WO2016166568A1 - Methods, kits and apparatus for expanding a population of cells - Google Patents

Methods, kits and apparatus for expanding a population of cells Download PDF

Info

Publication number
WO2016166568A1
WO2016166568A1 PCT/IB2015/002162 IB2015002162W WO2016166568A1 WO 2016166568 A1 WO2016166568 A1 WO 2016166568A1 IB 2015002162 W IB2015002162 W IB 2015002162W WO 2016166568 A1 WO2016166568 A1 WO 2016166568A1
Authority
WO
WIPO (PCT)
Prior art keywords
binding
agent
cells
reagent
streptavidin
Prior art date
Application number
PCT/IB2015/002162
Other languages
French (fr)
Inventor
Tom KOWSKI
Thomas Schmidt
Ken PRENTICE
Original Assignee
Juno Therapeutics Gmbh
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Priority claimed from PCT/EP2015/058339 external-priority patent/WO2015158868A2/en
Application filed by Juno Therapeutics Gmbh filed Critical Juno Therapeutics Gmbh
Publication of WO2016166568A1 publication Critical patent/WO2016166568A1/en

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C12BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
    • C12NMICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
    • C12N5/00Undifferentiated human, animal or plant cells, e.g. cell lines; Tissues; Cultivation or maintenance thereof; Culture media therefor
    • C12N5/06Animal cells or tissues; Human cells or tissues
    • C12N5/0602Vertebrate cells
    • C12N5/0634Cells from the blood or the immune system
    • C12N5/0636T lymphocytes
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/46Cellular immunotherapy
    • A61K39/461Cellular immunotherapy characterised by the cell type used
    • A61K39/4611T-cells, e.g. tumor infiltrating lymphocytes [TIL], lymphokine-activated killer cells [LAK] or regulatory T cells [Treg]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/46Cellular immunotherapy
    • A61K39/463Cellular immunotherapy characterised by recombinant expression
    • A61K39/4631Chimeric Antigen Receptors [CAR]
    • AHUMAN NECESSITIES
    • A61MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61KPREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K39/00Medicinal preparations containing antigens or antibodies
    • A61K39/46Cellular immunotherapy
    • A61K39/464Cellular immunotherapy characterised by the antigen targeted or presented
    • A61K39/4643Vertebrate antigens
    • A61K39/4644Cancer antigens
    • A61K39/464402Receptors, cell surface antigens or cell surface determinants
    • A61K39/464411Immunoglobulin superfamily
    • A61K39/464412CD19 or B4
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K14/00Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/705Receptors; Cell surface antigens; Cell surface determinants
    • C07K14/70503Immunoglobulin superfamily
    • C07K14/7051T-cell receptor (TcR)-CD3 complex
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2319/00Fusion polypeptide
    • C07K2319/01Fusion polypeptide containing a localisation/targetting motif
    • C07K2319/03Fusion polypeptide containing a localisation/targetting motif containing a transmembrane segment

Definitions

  • the present disclosure relates in some aspects to the incubation or culturing, such as to induce stimulation of expansion (proliferation), activation, costimulation and/or survival, of a composition of cells such as a population of lymphocytes.
  • the disclosure provides methods and reagents for the stimulation, e.g., of expansion (proliferation), survival or persistence, activation, costimulation, or other effect, of cell populations that involve binding of agents to a molecule on the surface of the cells, thereby providing one or more signals to the cells.
  • the reagents are reagents containing a plurality of binding sites for agents, such as multimerization reagents, and thus the one or more agents are multimerized by reversibly binding to the reagent, e.g., thereby creating a stimulatory reagent (multimerized agent), having stimulatory agents multimerized thereon.
  • the multimerized agent can provide for expansion or proliferation or other stimulation of a population of cells, and then such stimulatory agents can be removed by disruption of the reversible bond.
  • compositions, apparatus and methods of use thereof are compositions, apparatus and methods of use thereof. Background
  • Figure 1 provides schematic representations of exemplary embodiments.
  • Figure 1A shows a schematic representation of a reagent (or representative portion thereof) with a plurality of binding sites for reversible binding to agents.
  • the reagent is shown as capable of reversibly binding to two agents, each of which is capable of specifically binding to a molecule on a cell.
  • the reagent has a plurality of binding sites, including a plurality of the binding site, Zl, each capable of reversibly binding to the agents.
  • the first and second agents which, in some cases, can be the same, in the schematic
  • binding partner CI reversibly binds to binding site Zl.
  • the first and second agents each also contain a binding site, B2, which can specifically bind to a molecule on the surface of a cell, which, in some cases, can be on the same cell.
  • B2 binding site
  • the first and second agents are shown specifically binding to molecules on the same cell.
  • Figure IB shows a schematic representation of a reagent with a plurality of binding sites, capable of reversibly binding to a first and second agent, which agents are each capable of specifically binding to a molecule on a first and second cell, respectively.
  • the reagent has a plurality of binding sites Zl, each capable of reversibly binding to an agent.
  • the first and second agents which, in some cases, can be the same, each contain a binding partner CI, which reversibly binds to binding site Zl.
  • the first and second agents each contain a binding site B2, which can specifically bind to a molecule on the surface of a cell, which, in some cases, can be on the same cell or a different cell.
  • the first agent is bound to a molecule on the surface of a first cell and the second agent is bound to a molecule on the surface of a second cell.
  • Figure 1C shows a reagent capable of reversibly binding to a first and second agents, which agents are each capable of specifically binding to a molecule on a first and second cell, respectively.
  • the reagent has a plurality of binding sites Zl and Z2, which can be the same or different, each capable of reversibly binding to one or both of the agents.
  • the first agent contains a binding partner CI, which reversibly binds to Zl; the second agent contains a binding partner C2, which can reversibly bind to Z2.
  • CI and C2 are different.
  • CI and C2 are the same or substantially the same.
  • the first agent contains a binding site Bl, which can specifically bind to a molecule on the surface of a cell and the second agent contains at least one binding site B3, which can specifically bind to a molecule on the surface of a cell. Binding sites Bl and B3 in some cases bind to two different cell surface molecules, or different epitopes on a single molecule, or the same or different molecules on the surface of different cells.
  • the first agent is shown as being bound, via Bl, to a molecule on the surface of a first cell
  • the second agent is bound to a molecule on the surface of a second cell.
  • Figure ID shows a reagent capable of reversibly binding to a first and second agent, such as selection agents, which are each capable of specifically binding to a molecule on a cell.
  • the reagent has a plurality of binding sites, including Zl and Z2, which can be the same or different, each capable of reversibly binding to an agent.
  • the first agent contains a binding partner CI that can specifically bind to binding site Zl and the second agent contains at least one binding partner C2 that can specifically bind to binding site Z2.
  • CI and C2 are different.
  • CI and C2 are the same or substantially the same.
  • the first agent contains a binding site Bl, which can specifically bind to a molecule on the surface of a cell and the second agent contains a binding site B3, which can specifically bind to a molecule on the surface of a cell.
  • the first agent and second agent can be a selection agent.
  • Binding sites Bland B3 can bind the same or different molecules (e.g. receptor) on the surface of a cell, the same or different epitopes on a molecule, or the same or different molecules on the surface of different cells.
  • the first agent is bound to a first molecule on the surface of a cell and the second agent is bound to a second molecule on the surface of the same cell.
  • Figure IE shows a reagent reversibly bound to a first and second agent, which agents are each capable of specifically binding to a molecule on a cell.
  • the reagent has a plurality of binding sites, including Zl and Z2, which can be the same or different, each capable of reversibly binding to an agent.
  • the first agent contains a binding partner CI that can reversibly bind to Zl of the reagent and the second agent contains a binding partner C2 that can reversibly bind to Z2.
  • CI and C2 are different.
  • CI and C2 are the same or substantially the same.
  • the first agent contains at least one binding site B2, which can specifically bind to a molecule on the surface of a cell and the second agent contains at least one binding site B4, which can specifically bind to a molecule on the surface of a cell.
  • the first agent and second agent can be stimulatory agents. Binding sites B2 and B4 can bind the same or different molecules on the surface of a cell, the same or different epitopes on a molecule, or the same or different molecules on the surface of different cells.
  • the first agent is bound to a first molecule on the surface of a cell and the second agent is bound to a second molecule on the surface of the same cell.
  • Figure 2 which includes Figures 2A-2E, provide schematic representations of exemplary embodiments as shown in Figures 1A-1E, respectively, except that the depicted reagents are shown as being immobilized on a support, such as a stationary phase.
  • FIG. 3 provides a schematic representation of exemplary embodiments in which oligomeric reagents are used to multimerize stimulatory agents and the resulting complexes incubated with cells to deliver signals to the cells, followed by reversal of the binding.
  • Panel A shows an oligomeric reagent 1, which is shown as not bound to any support and as being flexible.
  • the agents comprise a binding partner (e.g. binding partner C) that is capable of reversibly binding to a binding site (e.g. binding site Z) on the reagent, multimerizing the agents.
  • Panel B depicts the binding partner reversibly binding to a binding site on the reagent.
  • Cells 3 are added to the system.
  • Panel C depicts the multimerized agents (Fab fragments) specifically binding to the molecules 4 on the surface of a cell 3.
  • the depicted agents are stimulatory receptor- binding agents, (e.g. a first receptor-binding agent and/or a second receptor-binding agent), which can induce or modulate a signal in a cell upon binding of the agent, to the molecule on the cell.
  • a substance 5 such as a competitive reagent (e.g.
  • the composition which can be a substance that exhibits a higher binding affinity for the binding site on the reagent than for the binding partner on the agent, thereby disrupting the reversible binding between the reagent 1 and the agent 2.
  • the agent e.g., Fab fragment also can dissociate from its interaction with the molecule 4 on the cell 3. In some cases, this can disrupt, lessen and/or terminate the signaling in the cell.
  • FIG. 4 provides a schematic representation of exemplary embodiments of a reversible system attached to a support, such as a solid support or a surface, including a stationary phase.
  • Panel A shows a support 6 containing the reagent 1.
  • Agents 2, such as Fab fragments, that are capable of specifically binding to a molecule on the surface of a cell are added to the system.
  • the agents 2, such as Fab fragments comprise a binding partner (e.g. binding partner C) that is capable of reversibly binding to a binding site (e.g. binding site Z) on the reagent.
  • Panel B depicts the binding partner reversibly binding to a binding site on the reagent.
  • Cells 3 are added to the system.
  • Panel C depicts the agents 2, e.g.
  • the scFvs comprise a receptor-binding agent or a selection agent.
  • the agents, e.g. Fab fragments can be a receptor-binding agent or a selection agent.
  • Panel C depicts an exemplary receptor-binding agent or agents (e.g. a first receptor-binding agent and/or a second receptor- binding agent), which can induce or modulate a signal in a cell upon binding of the agent, e.g. Fab fragment, to the molecule on the cell.
  • a substance 5, such as a competitive reagent e.g.
  • biotin is added, which can be a substance that exhibits a higher binding affinity for the binding site on the reagent than for the binding partner on the agent, e.g. Fab fragment, thereby disrupting binding between the reagent and the agent.
  • Panel D depicts disruption of the binding between the agent 2, e.g. Fab fragment, and the reagent, thereby resulting in dissociation of the reagent from the agent, and thereby the cell.
  • the agent e.g. Fab fragment
  • the agent e.g. Fab fragment
  • this can disrupt, lessen and/or terminate the signaling in the cell.
  • Figure 5 shows the results of an experiment in which CD3+ T responder cells were proliferated after being stimulated in vitro with aCD3 and aCD28 Fab fragments that were reversibly immobilized on beads coated with the streptavidin mutein Strep-tactin®.
  • Fig. 5 A is a histogram showing size-distribution (forward scatter) of stimulated cells
  • Fig. 5B depicts histograms representing the degree of proliferation according to the number of cells per cell division that are indicated on top of Fig. 5B (0 represents undivided cells; 5 represents cells that have gone through at least 5 divisions)
  • Fig. 5C shows a picture of the culture dish after 4 days of stimulation.
  • Figure 6 shows the results of an experiment in which CD3+ T responder cells were proliferated after being stimulated in vitro with reversible aCD3/aCD28 Fab fragments that were reversibly immobilized on soluble oligomeric streptavidin mutein acting a soluble reagent. For the experiments the results of which are shown in Fig.
  • CD3+ responder T cells were labeled with 2 ⁇ Carboxyfluorescein succinimidyl ester (CFSE) and stimulated with varying amounts of a preparation of soluble oligomeric streptavidin mutein on which a combination of aCD3 Fab fragment and aCD28 Fab both carrying a Strep-tag as streptavidin binding peptide at the heavy chain were immobilized, ("lx" corresponds to 3 ⁇ g oligomeric streptavidin mutein functionalized with O ⁇ g aCD3- and O ⁇ g aCD28 Fab; numbers indicate fold amount of "lx").
  • CFSE Carboxyfluorescein succinimidyl ester
  • Tresp cells either left unstimulated or were stimulated with blank oligomeric streptavidin muteins (no Fab) served as negative control.
  • Tresp cells were seeded in duplicates in 48-well plates along with 300,000 CD3 negative autologous feeder cells (irradiated with 30Gy) in 1ml cell culture medium supplemented with 20U/ml interleukin 2 (IL-2). Cells were incubated at 37 °C without media exchange and proliferation was analyzed according to CFSE dilution after 5 days by FACS analysis (Fig. 6B).
  • Fig. 6A shows size distribution of cells after 5 days in culture. Histograms show live CD3+ cells, while Fig.
  • FIG. 6C shows cells after culture that were liberated by stimulation reagents after treated with ImM D-biotin and washed. The dissociation and removal of monomeric Fab fragments was analyzed by restaining with oligomeric streptavidin mutein labeled with phycoerythrine (ST-PE) as a fluorescent label and a representative histogram is shown.
  • Fig. 6D shows the absolute number of live (trypan blue negative) cells after 5 days was counted using a Neubauer counting chamber and plotted against the respective stimulation condition. Median cell numbers are shown in Fig. 6D; error bars indicate standard deviation (SD).
  • Fig. 6E shows a picture of the culture dish after 5 days of stimulation.
  • Figure 7 shows the expansion kinetics of proliferation of purified CD4+ and CD8+ T responder cells (Tresp) that were stimulated in vitro either with aCD3/aCD28 Fab fragments or with aCD3/aCD28/aCD8 that were reversibly immobilized on two kinds of a soluble oligomeric streptavidin mutein acting as soluble reagent.
  • the first kind of oligomeric streptavidin mutein was the fraction of the oligomeric streptavidin mutein (n> 3) obtained in Example 3 (also referred herein as "conventional” or "smaller” oligomeric streptavidin mutein backbone, illustrated by the triangle symbol with the tip down in Fig.
  • the second kind of this oligomeric streptavidin mutein used as soluble reagent was an oligomer that was obtained by reacting the soluble oligomeric streptavidin mutein with biotinylated human serum albumin (HSA).
  • HSA biotinylated human serum albumin
  • This HSA based soluble reagent is also referred herein as "larger" oligomeric streptavidin mutein backbone).
  • the expansion was carried out without medium exchange.
  • the results for the CD4+ T responder cells are shown in Fig.7A
  • the results for the CD8+ T responder cells are shown in Fig. 7B.
  • the experimentally used soluble reagents that were functionalized by reversibly binding first agents, and optionally second and third agents are referred to in the Figures as "Streptamer® multimers.”
  • Figure 8 shows the expansion kinetics of proliferation of purified CD4+ and CD8+ T responder cells (Tresp) that were stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized fragments that were reversibly immobilized with two kinds of soluble oligomeric streptavidin mutein acting as soluble reagent.
  • the first kind of oligomeric Strep- tactin® was the fraction of the oligomeric streptavidin mutein (n> 3) obtained in Example 3 (also referred herein as "conventional oligomeric streptavidin mutein backbone", illustrated by the triangle symbol with the tip on top in Fig.
  • the second kind of this oligomeric streptavidin mutein used as soluble reagent was the HSA based soluble reagent, the above-mentioned "large backbone").
  • the expansion was carried out with medium exchange.
  • the results for the CD4+ T responder cells are shown in Fig. 8A, the results for the CD8+ T responder cells are shown in Fig. 8B.
  • Figure 9 shows the combined data from the results obtained in Figs 7 and 8 for the expansion kinetics of proliferation of purified CD4+ and CD8+ T responder cells, with Fig. 9A depicting the results for CD4+ T cells and Fig. 9B depicting the results for the CD8+ T cells.
  • Straight lines are used for the culturing with medium exchange on day 3, while dashed lines depict the values obtained for the degree of expansion without media exchange on day 3.
  • the data shown in Fig. 9 are normalized on the input cell number.
  • Figure 10 shows the expansion kinetics and phenotype of CD3+ central memory T cells (Tern) (CD3+CD62L+CD45RA-Tcm) polyclonally stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on the soluble oligomeric streptavidin mutein (with n> 3) described in Example 3.
  • the graphs shown in Fig. 10 represent the degree of proliferation according to the number of cells harvested per time point, with Fig. 10A showing the proliferation in only IL-2 supplemented media and in Fig. 10B showing the proliferation in IL-2 and IL-15 supplemented media.
  • Fig. IOC shows a flow-cytometric analysis of CD62L and CD 127 surface expression after 14 days of culture in these variable cytokine milieus.
  • Figure 11 shows the yield and phenotype of expansion of purified CD8+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on two kinds of soluble oligomeric streptavidin muteins acting a soluble reagent.
  • the first kind of oligomeric streptavidin mutein was the fraction of the oligomeric streptavidin mutein (obtained in Example 3 (conventional backbone)
  • the second kind of this oligomeric streptavidin mutein used as soluble reagent was the soluble oligomer described above and referred herein as "large" backbone.
  • the fraction of the oligomeric conventional streptavidin mutein (n> 3) was also used as a reagent that were either functionalized with single Fab fragments (third bar in Fig. 11 A and Fig. 1 IB) or with a combination of aCD3 and aCD28 Fab-fragments.
  • Fig. 11 A shows a graph of bars that represent the degree of proliferation according to the number of cells harvested at day 6 compared to the negative controls
  • Fig. 11B shows flow- cytometric analysis of the surface expression of CD8 and the T cell surface molecule CD45RO (that is indicative of T cell proliferation and activation) after cell culture. The various stimulating conditions were compared using one-way ANOVA and no significant difference (n.s.) was detected.
  • Figure 12 shows the yield and phenotype for the expansion of purified CD8+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on soluble oligomeric streptavidin mutein acting as a soluble reagent that were either functionalized with single Fab fragments or with a combination of Fab-fragments (as already described above).
  • the CD8+ T responder cells were stimulated with the soluble reagent (the soluble oligomeric streptavidin mutein (lmg/ml) of Example 3) which was functionalized with varying amounts of aCD3 and aCD28 Fab fragments, optionally together with the aCD8 Fab fragment described above.
  • lx corresponds to l ⁇ g oligomeric streptavidin mutein functionalized with O ⁇ g aCD3 Fab fragment alone and l ⁇ g oligomeric streptavidin mutein functionalized with O ⁇ g aCD28 Fab alone), or 3 ⁇ 1 of a preparation of oligomeric streptavidin mutein loaded with O ⁇ g aCD3 Fab fragment and O ⁇ g aCD28 Fab, or 4.5 ⁇ 1 of a preparation of oligomeric streptavidin mutein loaded with O ⁇ g strep- tagged aCD3, O ⁇ g strep-tagged aCD8 and O ⁇ g strep-tagged aCD28 Fab.
  • the term "2x" corresponds to 3.0 ⁇ g oligomeric streptavidin mutein functionalized with ⁇ g aCD3 Fab fragment alone and 3.0 ⁇ g oligomeric streptavidin mutein functionalized with ⁇ g aCD28 Fab alone, meaning that twice the amount of immobilized aCD3 Fab fragment was used.
