-2 specific antibodies were measured by enzyme linked immunosorbent assay (ELISA). Briefly, 96 well immulon 4 plates (Dynotech, Chantilly, VA.) were coated with either recombinant FGF-2, the heparin binding domain peptide of FGF-2, the receptor binding domain peptide of FGF-2, vascular endothelial growth factor (VEGF), (50tl; 2lig/ml in carbonate buffer), incubated overnight at 4"C, and blocked with 3% milk and 0.05% Tween 20 in PBS (PBS/Tween Plates were washed three times with PBS/Tween 20, and incubated with serial dilutions of serum in PBS/Tween20 for 1 hr. Plates were washed and incubated with biotin-conjugated goat anti-mouse immunoglobin (Ig)G and IgM or, to determine subclass response, biotin conjugated goat anti-mouse IgGI, IgG2a, IgG2b, IgG3, IgG, and IgM for 1 hr at RT. Following wash, wells were incubated with horseradish peroxidase (HRP)-conjugated streptavidin. Optical density was read at 540nm. Antibody titer was defined as the reciprocal of the serum dilution giving an O.D. reading of two standard deviations above the mean O.D. for normal mouse serum.
EXAMPLE In Vivo Studies for Demonstrating the Immunogenic Effects of VEGF Peptides in Mice The present example involved the use of vaccine compositions comprising growth factors peptides, specifically vascular endothelial growth factor (VEGF) peptide fragments, incorporated into liposomes such that the compositions were immunogenic for the growth factor peptide when administered to a human or animal. A successful 0 immunogenic response was obtained in mice when VEGF peptides were incorporated into the liposomes via either active peptide conjugation or \passive encapsulation.
O
A. VEGF Peptides OO Three different murine VEGF peptides, denominated as 00 Peptides C-E, were incorporated into the liposomes. Peptide C, SEQ ID C NO: 3 is a carboxyl terminal peptide that consists of residues 110-115, the six amino acids of exon 8, and an amino-terminal cysteine for cross-linking purposes. Peptide D, SEQ ID NO:4 also a carboxyl terminal peptide, CN contains residues 102-115, the six amino acids of exon 8, and an amino-terminal cysteine for cross-linking purposes. Peptide E SEQ ID is an amino terminal peptide corresponding to residues 1-20 of VEGF with a C-terminal cysteine added for cross-linking purposes. The amino acid sequences of each peptide are provided below: Peptide C CRTKPEKCDKPRR (SEQ. ID NO:3) Peptide D CECRPKKDRTKPEKCDKPRR (SEQ. ID NO:4) Peptide E APTTEGEQKSHEVIKFMDVYC (SEQ. ID B. Vaccine Preparation Using Liposomes i. Active Peptide Conjugation One method used to incorporate growth factor peptides into liposomes involved chemical coupling of the peptide to amino acids via a thiol group. In these studies, a thiol-reactive liposome was created by using an analog of cholesterol, PDS-CHOL. The PDS-CHOL was first created according to the method of White et al. Vaccine 12(2):1111-22(1995) Thiocholesterol (Aldrich Chem., 13,611-5 Milwaukee, Wisconsin) (1.772 g) was dissolved in chloroform, while in a separate vial PDS dipyridylsulfide or Aldrithiol-2 from Aldrich Chem.) (1.982 g) was dissolved in a 100:1 mixture of choloroform:glacial acetic acid. The thiocholesterol was added dropwise, at a rate of approximately 30 drops per minute, to the vigorously mixing PDS. The vial was then purged with nitrogen, sealed, covered with foil, and mixed overnight at room temperature.
After a stream of nitrogen was used to evaporate the solvent, the sample was recrystallized by adding 50 ml of approximately 56° C ethanol, placing the sample on ice for one hour, and then placing it at -20' C for two days. The 0-,0-
O
¢-Jo sample was recovered by filtration with ice cold ethanol and desiccated.
Purity was determined to be 90-95% using thin-layer chromatography and \an iodine vapor.