  • Fig. 12A shows a graph in which the bars represent the degree of proliferation according to the number of cells harvested at day 5 compared to the negative controls and normalized to the positive control.
  • Fig. 12B shows FACS analysis of CD8 and CD45RO surface expression after cell culture.
  • Figure 13 shows the expansion of purified CD3+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on the soluble oligomeric streptavidin mutein of Example 3 that served as a soluble reagent.
  • aCD8 Fab fragment commercially available from IBA GmbH, Gottingen, Germany (catalogue number 6-8000-203) was immobilized on the soluble oligomer of the streptavidin mutein in order to test whether it is possible to preferentially stimulate in vitro the CD8+ T cell subpopulation within the bulk CD3+ culture with a reagent having reversibly immobilized thereon also an aCD8 Fab fragment.
  • Tresp purified CD3+ responder T cells
  • oligomeric streptavidin mutein loaded with 0 ⁇ g aCD3, 0 ⁇ g aCD8 Fab and 0 ⁇ g aCD28 Fab described above.
  • Unstimulated Tresp cells served as negative control and Tresp stimulated with Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) served as positive control.
  • FIG. 14 shows the results of the differential intracellular calcium mobilization in Jurkat cells that are either labelled with the aCD3 antibody OKT3 or with Fab fragments of OKT3 being multimerized with Strep-tactin® (also referred to as Fab multimers herein).
  • Fig. 14A Jurkat cells were loaded with the calcium- sensitive dye Indo-l-AM and calcium release was triggered by injection of either aCD3 mAb (black squares) or aCD3 OKT3 Fab multimers (derived from the parental cell line OKT3) with or without prior D-biotin disruption (dark grey triangles and light grey circles respectively) compared to injection of PBS (inverted white triangles). Application of ionomycine served as positive control.
  • Figure 15 shows the result of the reversible staining of cells by anti CD3 OKT3 Fab- multimers.
  • Freshly isolated PBMCs were stained with either a monoclonal antibody (left dot plot, parental clone for the Fab-multimers) or cognate PE-labeled Fab-multimers and analyzed either before (second left column) or after treatment with D-biotin (middle column). Remaining Fab monomers were then detected after subsequent washing steps using fresh PE-labeled Strep- Tactin® (second right column). Secondary Fab-multimer staining of reversibly stained cells served as control (right column). Only live (pi ne atlve ) cells are shown. Numbers in dot plots indicate the percentage of cells within gates.
  • Figure 16 shows the isolation of cells by reversible binding of anti-CD28 Fab fragments multimerized with Strep-Tactin® labeled with phycoerythrine as a fluorescent label.
  • CD28+ cells were selected/isolation by Fab-multimer magnetic cell selection from freshly isolated PMBCs as described in International Patent Application WO2013/011011. Before selection cells were control stained with either the cognate fluorescent aCD28-multimers (left dot plot) or with an antibody directed against the immunoglobulin kappa light chain (second left dot plot, a-Ig kappa mAb). After selection, cells were treated with D-biotin and subsequently washed to remove magnetic beads and Fab-monomers. Liberated CD28+ cells were
  • Figure 17 shows early cluster formation of T cells after activation of purified CD4+ and CD8+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on the soluble oligomeric streptavidin mutein (n> 3) described in Example 3.
  • Fig. 17A depicts the results for CD4+ T cells and
  • Fig. 17B depicts the results for the CD8+ T cells.
  • Data for the Tresp stimulated with the soluble multimerization reagent the oligomeric streptavidin mutein
  • FIG. 18 shows the kinetics of selective antigen-specific (Ag- specific) expansion out of a bulk population of purified CD3+CD62L+CD45RA- Tcm responder cells that were stimulated in vitro with both a peptide:MHC molecule complex (that acts as first agent that provides a primary activation signal to the cells) and aCD28 Fab fragment (that acts as second agent that binds the accessory molecule on the surface of the cells) and unstimulated T cells (negative control) are shown.
  • a peptide:MHC molecule complex that acts as first agent that provides a primary activation signal to the cells
  • aCD28 Fab fragment that acts as second agent that binds the accessory molecule on the surface of the cells
  • unstimulated T cells negative control
  • the peptide used for the antigen-specific expansion in Fig. 18A was the peptide CRVLCCYVL (SEQ ID NO: 54), amino acids 309-317 of the immediate-early 1 protein restricted by the HLA-C702 MHC molecule (described in Ameres et al, PLOS Pathogens, May 2013, vol. 9, issue 5, el003383) representing an HLA-C7/IE-1 epitope that is specific for cytomegalovirus (CMV).
  • CMV cytomegalovirus
  • the MHC I molecule that presents the peptide carries at its C-terminus of the heavy chain the streptavidin binding peptide (S AWSHPQFEK(GGGS ) 2 GGS AWSHPQFEK (SEQ ID NO: 16), that is commercially available as "Twin-Strep-tag®” from IB A GmbH, Gottingen, Germany).
  • Fig. 18A shows exemplary flow- cytometric analysis for the fraction of the Ag- specific cells that were proliferated using the peptide:MHC-I complex specific for this HLA-C7/IE-1 epitope as first agent that provides a primary activation signal to the cells reversibly immobilized on the soluble oligomeric streptavidin mutein.
  • the graphs in Fig.l8B to Fig.l8E illustrates the expansion kinetics of further Ag- specificities according to the number of specific peptide:MHCI multimer-positive cells harvested per time point in analogy to Fig. 18A using distinct complexes of an antigen- specific peptide with the MHC I molecule as first agent that provides a primary activation signal to the cells reversibly immobilized on the soluble oligomeric streptavidin mutein.
  • FIG. 18B shows the expansion of Ag-specific cells that were expanded using the peptide:MHC-I complex specific for the pp65 epitope of CMV (amino acids 341-350 (QYDPVAALF) (SEQ ID NO: 55) restricted by HLA-A2402)
  • Fig. 18C shows the expansion of Ag-specific cells that were expanded using another peptide:MHC-I complex specific for the pp65 epitope of CMV (amino acids 265-274 (RPHERNGFTV) (SEQ ID NO: 56) restricted by HLA-B702)
  • Fig. 18D shows the expansion of Ag-specific cells that were proliferated using the peptide:MHC-I complex specific for the hexon 5 epitope of adenovirus (amino acids 114-124
  • Fig. 18E shows the expansion of Ag-specific cells that were proliferated using the peptide:MHC-I complex specific for the HLA-B7/IE-l 3 o9-3i7 epitope of CMV (exemplary FACS data see above Fig. 18A). All peptide:MHC molecules bearing the Twin Strep®-Tag are commercially available from
  • Fig. 18F shows exemplary flow-cytometric analysis of CD62L and CD 127 surface expression after 14 days of culture for HLA- B7/Hexon5 114-124 stimulated/expanded cells from Fig. 18D.
  • Figure 19 shows the kinetics of selective Ag-specific expansion out of purified CD3+CD62L+CD45RA-Tcm responder cells that were stimulated in vitro with a) antigen specific peptide MHC I complexes and b) aCD28 Fab fragments that were reversibly
  • soluble oligomeric streptavidin muteins immobilized as first and second agent on soluble oligomeric streptavidin muteins.
  • 500.000 CD3+CD62L+CD45RA- responder Tern cells (Tresp) were stimulated Ag- specifically using 3 ⁇ 1 of a preparation of Streptactin multimerization reagent functionalized with 0 ⁇ g peptide:MHC class I complexes equipped with a streptavidin binding peptide (the specific peptide represents amino acids 114-124 (CPYSGTAYNSL, SEQ ID NO: 57) of the Hexon 5 protein of the adenovirus restricted by HLA-B0702, see above) and 0 ⁇ g aCD28 Fab.
  • polyclonal stimulation was performed, using 3 ⁇ 1 of a preparation of Streptactin multimerization reagent (lmg/ml) either loaded with a combination of 0 ⁇ g aCD3 Fab and 0 ⁇ g aCD28 Fab.
  • 4.5 ⁇ 1 of a preparation of Streptactin multimers loaded with 0 ⁇ g aCD3 Fab, 0 ⁇ g aCD8 Fab and 0 ⁇ g aCD28 Fab was used.
  • Tresp cells served as negative control and Tresp cells stimulated polyclonal with Dynabeads as positive control.
  • Tresp cells were seeded in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2 and 5ng/ml IL-15. Cells were incubated at 37 °C with media exchange every 3 days and cell count was analyzed after 7 and 14 days.
  • the photographs shown in Fig. 19 represent the degree of cluster formation on day 5 for Ag-specific stimulation as exemplified for the HLA-B7/Hexon 5 epitope of adenovirus.
  • FIG 20 shows the activation of intracellular signaling cascades of transduced Jurkat cells that have been modified to express an aCD19 chimeric antigen receptor (CAR), and that were stimulated using the oligomeric Strep-tactin® of Example 3 as soluble multimerization reagent.
  • CAR aCD19 chimeric antigen receptor
  • the specificity of a CAR is typically derived from a scFv region assembled from the antigen-binding region of a monoclonal antibody (mAb) that specifically binds a target/tumor associated antigen such as CD 19 and links it to T cell specific signaling (described in Hudecek et al, Clin Cancer Res. 2013 June 15; 19(12): 3153-3164.
  • mAb monoclonal antibody
  • the extracellular domain (ECD) of CD 19, which contains the natural ligand of the ccCD19 CAR as well as the polyclonal algG F(ab) 2 fragment that recognizes the IgG4 spacer (donkey- anti-human F(ab) 2 is commercially available from Jackson Immuno Research) within the aCD19-CAR were also used in this experiment as first agent that provides a primary activation signal to the jurkat cells.
  • the reversibly immobilization to the soluble oligomeric streptavidin mutein was provided by the streptavidin peptide SAWSHPQFEK(GGGS) 2 GGSAWSHPQFEK (SEQ ID NO: 16) that was fused to the C-terminus of the ECD of CD 19 or by the biotinylated (Fab) 2 fragment of the algG (since the streptavidin mutein "m2" binds biotin with reduced affinity, this binding is reversible and can for example be displaced by addition of an excess of free biotin).
  • SAWSHPQFEK(GGGS) 2 GGSAWSHPQFEK SEQ ID NO: 16
  • Jresp cells were seeded in 1.5ml Eppendorf tubes in 200 ⁇ 1 cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37°C and put on ice and lysed after 0 min to 20min of stimulation.
  • the methods relates to reversible reagent systems capable of binding to molecules on the surface of a target cells, such as a receptor binding molecule, thereby providing a signal to the cells, which, in some cases, can be a primary activation signal.
  • the methods employ reagents, which can be multimerization reagent having bound thereon one or more agents, e.g. a first agent, second agent, etc. that provides a signal to the cells, such as a primary activation signal and/or an accessory or costimulatory signal.
  • the primary activation signal may as such be sufficient to activate the cells to expand/proliferate.
  • This first agent can either be bound reversibly or also irreversibly to the multimerization reagent.
  • the multimerization reagent may have bound thereto also a second agent that stimulates an accessory molecule on the surface of the cells.
  • the second agent when binding to the accessory molecule on the surface on the surface of the cells, may thereby stimulate the activated cells to expand.
  • this second agent can either be bound reversibly or also irreversibly to the multimerization reagent.
  • the multimerization agent may either be immobilized on a solid support or soluble.
  • the method disclosed herein is a serial expansion of a population of cells in which a complete population of lymphocytes is stimulated/expanded, the reagents necessary for the expansion are then removed by chromatography on a suitable stationary phase.
  • the expanded/stimulated cells which are the cultured cells, are optionally transfected with e.g. a T cell receptor or a chimeric antigen receptor (CAR) and, in some aspects, can be subjected to a second stimulation expansion with a different stimulatory molecule that binds to the introduced T cell receptor or the chimeric antigen receptor.
  • CAR chimeric antigen receptor
  • the methods provided herein address these concerns.
  • the provided reagents are reversible, such that the stimulating agents can be removed from the cell composition.
  • the reagent, e.g. multimerization reagent, to which the stimulating agents are bound is not immobilized on a support, such as not
  • the reagent e.g.
  • multimerization reagent is flexible and not rigid.
  • the reagent can adapt or conform to the cell surface.
  • such methods can be used in concert with selection methods using similar selection agents in which one or more target cells can be selected and, simultaneously or sequentially, exposed to the stimulatory agents.
  • the stimulation of particular cells or subsets of cells can be biased by selection and isolation in together with stimulation.
  • the provided methods involve culturing, e.g. contacting, a composition of cells with a reagent, e.g. multimerization reagent to which is bound one or more receptor-binding agents (e.g. stimulatory agents) (see e.g. Figure 4A and B).
  • a reagent e.g. multimerization reagent to which is bound one or more receptor-binding agents (e.g. stimulatory agents) (see e.g. Figure 4A and B).
  • receptor-binding agents e.g. stimulatory agents
  • the population of cells after contacting the cell composition with the multimerization reagent and usually incubating the cell population with the multimerization reagent, the population of cells forms complexes/is bound to the multimerization agent via the first agent.
  • the other cell populations contained in the initial sample that lack the specific cell surface molecule do not bind to the multimerization reagent.
  • the cell population usually has multiple copies of the cell surface molecule on its surface and binding of these multiple copies is typically needed for stimulation or activation.
  • the multimerization agent provide typically more than one binding site, e.g. Zl, in which, in some cases, a plurality of agents can be reversibly bound to present the first agent, second agent and/or other agents in a sufficient density to the population of cells.
  • a multimerization agent can as such have multiple binding sites, e.g., Zl, for example, a streptavidin mutein (being a homo-tetramer) in its native state has four such binding sites, e.g. Zl, and can further be oligomerized.
  • a reagent may have only one binding site, e.g.
  • calmodulin for the reversible binding of a binding partner, e.g. CI.
  • a binding partner e.g. CI.
  • Such an example is multimeric calmodulin.
  • Calmodulin as such has only one binding site for calmodulin binding peptides.
  • calmodulin can be biotinylated and then reacted with streptavidin- oligomers (see also below), thereby providing a multimerization reagent in which multiple calmodulin molecules are presented in high density on a "scaffold", thereby providing multimeric calmodulin.
  • the binding between the binding partner C, e.g. CI of a reversibly bound agent and the binding site Z, e.g. Zl, of the multimerization reagent is disrupted by disrupting the respective reversible bond.
  • the disruption may be achieved by adding a competitor to the incubation/reaction mixture containing the population of cells being bound to the multimerization reagent.
  • competitive disruption (which can be understood as being a competitive elution) of the reversible bond between the binding partner C, e.g.Cl, of a reversibly bound agent and the binding site Z, e.g.
  • the incubation mixture/population of cells can be contacted with a free first binding partner C, e.g. CI, or an analog of said first binding partner C that is capable of disrupting the bond between the first binding partner and the binding site Z, e.g. Zl.
  • a free first binding partner C e.g. CI
  • the binding partner C e.g. CI
  • the first free partner may be the corresponding free streptavidin binding peptide or an analogue that binds competitively.
  • an analogue can, for example, be biotin or a biotin derivate such as desthiobiotin.
  • the addition of the free partner or the analog thereof results in displacement of the binding partner C, e.g.Cl, from the multimerization reagent and thus, since the binding partner is comprised in the reversibly bound agent, displacement of such agent from the multimerization reagent is achieved.
  • This displacement of the agent in turn results in a dissociation of the first agent from the cell surface molecule, in particular if the binding affinity of the bond between the first agent and the cell surface receptor has a dissociation constant (3 ⁇ 4) in the range of 10 - " 2 M to 10 - " 13 M and is thus also reversible. Due to this dissociation, in some aspects, the stimulation of the cell population is also terminated.
  • the binding affinity of antibody molecules towards their antigen is usually in the affinity range of the K d of 10 - " 7 M to 10 - " 13 M.
  • conventional monoclonal antibodies can be used as an agent (first or second, receptor-binding, e.g. stimulatory agent, or selection agent).
  • monoclonal antibodies in order to avoid any unwanted avidity effects that lead to a stronger binding, monoclonal antibodies can also be used in form of their monovalent antibody fragments such as Fab-fragments or single chain Fv fragments.
  • the provided method has the added advantage that the stimulated cell population is free of stimulating agents at the end of the stimulation period.
  • all other reagents used in the method namely the agents (e.g. first or second, receptor-binding agents, e.g. stimulatory agents, or selection agents) as well as the competition reagent of the binding partner C, e.g. CI, or the analog thereof can be easily removed from the stimulated cell population via a "removal cartridge" (see e.g. described in International patent application WO 2013/124474).
  • the use of a removal cartridge for removal of the free agent and the competition reagent can include loading the elution sample (e.g. sample obtained after disruption of the reversible binding) onto a second chromatography column.
  • this chromatography column has a suitable stationary phase that is both an affinity chromatography matrix and, at the same time, can act as gel permeation matrix.
  • this affinity chromatography matrix has an affinity reagent immobilized thereon.
  • the affinity reagent may, for instance, be streptavidin, a streptavidin mutein, avidin, an avidin mutein or a mixture thereof.
  • the agent e.g. first or second, receptor-binding agents, e.g. stimulatory agents, or selection agents
  • the competition reagent of the binding partner C, CI bind to the affinity reagent, thereby being immobilized on the chromatography matrix.
  • the elution sample containing the isolated and expanded cell population is being depleted of the agent (e.g. first or second, receptor-binding agents, e.g. stimulatory agents, or selection agents) and the competition reagent.
  • the agent e.g. first or second, receptor-binding agents, e.g. stimulatory agents, or selection agents
  • the competition reagent e.g. the agent for reactants, which in some aspects is an advantageous for use in connection with diagnostic applications (for example, further FACSTM sorting) or for any cell based therapeutic application.
  • the ability to remove the reagent and other components form the composition has the further advantage of being able to avoid any solid support such as magnetic beads. In some embodiments, this means there is no risk or minimal risk of contamination of the activated T cells by such magnetic beads. In some embodiments, this also means that a process that is compliant with GMP standards can be more easily established compared to other methods, such as the use of Dynabeads® in which additional measures have to be taken to ensure that the final expanded T cell population is free of magnetic beads.
  • the use of a soluble multimerization agent makes it much easier to remove the same from the activated cell population (T cells, B cells or also natural killer cells) since the cells can be simple sedimented by centrifugation and the supernatant, including the soluble multimerization agent can be discarded.
  • the soluble multimerization agent can be removed from the expanded cell population in a gel permeations matrix of the removal cartridge, such as described above (e.g. International patent application WO 2013/124474).
  • no solid phase e.g.
  • the present invention also provides for an automated closed system for expansion of the cells that can be integrated into known cell expansion systems such as the Xuri Cell Expansion System W25 and WAVE Bioreactor 2/10 System, available from GE Healthcare (Little Chalfont, Buckinghamshire, United Kingdom) or the Quantum® Cell Expansion System, available from TerumoBCT Inc. (Lakewood, CO, USA).
  • known cell expansion systems such as the Xuri Cell Expansion System W25 and WAVE Bioreactor 2/10 System, available from GE Healthcare (Little Chalfont, Buckinghamshire, United Kingdom) or the Quantum® Cell Expansion System, available from TerumoBCT Inc. (Lakewood, CO, USA).
  • the methods provided herein can include a population of cells that carry at least two specific cell surface molecules.
  • a first cell surface molecule is involved in a primary activation signal to the cell population, while the second cell surface molecule is an accessory molecule on the cell surface that is involved in providing a stimulus to the cells.
  • the cell population is contacted with a first cell surface molecule
  • the multimerization reagent in which is reversibly bound a first agent that provides a primary activation signal to the cells and a second agent that induces or modulates an additional signal, such as stimulates an accessory molecule on the surface of the cells.
  • the population of cells may, for example, be a T cell population in which the cell surface molecule is a TCR/CD3 complex and the cell surface molecule is the accessory molecule CD28.
  • stimulation through such other accessory molecules can result in an increase in a less- differentiated, and, in some cases, a long-lived population T cells such as long-lived memory T cells as compared to conventional stimulation through CD28.
  • binding of both the TCR/CD3 complex as the primary activation signal and binding of the accessory molecule can be necessary for expansion/proliferation of T cells.
  • the methods provided herein also can be further combined to include at least one selection agent reversibly bound to the same reagent, e.g. same
  • the multimerization reagent as either or both of the first or second receptor-binding agent (e.g. stimulatory agent).
  • the first or second receptor-binding agent e.g. stimulatory agent
  • the degree of expansion in a composition of T cells was selectively increased in CD8+ cells when such cells were incubated with a multimerized agent to which was reversibly bound an anti-CD8 antibody in addition to the anti-CD3 antibody and anti-CD28 antibody stimulatory agents.
  • one or more features resulting from the incubation or culture can be increased at least 1.5-fold, at least 2.0-fold, at least 3.0-fold, at least 4.0-fold, at least 5.0-fold, at least 6.0-fold, at least 7.0-fold, at least 8.0-fold, at least 9.0-fold, at least 10-fold or more in a subset of T cell in the cultured composition that are positive for a selection marker when incubated in the presence of the one or more stimulatory agents and the selection agent that specifically binds to the selection marker compared to the incubation only in the presence of the one of more stimulatory agents but not the selection agent.
  • the selection marker can be any selection marker as described herein.
  • the selection marker is selected from among CD25, CD28, CD62L, CCR7, CD27, CD 127, CD3, CD4, CD8, CD45RA, and/or CD45RO
  • the multimerization reagent comprises at least one binding site Z, e.g. Zl, for the reversible binding of the first agent and the first agent also comprises at least one binding partner C, e.g. CI, wherein the binding partner C, e.g. CI, is able of reversibly binding to the binding site Z, e.g. Zl, of the multimerization reagent.
  • the first agent when contacted or incubated with the multimerization agent, can be reversibly bound to the multimerization reagent via the reversible bond formed between the binding partner C, e.g. CI, and the binding site Z, e.g. Zl.
  • the second agent can comprises a binding partner C, e.g. C2, wherein the binding partner C2 is able of being reversibly bound to a binding site Z, e.g. Z2, respectively, of the multimerization reagent.
  • the second agent when it is contacted or incubated with the multimerization agent, is reversibly bound to the
  • CI and C2 can be the same or substantially the same and/or comprise the same or substantially the same moiety.
  • Zl and Z2 can be the same or substantially the same and/or comprise the same or substantially the same moiety.
  • moieties that bind to the same binding site of the multimerization agent has the advantage that the same competition reagent (of the first binding partner CI and also of the second binding partner C2) or analog thereof can be used to disrupt, and in some cases terminate, the expansion of the population of target cells (e.g. T cells) and to release this population of target cells (e.g. T cells) from the multimerization agent.
  • the binding agents e.g. e.g. first or second, receptor- binding agents, e.g. stimulatory agents, or selection agents
  • the binding partner C e.g. CI or C2
  • the agent e.g. antibody fragment
  • the binding partner C e.g. CI or C2
  • the binding partner C is part of a fusion peptide with the agent at either the N-terminus or C-terminus.
  • the binding partner C e.g.
  • an antibody molecule can be generated of artificial binding molecules with antibody like properties against a given target, such as CD3 or CD28 or other accessory or stimulatory agent molecules as described, such as by well-known evolutive methods such as phage display (reviewed, e.g., in Kay, B.K. et al. (1996) Phage Display of Peptides and Proteins - A Laboratory Manual, 1 st Ed., Academic Press, New York NY;
  • the methods employ reversible systems in which at least one agent (e.g., a receptor-binding agent or selection agent) capable of binding to a molecule on the surface of a cell (cell surface molecule), is reversibly associated with a reagent.
  • the reagent contains a plurality of binding sites capable of reversibly binding to the agent (e.g., receptor-binding agent or selection agent).
  • the reagent is a multimerization reagent.
  • the at least one agent e.g., receptor-binding agent or selection agent
  • the binding interaction between the binding partner C and the at least one binding site Z is a non-covalent interaction.
  • the binding interaction, such as non-covalent interaction, between the binding partner C and the at least one binding site Z is reversible.
  • the reversible association can be mediated in the presence of a substance, such as a competition reagent (also called an eluent reagent), that is or contains a binding site that also is able to bind to the at least one binding site Z.
  • a substance such as a competition reagent (also called an eluent reagent)
  • the substance e.g. competition reagent
  • the affinity of the substance e.g.
  • competition reagent for the at least one binding site Z is greater than the affinity of the binding partner C of the agent (e.g., receptor- binding agent or selection agent) for the at least one binding site Z.
  • the bond between the binding site Z of the reagent and the binding partner C of the agent can be disrupted by addition of the substance (e.g. competition reagent), thereby rendering the association of the agent (e.g., receptor-binding agent or selection agent) and reagent reversible.
  • the reagent contains one or a plurality of binding sites Z that are capable of reversibly binding to a binding partners C comprised by the agent (e.g., receptor- binding agent or selection agent).
  • the reagent contains a plurality of binding sites Z, which each are able to specifically bind to the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent), such that the reagent is capable of reversibly binding to a plurality of agents (e.g., receptor-binding agent or selection agent), e.g., is a multimerization reagent.
  • the reagent is an oligomer or polymer of individual molecules (e.g.
  • the reagent contains at least two binding sites Z, at least three binding sites Z, at least four binding sites Z, such as at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72 or more binding sites Z.
  • the binding sites can all be the same or the plurality of binding sites can contain one or more different binding sites (e.g., Zl, Z2, Z3, etc.).
  • two or more agents associate with, such as are reversibly bound to, the reagent, such as via the one or plurality of binding sites Z present on the reagent.
  • the agents e.g., receptor-binding agents or selection agents
  • the agents being closely arranged to each other such that an avidity effect can take place if a target cell having (at least two copies of) a cell surface molecule is brought into contact with the agent (e.g., receptor-binding agent or selection agent) that has one or more binding sites B able to bind the particular molecule.
  • two or more different agents that are the same, i.e. containing the same binding site B, can be reversibly bound to the reagent.
  • the reagent can be reversibly bound to a first agent (e.g., receptor-binding agent or selection agent) containing a binding site B l, B2, B3 or B4, etc.
  • each of the at least two agents can bind to the same molecule.
  • the binding site of the first agent and the second agent can be different.
  • each of the at least two agents can bind to a different molecule, such as a first molecule, second molecule and so on.
  • the different molecules can be present on the same target cell. In other cases, the different molecules, such as cell surface molecules, can be present on different target cells that are present in the same population of cells.
  • a third, fourth and so on agent e.g., receptor-binding agent or selection agent
  • the two or more different agents contain the same binding partner C. In some embodiments, the two or more different agents (e.g., receptor-binding agents or selection agents) contain different binding partners.
  • a first agent e.g., receptor-binding agent or selection agent
  • a second agent e.g., receptor-binding agents or selection agent
  • the plurality of binding sites Z comprised by the reagent includes binding sites Zl and Z2, which are capable of reversibly binding to binding partners CI and C2, respectively, comprised by the agent (e.g., receptor-binding agent or selection agent).
  • the agent e.g., receptor-binding agent or selection agent.
  • CI and C2 are the same, and/or Zl and Z2 are the same.
  • one or more of the plurality of binding sites Z can be different.
  • one or more of the plurality of binding partners C may be different.
  • binding partners C that are compatible with a reagent containing the binding sites Z, as long as each of the binding partners C are able to interact, such as specifically bind, with one of the binding sites Z.
  • the reagent is a streptavidin, a streptavidin mutein or analog, avidin, an avidin mutein or analog (such as neutravidin) or a mixture thereof, in which such reagent contains one or more binding sites Z for reversible association with a binding partner C.
  • the binding partner C can be a biotin, a biotin derivative or analog, or a streptavidin-binding peptide or other molecule that is able to specifically bind to streptavidin, a streptavidin mutein or analog, avidin or an avidin mutein or analog.
  • the reagent is or contains streptavidin, avidin, an analog or mutein of streptavidin, or an analog or mutein or avidin that reversibly binds biotin, a biotin analog or a biologically active fragment thereof.
  • the reagent is or contains an analog or mutein of streptavidin or an analog or mutein of avidin that reversibly binds a streptavidin-binding peptide.
  • the substance e.g. competitive reagent
  • the binding partner C and the substance (e.g. competitive reagent) are different, and the substance (e.g. competitive reagent) exhibits a higher binding affinity for the one or more binding sites Z compared to the affinity of the binding partner.
  • the streptavidin can be wild-type streptavidin, streptavidin muteins or analogs, such as streptavidin-like polypeptides.
  • avidin in some aspects, includes wild-type avidin or muteins or analogs of avidin such as neutravidin, a deglycosylated avidin with modified arginines that typically exhibits a more neutral pi and is available as an alternative to native avidin.
  • deglycosylated, neutral forms of avidin include those commercially available forms such as "Extravidin", available through Sigma Aldrich, or "NeutrAvidin” available from Thermo Scientific or Invitrogen, for example.
  • the reagent is a streptavidin or a streptavidin mutein or analog.
  • wild-type streptavidin has the amino acid sequence disclosed by Argarana et al, Nucleic Acids Res. 14 (1986) 1871-1882 (SEQ ID NO: 1).
  • streptavidin naturally occurs as a tetramer of four identical subunits, i.e. it is a homo-tetramer, where each subunit contains a single binding site for biotin, a biotin derivative or analog or a biotin mimic.
  • streptavidin subunit is the sequence of amino acids set forth in SEQ ID NO: 1, but such a sequence also can include a sequence present in homologs thereof from other Streptomyces species.
  • each subunit of streptavidin may exhibit a strong binding affinity for biotin with a dissociation constant (3 ⁇ 4) on the order of about 10 "14 M.
  • streptavidin can exist as a monovalent tetramer in which only one of the four binding sites is functional (Howarth et al. (2006) Nat. Methods, 3:267-73; Zhang et al. (2015) Biochem. Biophys. Res.
  • streptavidin may be in any form, such as wild-type or unmodified streptavidin, such as a streptavidin from a Streptomyces species or a functionally active fragment thereof that includes at least one functional subunit containing a binding site for biotin, a biotin derivative or analog or a biotin mimic, such as generally contains at least one functional subunit of a wild-type streptavidin from Streptomyces avidinii set forth in SEQ ID NO: 1 or a functionally active fragment thereof.
  • streptavidin can include a fragment of wild-type streptavidin, which is shortened at the N- and/or C-terminus.
  • Such minimal streptavidins include any that begin N-terminally in the region of amino acid positions 10 to 16 of SEQ ID NO: 1 and terminate C-terminally in the region of amino acid positions 133 to 142 of SEQ ID NO: 1.
  • a functionally active fragment of streptavidin contains the sequence of amino acids set forth in SEQ ID NO: 2.
  • streptavidin, such as set forth in SEQ ID NO: 2 can further contain an N- terminal methionine at a position corresponding to Alal3 with numbering set forth in SEQ ID NO: 1. Reference to the position of residues in streptavidin or streptavidin muteins is with reference to numbering of residues in SEQ ID NO: 1.
  • streptavidin muteins include polypeptides that are distinguished from the sequence of an unmodified or wild-type streptavidin by one or more amino acid substitutions, deletions, or additions, but that include at least one functional subunit containing a binding site for biotin, a biotin derivative or analog or a streptavidin-binding peptide.
  • streptavidin-like polypeptides and streptavidin muteins can be polypeptides which essentially are immunologically equivalent to wild-type streptavidin and are in particular capable of binding biotin, biotin derivatives or biotin analogues with the same or different affinity as wt- strep tavidin.
  • streptavidin-like polypeptides or streptavidin muteins may contain amino acids which are not part of wild-type streptavidin or they may include only a part of wild-type streptavidin.
  • streptavidin-like polypeptides are polypeptides which are not identical to wild-type streptavidin, since the host does not have the enzymes which are required in order to transform the host-produced polypeptide into the structure of wild-type streptavidin.
  • streptavidin also may be present as streptavidin tetramers and streptavidin dimers, in particular streptavidin homotetramers, streptavidin homodimers, streptavidin heterotetramers and streptavidin heterodimers.
  • each subunit normally has a binding site for biotin or biotin analogues or for streptavidin- binding peptides.
  • streptavidins or streptavidin muteins are mentioned, for example, in WO 86/02077, DE 19641876 Al, US 6,022,951, WO 98/40396 or WO 96/24606.
  • a streptavidin mutein can contain amino acids that are not part of an unmodified or wild-type streptavidin or can include only a part of a wild-type or unmodified streptavidin.
  • a streptavidin mutein contains at least one subunit that can have one more amino acid substitutions (replacements) compared to a subunit of an unmodified or wild-type streptavidin, such as compared to the wild-type streptavidin subunit set forth in SEQ ID NO: 1 or a functionally active fragment thereof, e.g. set forth in SEQ ID NO: 2.
  • At least one subunit of a streptavidin mutein can have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acid differences compared to a wild-type or unmodified streptavidin and/or contains at least one subunit that comprising an amino acid sequence that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the sequence of amino acids set forth in SEQ ID NO: 1 or 2, where such streptavidin mutein exhibits functional activity to bind biotin, a biotin derivative or analog or biotin mimic.
  • the amino acid replacements (substitutions) are conservative or non-conservative mutations.
  • streptavidin muteins are known in the art, see e.g., U.S. Pat. No. 5,168,049;
  • streptavidin or a streptavidin mutein includes proteins containing one or more than one functional subunit containing one or more binding sites Z for biotin, a biotin derivative or analog or a streptavidin-binding peptide, such as two or more, three or more, four or more, and, in some cases, 5, 6, 7, 8, 9, 10, 11, 12 or more functional subunits.
  • streptavidin or streptavidin mutein can include a monomer; a dimer, including a heterodimer or a homodimer; a tetramer, including a homotetramer, a
  • heterotetramer a monovalent tetramer or a divalent tetramer; or can include higher ordered multimers or oligomers thereof.
  • the binding affinity of streptavidin or a streptavidin mutein for a peptide ligand binding partner is less than 1 x 10 "4 M, 5 x 10 "4 M, 1 x 10 "5 M, 5x 10 "5 M, 1 x 10 " 6 M, 5 x 10 "6 M or 1 x 10 "7 M, but generally greater than 1 x 10 "13 M, 1 x 10 "12 M or 1 x 10 "11 M.
  • peptide sequences such as disclosed in U.S. Pat. No.
  • 5,506,121 can act as biotin mimics and demonstrate a binding affinity for streptavidin, e.g., with a 3 ⁇ 4 of approximately between 10 "4 and 10 "5 .
  • the binding affinity can be further improved by making a mutation within the streptavidin molecule, see e.g. U.S. Pat. No.
  • binding affinity can be determined by methods known in the art, such as any described below.
  • the reagent such as a streptavidin or streptavidin mutein, exhibits binding affinity for a peptide ligand binding partner, which peptide ligand binding partner can be the binding partner C present in the agent (e.g., receptor-binding agent or selection agent).
  • the peptide sequence contains a sequence with the general formula set forth in SEQ ID NO: 9, such as contains the sequence set forth in SEQ ID NO: 10.
  • the peptide sequence has the general formula set forth in SEQ ID NO: 11, such as set forth in SEQ ID NO: 12.
  • the peptide sequence is Trp- Arg-His-Pro-Gln-Phe-Gly-Gly (also called Strep-tag®, set forth in SEQ ID NO: 7). In one example, the peptide sequence is Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (also called Strep-tag® II, set forth in SEQ ID NO: 8).
  • the peptide ligand contains a sequential arrangement of at least two streptavidin-binding modules, wherein the distance between the two modules is at least 0 and not greater than 50 amino acids, wherein one binding module has 3 to 8 amino acids and contains at least the sequence His-Pro-Xaa (SEQ ID NO: 9), where Xaa is glutamine, asparagine, or methionine, and wherein the other binding module has the same or different streptavidin peptide ligand, such as set forth in SEQ ID NO: 11 (see e.g. International Published PCT Appl. No. WO02/077018; U.S. Patent No. 7,981,632).
  • the peptide ligand contains a sequence having the formula set forth in any of SEQ ID NO: 13 or 14. In some embodiments, the peptide ligand has the sequence of amino acids set forth in any of SEQ ID NOS: 15-19. In most cases, all these streptavidin binding peptides bind to the same binding site, namely the biotin binding site of streptavidin. If one or more of such streptavidin binding peptides is used as binding partners C, e.g. CI and C2, the multimerization reagent is typically a streptavidin mutein.
  • the reagent is or contains a streptavidin mutein.
  • the streptavidin muteins contain one or more mutations (e.g. amino acid replacements) compared to wild-type streptavidin set forth in SEQ ID NO: 1 or a biologically active portion thereof.
  • biologically active portions of streptavidin can include streptavidin variants that are shortened at the N- and/or the C-terminus, which in some cases is called a minimal streptavidin.
  • an N-terminally shortened minimal streptavidin begins N-terminally in the region of the amino acid positions 10 to 16 and terminates C-terminally in the region of the amino acid positions 133 to 142 compared to the sequence set forth in SEQ ID NO: 1.
  • an N-terminally shortened streptavidin contains the amino acid sequence set forth in SEQ ID NO: 2.
  • the minimal streptavidin contains an amino acid sequence from position Alal3 to Serl39 and optionally has an N-terminal methionine residue instead of Alal3.
  • the numbering of amino acid positions refers throughout to the numbering of wt- streptavidin set forth in SEQ ID NO: 1 ( e.g. Argarana et al., Nucleic Acids Res. 14 (1986), 1871 -1882, cf. also Fig. 3).
  • the streptavidin mutein is a mutant as described in U.S. Pat. No. 6,103,493.
  • the streptavidin mutein contains at least one mutation within the region of amino acid positions 44 to 53, based on the amino acid sequence of wild- type streptavidin, such as set forth in SEQ ID NO: 1.
  • the streptavidin mutein contains a mutation at one or more residues 44, 45, 46, and/or 47.
  • the streptavidin mutein contains a replacement of Glu at position 44 of wild-type streptavidin with a hydrophobic aliphatic amino acid, e.g. Val, Ala, lie or Leu, any amino acid at position 45, an aliphatic amino acid, such as a hydrophobic aliphatic amino acid at position 46 and/or a replacement of Val at position 47 with a basic amino acid, e.g. Arg or Lys, such as generally Arg.
  • Ala is at position 46 and/or Arg is at position 47 and/or Val or He is at position 44.
  • the streptavidin mutant contains residues Val 44 -Thr 45 -Ala 46 -Arg 47 , such as set forth in exemplary streptavidin muteins containing the sequence of amino acids set forth in SEQ ID NO: 3 or SEQ ID NO: 4 (also known as streptavidin mutant 1, SAM1).
  • the streptavidin mutein contains residues Ile 44 -Gly 45 -Ala 46 -Arg 47 , such as set forth in exemplary streptavidin muteins containing the sequence of amino acids set forth in SEQ ID NO: 5 or 6 (also known as SAM2).
  • streptavidin mutein are described, for example, in US patent 6,103,493, and are
  • the streptavidin mutein is a mutant as described in
  • the streptavidin mutein contains at least two cysteine residues in the region of amino acid positions 44 to 53 with reference to amino acid positions set forth in SEQ ID NO: 1.
  • the cysteine residues are present at positions 45 and 52 to create a disulfide bridge connecting these amino acids.
  • amino acid 44 is typically glycine or alanine and amino acid 46 is typically alanine or glycine and amino acid 47 is typically arginine.
  • the streptavidin mutein contains at least one mutation or amino acid difference in the region of amino acids residues 115 to 121 with reference to amino acid positions set forth in SEQ ID NO: 1.