Once the PDS-CHOL was prepared, it was combined in a 100 ml round bottom flask with lipids, dimyristoyl phosphatidylcholine 00 (DMPC), dimyristoyl phosphatidylglycerol (DMPG), cholesterol (CHOL), 00 00 and Lipid A to produce a mole ratio of 9:1:7.4:2:0.02 m€ (DMPC:DMPG:Cholesterol:PDS:Chol:LipidA) (mol:mol). The lipid mixture was rotary evaporated with nitrogen and desiccated. All manipulations were carried out anaerobically using degassed liquids except for final PBS wash. The peptides were then dissolved in 10 mM acetic acid to a concentration of 5 mg/ml and the equivalent of 1 mg was diluted in 6.4 ml de-ionized water. This peptide hydration solution was added to the desiccated liquid, re-suspended via bath sonication, briefly vortexed, and mixed on an orbital shaker overnight at room temperature. The mixture was then lyophilized. Liposomes were pre-formed by adding 2.135 ml citrate/phosphate buffer (0.1 M) and vortexing for 1-2 minutes. Additional peptides were dissolved in sterile 10 mM acetic acid at a concentration of mg/ml, and 0.2 ml (2 mg) was added to the pre-formed vesicles. The mixtures was covered with foil and mixed overnight on an orbital shaker at room temperature. After washing two times with PBS, the liposomes were analyzed for incorporation using BCA (Bicinchroninic acid, Pierce Chemical Co. Rockford, Illinois) (see Bartlett et al. J. Bio. Chem. 234:466- 68 (1959) for an explanation of the assay used). The results of the incorporation assay indicated that there was 68%, 74%, and 66% conjugation of peptides C, D, and E, respectively.
O
O ¢-3r o ii. Passive Encapsulation Another method used to incorporate the peptides of growth 0 factors such as VEGF was passive, or simple encapsulation. Again, lipids were aliquotted into depyrogenated 100 ml round bottom flasks in the following order: lipid A in 1: 1 chloroform:methanol, DMPC, DMPG, and 00 cholesterol. The lipids were rotary evaporated to remove the bulk solvent 00 and then desiccated. To hydrate the lipids, 4.5 ml sterile de-ionized water was added, the mixture was sonicated and allowed to stand at room temperature for two hours. After transfer to vaccine vials, the mixture was lyophilized. The peptide solutions (2.5 mg/ml in room temperature PBS from a 10 mg/ml stock in acetic acid) were added to the lyophilized lipid and the vials were vortexed vigorously for 2 minutes. The final concentration with respect to the phospholipid was approximately 100 mM.
To allow for encapsulation, the vials were placed at 40 C for 24 hours and then were washed two times with PBS. Subsequent analysis of encapsulation indicated that there was 33%, 19%, and 19% encapsulation of peptides C, D, and E, respectively.
C. Analysis of Vaccine Efficacy Five Balb/cByJ mice, 6-8 weeks old, were immunized by intraperitoneal injection with liposomes containing one of the three previously described peptides of VEGF incorporated either via active conjugation or passive encapsulation. The target dose was approximately 10-50 pg of peptide plus 100 gLg of Lipid A. Serum was collected on day 35 and analyzed for anti-VEGF activity by ELISA. As a control, mice that were not injected with liposomes were also bled for anti-VEGF peptide titers.
Preliminary data derived, from VEGF-peptide-liposomevaccinated and control Balb/cByJ mice indicate that VEGF vaccine stimulates an anti-VEGF antibody response. When the peptides were conjugated to the liposome, individual Balb/cByJ mice responded with anti-VEGF peptide titers of greater than 1:100,000 for peptides 2 and 3 and titers of 1:25,000 for peptide C (Figures For peptides incorporated by simple encapsulation, individual Balb/cByJ mice responded with anti-VEGF peptide titers ranging from 1:12,500 to 1:50,000 for peptides D and E (Figures 0 0 The above experiment reasonably demonstrates that a vaccine composition comprising a growth factor, particularly a peptide epitope of vascular endothelial growth factor, incorporated into a liposome, either by encapsulation or conjugation, can elicit a significant antibody response in vivo.