  • the streptavidin mutein contains at least one mutation at amino acid position 117, 120 and 121 and/or a deletion of amino acids 118 and 119 and substitution of at least amino acid position 121.
  • the streptavidin mutein contains a mutation at a position corresponding to position 117, which mutation can be to a large hydrophobic residue like Trp, Tyr or Phe or a charged residue like Glu, Asp or Arg or a hydrophilic residue like Asn or Gin, or, in some cases, the hydrophobic residues Leu, Met or Ala, or the polar residues Thr, Ser or His.
  • the mutation at position 117 is combined with a mutation at a position corresponding to position 120, which mutation can be to a small residue like Ser or Ala or Gly, and a mutation at a position corresponding to position 121, which mutation can be to a hydrophobic residue, such as a bulky hydrophobic residue like Trp, Tyr or Phe. In some embodiments, the mutation at position 117 is combined with a mutation at a position corresponding to position 120, which mutation can be to a small residue like Ser or Ala or Gly, and a mutation at a position corresponding to position 121, which mutation can be to a hydrophobic residue, such as a bulky hydrophobic residue like Trp, Tyr or Phe. In some embodiments, the mutation at position 117 is combined with a mutation at a position
  • biologically active fragment thereof which mutation can be a hydrophobic residue such as Leu, He, Met, or Val or, generally, Tyr or Phe, and a mutation at a position corresponding to position 121 compared to positions of wildtype streptavidin set forth in SEQ ID NO: 1 or a biologically active fragment thereof, which mutation can be to a small residue like Gly, Ala, or Ser, or with Gin, or with a hydrophobic residue like Leu, Val, He, Trp, Tyr, Phe, or Met.
  • such muteins also can contain residues Val44-Thr45-Ala46-Arg47 or residues Ile44-Gly45-Ala46-Arg47.
  • the streptavidin mutein contains the residues Val44, Thr45, Ala46, Arg47, Glul l7, Glyl20 and Tyrl21.
  • the mutein streptavidin contains the sequence of amino acids set forth in SEQ ID NO:27 or SEQ ID NO:28, or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the sequence of amino acids set forth in SEQ ID NO: 27 or SEQ ID NO: 28, contains the residues Val44, Thr45, Ala46, Arg47, Glul 17, Glyl20 and Tyr 121 and exhibits functional activity to bind to biotin, a biotin analog or a strep tavidin-binding peptide.
  • a streptavidin mutein can contain any of the above mutations in any combination, and the resulting streptavidin mutein may exhibit a binding affinity that is less than 2.7 x 10 "4 M for the peptide ligand (Trp Arg His Pro Gin Phe Gly Gly; also called Strep-tag®, set forth in SEQ ID NO: 7) and/or less than 1.4 x 10 "4 M for the peptide ligand (Trp Ser His Pro Gin Phe Glu Lys; also called Strep-tag® II, set forth in SEQ ID NO: 8) and/or is less than 1 x 10 "4 M, 5 x 10 "4 M, 1 x 10 "5 M, 5x 10 "5 M, 1 x 10 "6 M, 5 x 10 "6 M or 1 x 10 "7 M, but generally greater than 1 x 10 - " 13 M, 1 x 10 - " 12 M or 1 x 10 - " 11 M for any of
  • the streptavidin mutein exhibits the sequence of amino acids set forth in any of SEQ ID NOs: 3-6, 27 or 28, or a sequence of amino acids that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the sequence of amino acids set forth in any of SEQ ID NO: 3-6, 27 or 28, and exhibits a binding affinity that is less than 2.7 x 10 "4 M for the peptide ligand (Trp Arg His Pro Gin Phe Gly Gly; also called Strep-tag®, set forth in SEQ ID NO: 7) and/or less than 1.4 x 10 "4 M for the peptide ligand (Trp Ser His Pro Gin Phe Glu Lys; also called Strep-tag® II, set forth in SEQ ID NO: 8) and/or is less than 1 x 10 "4 M, 5 x 10 "4 M, 1 x 10 "5 M,
  • the streptavidin mutein also exhibits binding to other streptavidin ligands, such as but not limited to, biotin, iminobiotin, lipoic acid, desthiobiotin, diaminobiotin, HABA (hydroxyazobenzene-benzoic acid) and/or dimethyl-HABA.
  • the streptavidin mutein exhibits a binding affinity for another streptavidin ligand, such as biotin or desthiobiotin, that is greater than the binding affinity of the streptavidin mutein for a biotin mimic peptide ligand, such as set forth in any of SEQ ID NOS: 7-19.
  • biotin or a biotin analog or derivative can be employed as a competition reagent in the provided methods.
  • a mutein streptavidin designated Strep-tactin ® e.g. containing the sequence set forth in SEQ ID NO: 4
  • the peptide ligand designated Strep-tag ® II e.g. set forth in SEQ ID NO: 8
  • a binding affinity with a K ⁇ j of approximately 10 ⁇ 6 M compared to
  • biotin which can bind with high affinity to the Strep-tactin ® with a 3 ⁇ 4 of between or between about 10 ⁇ 10 and 10 ⁇ 13 M, can compete with Strep-tag ® II for the binding site.
  • the reagent contains at least two chelating groups K that may be capable of binding to a transition metal ion.
  • the reagent may be capable of binding to an oligohistidine affinity tag, a glutathione-S-transferase, calmodulin or an analog thereof, calmodulin binding peptide (CBP), a FLAG-peptide, an HA-tag, maltose binding protein (MBP), an HSV epitope, a myc epitope, and/or a biotinylated carrier protein.
  • the reagent is an oligomer or polymer.
  • the oligomer or polymer can be generated by linking directly or indirectly individual molecules of the protein as it exists naturally, either by linking directly or indirectly individual molecules of a monomer or a complex of subunits that make up an individual molecule (e.g. linking directly or indirectly dimers, trimers, tetramers, etc. of a protein as it exists naturally).
  • a tetrameric homodimer or heterodimer of streptavidin or avidin may be referred to as an individual molecule or smallest building block of a respective oligomer or polymer.
  • the oligomer or polymer can contain linkage of at least 2 individual molecules of the protein (e.g. is a 2-mer), or can be at least a 3-mer, 4-mer, 5-mer, 6-mer, 7-mer, 8-mer, 9- mer, 10-mer, 11-mer, 12-mer, 13-mer, 14-mer, 15-mer, 16-mer, 17-mer, 18-mer, 19-mer, 20- mer, 25-mer, 30-mer, 35-mer, 40-mer, 45-mer or 50-mer of individual molecules of the protein (e.g., monomers, tetramers).
  • linkage of at least 2 individual molecules of the protein e.g. is a 2-mer
  • the protein e.g. is a 2-mer
  • the oligomer or polymer can contain linkage of at least 2 individual molecules of the protein (e.g. is a 2-mer), or can be at least a 3-mer, 4-mer, 5-mer, 6-mer, 7-mer, 8-mer, 9- mer, 10-
  • Oligomers can be generated using any methods known in the art, such as any described in published U.S. Patent Application No. US2004/0082012.
  • the oligomer or polymer contains two or more individual molecules that may be crosslinked, such as by a polysaccharide or a bifunctional linker.
  • the oligomer or polymer is obtained by crosslinking individual molecules or a complex of subunits that make up an individual molecule in the presence of a polysaccharide.
  • oligomers or polymers can be prepared by the introduction of carboxyl residues into a polysaccharide, e.g. dextran.
  • individual molecules of the reagent can be coupled via primary amino groups of internal lysine residues and/or the free N-terminus to the carboxyl groups in the dextran backbone using conventional carbodiimide chemistry.
  • the coupling reaction is performed at a molar ratio of about 60 moles of individual molecules of the reagent (e.g., monomers, tetramers) per mole of dextran.
  • the reagent is an oligomer or a polymer of one or more streptavidin or avidin or of any analog or mutein of streptavidin or an analog or mutein of avidin (e.g. neutravidin).
  • the binding site Z is a natural biotin binding site of avidin or streptavidin for which there can be up to four binding sites in an individual molecule (e.g. a tetramer contains four binding sites Z), whereby a homo-tetramer can contain up to 4 binding sites that are the same, i.e. Zl, whereas a hetero-tetramer can contain up to 4 binding sites that may be different, e.g. containing Zl and Z2.
  • the oligomer is generated or produced from a plurality of individual molecules (e.g. a plurality of homo- tetramers) of the same streptavidin, streptavidin mutein, avidin or avidin mutein, in which case each binding site Z, e.g. Zl, of the oligomer is the same.
  • an oligomer can contain a plurality of binding sites Zl, such as at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50 or more binding sites Zl.
  • the oligomer is generated or produced from a plurality of individual molecules that can be hetero-tetramers of a streptavidin, streptavidin mutein, avidin or avidin mutein and/or from a plurality of two or more different individual molecules (e.g. different homo-tetramers) of streptavidin, streptavidin mutein, avidin or avidin mutein that differ in their binding sites Z, e.g. Zl and Z2, in which case a plurality of different binding sites Z, e.g. Zl and Z2, may be present in the oligomer.
  • an oligomer can contain a plurality of binding sites Zl and a plurality of binding sites Z, which, in combination, can include at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50 or more combined binding sites Zl and Z2.
  • the respective oligomer or polymer may be crosslinked by a polysaccharide.
  • oligomers or polymers of streptavidin or of avidin or of analogs of streptavidin or of avidin can be prepared by the introduction of carboxyl residues into a polysaccharide, e.
  • streptavidin or avidin or analogs thereof then may be linked via primary amino groups of internal lysine residue and/or the free N-terminus to the carboxyl groups in the dextran backbone using conventional carbodiimide chemistry in a second step.
  • cross-linked oligomers or polymers of streptavidin or avidin or of any analog of streptavidin or avidin may also be obtained by crosslinking via bifunctional molecules, serving as a linker, such as
  • the oligomer or polymer is obtained by crosslinking individual molecules or a complex of subunits that make up an individual molecule using a bifunctional linker or other chemical linker, such as glutardialdehyde or by other methods known in the art.
  • a bifunctional linker or other chemical linker such as glutardialdehyde or by other methods known in the art.
  • cross-linked oligomers or polymers of streptavidin or avidin or of any mutein or analog of streptavidin or avidin may be obtained by crosslinking individual streptavidin or avidin molecules via bifunctional molecules, serving as a linker, such as glutardialdehyde or by other methods described in the art.
  • oligomers of streptavidin muteins by introducing thiol groups into the streptavidin mutein (this can, for example, be done by reacting the streptavidin mutein with 2-iminothiolan (Trauts reagent) and by activating, for example in a separate reaction, amino groups available in the streptavidin mutein.
  • 2-iminothiolan Trauts reagent
  • this activation of amino groups can be achieved by reaction of the streptavidin mutein with a commercially available heterobifunctional crosslinker such as sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-l-carboxylate (sulfo SMCC) or Succinimidyl-6-[(P-maleimidopropionamido)hexanoate (SMPH).
  • sulfo SMCC N-maleimidomethyl)cyclohexane-l-carboxylate
  • SMPH Succinimidyl-6-[(P-maleimidopropionamido)hexanoate
  • the two reaction products so obtained are mixed together, typically leading to the reaction of the thiol groups contained in the one batch of modified streptavidin mutein with the activated (such as by maleimide functions) amino acids of the other batch of modified streptavidin mutein.
  • multimers/oligomers of the streptavidin mutein are formed.
  • These oligomers can have any suitable number of individual molecules, such as at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50 or more, and the oligomerization degree can be varied according to the reaction condition.
  • the oligomeric or polymeric reagent can be isolated via size exclusion chromatography and any desired fraction can be used as the reagent.
  • the oligomeric or polymeric reagent can be isolated via size exclusion chromatography and any desired fraction can be used as the reagent.
  • the oligomers do not have (and do not need to have) a single molecular weight but they may observe a statistical weight distribution such as Gaussian distribution.
  • any oligomer with more than three streptavidin or mutein tetramers can be used as a soluble reagent, such as generally 3 to 50 tetramers, e.g., homotetramers or heterotetramers, 10 to 40 tetramers, e.g., homotetramers or heterotetramers, or 25 to 35 tetramers, e.g., homotetramers or heterotetramers.
  • the oligomers might have, for example, from 3 to 25 streptavidin mutein tetramers, e.g., homotetramers or heterotetramers.
  • the soluble oligomers can have a molecular weight from about 150 kDa to about 2000 kDa, about 150 kDa to about 1500 kDa, about 150 kDa to about 1250 kDa, about 150 kDa to 1000 kDa, about 150 kDa to about 500 kDa or about 150 kDa to about 300 kDa, about 300 kDa to about 2000 kDa, about 300 kDa to about 1500 kDa, about 300 kDa to about 1250 kDa, about 300 kDa to 1000 kDa, about 300 kDa to about 500 kDa, about 500 kDa to about 2000 kDa, about 500 kDa to about 1500 kDa, about 500 kDa to about 1250 kDa, about 500 kDa to 1000 kDa, about
  • the reagent is comprised on a support, such as a solid support or surface, e.g., bead, or a stationary phase (chromatography matrix).
  • a support such as a solid support or surface, e.g., bead, or a stationary phase (chromatography matrix).
  • the reagent is reversibly immobilized on the support. In some cases, the reagent is immobilized to the support via covalent bonds. In some aspects, the reagent is reversibly immobilized to the support non-covalently.
  • the support is a solid support. Any solid support (surface) can be used for the reversible immobilization of the reagent.
  • Illustrative examples of solid supports on which the reagent can be immobilized include a magnetic bead, a polymeric bead, a cell culture plate, a microtiter plate, a membrane, or a hollow fiber.
  • hollow fibers can be used as a bioreactor in the Quantum® Cell Expansion System, available from
  • the reagent is covalently attached to the solid support. In other embodiments, non-covalent interactions can also be used for immobilization, for example on plastic substrates.
  • the reagent can, for example, be a streptavidin or avidin mutein that reversibly binds a streptavidin binding peptide.
  • streptavidin muteins can be covalently attached to any surface, for example, resin (beads) used for chromatography purification and are commercially available in such form from IBA GmbH, Gottingen, for example, as Strep-Tactin® Sepharose, Strep-Tactin® Superflow®, Strep-Tactin® Superflow® high capacity or Strep-Tactin® MacroPrep®.
  • resin used for chromatography purification
  • Other illustrative examples that are readily commercially available are immobilized metal affinity
  • IMAC chromatography
  • oligo-histidine tagged (his- tagged) proteins such as for the reversible binding of an agent (e.g., receptor-binding agent or selection agent) that contains as a binding partner C an oligohistidine tag such as an penta- or hexa-histidine tag.
  • an agent e.g., receptor-binding agent or selection agent
  • calmodulin sepharose available from GE Life Sciences which can be used together with an agent (e.g., receptor-binding agent or selection agent) that contains a calmodulin binding peptide as a binding partner C or sepharose, to which glutathion is coupled.
  • the binding partner C is glutathion-S-transferase.
  • the support contains a stationary phase.
  • the reagent is comprised on a stationary phase (also called chromatography matrix).
  • the reagent is reversibly immobilized on the stationary phase.
  • the reagent is reversibly immobilized to the stationary phase via covalent bonds.
  • the reagent is reversibly immobilized to the stationary phase non- covalently.
  • any material may be employed as a chromatography matrix.
  • a suitable chromatography material is essentially innocuous, i.e. not detrimental to cell viability, such as when used in a packed chromatography column under desired conditions.
  • the stationary phase remains in a predefined location, such as a predefined position, whereas the location of the sample is being altered.
  • the stationary phase is the part of a chromatographic system through which the mobile phase flows (either by flow through or in a batch mode) and where distribution of the components contained in the liquid phase (either dissolved or dispersed) between the phases occurs.
  • the chromatography matrix has the form of a solid or semisolid phase, whereas the sample that contains the target cell to be isolated/separated is a fluid phase.
  • the chromatography matrix can be a particulate material (of any suitable size and shape) or a monolithic chromatography material, including a paper substrate or membrane.
  • the chromatography can be both column chromatography as well as planar chromatography.
  • columns allowing a bidirectional flow such as PhyTip ® columns available from PhyNexus, Inc. San Jose, CA, U.S.A. or pipette tips can be used for column based/flow through mode based methods.
  • pipette tips or columns allowing a bidirectional flow are also comprised by chromatography columns useful in the present methods.
  • the particulate matrix material may, for example, have a mean particle size of about 5 ⁇ to about 200 ⁇ , or from about 5 ⁇ to about 400 ⁇ , or from about 5 ⁇ to about 600 ⁇ .
  • the chromatography matrix may, for example, be or include a polymeric resin or a metal oxide or a metalloid oxide.
  • the matrix material may be any material suitable for planar chromatography, such as conventional cellulose-based or organic polymer based membranes (for example, a paper membrane, a nitrocellulose membrane or a polyvinylidene difluoride (PVDF) membrane) or silica coated glass plates.
  • the chromatography matrix/stationary phase is a non-magnetic material or non-magnetizable material.
  • non-magnetic or non-magnetizable chromatography stationary phases that are suitable in the present methods include derivatized silica or a crosslinked gel.
  • a crosslinked gel may be based on a natural polymer, such as on a polymer class that occurs in nature.
  • a natural polymer on which a chromatography stationary phase may be based is a polysaccharide.
  • a respective polysaccharide is generally crosslinked.
  • polysaccharide matrix includes, but is not limited to, an agarose gel (for example, SuperflowTM agarose or a Sepharose® material such as SuperflowTM Sepharose® that are commercially available in different bead and pore sizes) or a gel of crosslinked dextran(s).
  • agarose gel for example, SuperflowTM agarose or a Sepharose® material such as SuperflowTM Sepharose® that are commercially available in different bead and pore sizes
  • a gel of crosslinked dextran(s) for example, SuperflowTM agarose or a Sepharose® material such as SuperflowTM Sepharose® that are commercially available in different bead and pore sizes
  • a further illustrative example is a particulate cross-linked agarose matrix, to which dextran is covalently bonded, that is commercially available (in various bead sizes and with various pore sizes) as Sephadex® or Superdex®, both available from GE Healthcare.
  • Sephacryl® is
  • a crosslinked gel may also be based on a synthetic polymer, such as on a polymer class that does not occur in nature.
  • a synthetic polymer on which a chromatography stationary phase is based is a polymer that has polar monomer units, and which is therefore in itself polar.
  • a polar polymer is hydrophilic.
  • Hydrophilic molecules also termed lipophobic, in some aspects contain moieties that can form dipole-dipole interactions with water molecules. In general, hydrophobic molecules, also termed lipophilic, have a tendency to separate from water.
  • Suitable synthetic polymers are polyacrylamide(s), a styrene- divinylbenzene gel and a copolymer of an acrylate and a diol or of an acrylamide and a diol.
  • An illustrative example is a polymethacrylate gel, commercially available as a Fractogel®.
  • a further example is a copolymer of ethylene glycol and methacrylate, commercially available as a Toyopearl®.
  • a chromatography stationary phase may also include natural and synthetic polymer components, such as a composite matrix or a composite or a copolymer of a polysaccharide and agarose, e.g.
  • a derivatized silica may include silica particles that are coupled to a synthetic or to a natural polymer.
  • Examples of such embodiments include, but are not limited to, polysaccharide grafted silica, polyvinylpyrrolidone grafted silica, polyethylene oxide grafted silica, poly(2-hydroxyethylaspartamide) silica and poly(N-isopropylacrylamide) grafted silica.
  • the chromatography matrix is a gel filtration matrix, for example, when used in a removal cartridge as described herein.
  • a gel filtration can be characterized by the property that it is designed to undergo.
  • a gel filtration matrix in some aspects allows the separation of cells or other biological entities largely on the basis of their size.
  • the respective chromatography matrix is typically a particulate porous material as mentioned above.
  • the chromatography matrix may have a certain exclusion limit, which is typically defined in terms of a molecular weight above which molecules are entirely excluded from entering the pores.
  • the respective molecular weight defining the size exclusion limit may be selected to be below the weight corresponding to the weight of a target cell.
  • the target cell is prevented from entering the pores of the size exclusion chromatography matrix.
  • a stationary phase may have pores that are of a size that is smaller than the size of a chosen target cell.
  • chromatography matrix has a mean pore size of 0 to about 500 nm.
  • components present in a sample such as agents (e.g., receptor- binding agents or selection agents) or a competition reagent may have a size that is below the exclusion limit of the pores and thus can enter the pores of the chromatography matrix.
  • agents e.g., receptor- binding agents or selection agents
  • a competition reagent may have a size that is below the exclusion limit of the pores and thus can enter the pores of the chromatography matrix.
  • larger molecules, with less access to the pore volume can elute first, whereas the smallest molecules typically elute last.
  • the exclusion limit of the chromatography matrix is selected to be below the maximal width of the target cell.
  • components that have access to the pore volume can remain longer in/on the chromatography matrix than target cell.
  • target cells can be collected in the eluate of a chromatography column separately from other matter/components of a sample. Therefore, in some aspects, components such as an agent (e.g., receptor-binding agent or selection agent), or where applicable a competition reagent, may elute at a later point of time from a gel filtration matrix than the target cell. In some embodiments, this effect can be further increased, such as if the gel permeation matrix contains a reagent (such as covalently bound thereon) that contains binding sites Z that are able to bind agents (e.g., receptor-binding agents or selection agents) and/or a competition reagent present in a sample.
  • a reagent such as covalently bound thereon
  • the agent e.g., receptor-binding agent or selection agent
  • the competition reagent can be bound by the binding sites Z of the reagent and thereby immobilized on the matrix. In some aspects, this method is carried out in a removal cartridge.
  • a chromatography matrix employed in the present methods may also include magnetically attractable matter such as one or more magnetically attractable particles or a ferrofluid.
  • a respective magnetically attractable particle may comprise a reagent with a binding site that is capable of binding a target cell.
  • magnetically attractable particles may contain diamagnetic, ferromagnetic, paramagnetic or
  • superparamagnetic material responds to a magnetic field with an induced magnetic field without a resulting permanent magnetization.
  • Magnetic particles based on iron oxide are for example commercially available as Dynabeads® from Dynal Biotech, as magnetic MicroBeads from Miltenyi Biotec, as magnetic porous glass beads from CPG Inc., as well as from various other sources, such as Roche Applied Science,
  • a chromatography matrix employed in the present methods is void of any magnetically attractable matter.
  • an apparatus that contains at least one
  • the apparatus may comprise a plurality of arrangements of first and second stationary phases (chromatography columns) being fluidly connected in series.
  • the apparatus may comprise a sample inlet being fluidly connected to the first stationary phase of the first arrangement of the first and second stationary phases.
  • the apparatus may also comprise a sample outlet for cells, the sample outlet being fluidly connected to the second stationary phase of the last of the at least one arrangement of a first and second stationary phases for chromatography.
  • the apparatus may also comprise a competition reagent container that is fluidly connected to at least one of the first stationary phases of the arrangements of the first and second stationary phases,
  • the reagent is not bound to a solid support, i.e. it is present in soluble form or is soluble.
  • the same reagent can be used as in the case of a reagent that is immobilized on a support, such as a solid support or stationary phase.
  • a support such as a solid support or stationary phase.
  • any of the exemplary of reagents described above can be used without immobilizing or attaching such reagent to a support, e.g. not attaching solid support or stationary phase.
  • the reagent contains a plurality of binding sites, Z, for reversibly binding to a binding agent via interaction with a binding partner, C.
  • the reagent is an oligomer or polymer of individual molecules or an oligomer or polymer of a complex of subunits that make up the individual molecule (e.g. oligomers or polymers of a dimeric, trimeric or tetrameric protein).
  • the reagent can, for example, be a streptavidin mutein oligomer, a calmodulin oligomer, a compound (oligomer) that provides least two chelating groups K, wherein the at least two chelating groups are capable of binding to a transition metal ion, thereby rendering the reagent capable of binding to an oligohistidine affinity tag, multimeric glutathione-S-transferase, or a biotinylated carrier protein.
  • the reagent is characterized by the absence of a solid support (surface) attached to the reagent.
  • the reagent does not comprise or is not attached (directly or indirectly) to a particle, bead, nanoparticle, microsphere or other solid support.
  • the reagent is not rigid, inflexible or stiff or does not comprise or is not attached to a rigid, inflexible, or stiff surface.
  • the reagent is flexible or substantially flexible. In some cases, the reagent is able to adjust or adapt to the form of the surface of the cells.
  • the reagent does not or does not comprise a shape that is spherical or substantially spherical.
  • substantially all, i.e. more than 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of the reagent is is composed of or contains organic material.
  • more than 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of the reagent is is composed of or contains lipids, carbohydrates, proteins, peptides or mixtures thereof.
  • the reagent is, is composed of or contains an essential absence of inorganic material, an inorganic core, e.g. metal, e.g.
  • iron synthetic or inorganic polymers, such as styrene polymers, e.g. polystyrene, latex, silica or magnetic cores.
  • styrene polymers e.g. polystyrene, latex, silica or magnetic cores.
  • the relative percentage of inorganic material of the reagent or that is comprised as part of the reagent is less than 20%, 15%, 10%, 5% or less.
  • the majority (i.e. more than 50%), such as more than 60%, 70%, 80%, 90%, 95%, 99% or more of the total volume of the reagent in aqueous solution consists of the individual protein molecules that comprise the reagent, such as oligomers or polymers of individual molecules or a complex of subunits that make up an individual molecule (e.g. tetrameric molecule).
  • the total density of the soluble reagent is less than 1.2 g/cm 3 , 1.1 g/cm 3 , 1.0 g/cm 3 or less.
  • the soluble reagent e.g.
  • a support or solid support e.g. is not attached to a bead
  • has a relatively small size such as generally less than or about less than 20 nM in size, such as less than or about less than 15 nM, less than or about less than 10 nM, less than or about less than 5 nM or smaller.
  • the soluble reagent e.g. not being attached to a support or solid support (e.g. is not attached to a bead), is biologically inert, i.e. it is non-toxic to living cells.
  • the reagent may be biodegradable, for example, it can be degraded by enzymatic activity or cleared by phagocytic cells.
  • the reagent e.g. a streptavidin or mutein, such as tetrameric streptavidin muteins
  • a carrier such as an organic carrier.
  • physiologically or pharmaceutically acceptable proteins such as serum albumin (for example human serum albumin (HSA) or bovine serum albumin (BSA)) as carrier protein.
  • the reagent such as streptavidin or a streptavidin mutein (either as individual tetramer or also in the form of oligomers), can be coupled to the carrier protein via non-covalent interaction.
  • biotinylated BSA which is commercially available from various suppliers such as ThermoFisher Scientific, Sigma Aldrich or Vectorlabs, to name only a few
  • the reagent e.g. streptavidin mutein
  • some of the reagent oligomers e.g. streptavidin oligomers
  • the agent e.g., receptor-binding agent or selection agent
  • any further agent as described herein.
  • a reagent such as a streptavidin mutein (either as an individual tetramer or also in the form of an oligomer), can be covalently coupled to a synthetic carrier such as a polyethylene glycol (PEG) molecule.
  • PEG polyethylene glycol
  • Any suitable PEG molecule can be used for this purpose, for example, and the PEG molecule and the respective reagent can be soluble.
  • PEG molecules up to a molecular weight of 1000 Da are soluble in water or culture media that may be used in the present methods.
  • such PEG based reagent can be prepared using commercially available activated PEG molecules (for example, PEG-NHS derivatives available from NOF North America Corporation, Irvine, California, USA, or activated PEG derivatives available from Creative PEGWorks, Chapel Hills, North Carolina, USA) with amino groups of the streptavidin mutein.
  • activated PEG molecules for example, PEG-NHS derivatives available from NOF North America Corporation, Irvine, California, USA, or activated PEG derivatives available from Creative PEGWorks, Chapel Hills, North Carolina, USA
  • the agent e.g., receptor-binding agent or selection agent
  • the agent has one or binding sites, B, for binding to the molecule on the surface of the cell, e.g. cell surface molecule.
  • the agent e.g., receptor-binding agent or selection agent
  • the agent contains only a single binding site, i.e. is monovalent.
  • the agent e.g., receptor-binding agent or selection agent
  • the agent has at least two, such as a plurality of binding sites B including three, four or five binding sites B capable of binding to the cell surface molecule.
  • the at least two or plurality of binding sites B may be identical.
  • one or more of the at least two or plurality of binding sites B may be different (e.g. Bl and B2).
  • one or more different agents are reversibly bound to the reagent.
  • at least 2, 3, 4 or more different agents are reversibly bound to the same reagent.
  • at least two different agents are reversibly bound to the same reagent, whereby each reagent comprises a binding site B or a plurality of binding sites B for specific binding between the agent and the molecule.
  • the at least two or more agents contain the same binding site B, e.g. for the binding the same or substantially the same molecule.
  • the at least two or more agents contain different binding sites B, e.g. for the binding to different molecules.
  • a first agent e.g. a first receptor-binding agent or a first selection agent
  • a second agent e.g. a second receptor-binding agent or second selection agent
  • a first agent e.g. a first selection agent
  • a second agent e.g. second selection agent
  • a first receptor-binding agent contains a binding site B2 and a second agent (e.g. a second receptor-binding agent) contains a binding site B4.
  • the first agent and second agent can contain a binding partner, CI or C2.
  • CI and C2 can be the same.
  • CI and C2 are different.
  • the first agent and second agent contain the same binding partner, CI.
  • the dissociation constant (K D ) of the binding between the agent (e.g., via the binding site B) and the binding site Z of the reagent may have a value in the range from about 10 "2 M to about 10 "13 M or from about 10 "3 M to about 10 "12 M or from about 10 "4 M to about 10 "U M, or from about 10 "5 M to about 10 "10 M.
  • the dissociation constant (Kd) for the binding between the binding agent and the molecule is of low affinity, for example, in the range of a Kd of about 10 — " 3 J to about 10— " 7' M.
  • the dissociation constant (Kd) for the binding between the binding agent and the molecule is of high affinity, for example, in the range of a Kd of about 10 — " 7' to about lxl0— " 1 l 0 u M.
  • the dissociation of the binding of the agent via the binding site B and the molecule occurs sufficiently fast, for example, to allow the target cell to be only transiently stained or associated with the agent after disruption of the reversible bond between the reagent and the agent.
  • the karate when expressed in terms of the k Q ff rate (also called dissociation rate constant for the binding between the agent (via the binding site B) and the molecule, the karate is about 0.5xl0 ⁇ 4 sec -1 or greater, about lxlO -4 sec -1 or greater, about 2x10 ⁇ 4 sec -1 or greater, about 3x10 ⁇ 4 sec -1 or greater, about 4x10 ⁇ 4 sec -1 of greater, about 5x10 ⁇ 4 sec -1 or greater, about lxlO -3 sec -1 or greater, about 1.5xl0 ⁇ 3 sec -1 or greater, about
  • an agent with a lower k Q ff rate of, for example, l.OxlO -4 sec -1 , may be used, so that after the disruption of the binding complexes, most of the agent may be removed or dissociated from the cell within about 3 and a half hours.
  • the K D of this bond as well as the K D , k Q ff and k on rate of the bond formed between the binding site B of the agent (e.g., receptor-binding agent or selection agent) and the cell surface molecule can be determined by any suitable means, for example, by fluorescence titration, equilibrium dialysis or surface plasmon resonance.
  • the cell surface molecule is a molecule against which an agent (e.g., receptor-binding agent or selection agent) may be directed.
  • the cell surface molecule is a peptide or a protein, such as a receptor, e.g., a membrane receptor protein.
  • the receptor is a lipid, a polysaccharide or a nucleic acid.
  • a cell surface molecule that is a protein may be a peripheral membrane protein or an integral membrane protein. The cell surface molecule may in some embodiments have one or more domains that span the membrane.
  • a membrane protein with a transmembrane domain may be a G-protein coupled receptor, such as an odorant receptors, a rhodopsin receptor, a rhodopsin pheromone receptor, a peptide hormone receptor, a taste receptor, a GABA receptor, an opiate receptor, a serotonin receptor, a Ca2+ receptor, melanopsin, a neurotransmitter receptor, such as a ligand gated, a voltage gated or a G-protein coupled receptor, such as an odorant receptors, a rhodopsin receptor, a rhodopsin pheromone receptor, a peptide hormone receptor, a taste receptor, a GABA receptor, an opiate receptor, a serotonin receptor, a Ca2+ receptor, melanopsin, a neurotransmitter receptor, such as a ligand gated, a voltage gated or a
  • a mechanically gated receptor including the acetylcholine, the nicotinic, the adrenergic, the norepinephrine, the catecholamines, the L-DOPA-, a dopamine and serotonin (biogenic amine, endorphin/enkephalin) neuropeptide receptor, a receptor kinase such as serine/threonine kinase, a tyrosine kinase, a porin/channel such as a chloride channel, a potassium channel, a sodium channel, an OMP protein, an ABC transporter (ATP-Binding Cassette-Transporter) such as amino acid transporter, the Na-glucose transporter, the Na/iodide transporter, an ion transporter such as Light Harvesting Complex, cytochrome c oxidase, ATPase Na/K, H/K, Ca, a cell adhesion receptor such as metalloprotease, an integr
  • the cell surface molecule may be an antigen defining a desired cell population or subpopulation, for instance a population or subpopulation of blood cells, e.g., lymphocytes (e.g., T cells, T-helper cells, for example, CD4+ T-helper cells, B cells or natural killer cells), monocytes, or stem cells, e.g. CD34-positive peripheral stem cells or Nanog or Oct- 4 expressing stem cells.
  • lymphocytes e.g., T cells, T-helper cells, for example, CD4+ T-helper cells, B cells or natural killer cells
  • monocytes e.g. CD34-positive peripheral stem cells or Nanog or Oct- 4 expressing stem cells.
  • stem cells e.g. CD34-positive peripheral stem cells or Nanog or Oct- 4 expressing stem cells.
  • T-cells include cells such as CM V- specific CD8+ T- lymphocytes, cytotoxic T-cells, memory T-cells and regulatory T-cells (Treg).
  • Treg is CD4 CD25 CD45RA Treg cells and an illustrative example of memory T- cells is CD62L CD8+ specific central memory T-cells.
  • the cell surface molecule may also be a marker for a tumor cell.
  • the agent e.g., receptor-binding agent or selection agent
  • the agent has, in addition to the binding site B that is able to bind the cell surface molecule, a binding partner C.
  • this binding partner C is able to bind to a binding site Z of the reagent wherein the reagent has one or more binding sites for the binding partner C.
  • the non-covalent bond that may be formed between the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) and the binding site(s) Z of the reagent may be of any desired strength and affinity, and may be disruptable or reversible under conditions under which the method is performed.
  • the agent may include at least one, including two, three or more, additional binding partners C and the reagent may include at least two, such as three, four, five, six, seven, eight or more binding sites Z for the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent).
  • the agent e.g., receptor-binding agent or selection agent
  • any combination of a binding partner C and a reagent with one or more corresponding binding sites Z can be chosen, for example, such that the binding partner C and the binding site Z are able to reversibly bind in a complex, such as to cause an avidity effect.
  • the binding partner C included in the agent may for instance be hydrocarbon-based (including polymeric) and include nitrogen-, phosphorus-, sulphur-, carben-, halogen- or pseudohalogen groups. In some aspects, it may be an alcohol, an organic acid, an inorganic acid, an amine, a phosphine, a thiol, a disulfide, an alkane, an amino acid, a peptide, an oligopeptide, a polypeptide, a protein, a nucleic acid, a lipid, a saccharide, an oligosaccharide, or a polysaccharide.
  • hydrocarbon-based including polymeric
  • nitrogen-, phosphorus-, sulphur-, carben-, halogen- or pseudohalogen groups may be an alcohol, an organic acid, an inorganic acid, an amine, a phosphine, a thiol, a disulfide, an alkane, an amino acid,
  • a binding partner C may also be a cation, an anion, a polycation, a polyanion, a polycation, an electrolyte, a polyelectrolyte, a carbon nanotube or carbon nanofoam.
  • a binding partner C has a higher affinity to the binding site of the reagent than to other matter.
  • Examples of a respective binding partner C include, but are not limited to, a crown ether, an immunoglobulin, a fragment thereof and a proteinaceous binding molecule with antibody-like functions.
  • the binding partner C that is included in the agent includes biotin and the reagent includes a streptavidin analog or an avidin analog that reversibly binds to biotin.
  • the binding partner C that is included in the agent includes a biotin analog that reversibly binds to streptavidin or avidin, and the reagent includes
  • the binding partner C that is included in the agent includes a streptavidin or avidin binding peptide and the reagent includes streptavidin, avidin, a streptavidin analog or an avidin analog that reversibly binds to the respective streptavidin or avidin binding peptide.
  • the reagent is a streptavidin, such as a streptavidin mutein including any described above (e.g. set forth in SEQ ID NOS: 3-6), and the binding partner C that is included in the agent (e.g. receptor-binding agent or selection agent) may include a streptavidin-binding peptide.
  • the streptavidin-binding peptide may include a sequence with the general formula set forth in SEQ ID NO: 9, such as contains the sequence set forth in SEQ ID NO: 10.
  • the peptide sequence has the general formula set forth in SEQ ID NO: 11, such as set forth in SEQ ID NO: 12.
  • the peptide sequence is Trp-Arg-His-Pro-Gln-Phe-Gly-Gly (also called Strep-tag®, set forth in SEQ ID NO: 7). In one example, the peptide sequence is Trp-Ser-His-Pro-Gln-Phe-Glu- Lys (also called Strep-tag® II, set forth in SEQ ID NO: 8).
  • the peptide ligand contains a sequential arrangement of at least two streptavidin-binding modules, wherein the distance between the two modules is at least 0 and not greater than 50 amino acids, wherein one binding module has 3 to 8 amino acids and contains at least the sequence His-Pro-Xaa (SEQ ID NO: 9), where Xaa is glutamine, asparagine, or methionine, and wherein the other binding module has the same or different streptavidin peptide ligand, such as set forth in SEQ ID NO: 11 (see e.g. International Published PCT Appl. No. WO02/077018; U.S. Patent No. 7,981,632).
  • the peptide ligand contains a sequence having the formula set forth in any of SEQ ID NO: 13 or 14. In some embodiments, the peptide ligand has the sequence of amino acids set forth in any of SEQ ID NOS: 15-19.
  • the binding partner C of the agent includes a moiety known to the skilled artisan as an affinity tag.
  • the reagent may include a corresponding binding partner, for example, an antibody or an antibody fragment, known to bind to the affinity tag.
  • the binding partner C that is included in the agent may include dinitrophenol or digoxigenin, oligohistidine, polyhistidine, an immunoglobulin domain, maltose-binding protein, glutathione-S-transferase (GST), chitin binding protein (CBP) or thioredoxin, calmodulin binding peptide (CBP), FLAG '-peptide, the HA-tag (sequence: Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala) (SEQ ID NO: 20), the VSV-G-tag (sequence: Tyr-Thr-Asp-Ile-Glu-Met-Asn-Arg-Leu-Gly-Lys) (SEQ ID NO: 21), the HSV-tag (sequence: Gln-Pro-Glu-Leu-Ala
  • the complex formed between the one or more binding sites Z of the reagent which may be an antibody or antibody fragment, and the antigen can be disrupted competitively by adding the free antigen, i.e. the free peptide (epitope tag) or the free protein (such as MBP or CBP).
  • the affinity tag might also be an oligonucleotide tag. In some cases, such an oligonucleotide tag may, for instance, be used to hybridize to an oligonucleotide with a complementary sequence, linked to or included in the reagent.