00 00 00 EXAMPLE 16
C
c Inhibition of the Growth and Development of BI6BL6 Experimental Metastasis in Mice Vaccinated with a VEGF Peptide in a Liposome Format 0 A synthetic peptide generated to the neuropilin receptor binding domain of VEGF (Peptide F, SEQ ID NO: 6) was covalently conjugated to liposome vesicles containing lipid A. Mice were vaccinated with Peptide F liposome preparation utilizing the same vaccine regimen as the bFGF peptide vaccines. Two weeks following the final boost, mice were intravenously challenged with B16BL6. Mice were sacrificed at day 14 following challenge. Vaccination with the Peptide F liposome formulation resulted in significant inhibition of B16BL6 experimental metastasis when compared to liposomal lipid A controls The heparin binding domain peptide bFGF covalently linked to liposomes was used as a positive control in this experiment. The results of this experiment are provided in Figures 11 and 18.
While this invention has been described in specific detail with reference to the disclosed embodiments, it will be understood that many variations and modifications may be effected within the spirit and scope of the invention.
Claims (35)
1. An immunogenic composition comprising, an immunogenic peptide fragment of fibroblast growth factor and pharmaceutically acceptable carrier. 00 2. The composition of Claim 1, wherein the immunogenic 00 peptide corresponds to the heparin binding domain of fibroblast growth ¢C factor.
3. The composition of Claim 1, wherein the amino acid i sequence of the immunogenic peptide comprises SEQ ID NOS: 1 and 2.
4. The composition of Claim 1, wherein the pharmaceutically acceptable carrier comprises liposomes, colloidal gold, and carrier proteins. The composition of Claim 4, wherein the carrier protein comprises maltose binding protein, bovine serum albumin, keyhole lympet hemocyanin, ovalbumin, flagellin, thyroglobulin, serum albumin, gamma globulin, syngeneic cells, and polymers of D- and/or L- amino acids.
6. The composition of Claim 4, further comprising adjuvants, preservatives, diluents, emulsifiers, and stabilizers.
7. The composition of Claim 6, wherein the adjuvant is selected from the group consisting of lipophilic muramyl dipeptide derivatives, nonionic block polymers, aluminum hydroxide, aluminum phosphate, lipid A, Freund's incomplete adjuvant, Freund's complete adjuvant, polydispersed linked acetylated mannan, polyoxyethylene- polyoxypropylene copolymer adjuvants, saponin derivative adjuvants, killed Bordetella pertussis, lipopolysaccharide of gram-negative bacteria, polymeric anions, dextran sulfate, inorganic gels, alum, aluminum hydroxide, and aluminum phosphate.
8. The composition of Claim 1, further comprising a hydrophobic moiety attached to the immunogenic peptide. -62- o 9. The composition of Claim 8, wherein the hydrophobic moiety comprises at least one long chain fatty acid having at least 10 carbon 0 atoms in the lipid backbone.
10. The composition of Claim 8, wherein the hydrophobic 00 moiety is selected from the group consisting of palmitic acid, stearic acid, 00 myristic acid, lauric acid, oleic acid, linoleic acid, and linolenic acid. I1. An immunogenic composition comprising, an immunogenic peptide fragment of vascular endothelial growth factor and a Spharmaceutically acceptable carrier.
12. The composition of Claim 11, wherein the immunogenic peptide fragment corresponds to the receptor binding domain of vascular endothelial growth factor.
13. The composition of Claim 11, wherein the amino acid sequence of the immunogenic peptide comprises SEQ ID NOS: 3-9.
14. The composition of Claim 11, wherein the pharmaceutically acceptable carrier comprises liposomes, colloidal gold, and carrier proteins. The composition of Claim 14, wherein the carrier protein comprises maltose binding protein, bovine serum albumin, keyhole lympet hemocyanin, ovalbumin, flagellin, thyroglobulin, serum albumin, gamma globulin, syngeneic cells, and polymers of D- and/or L- amino acids.