  • a suitable binding partner C include, but are not limited to, a lectin, protein A, protein G, a metal, a metal ion, nitrilo triacetic acid derivatives (NT A), RGD- motifs, a dextrane, polyethyleneimine (PEI), a redox polymer, a glycoproteins, an aptamers, a dye, amylose, maltose, cellulose, chitin, glutathione, calmodulin, gelatine, polymyxin, heparin, NAD, NADP, lysine, arginine, benzamidine, poly U, or oligo-dT.
  • a lectin protein A
  • protein G a metal, a metal ion, nitrilo triacetic acid derivatives (NT A), RGD- motifs, a dextrane, polyethyleneimine (PEI), a redox polymer, a glycoproteins, an aptamers, a
  • Lectins such as Concavalin A are known to bind to polysaccharides and glycosylated proteins.
  • An illustrative example of a dye is a triazine dye such as Cibacron blue F3G-A (CB) or Red HE-3B, which specifically bind NADH-dependent enzymes.
  • CB Cibacron blue F3G-A
  • Red HE-3B Red HE-3B
  • Green A binds to Co A proteins, human serum albumin, and dehydrogenases.
  • the dyes 7-aminoactinomycin D and 4',6-diamidino-2- phenylindole bind to DNA.
  • cations of metals such as Ni, Cd, Zn, Co, or Cu, are typically used to bind affinity tags such as an oligohistidine containing sequence, including the hexahistidine or the His-Asn-His-Arg-His-Lys-His-Gly-Gly-Gly-Cys tag (MAT tag) (SEQ ID NO: 35), and N-methacryloyl-(L)-cysteine methyl ester.
  • affinity tags such as an oligohistidine containing sequence, including the hexahistidine or the His-Asn-His-Arg-His-Lys-His-Gly-Gly-Gly-Cys tag (MAT tag) (SEQ ID NO: 35), and N-methacryloyl-(L)-cysteine methyl ester.
  • the binding between the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) and the one or more binding sites Z of the reagent occurs in the presence of a divalent, a trivalent or a tetravalent cation.
  • the reagent includes a divalent, a trivalent or a tetravalent cation, typically held, e.g. complexed, by means of a suitable chelator.
  • the binding partner C that is included in the agent may include a moiety that includes, e.g.
  • a respective metal chelator examples include, but are not limited to, ethylenediamine, ethylene-diaminetetraacetic acid (EDTA), ethylene glycol tetraacetic acid (EGTA),
  • EDTA diethylenetri-aminepentaacetic acid
  • NTA N,N-bis(carboxymethyl)glycine
  • BAPTA l,2-bis(o-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid
  • dimercaprol 2,3-dimer-capto-l-propanol
  • porphine and heme.
  • EDTA forms a complex with most monovalent, divalent, trivalent and tetravalent metal ions, such as e.g.
  • a standard method used in the art is the formation of a complex between an oligohistidine tag and copper (Cu 2+ ), nickel (Ni 2+ ), cobalt (Co 2+ ), or zinc (Zn 2+ ) ions, which are presented by means of the chelator nitrilotriacetic acid (NTA).
  • NTA chelator nitrilotriacetic acid
  • the binding partner C that is included in the agent includes a calmodulin binding peptide and the reagent includes multimeric calmodulin as described in US Patent 5,985,658, for example.
  • the binding partner C that is included in the agent includes a FLAG peptide and the reagent includes an antibody that binds to the FLAG peptide, e.g. the FLAG peptide, which binds to the monoclonal antibody 4E11 as described in US Patent 4,851,341.
  • the binding partner C that is included in the agent includes an oligohistidine tag and the reagent includes an antibody or a transition metal ion binding the oligohistidine tag.
  • the disruption of all these binding complexes may be accomplished by metal ion chelation, e.g. calcium chelation, for instance by adding EDTA or EGTA.
  • calmodulin, antibodies such as 4E11 or chelated metal ions or free chelators may be multimerized by conventional methods, e.g. by biotinylation and complexation with streptavidin or avidin or oligomers thereof or by the introduction of carboxyl residues into a polysaccharide, e.g. dextran, essentially as described in Noguchi, A, et al. Bioconjugate
  • the binding between the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) and the one or more binding sites Z of the reagent can be disrupted by metal ion chelation.
  • the metal chelation may, for example, be accomplished by addition of EGTA or EDTA.
  • the agent e.g., receptor-binding agent or selection agent
  • the agent which specifically bind to the cell surface molecule
  • the binding site B of the agent is an antibody combining site, such as is or contains one or more complementarity determining regions (CDRs) of an antibody.
  • Examples of (recombinant) antibody fragments include, but are not limited to, Fab fragments, Fv fragments, single-chain Fv fragments (scFv), a divalent antibody fragment such as an
  • the agent e.g., receptor-binding agent or selection agent
  • the agent may comprise a bivalent proteinaceous artificial binding molecule such as a dimeric lipocalin mutein that is also known as "duocalin”.
  • the agent may have a single binding site B, i.e., it may be monovalent.
  • monovalent agents include, but are not limited to, a monovalent antibody fragment, a proteinaceous binding molecule with antibody-like binding properties or an MHC molecule.
  • monovalent antibody fragments include, but are not limited to a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv), including a divalent single-chain Fv fragment.
  • the agent is an antibody or an antigen-binding fragment thereof, such as a Fab fragments, Fv fragments, single-chain Fv fragments (scFv), a divalent antibody fragment such as an (Fab)2'-fragment.
  • the agent is or is derived from a parental antibody that is known to bind to a cell molecule of interest.
  • Various antibody molecules or fragments thereof against cell surface molecules are well known in the art and any of a variety of such can be used as agents in the methods herein.
  • the agent is an antibody or fragment thereof that contains one or more amino acid replacements in the variable heavy chain of a parental or reference antibody, for example, to generate an antibody with an altered affinity or that exhibits a sufficiently fast off-rate as described above.
  • exemplary of such mutations are known the context of mutants of the anti-CD4 antibody 13B8.2 (see e.g., U.S. Patent Nos. 7,482,000, U.S. Patent Appl. No. US2014/0295458 or International Patent Application No. WO2013/ 124474), and any of such mutations can be generated in another parental or reference antibody.
  • the agent e.g., receptor-binding agent or selection agent
  • the agent that can be monovalent, for example comprise a monovalent antibody fragment or a monovalent artificial binding molecule (proteinaceous or other) such as a mutein based on a polypeptide of the lipocalin family (also known as "Anticalin®), or a bivalent molecule such as an antibody or a fragment in which both binding sites are retained such as an F(ab') 2 fragment.
  • a monovalent antibody fragment or a monovalent artificial binding molecule proteinaceous or other
  • a mutein based on a polypeptide of the lipocalin family also known as "Anticalin®
  • a bivalent molecule such as an antibody or a fragment in which both binding sites are retained such as an F(ab') 2 fragment.
  • An example of a proteinaceous binding molecule with antibody- like functions includes a mutein based on a polypeptide of the lipocalin family (see for example, WO
  • lipocalins such as the bilin binding protein, the human neutrophil gelatinase-associated lipocalin, human Apo lipoprotein D or human tear lipocalin possess natural ligand-binding sites that can be modified so that they bind a given target.
  • agent e.g., receptor- binding agent or selection agent
  • glubodies see e.g. international patent application WO
  • avimers including multivalent avimer proteins evolved by exon shuffling of a family of human receptor domains, contain so called A-domains that occur as strings of multiple domains in several cell surface receptors (Silverman, J., et al, Nature Biotechnology (2005) 23, 1556-1561).
  • Adnectins generally derived from a domain of human fibronectin, typically contain three loops that can be engineered for immunoglobulin-like binding to targets (Gill, D.S. & Damle, N.K., Current Opinion in Biotechnology (2006) 17, 653-658).
  • Tetranectins generally derived from the respective human homotrimeric protein, likewise typically contain loop regions in a C-type lectin domain that can be engineered for desired binding.
  • Peptoids which can, in some cases, act as protein ligands, typically are oligo(N-alkyl) glycines that differ from peptides in that the side chain is connected to the amide nitrogen rather than the carbon atom. Peptoids are typically resistant to proteases and other modifying enzymes and can have a much higher cell permeability than peptides (see e.g. Kwon, Y.-U., and Kodadek, T., J. Am. Chem. Soc. (2007) 129, 1508-1509).
  • suitable proteinaceous binding molecules include, but are not limited to, an EGF-like domain, a Kringle-domain, a fibronectin type I domain, a fibronectin type II domain, a fibronectin type III domain, a PAN domain, a Gla domain, a SRCR domain, a Kunitz/Bovine pancreatic trypsin Inhibitor domain, tendamistat, a Kazal-type serine protease inhibitor domain, a Trefoil (P-type) domain, a von Willebrand factor type C domain, an EGF-like domain, a Kringle-domain, a fibronectin type I domain, a fibronectin type II domain, a fibronectin type III domain, a PAN domain, a Gla domain, a SRCR domain, a Kunitz/Bovine pancreatic trypsin Inhibitor domain, tendamistat, a Kazal-type serine protease inhibitor domain, a Trefoil (P-type
  • Anaphylatoxin-like domain a CUB domain, a thyroglobulin type I repeat, LDL-receptor class A domain, a Sushi domain, a Link domain, a Thrombospondin type I domain, an immunoglobulin domain or a an immunoglobulin-like domain (for example, domain antibodies or camel heavy chain antibodies), a C-type lectin domain, a MAM domain, a von Willebrand factor type A domain, a Somatomedin B domain, a WAP -type four disulfide core domain, a F5/8 type C domain, a Hemopexin domain, an SH2 domain, an SH3 domain, a Laminin-type EGF-like domain, a C2 domain, "Kappabodies" (111 et al.
  • a nucleic acid molecule with antibody-like functions can be an aptamer. Generally, an aptamer folds into a defined three-dimensional motif and shows high affinity for a given target structure.
  • the agent is a receptor-binding agent.
  • the receptor-binding agent binds to a molecule (e.g. receptor) on the surface of a cell, which binding between the agent and the molecule is capable of inducing or modulating a signal in the cells.
  • the cell surface molecule e.g. receptor
  • the receptor-binding agent is capable of specifically binding to a signaling molecule expressed by one or more of the cells.
  • the receptor-binding agent is a stimulatory agent, which can be any agent that is capable of inducing a signal in a cell (e.g.
  • the signal can be immuno stimulatory, in which case the receptor-binding agent or stimulatory agent is capable of inducing or modulating a signal that is involved in or that does stimulate an immune response by the cell (e.g. T cell), e.g. increase immune cell proliferation or expansion, immune cell activation, immune cell differentiation, cytokine secretion, cytotoxic activity or one or more other functional activities of an immune cell.
  • the signal can be inhibitory, in which case the receptor-binding agent or stimulatory agent is capable of inducing or modulating a signal in the cell (e.g. T cell) that is involved in or that does inhibit an immune response, e.g. inhibits or decreases immune cell proliferation or expansion, immune cell activation, immune cell differentiation, cytokine secretion, cytotoxic activity or one or more other functional activities of an immune cell.
  • the receptor-binding agent e.g., stimulatory agent is a first receptor-binding agent, e.g., first stimulatory agent.
  • the first receptor-binding agent e.g., first stimulatory agent
  • the first receptor-binding agent e.g., first stimulatory agent
  • the inducing or modulating of a signal by the first receptor-binding agent, e.g., first stimulatory agent effects the activation, stimulation, and/or expansion
  • the first receptor-binding agent e.g., first stimulatory agent
  • the first receptor-binding agent provides a primary activation signal to the cells, thereby activating the cells.
  • the cell population may be a population of lymphocytes including, but not limited a population of B cells, a population of T cells or a population of natural killer cells.
  • Illustrative examples of cell populations are B cells carrying CD40 or CD 137 (both cell population can be proliferated upon binding of only a first agent that provides an activation signal, for example 4-1BB ligand; or an aCD40 antibody molecule or an aCD137 antibody molecule (see for example Zhang et al., 2010, J Immunol, 184:787-795)).
  • first or second agents for the expansion of B cell may comprise ligands for toll like receptors or interleukins, such as IL-21 (see for example Dienz O, et al. 2009. J. Exp. Med. 206:69).
  • lipopolysaccharide dependent activation of B cells is also encompassed in the present invention, as a
  • lipopolysaccharide can also be used as first agent and can be equipped with a binding partner CI as used herein.
  • suitable cell populations include T cell population that expand after being activated by binding of a first agent to TCR/CD3 and binding of a second agent to an accessory molecule on the T cell such as CD28.
  • the first agent stimulates a TCR/CD3 complex-associated signal in the T cells and the second agent provides a secondary stimulus by binding CD28 as accessory molecule.
  • Agents that can be used for the expansion of T cells may also include interleukins, such as IL-2, IL-7, IL-15, or IL-21 (see for example Cornish et al. 2006, Blood.
  • agents that may be used for the expansion of T cells are agents that bind to CD8, CD45 or CD90, such as aCD8, aCD45 or aCD90 antibodies.
  • T cell population including antigen- specific T cells, T helper cells, cytotoxic T cells, memory T cell (an illustrative example of memory T-cells are CD62L + CD8 + specific central memory T cells) or regulatory T cells (an illustrative example of Treg are CD4 + CD25 + CD45RA+ Treg cells).
  • a suitable cell population includes natural killer cells (NK cells), which may for example be expanded with agents that bind to CD 16 or CD56, such as for example aCD16 or aCD56 antibodies.
  • NK cells natural killer cells
  • an aCD16 antibody is the antibody 3G8 with a VH sequence set forth in SEQ ID NO: 52 and a VL sequence set forth in SEQ ID NO: 53 (see for example Hoshino et al, Blood. 1991 Dec 15;78(12):3232-40.).
  • Another agent that may be used for expansion of NK cells may be IL-15 (see for example Vitale et al. 2002. The Anatomical Record. 266:87-92).
  • monocytes which may for instance be expanded using an agent that binds to CD 14, such as an aCD14 antibody molecule.
  • the first receptor-binding agent may stimulate a TCR/CD3 complex-associated signal in the cells, e.g., T cells.
  • the first receptor-binding agent e.g., first stimulatory agent
  • a first receptor-binding agent, e.g., first stimulatory agent, that specifically binds CD3 may be selected from the group consisting of an anti-CD3- antibody, a divalent antibody fragment of an anti-CD3 antibody, a monovalent antibody fragment of an anti-CD3-antibody, and a proteinaceous CD3 binding molecule with antibodylike binding properties.
  • the divalent antibody fragment may be a (Fab)2' -fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv).
  • a proteinaceous CD3 binding molecule with antibody- like binding properties may be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, or an avimer.
  • an anti-CD3 Fab fragment can be derived from the CD3 binding monoclonal antibody produced by the hybridoma cell line OKT3 (ATCC® CRL- 8001TM; see also U.S. Patent No. 4,361,549).
  • the variable domain of the heavy chain and the variable domain of the light chain of the anti-CD3 antibody OKT3 are described in Arakawa et al J. Biochem. 120, 657-662 (1996) and comprise the amino acid sequences set forth in SEQ ID NO: 31 and 32, respectively.
  • the receptor-binding agent e.g., stimulatory agent
  • the receptor-binding agent is a second receptor-binding agent, e.g., second stimulatory agent,.
  • the second receptor-binding agent e.g., second stimulatory agent
  • the second receptor-binding agent e.g., second stimulatory agent
  • the second receptor-binding agent induces or modulates a signal, e.g., a second or an additional signal.
  • the second receptor-binding agent e.g., second stimulatory agent
  • the second receptor-binding agent e.g., second stimulatory agent
  • the second receptor-binding agent e.g., second stimulatory agent, binds to a co- stimulatory molecule and/or provides a
  • the receptor-binding agent e.g., stimulatory agent
  • the second receptor-binding agent e.g., second stimulatory agent
  • binds e.g. specifically binds, to a second molecule that can be a costimulatory molecule, an accessory molecule, a cytokine receptor, a chemokine receptor, an immune checkpoint molecule, or a member of the TNF family or the TNF receptor family.
  • the molecule on the cell may be CD28 and the receptor-binding agent, e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) specifically binds CD28.
  • the receptor-binding agent e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) specifically binds CD28.
  • the receptor-binding agent e.g., stimulatory agent (e.g.
  • CD28 which can be the second receptor-binding agent, e.g., second stimulatory agent,
  • the second receptor-binding agent e.g., second stimulatory agent
  • the divalent antibody fragment may be an (Fab)2' -fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv).
  • a proteinaceous CD28 binding molecule with antibody- like binding properties may be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, and an avimer.
  • an anti-CD28 Fab fragment can be derived from antibody CD28.3 (deposited as a synthetic single chain Fv construct under GenBank Accession No. AF451974.1; see also Vanhove et al, BLOOD, 15 July 2003, Vol. 102, No. 2, pages 564-570) the heavy and light chain of which comprise SEQ ID NO: 33 and 34, respectively.
  • the molecule on the cell may be CD90 and the receptor-binding agent, e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) specifically binds CD90.
  • the receptor-binding agent e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) specifically binds CD90.
  • the receptor-binding agent e.g., stimulatory agent (e.g.
  • the second receptor-binding agent e.g., second stimulatory agent
  • the second receptor-binding agent e.g., second stimulatory agent
  • CD90 may be selected from the group consisting of an anti-CD90-antibody, a divalent antibody fragment of an anti-CD90 antibody, a monovalent antibody fragment of an anti-CD90-antibody, and a proteinaceous CD90 binding molecule with antibody- like binding properties.
  • the antibody or antigen-binding fragment can be derived from any known in the art. See e.g. anti-CD90 antibody G7 (Biolegend, cat. no. 105201).
  • the molecule on the cell may be CD95 and the receptor-binding agent, e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) specifically binds CD95.
  • the receptor-binding agent e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) specifically binds CD95.
  • the receptor-binding agent e.g., stimulatory agent (e.g.
  • the second receptor-binding agent e.g., second stimulatory agent
  • the second receptor-binding agent e.g., second stimulatory agent
  • CD95 may be selected from the group consisting of an anti-CD95-antibody, a divalent antibody fragment of an anti-CD95 antibody, a monovalent antibody fragment of an anti-CD95-antibody, and a proteinaceous CD95 binding molecule with antibody- like binding properties.
  • the antibody or antigen-binding fragment can be derived from any known in the art.
  • the anti-CD90 antibody can be monoclonal mouse anti-human CD95 CHI 1 (Upstate Biotechnology, Lake Placid, NY) or can be anti-CD95 mAb 7C11 or anti-APO-1, such as described in Paulsen et al. Cell Death & Differentiation 18.4 (2011): 619-631.
  • the molecule on the cell may be CD 137 and the receptor-binding agent, e.g., stimulatory agent (e.g. which can be the second receptor- binding agent, e.g., second stimulatory agent,) specifically binds CD137.
  • the receptor-binding agent e.g., stimulatory agent, (e.g.
  • CD 137 which can be the second receptor-binding agent, e.g., second stimulatory agent
  • the second receptor-binding agent e.g., second stimulatory agent
  • the antibody or antigen- binding fragment can be derived from any known in the art.
  • the anti-CD 137 antibody can be LOB 12, IgG2a or LOB 12.3, IgGl as described in Taraban et al. Eur J Immunol. 2002 Dec;32(12):3617-27. See also e.g. US6569997, US6303121, Mittler et al. Immunol Res. 2004;29(l-3): 197-208.
  • the molecule on the cell may be CD40 and the receptor-binding agent, e.g., stimulatory agent, (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent) specifically binds CD40.
  • the receptor-binding agent (which can be the second receptor-binding agent, e.g., second stimulatory agent) that specifically binds CD40 may be selected from the group consisting of an anti-CD40- antibody, a divalent antibody fragment of an anti-CD40 antibody, a monovalent antibody fragment of an anti-CD40-antibody, and a proteinaceous CD40 binding molecule with antibodylike binding properties.
  • the molecule on the cell may be CD40L (CD 154) and the receptor-binding agent, e.g., stimulatory agent, (e.g. which can be the second receptor- binding agent, e.g., second stimulatory agent) specifically binds CD40L.
  • the receptor-binding agent, e.g., stimulatory agent e.g., a stimulatory agent
  • CD40L which can be the second receptor-binding agent, e.g., second stimulatory agent
  • the second receptor-binding agent e.g., second stimulatory agent
  • CD40L may be selected from the group consisting of an anti-CD40L-antibody, a divalent antibody fragment of an anti-CD40L antibody, a monovalent antibody fragment of an anti-CD40L-antibody, and a proteinaceous CD40L binding molecule with antibody- like binding properties.
  • the antibody or antigen- binding fragment can be derived from any known in the art.
  • the anti-CD40L antibody can in some aspects be Hu5C8, as described in Blair et al. JEM vol. 191 no. 4 651-660. See also e.g. WO1999061065, US20010026932, US7547438, WO2001056603.
  • the receptor-binding agent e.g., stimulatory agent is capable of binding to any one or more of CD28, CD5, CD4, CD8, MHCI, MHCII, CTLA-4, ICOS, PD- 1, OX40, CD27L (CD70), 4-lBBL, CD30L and LIGHT
  • the receptor-binding agent e.g. stimulatory agent
  • Fab fragment an Fv fragment, or a single-chain Fv fragment (scFv)) or ligand to any one or more of CD28, CD5, CD4, CD8, MHCI, MHCII, CTLA-4, ICOS, PD-1, OX40, CD27L (CD70), 4-lBBL, CD30L and LIGHT, in which such agent is capable of inducing or modeling a signal in the cells upon binding of the receptor-binding agent, e.g., stimulatory agent to the molecule.
  • the receptor-binding agent e.g., stimulatory agent to the molecule.
  • the receptor-binding agent e.g., stimulatory agent
  • the receptor-binding agent is capable of specifically binding to a molecule on the surface of the target cells other than CD28, CD3, CD137 or CD40.
  • the binding of the receptor-binding agent, e.g., stimulatory agent, to the molecule on the surface of the target cells other than CD28, CD3, CD 137 or CD40 induces or modulates a signal in the target cells and/or alters a function of the target cells, thereby generating cultured target cells.
  • the divalent antibody fragment may be an (Fab)2'- fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv).
  • the proteinaceous binding molecule with antibody-like binding properties may be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, and an avimer.
  • the agent is a selection agent.
  • the selection agent binds to a molecule on the surface of a cell, such as a cell surface molecule.
  • the cell surface molecule is a selection marker.
  • the selection agent is capable of specifically binding to a selection marker expressed by one or more of the cells.
  • a selection agent or agents that are reversibly bound to a reagent can be used to facilitate selection or isolation of cells.
  • the cell surface molecule e.g., selection marker
  • lymphocytes e.g. T cells, T-helper cells, for example, CD4+ T-helper cells, B cells or natural killer cells
  • monocytes or stem cells, e.g. CD34-positive peripheral stem cells or Nanog or Oct-4 expressing stem cells.
  • the selection marker can be a marker expressed on the surface of T cells or a subset of T cells, such as CD25, CD28, CD62L, CCR7, CD27, CD127, CD3, CD4, CD8, CD45RA, and/or CD45RO
  • T-cells include cells such as CM V- specific CD8+ T-lymphocytes, cytotoxic T-cells, memory T-cells and regulatory T-cells (Treg).
  • Treg includes CD4 CD25 CD45RA Treg cells and an illustrative example of memory T-cells includes CD62L CD8+ specific central memory T-cells.
  • the cell surface molecule e.g., selection marker, may also be a marker for a tumor cell.
  • the selection marker may be CD4 and the selection agent specifically binds CD4.
  • the selection agent that specifically binds CD4 may be selected from the group consisting of an anti-CD4-antibody, a divalent antibody fragment of an anti-CD4 antibody, a monovalent antibody fragment of an anti-CD4-antibody, and a
  • an anti-CD4-antibody such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD4 Fab fragment) can be derived from antibody 13B8.2 or a functionally active mutant of 13B8.2 that retains specific binding for CD4.
  • a divalent antibody fragment or a monovalent antibody fragment e.g. CD4 Fab fragment
  • exemplary mutants of antibody 13B8.2 or ml3B8.2 are described in U.S. Patent Nos.
  • mutant Fab fragment termed "ml3B8.2" carries the variable domain of the CD4 binding murine antibody 13B8.2 and a constant domain containing constant human CHI domain of type gamma for the heavy chain and the constant human light chain domain of type kappa, as described in US Patent 7,482,000.
  • the anti-CD4 antibody e.g.
  • a mutant of antibody 13B8.2 contains the amino acid replacement H91A in the variable light chain, the amino acid replacement Y92A in the variable light chain, the amino acid replacement H35A in the variable heavy chain and/or the amino acid replacement R53A in the variable heavy chain, each by Kabat numbering.
  • the His residue at position 91 of the light chain (position 93 in SEQ ID NO: 30) is mutated to Ala and the Arg residue at position 53 of the heavy chain (position 55 in SEQ ID NO: 29) is mutated to Ala.
  • the reagent that is reversibly bound to anti- CD4 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-206 or 6-8000-205 or 6-8002-100; IBA GmbH, Gottingen, Germany).
  • the selection marker may be CD8 and the selection agent specifically binds CD8.
  • the selection agent that specifically binds CD8 may be selected from the group consisting of an anti-CD8-antibody, a divalent antibody fragment of an anti-CD8 antibody, a monovalent antibody fragment of an anti-CD8-antibody, and a
  • an anti-CD8-antibody such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD8 Fab fragment) can be derived from antibody OKT8 (e.g. ATCC CRL-8014) or a functionally active mutant thereof that retains specific binding for CD8.
  • the reagent that is reversibly bound to anti-CD8 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8003 or 6-8000-201; IBA GmbH, Gottingen, Germany).
  • the selection marker may be CD3 and the selection agent specifically binds CD3.
  • the selection agent that specifically binds CD3 may be selected from the group consisting of an anti-CD3-antibody, a divalent antibody fragment of an anti-CD3 antibody, a monovalent antibody fragment of an anti-CD3-antibody, and a
  • an anti-CD3-antibody such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD3 Fab fragment) can be derived from antibody OKT3 (e.g. ATCC CRL-8001; see e.g., Stemberger et al. PLoS One. 2012; 7(4): e35798) or a functionally active mutant thereof that retains specific binding for CD3.
  • the reagent that is reversibly bound to anti-CD3 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-201, 6-8001-100; IBA GmbH, Gottingen, Germany).
  • the selection marker may be CD25 and the selection agent specifically binds CD25.
  • the selection agent that specifically binds CD25 may be selected from the group consisting of an anti-CD25-antibody, a divalent antibody fragment of an anti-CD25 antibody, a monovalent antibody fragment of an anti-CD25-antibody, and a proteinaceous CD25 binding molecule with antibody-like binding properties.
  • an anti-CD25-antibody such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD25 Fab fragment) can be derived from antibody FRT5 (See e.g., Stemberger et al. 20128) or a functionally active mutant thereof that retains specific binding for CD25.
  • the reagent that is reversibly bound to anti-CD4 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-205 or 6-8000-207 or 6-8004-050; IBA GmbH, Gottingen, Germany).
  • the selection marker may be CD62L and the selection agent specifically binds CD62L.
  • the selection agent that specifically binds CD62L may be selected from the group consisting of an anti-CD62L-antibody, a divalent antibody fragment of an anti-CD62L antibody, a monovalent antibody fragment of an anti-CD62L- antibody, and a proteinaceous CD62L binding molecule with antibody- like binding properties.
  • an anti-CD62L-antibody such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD62L Fab fragment) can be derived from antibody DREG56 (e.g. ATCC HB300; see e.g. Stemberger et al.
  • the reagent that is reversibly bound to anti-CD62L or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-204 or 6-8005-050; IBA GmbH, Gottingen, Germany).
  • the selection marker may be CD45RA and the selection agent specifically binds CD45RA. In some aspects, the selection agent that specifically binds
  • CD45RA may be selected from the group consisting of an anti-CD45RA-antibody, a divalent antibody fragment of an anti-CD45RA antibody, a monovalent antibody fragment of an anti- CD45RA-antibody, and a proteinaceous CD45RA binding molecule with antibody-like binding properties.
  • an anti-CD45RA-antibody such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD45RA Fab fragment) can be derived from antibody MEM56 (e.g. Millipore 05-1413; see e.g. Stemberger et al. 2012) or a functionally active mutant thereof that retains specific binding for CD45RA.
  • the reagent that is reversibly bound to anti-CD45RA or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-208 or 6-8007- 050; IBA GmbH, Gottingen, Germany).
  • the selection marker may be CD45RO and the selection agent specifically binds CD45RO.
  • the selection agent that specifically binds CD45RO may be selected from the group consisting of an anti-CD45RO-antibody, a divalent antibody fragment of an anti-CD45RO antibody, a monovalent antibody fragment of an anti- CD45RO-antibody, and a proteinaceous CD45RO binding molecule with antibody-like binding properties.
  • the reagent that is reversibly bound to anti-CD45RO or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-209 or 6-8012-020; IBA GmbH, Gottingen, Germany).
  • the selection marker may be CD 154 and the selection agent specifically binds CD 154.
  • the selection agent that specifically binds CD 154 may be selected from the group consisting of an anti-CD 154-antibody, a divalent antibody fragment of an anti-CD 154 antibody, a monovalent antibody fragment of an anti-CD 154- antibody, and a proteinaceous CD 154 binding molecule with antibody- like binding properties.
  • the reagent that is reversibly bound to anti-CD 154 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-202 or 6-5510-050; IBA GmbH, Gottingen, Germany).
  • the selection marker may be CD 16 and the selection agent specifically binds CD 16.
  • the selection agent that specifically binds CD 16 may be selected from the group consisting of an anti-CD 16-antibody, a divalent antibody fragment of an anti-CD 16 antibody, a monovalent antibody fragment of an anti-CD 16-antibody, and a proteinaceous CD 16 binding molecule with antibody-like binding properties.
  • the reagent that is reversibly bound to anti-CD 16 or a fragment thereof is commercially available or derived from a reagent that is commercially available.
  • the CD 16 binding molecule comprises the heavy chain and/or light chain sequences set forth in SEQ ID NO: 52 and 53, respectively.
  • the divalent antibody fragment may be an (Fab)2'- fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv).
  • the proteinaceous binding molecule with antibody-like binding properties may be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, and an avimer.
  • culturing cells which include incubating a composition containing target cells (e.g. T cells) in the presence of an agent (e.g. first or second, receptor-binding agents, e.g. stimulatory agents, or selection agents) that is capable of binding to a molecule on the surface of targets cells (e.g. T cells) in the composition and that is reversibly bound to a reagent containing a plurality of binding sites capable of reversibly binding to the agent.
  • the incubation is performed under conditions in which the agent binds, such as specifically binds, to the molecule on the cell.
  • receptor-binding agents e.g.
  • binding can induce or modulate a signal in target cells (e.g. T cells) in the compositions, such as a primary signal or accessory signal as described.
  • target cells e.g. T cells
  • binding of the agent to the molecule results in one or more of the stimulation, activation, expansion (proliferation) and/or differentiation of target cells in the composition.
  • the provided method can be used for selectively inducing ex vivo expansion of a population of cells such as B cells, T cells or natural killer cells.
  • the stimulation can be in the absence of exogenous growth factors, such as lymphokines, and accessory cells.
  • the proliferation of these cells such as B cells or T cells can be induced without the need for antigen, thus providing an expanded cell population such as a T cell population which is polyclonal with respect to antigen reactivity.
  • the methods disclosed herein may provide for sustained proliferation of a selected population of T cells such as CD4+ or CD8+ T cells over an extended period of time to yield a multi-fold increase in the number of these cells relative to the original T cell population.
  • all progeny may share the same antigen specificity as the cell population that was selected for expansion.
  • the methods relate to expanding a population of antigen specific T cells.
  • T cells are contacted with an antigen in a form suitable to trigger a primary activation signal in the T cell, i.e., the antigen is presented to the T cell such that a signal is triggered in the T cell through the TCR/CD3 complex.
  • the antigen can be presented to the T cell by an antigen presenting cell in conjunction with an MHC molecule.
  • An antigen presenting cell such as a B cell, macrophage, monocyte, dendritic cell, Langerhans cell, or other cell which can present antigen to a T cell, can be incubated with the T cell in the presence of the antigen (e.g., a soluble antigen) such that the antigen presenting cell presents the antigen to the T cell.
  • the antigen e.g., a soluble antigen
  • a cell expressing an antigen of interest can be incubated with the T cell.
  • a tumor cell expressing tumor-associated antigens can be incubated with a T cell together to induce a tumor- specific response.
  • a cell infected with a pathogen e.g., a virus, which presents antigens of the pathogen can be incubated with a T cell.
  • the cells can be expanded in accordance with the provided methods. For example, after antigen specificity has been established, T cells can be expanded by culture with an anti-CD3 antibody (used as first agent) and an anti-CD28 antibody (used as second agent) according to the methods described herein.
  • the first agent can be an MHC I: peptide complex, which binds to an antigen specific T cell population.
  • any antigen specific peptide that is known and that can be complexed with the respective MHC I molecule can be used.
  • the extracellular domain of CD 19 can be used to cause the activation of intracellular signaling cascades of cells transduced to express chimeric CD 19 binding antigen receptor (CAR).
  • an in viiro-method of culturing a population of cells comprising contacting a sample comprising a composition comprising a plurality of cells with a multimerization reagent.
  • the multimerization reagent has reversibly immobilized thereon (bound thereto) an agent (first or second, receptor-binding, e.g. stimulatory agent, or selection agent), which can be used for the selection, stimulation, expansion and/or differentiation of cells.
  • a first agent that provides a primary activation signal to the cells, wherein the multimerization reagent comprising at least one binding site Zl for the reversible binding of the first agent.
  • the first agent comprises at least one binding partner CI, wherein the binding partner CI is able of reversibly binding to the binding site Zl of the multimerization reagent, wherein the first agent is bound to the multimerization reagent via the reversible bond formed between the binding partner CI and the binding site Zl.
  • the first agent binds to a receptor molecule on the surface of the cells, thereby providing a primary activation signal to the cells and thereby activating the cells.
  • the multimerization reagent is immobilized on a support, such as a solid surface. In some embodiments, the multimerization reagent is not bound to a support, such as not bound to a solid surface or stationary phase.
  • an in viiro-method of expanding a population of cells comprising contacting a sample comprising a population of cells with a multimerization reagent, wherein the multimerization reagent is not immobilized on a solid support, i.e. is in a soluble form, and has bound thereto an agent (first or second, receptor- binding, e.g.
  • a first agent that provides a primary activation signal to the cells is reversibly bound to the multimerization reagent.
  • the multimerization reagent comprises at least one binding site, e.g. Zl for the binding of the first agent, wherein the first agent comprises at least one binding partner, e.g. CI, wherein the binding partner CI is able of binding to the binding site Zl of the multimerization reagent.
  • the first agent is bound to the multimerization reagent via the bond formed between the binding partner CI and the binding site Zl, and the first agent binds to a receptor molecule on the surface of the cells, thereby providing a primary activation signal to the cells and thereby activating the cells.
  • the bond between the binding part C, e.g. CI and the binding site Z, e.g. Zl does not need to be reversible.
  • the provided methods also include the use of a multimerization reagent having bound thereto a second agent, such as an accessory or co- stimulatory molecules, that stimulates an accessory molecule on the surface of the cells.
  • a multimerization agent is immobilized on a support, e.g. a solid support or stationary phase.
  • the multimerization agent is not immobilized on a support, i.e. is in soluble form.
  • the second agent comprises a binding partner, e.g. C2, wherein the binding partner, e.g. C2 is able of being reversibly bound to a binding site, e.g.
  • the bond formed between the binding partner CI and the binding site Zl may be reversible and the bond formed between the binding partner C2 and the binding site Z2 may be reversible.
  • the dissociation constant (Ka) for the reversible binding between said binding site Zl and said binding partner CI and/or for the reversible binding between said binding site Z2 and said binding partner C2 may be in the range of 10 - " 2 M to 10 - " 13 M.
  • the bond formed between the binding partner CI and the binding site Zl may be irreversible and/or also the bond formed between the binding partner C2 and the binding site Z2 may be irreversible
  • the second agent binds to the accessory molecule on the surface on the surface of the cells, thereby stimulating the activated cells.
  • the first agent may stimulate a TCR/CD3 complex-associated signal in the T cells and may be a binding agent that specifically binds CD3.
  • the accessory molecule on the T cell may be CD28 and the second agent that binds the accessory molecule is a binding reagent that specifically binds CD28.
  • targeting other accessory molecules also can be employed, which can, in some cases, alter, such as improve, one or more features, properties or characteristics of the cultured cells.
  • the accessory molecule can be one or more of IL-12R, IFNyR, IL-4R, IL-17R, RORyt, RORa, CXCR3, CCR7, CD62L, CXCR1 or CXCR4 (e.g. an anti-IL-12R antibody, an anti- IFNyR antibody, an anti- IL-4R antibody, and an anti- IL-17R antibody, anti-RORyt antibody, anti- RORa antibody, anti-CXCR3 antibody, anti-CCR7 antibody, anti-CD62L antibody, anti- CXCR1 antibody or anti-CXCR4 antibody, respectively.
  • agents such as receptor- binding agents (e.g. stimulatory agents), are described below.
  • the provided method may be carried out at any temperature at which the viability of the cell population is at least essentially uncompromised.
  • the condition at which incubation or culture is carried out include any conditions that are at least essentially not harmful, not detrimental or at least essentially not compromising viability, for example, under which the percentage of the population of cells that are to be expanded with full viability, is at least 70 , including at least 75 , at least 80 , at least 85 %, at least 90 %, at least 92 %, at least 95 %, at least 97 %, at least 98 %, at least 99 % or at least 99.5 %.
  • the provided method is carried out at a temperature of about 20 °C or higher.
  • a suitable temperature range may for instance be from about 20 °C to about 45 °C, including from about 25 °C to about 40 °C, or from about 32 °C to 37 °C.
  • a method according to the invention is carried out at a constant temperature value, or at a selected temperature value + about 5 °C, + about 4 °C, + about 3 °C, + about 2 °C, + about 1 °C or + about 0.5 °C.
  • the person skilled in the art is able to empirically determine a suitable temperature, taking into account the nature of the cells and the expansion conditions.
  • multimerized agents or composition comprising multimerization reagents that care capable of expanding a population of cells.
  • a multimerized agent that is capable of expanding a population of cells is a multimerization reagent that is not bound to a support (e.g. in soluble form) and comprises at least one binding site Z, e.g.
  • the multimerization reagent for the reversible binding of a first agent that provides a primary activation signal to the cells, wherein the multimerization reagent has reversibly bound thereto said first agent that provides a primary activation signal to the cells; wherein the first agent comprises at least one binding partner C, e.g. CI, wherein the binding partner CI is able of reversibly binding to the at least one binding site Zl of the multimerization reagent, wherein the first agent is bound to the multimerization reagent via the reversible bond formed between the binding partner CI and the binding site Zl.
  • a multimerization agent can have immobilized thereon any of the first agent that are described herein.
  • a multimerized agent provided herein may further comprise at least one binding site, e.g. Z2 for the reversible binding of a second agent that stimulates an accessory molecule on the surface of the cells, wherein the multimerization reagent has reversibly bound thereto the second agent that stimulates an accessory molecule on the surface of the cells, wherein the second agent comprises a binding partner, e.g. C2, wherein the binding partner C2 is able of binding to the at least one binding site Z2 of the multimerization reagent.