16. The composition of Claim 14, further comprising adjuvants, preservatives, diluents, emulsifiers, and stabilizers.
17. The composition of Claim 16, wherein the adjuvant is selected from the group consisting of lipophilic muramyl dipeptide derivatives, nonionic block polymers, aluminum hydroxide, aluminum phosphate, lipid A, Freund's incomplete adjuvant, Freund's complete adjuvant, polydispersed linked acetylated mannan, polyoxyethylene- polyoxypropylene copolymer adjuvants, saponin derivative adjuvants, killed r -63- Bordetella pertussis, lipopolysaccharide of gram-negative bacteria, polymeric anions, dextran sulfate, inorganic gels, alum, aluminum 0hydroxide, and aluminum phosphate.
18. The composition of Claim 14, further comprising a 00 OO hydrophobic moiety attached to the immuhnogenic peptide. 00 M 19. The composition of Claim 18, wherein the hydrophobic moiety comprises at least one long chain fatty acid having at least 10 carbon atoms in the lipid backbone. The composition of Claim 18, wherein the hydrophobic moiety is selected from the group consisting of palmitic acid, stearic acid, myristic acid, lauric acid, oleic acid, linoleic acid, and linolenic acid.
21. An immunogenic composition comprising, an immunogenic peptide fragment of fibroblast growth factor and vascular endothelial growth factor and a pharmaceutically acceptable carrier.
22. The composition of Claim 21, wherein the immunogenic peptide fragment of fibroblast growth factor corresponds to the heparin binding domain of fibroblast growth factor, and the immunogenic peptide fragment of vascular endothelial growth factor corresponds to the receptor binding domain of vascular endothelial growth factor.
23. The composition of Claim 22, wherein the pharmaceutically acceptable carrier comprises liposomes, colloidal gold, and carrier proteins.
24. The composition of Claim 23, wherein the carrier protein comprises maltose binding protein, bovine serum albumin, keyhole lympet hemocyanin, ovalbumin, flagellin, thyroglobulin, serum albumin, gamma globulin, syngeneic cells, and polymers of D- and/or L- amino acids. The composition of Claim 23, further comprising adjuvants, preservatives, diluents, emulsifiers, and stabilizers. -64-
26. The composition of Claim 25, wherein the adjuvant is selected from the group consisting of lipophilic muramyl dipeptide 0derivatives, nonionic block polymers, aluminum hydroxide, aluminum phosphate, lipid A, Freund's incomplete adjuvant, Freund's complete adjuvant, polydispersed linked acetylated mannan, polyoxyethylene- 00 polyoxypropylene copolymer adjuvants, saponin derivative adjuvants, killed 00 00 Bordetella pertussis, lipopolysaccharide of gram-negative bacteria, polymeric anions, dextran sulfate, inorganic gels, alum, aluminum hydroxide, and aluminum phosphate.
27. A method for treating cancer or hyperproliferative disorders in a human or animal comprising administering to the human or animal an effective amount of a composition comprising an immunogenic peptide fragment of fibroblast growth factor and a pharmaceutically acceptable carrier.
28. The method of Claim 27, wherein the immunogenic peptide fragment corresponds to the heparin binding domain of fibroblast growth factor.
29. The method of Claim 27, wherein the amino acid sequence of the immunogenic peptide fragment comprises SEQ ID NOS: 1 and 2. The method of Claim 27, wherein the pharmaceutically acceptable carrier comprises liposomes, colloidal gold, and carrier proteins.
31. The method of Claim 27, wherein the carrier protein comprises maltose binding protein, bovine serum albumin, keyhole lympet hemocyanin, ovalbumin, flagellin, thyroglobulin, serum albumin, gamma globulin, syngeneic cells, and polymers of D- and/or L- amino acids.
32. The method of Claim 27, further comprising adjuvants, preservatives, diluents, emulsifiers, and stabilizers.
33. The method of Claim 27, wherein the hyperproliferative disorder comprises hemangioma, solid tumors, blood borne tumors, 0-03- O leukemia, metastasis, telangiectasia, psoriasis, scleroderma, pyogenic granuloma, myocardial angiogenesis, Crohn's disease, plaque neovascularization, arteriovenous malformations, comeal diseases, rubeosis, neovascular glaucoma, diabetic retinopathy, retrolental fibroplasia, arthritis, diabetic neovascularization, macular degeneration, wound healing, peptic 00 ulcer, Helicobacter related diseases, fractures, keloids, vasculogenesis, 0 0 hematopoiesis, ovulation, menstruation, placentation, and cat scratch fever.
34. A method for treating cancer or hyperproliferative disorders in a human or animal comprising administering to the human or animal an C<1 effective amount of a composition comprising an immunogenic peptide fragment of vascular endothelial growth factor and a pharmaceutically acceptable carrier.
35. The method of Claim 34, wherein the immunogenic peptide fragment corresponds to the receptor binding domain of vascular endothelial growth factor.
36. The method of Claim 34, wherein the amino acid sequence of the immunogenic peptide fragment comprises SEQ ID NOS: 3-9.
37. The method of Claim 34, wherein the pharmaceutically acceptable carrier comprises liposomes, colloidal gold, and carrier proteins.
38. The method of Claim 34, wherein the carrier protein comprises maltose binding protein, bovine serum albumin, keyhole lympet hemocyanin, ovalbumin, flagellin, thyroglobulin, serum albumin, gamma globulin, syngeneic cells, and polymers of D- and/or L- amino acids.
39. The method of Claim 34, further comprising adjuvants, preservatives, diluents, emulsifiers, and stabilizers. The method of Claim 34, wherein the hyperproliferative disorder comprises hemangioma, solid, tumors, blood borne tumors, leukemia, metastasis, telangiectasia, psoriasis, scleroderma, pyogenic granuloma, myocardial angiogenesis, Crohn's disease, plaque -66- Sneovascularization, arteriovenous malformations, corneal diseases, rubeosis, neovascular glaucoma, diabetic retinopathy, retrolental fibroplasia, arthritis, 0diabetic neovascularization, macular degeneration, wound healing, peptic ulcer, Helicobacter related diseases, fractures, keloids, vasculogenesis, hematopoiesis, ovulation, menstruation, placentation, and cat scratch fever. 00 00 00
41. A method of treating a human or animal in need of an immune response to a growth factor comprising administering to a human or animal an effective amount of a growth factor composition, wherein the composition comprises, an immunogenic peptide fragment of fibroblast growth factor and a pharmaceutically acceptable carrier such that the composition is immunogenic for fibroblast growth factor when administered to a human or animal.
42. The method of Claim 41, wherein the immunogenic peptide comprises SEQ ID NOS: 1 and 2.
43. The method of Claim 41, wherein the pharmaceutically acceptable carrier comprises liposomes, colloidal gold, and carrier proteins.
44. A method of treating a human or animal in need of an immune response to a growth factor comprising administering to a human or animal an effective amount of a growth factor composition, wherein the composition comprises, an immunogenic peptide fragment of vascular endothelial growth factor and a pharmaceutically acceptable carrier such that the composition is immunogenic for vascular endothelial growth factor when administered to a human or animal. The method of Claim 44, wherein the immunogenic peptide comprises SEQ ID NOS: 3-9.
46. The method of Claim 44, wherein the pharmaceutically acceptable carrier comprises liposomes, colloidal gold, and carrier proteins.
Applications Claiming Priority (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US09/266543 | 1999-03-11 | ||
US09/266,543 US6805865B1 (en) | 1993-05-27 | 1999-03-11 | Compositions and methods for treating cancer and hyperproliferative disorders |
PCT/US2000/006320 WO2000053219A2 (en) | 1999-03-11 | 2000-03-10 | Compositions and methods for treating cancer and hyperproliferative disorders |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU33972/00A Division AU776473C (en) | 1999-03-11 | 2000-03-10 | Compositions and methods for treating cancer and hyperproliferative disorders |
Publications (2)
Publication Number | Publication Date |
---|---|
AU2004237888A1 true AU2004237888A1 (en) | 2005-01-13 |
AU2004237888B2 AU2004237888B2 (en) | 2008-04-10 |
Family
ID=23015010
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU33972/00A Ceased AU776473C (en) | 1999-03-11 | 2000-03-10 | Compositions and methods for treating cancer and hyperproliferative disorders |
AU2004237888A Ceased AU2004237888B2 (en) | 1999-03-11 | 2004-12-09 | Compositions and methods for treating cancer and hyperproliferative disorders |
Family Applications Before (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
AU33972/00A Ceased AU776473C (en) | 1999-03-11 | 2000-03-10 | Compositions and methods for treating cancer and hyperproliferative disorders |
Country Status (6)
Country | Link |
---|---|
EP (1) | EP1156824A2 (en) |
JP (1) | JP2002538219A (en) |
KR (1) | KR20010102556A (en) |
AU (2) | AU776473C (en) |
CA (1) | CA2364503A1 (en) |
WO (1) | WO2000053219A2 (en) |
Families Citing this family (16)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
FR2814744B1 (en) * | 2000-10-04 | 2002-11-29 | Commissariat Energie Atomique | CYCLOPEPTIDES, THEIR PREPARATION PROCESS AND THEIR USE AS ANGIOGENESIS INHIBITOR OR ACTIVATOR |
ITRM20010088A1 (en) * | 2001-02-21 | 2002-08-21 | Idi Irccs | PEPTIDE ABLE TO INHIBIT THE ACTIVITY OF THE GROWTH FACTOR DERIVED FROM THE PLATES (PDGF-BB) AND OF THE GROWTH FACTOR DERIVED FROM THE FI |
JP2005515157A (en) * | 2001-05-25 | 2005-05-26 | トマス ジェファソン ユニバーシティ | Alternative splice forms as the main component for a variety of treatment modalities |
US7186693B2 (en) | 2001-08-16 | 2007-03-06 | Kimberly - Clark Worldwide, Inc. | Metalloproteinase inhibitors for wound healing |
US7071164B2 (en) | 2001-08-16 | 2006-07-04 | Kimberly-Clark Worldwide, Inc. | Anti-cancer and wound healing compounds |
US6906036B2 (en) * | 2001-08-16 | 2005-06-14 | Kimberly-Clark Worldwide, Inc. | Anti-aging and wound healing compounds |
FR2838444B1 (en) * | 2002-04-10 | 2016-01-01 | Neovacs | NEW PEPTIDES AND THEIR THERAPEUTIC APPLICATION |
CU23178A1 (en) | 2002-04-15 | 2006-09-22 | Ct Ingenieria Genetica Biotech | ANTIANGIOGEN ACTIVE ACTIVE IMMUNOTHERAPY |
US7148194B2 (en) | 2002-12-30 | 2006-12-12 | Kimberly-Clark Worldwide, Inc. | Method to increase fibronectin |
US7189700B2 (en) | 2003-06-20 | 2007-03-13 | Kimberly-Clark Worldwide, Inc. | Anti-chrondrosarcoma compounds |
KR100768265B1 (en) * | 2005-11-10 | 2007-10-17 | 한국화학연구원 | Heparin coated liposomes to prolong circulation time in bloodstream and preparation method thereof |
CN105664147A (en) * | 2007-02-07 | 2016-06-15 | 日本电气株式会社 | Therapeutic agent for cancer |
US20100316639A1 (en) | 2009-06-16 | 2010-12-16 | Genentech, Inc. | Biomarkers for igf-1r inhibitor therapy |
FR2990352A1 (en) * | 2012-05-10 | 2013-11-15 | Univ Paris 13 | IMMUNOGENIC COMPOSITION COMPRISING A VEGF DERIVED PEPTIDE AND USES THEREOF |
WO2020110154A1 (en) * | 2018-11-30 | 2020-06-04 | Bharat Biotech International Limited | A chimeric therapeutic vaccine |
CU24637B1 (en) | 2019-12-24 | 2022-12-12 | Ct Ingenieria Genetica Biotecnologia | POLYPEPTIDES INCLUDING HUMAN VEGF-A MUTANTS WITH DISULFIDE BRIDGE RE-ARRANGEMENTS AND COMPOSITIONS CONTAINING THEM |
Family Cites Families (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
EP0702563B1 (en) * | 1993-05-27 | 2003-08-06 | EntreMed, Inc. | Compositions and methods for treating cancer and hyperproliferative disorders |
DE69434279T2 (en) * | 1993-12-09 | 2006-04-06 | Centro De Inmunologia Molecular | Vaccine containing a human autologous epidermal growth factor and its use |
JPH09316000A (en) * | 1996-05-31 | 1997-12-09 | Toagosei Co Ltd | Vaccine for suppressing arterialization |
EP1032583A4 (en) * | 1998-03-06 | 2005-02-02 | Imclone Systems Inc | Active immunization against angiogenesis-associated antigens |
-
2000
- 2000-03-10 AU AU33972/00A patent/AU776473C/en not_active Ceased
- 2000-03-10 KR KR1020017011491A patent/KR20010102556A/en not_active Application Discontinuation
- 2000-03-10 EP EP00912209A patent/EP1156824A2/en not_active Withdrawn
- 2000-03-10 CA CA002364503A patent/CA2364503A1/en not_active Abandoned
- 2000-03-10 WO PCT/US2000/006320 patent/WO2000053219A2/en not_active Application Discontinuation
- 2000-03-10 JP JP2000603708A patent/JP2002538219A/en not_active Withdrawn
-
2004
- 2004-12-09 AU AU2004237888A patent/AU2004237888B2/en not_active Ceased
Also Published As
Publication number | Publication date |
---|---|
CA2364503A1 (en) | 2000-09-14 |
AU776473B2 (en) | 2004-09-09 |
AU3397200A (en) | 2000-09-28 |
JP2002538219A (en) | 2002-11-12 |
EP1156824A2 (en) | 2001-11-28 |
AU2004237888B2 (en) | 2008-04-10 |
WO2000053219A3 (en) | 2001-01-25 |
AU776473C (en) | 2005-04-14 |
KR20010102556A (en) | 2001-11-15 |
WO2000053219A2 (en) | 2000-09-14 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2004237888B2 (en) | Compositions and methods for treating cancer and hyperproliferative disorders | |
US5919459A (en) | Compositions and methods for treating cancer and hyperproliferative disorders | |
ES2255027T3 (en) | ANTAGONISTS OF GROWTH FACTORS OF VASCULAR ENDOTHELIAL CELLS. | |
JP5249043B2 (en) | Therapeutic vaccine | |
EP1056845B1 (en) | Immunological compositions to modulate myostatin in vertebrate subjects | |
CZ291047B6 (en) | Pharmaceutical composition containing antagonists of growth factor of vascular endothelial cells | |
JP2002518347A (en) | Immunotherapeutic compositions and methods for treating prostate cancer | |
US20130243822A1 (en) | Composition and Method for Healing of Skin Wounds | |
US6805865B1 (en) | Compositions and methods for treating cancer and hyperproliferative disorders | |
SK6542002A3 (en) | The use of antibodies for the production of pharmaceutical composition useful as vaccines | |
US20040248799A1 (en) | Compositions and methods for treating cancer and hyperproliferative disorders | |
RU2321422C2 (en) | Combinations of growth-regulating factors and hormones for neoplasia treatment | |
US20050169929A1 (en) | Use of a vaccine for active immunization against cancer | |
CN113278634A (en) | Novel vaccine for preventing and treating merkel cell carcinoma | |
JP5960064B2 (en) | Immunogenic compositions against human progastrin peptides | |
CN102311485A (en) | Polypeptide with neovascularization suppression effect and application thereof | |
EP1027071A2 (en) | Encapsulated immunomodulators useful as vaccine adjuvants | |
CN118403154A (en) | Anticancer pharmaceutical composition and application thereof | |
AU2003200723B2 (en) | Encapsulated immunomodulators useful as vaccine adjuvants |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
MK17 | Application lapsed reg. 22.2b(2) - non-payment of filing fees | ||
NB | Applications allowed - extensions of time section 223(2) |
Free format text: THE TIME IN WHICH TO PAY THE FILING FEE HAS BEEN EXTENDED TO 16 MAR 2005. |
|
FGA | Letters patent sealed or granted (standard patent) | ||
MK14 | Patent ceased section 143(a) (annual fees not paid) or expired |