  • the second agent is bound to the multimerization reagent via the bond formed between the binding partner C2 and the binding site Z2.
  • the second agent is any that can bind to IL-12R, IFNyR, IL-4R, IL-17R, RORyt, RORa, CXCR3, CCR7, CD62L, CXCR1 or CXCR4 (e.g. an anti-IL-12R antibody, an anti- IFNyR antibody, an anti- IL- 4R antibody, and an anti- IL-17R antibody, anti-RORyt antibody, anti- RORa antibody, anti- CXCR3 antibody, anti-CCR7 antibody, anti-CD62L antibody, anti-CXCRl antibody or anti- CXCR4 antibody, respectively).
  • an anti-IL-12R antibody an anti- IFNyR antibody, an anti- IL- 4R antibody, and an anti- IL-17R antibody
  • anti-RORyt antibody anti- RORa antibody, anti- CXCR3 antibody, anti-CCR7 antibody, anti-CD62L antibody, anti-CXCRl antibody or anti- CXCR4 antibody, respectively.
  • the culturing of the composition containing target cells (e.g. T cells) with the multimerized agent can be carried out in a bioreactor such as a hollow-fiber bioreactor (e.g. hollow fiber bioreactor of the Quantum® cell expansion system) or a plastic bag bioreactor (e.g. Cellbag® used in Xuri Cell Expansion System W25 from GE Healthcare).
  • a bioreactor such as a hollow-fiber bioreactor (e.g. hollow fiber bioreactor of the Quantum® cell expansion system) or a plastic bag bioreactor (e.g. Cellbag® used in Xuri Cell Expansion System W25 from GE Healthcare).
  • the method further includes contacting the cultured target cells (e.g. T cells) in the reaction mixture (e.g. containing the target cells, e.g. T cells, bound to the multimerization reagent via, for example, the first agent and the second agent) with (i) a competition reagent (e.g. free first binding partner C, e.g. CI) or an analog thereof capable of disrupting the bond between the first binding partner, e.g. CI and the binding site, e.g. Zl and/or (such as if necessary) (ii) a second competition reagent, e.g. free second binding partner, e.g.
  • a competition reagent e.g. free first binding partner C, e.g. CI
  • a second competition reagent e.g. free second binding partner
  • the method further includes separating or removing one or more of the components remaining after the reversible dissociation of components.
  • any unbound or residual biotin in the cultured target cells e.g. T cells
  • the multimerization reagent is removed or separated from the cells in the cultured target cell composition.
  • the separation/removal might be carried out using a second stationary phase. For this purpose, a mixture comprising the target cells (e.g. T cells) and the soluble multimerization reagent are exposed, before or after being applied onto the first stationary phase described above, to chromatography on a suitable second stationary phase.
  • This secondary stationary phase may be a gel filtration matrix and/or affinity chromatography matrix, wherein the gel filtration and/or affinity chromatography matrix comprises an affinity reagent.
  • the affinity reagent comprised on the chromatography resin include a binding partner D that (specifically) binds to the binding site Zl and/or binding site Z2, if present, of the multimerization reagent, thereby immobilizing the multimerization reagent on the stationary phase. If a streptavidin based multimerization reagent is used and both first and second agents have a streptavidin binding peptide as binding partner CI or C2, the binding partner D that is comprised in the affinity reagent of this second stationary phase can be biotin.
  • the soluble oligomer of streptavidin or of a streptavidin mutein that is used as multimerization reagent then binds to the biotin that is usually covalently coupled to a chromatography matrix such as biotin- sepharoseTM that is commercially available.
  • the cultured cells e.g. cultured T cells
  • Cells contained in the composition containing target cells generally are eukaryotic cells, such as mammalian cells, and typically are human cells.
  • the cells are derived from the blood, bone marrow, lymph, or lymphoid organs, or are cells of the immune system, such as cells of the innate or adaptive immunity, e.g., myeloid or lymphoid cells, including lymphocytes, typically T cells and/or NK cells.
  • Other exemplary cells include stem cells, such as multipotent and pluripotent stem cells, including induced pluripotent stem cells (iPSCs).
  • the cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen.
  • the reversibly-bound agents are capable of expanding a lymphocyte population or a subpopulation contained in the lymphocyte population.
  • the lymphocyte population to be expanded may any suitable population, for example, a B cell population, a T cell population, or a natural killer cell population.
  • the T-cell population may be an antigen-specific T cell population, a T helper cell population, a cytotoxic T cell, a memory T cell, a regulatory T cell, or a natural killer T cell population.
  • the first agent is able to stimulate a TCR/CD3 complex-associated signal in the T cells.
  • the first agent present in the multimerized agent may thus be binding reagent that specifically binds CD3, while the second agent that binds the accessory molecule, such as may be a binding agent that specifically binds CD28, CD137, IL-12R, IFNyR, IL-4R, IL-17R, RORyt, RORa, CXCR3, CCR7, CD62L, CXCR1 or CXCR4.
  • the cells include one or more subsets of T cells or other cell types, such as whole T cell populations, CD4+ cells, CD8+ cells, and subpopulations thereof, such as those defined by function, activation state, maturity, potential for differentiation, expansion, recirculation, localization, and/or persistence capacities, antigen-specificity, type of antigen receptor, presence in a particular organ or compartment, marker or cytokine secretion profile, and/or degree of differentiation.
  • the cells may be allogeneic and/or autologous.
  • the methods include off-the-shelf methods.
  • the cells are pluripotent and/or multipotent, such as stem cells, such as induced pluripotent stem cells (iPSCs).
  • the methods include isolating cells from the subject, preparing, processing, culturing, and/or engineering them, as described herein, and re-introducing them into the same patient, before or after cryopreservation.
  • T N naive T
  • T EFF effector T cells
  • memory T cells and sub-types thereof such as stem cell memory T (T SCM ), central memory T (T CM ), effector memory T (T EM ), or terminally differentiated effector memory T cells
  • TIL tumor- infiltrating lymphocytes
  • immature T cells mature T cells
  • helper T cells cytotoxic T cells
  • mucosa-associated invariant T (MAIT) cells mucosa-associated invariant T (MAIT) cells
  • Reg adaptive regulatory T
  • helper T cells such as TH1 cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells, follicular helper T cells, alpha/beta T cells, and delta/gamma T cells.
  • the cells are natural killer (NK) cells.
  • the cells are monocytes or granulocytes, e.g., myeloid cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, and/or basophils.
  • preparation of the cells includes one or more culture and/or preparation steps.
  • the cells may be isolated from a sample, such as a biological sample, e.g., one obtained from or derived from a subject.
  • the subject from which the cells are isolated is one having the disease or condition or in need of a cell therapy or to which cell therapy will be administered.
  • the subject in some embodiments is a human in need of a particular therapeutic intervention, such as the adoptive cell therapy for which cells are being isolated, processed, and/or engineered.
  • the cells in some embodiments are primary cells, e.g., primary human cells.
  • the samples include tissue, fluid, and other samples taken directly from the subject, as well as samples resulting from one or more processing steps, such as separation, centrifugation, genetic engineering (e.g. transduction with viral vector), washing, and/or incubation.
  • the biological sample can be a sample obtained directly from a biological source or a sample that is processed.
  • Biological samples include, but are not limited to, body fluids, such as blood, plasma, serum, cerebrospinal fluid, synovial fluid, urine and sweat, tissue and organ samples, including processed samples derived therefrom.
  • the sample from which the cells are derived or isolated is blood or a blood-derived sample, or is or is derived from an apheresis or leukapheresis product.
  • exemplary samples include whole blood, peripheral blood mononuclear cells (PBMCs), leukocytes, bone marrow, thymus, tissue biopsy, tumor, leukemia, lymphoma, lymph node, gut associated lymphoid tissue, mucosa associated lymphoid tissue, spleen, other lymphoid tissues, liver, lung, stomach, intestine, colon, kidney, pancreas, breast, bone, prostate, cervix, testes, ovaries, tonsil, or other organ, and/or cells derived therefrom.
  • Samples include, in the context of cell therapy, e.g., adoptive cell therapy, samples from autologous and allogeneic sources.
  • the cells are derived from cell lines, e.g., T cell lines.
  • the cells in some embodiments are obtained from a xenogeneic source, for example, from mouse, rat, non-human primate, or pig.
  • isolation of the cells includes one or more preparation and/or non-affinity based cell separation steps.
  • cells are washed, centrifuged, and/or incubated in the presence of one or more reagents, for example, to remove unwanted
  • cells are separated based on one or more property, such as density, adherent properties, size, sensitivity and/or resistance to particular components.
  • cells from the circulating blood of a subject are obtained, e.g., by apheresis or leukapheresis.
  • the samples contain lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and/or platelets, and in some aspects contains cells other than red blood cells and platelets.
  • the blood cells collected from the subject are washed, e.g., to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps.
  • the cells are washed with phosphate buffered saline (PBS).
  • PBS phosphate buffered saline
  • the wash solution lacks calcium and/or magnesium and/or many or all divalent cations.
  • a washing step is
  • a washing step is accomplished by tangential flow filtration (TFF) according to the manufacturer's instructions.
  • the cells are resuspended in a variety of biocompatible buffers after washing, such as, for example, Ca ++ /Mg ++ free PBS.
  • components of a blood cell sample are removed and the cells directly resuspended in culture media.
  • the methods include density-based cell separation methods, such as the preparation of white blood cells from peripheral blood by lysing the red blood cells and centrifugation through a Percoll or Ficoll gradient.
  • the isolation methods include the separation of different cell types based on the expression or presence in the cell of one or more specific molecules, such as surface markers, e.g., surface proteins, intracellular markers, or nucleic acid. In some embodiments, any known method for separation based on such markers may be used.
  • Separation methods may include any of those disclosed herein, including methods using reversible reagent systems, e.g., agents (such as receptor binding agents or selection agents) and reagents as described herein.
  • agents such as receptor binding agents or selection agents
  • the separation is affinity- or immunoaffinity-based separation.
  • the isolation in some aspects includes separation of cells and cell populations based on the cells' expression or expression level of one or more markers, typically cell surface markers, for example, by incubation with an antibody or binding partner that specifically binds to such markers, followed generally by washing steps and separation of cells having bound the antibody or binding partner, from those cells having not bound to the antibody or binding partner.
  • Such separation steps can be based on positive selection, in which the cells having bound the reagents are retained for further use, and/or negative selection, in which the cells having not bound to the antibody or binding partner are retained. In some examples, both fractions are retained for further use. In some aspects, negative selection can be particularly useful where no antibody is available that specifically identifies a cell type in a heterogeneous population, such that separation is best carried out based on markers expressed by cells other than the desired population.
  • the separation need not result in 100% enrichment or removal of a particular cell population or cells expressing a particular marker.
  • positive selection of or enrichment for cells of a particular type refers to increasing the number or percentage of such cells, but need not result in a complete absence of cells not expressing the marker.
  • negative selection, removal, or depletion of cells of a particular type refers to decreasing the number or percentage of such cells, but need not result in a complete removal of all such cells.
  • multiple rounds of separation steps are carried out, where the positively or negatively selected fraction from one step is subjected to another separation step, such as a subsequent positive or negative selection.
  • a single separation step can deplete cells expressing multiple markers simultaneously, such as by incubating cells with a plurality of antibodies or binding partners, each specific for a marker targeted for negative selection.
  • multiple cell types can simultaneously be positively selected by incubating cells with a plurality of antibodies or binding partners expressed on the various cell types.
  • T cells such as cells positive or expressing high levels of one or more surface markers, e.g., CD28 + , CD62L + , CCR7 + , CD27 + , CD127 + , CD4 + , CD8 + , CD45RA + , and/or CD45RO + T cells, are isolated by positive or negative selection techniques.
  • surface markers e.g., CD28 + , CD62L + , CCR7 + , CD27 + , CD127 + , CD4 + , CD8 + , CD45RA + , and/or CD45RO + T cells.
  • CD3 + , CD28 + T cells can be positively selected using CD3/CD28 conjugated magnetic beads (e.g., DYNABEADS® M-450 CD3/CD28 T Cell Expander).
  • CD3/CD28 conjugated magnetic beads e.g., DYNABEADS® M-450 CD3/CD28 T Cell Expander
  • isolation is carried out by enrichment for a particular cell population by positive selection, or depletion of a particular cell population, by negative selection.
  • positive or negative selection is accomplished by incubating cells with one or more antibodies or other binding agent that specifically bind to one or more surface markers expressed or expressed (marker "1" ) at a relatively higher level (marker hlgh ) on the positively or negatively selected cells, respectively.
  • T cells are separated from a PBMC sample by negative selection of markers expressed on non-T cells, such as B cells, monocytes, or other white blood cells, such as CD 14.
  • a CD4 + or CD8 + selection step is used to separate CD4 + helper and CD8 + cytotoxic T cells.
  • Such CD4 + and CD8 + populations can be further sorted into sub-populations by positive or negative selection for markers expressed or expressed to a relatively higher degree on one or more naive, memory, and/or effector T cell subpopulations.
  • CD8 + cells are further enriched for or depleted of naive, central memory, effector memory, and/or central memory stem cells, such as by positive or negative selection based on surface antigens associated with the respective subpopulation.
  • enrichment for central memory T (T CM ) cells is carried out to increase efficacy, such as to improve long-term survival, expansion, and/or engraftment following administration, which in some aspects is particularly robust in such sub-populations. See Terakuraet al. (2012) Blood.1:72-82; Wang et al. (2012) J Immunother. 35(9):689-701.
  • combining TcM-enriched CD8 + T cells and CD4 + T cells further enhances efficacy.
  • memory T cells are present in both CD62L “1” and CD62L " subsets of CD8 + peripheral blood lymphocytes.
  • PBMC can be enriched for or depleted of CD62L CD8 "1” and/or CD62L + CD8 + fractions, such as using anti-CD8 and anti-CD62L antibodies.
  • the enrichment for central memory T (T CM ) cells is based on positive or high surface expression of CD45RO, CD62L, CCR7, CD28, CD3, and/or CD 127; in some aspects, it is based on negative selection for cells expressing or highly expressing
  • isolation of a CD8 + population enriched for T CM cells is carried out by depletion of cells expressing CD4, CD 14, CD45RA, and positive selection or enrichment for cells expressing CD62L.
  • enrichment for central memory T (T CM ) cells is carried out starting with a negative fraction of cells selected based on CD4 expression, which is subjected to a negative selection based on expression of CD 14 and
  • CD45RA and a positive selection based on CD62L. Such selections in some aspects are carried out simultaneously and in other aspects are carried out sequentially, in either order.
  • the same CD4 expression-based selection step used in preparing the CD8 + cell population or subpopulation also is used to generate the CD4 + cell population or sub- population, such that both the positive and negative fractions from the CD4-based separation are retained and used in subsequent steps of the methods, optionally following one or more further positive or negative selection steps.
  • CD4 + T helper cells are sorted into naive, central memory, and effector cells by identifying cell populations that have cell surface antigens.
  • CD4 + lymphocytes can be obtained by standard methods.
  • naive CD4 + T lymphocytes are CD45RO " , CD45RA + , CD62L + , CD4 + T cells.
  • central memory CD4 + cells are CD62L + and CD45RO + .
  • effector CD4 + cells are CD62L " and CD45RO " .
  • a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CDl lb, CD16, HLA-DR, and CD8.
  • the antibody or binding partner is bound to a solid support or matrix, such as a magnetic bead or paramagnetic bead, to allow for separation of cells for positive and/or negative selection.
  • the cells and cell populations are separated or isolated using immunomagnetic (or affinitymagnetic) separation techniques (reviewed in Methods in Molecular Medicine, vol. 58: Metastasis Research
  • the sample or composition of cells to be separated is incubated with small, magnetizable or magnetically responsive material, such as magnetically responsive particles or microp articles, such as paramagnetic beads (e.g., such as Dynalbeads or MACS beads).
  • the magnetically responsive material, e.g., particle generally is directly or indirectly attached to a binding partner, e.g., an antibody, that specifically binds to a molecule, e.g., surface marker, present on the cell, cells, or population of cells that it is desired to separate, e.g., that it is desired to negatively or positively select.
  • a binding partner e.g., an antibody
  • the magnetic particle or bead contains a magnetically responsive material bound to a specific binding member, such as an antibody or other binding partner.
  • a magnetically responsive material such as an antibody or other binding partner.
  • Suitable magnetic particles include those described in Molday, U.S. Pat. No. 4,452,773, and in European Patent Specification EP 452342 B, which are hereby
  • Colloidal sized particles such as those described in Owen U.S. Pat. No. 4,795,698, and Liberti et al., U.S. Pat. No. 5,200,084 are other examples.
  • the incubation generally is carried out under conditions whereby the antibodies or binding partners, or molecules, such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.
  • the antibodies or binding partners, or molecules such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.
  • the sample is placed in a magnetic field, and those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells.
  • those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells.
  • positive selection cells that are attracted to the magnet are retained; for negative selection, cells that are not attracted (unlabeled cells) are retained.
  • a combination of positive and negative selection is performed during the same selection step, where the positive and negative fractions are retained and further processed or subject to further separation steps.
  • the magnetically responsive particles are coated in primary antibodies or other binding partners, secondary antibodies, lectins, enzymes, or streptavidin.
  • the magnetic particles are attached to cells via a coating of primary antibodies specific for one or more markers.
  • the cells, rather than the beads are labeled with a primary antibody or binding partner, and then cell-type specific secondary antibody- or other binding partner (e.g., streptavidin)-coated magnetic particles, are added.
  • streptavidin-coated magnetic particles are used in conjunction with biotinylated primary or secondary antibodies.
  • the magnetically responsive particles are left attached to the cells that are to be subsequently incubated, cultured and/or engineered; in some aspects, the particles are left attached to the cells for administration to a patient.
  • the magnetizable or magnetically responsive particles are removed from the cells. Methods for removing magnetizable particles from cells are known and include, e.g., the use of competing non-labeled antibodies, magnetizable particles or antibodies conjugated to cleavable linkers, etc. In some embodiments, the magnetizable particles are biodegradable.
  • the affinity-based selection is via magnetic-activated cell sorting (MACS) (Miltenyi Biotech, Auburn, CA). Magnetic Activated Cell Sorting (MACS) systems are capable of high-purity selection of cells having magnetized particles attached thereto.
  • MACS operates in a mode wherein the non-target and target species are sequentially eluted after the application of the external magnetic field. That is, the cells attached to magnetized particles are held in place while the unattached species are eluted. Then, after this first elution step is completed, the species that were trapped in the magnetic field and were prevented from being eluted are freed in some manner such that they can be eluted and recovered.
  • the non-target cells are labelled and depleted from the heterogeneous population of cells.
  • the isolation or separation is carried out using a system, device, or apparatus that carries out one or more of the isolation, cell preparation, separation, processing, incubation, culture, and/or formulation steps of the methods.
  • the system is used to carry out each of these steps in a closed or sterile environment, for example, to minimize error, user handling and/or contamination.
  • the system is a system as described in International Patent Application, Publication Number WO2009/072003, or US 20110003380 Al.
  • the system or apparatus carries out one or more, e.g., all, of the isolation, processing, engineering, and formulation steps in an integrated or self-contained system, and/or in an automated or programmable fashion.
  • the system or apparatus includes a computer and/or computer program in communication with the system or apparatus, which allows a user to program, control, assess the outcome of, and/or adjust various aspects of the processing, isolation, engineering, and formulation steps.
  • the separation and/or other steps is carried out using CliniMACS system (Miltenyi Biotic), for example, for automated separation of cells on a clinical-scale level in a closed and sterile system.
  • Components can include an integrated microcomputer, magnetic separation unit, peristaltic pump, and various pinch valves.
  • the integrated computer in some aspects controls all components of the instrument and directs the system to perform repeated procedures in a standardized sequence.
  • the magnetic separation unit in some aspects includes a movable permanent magnet and a holder for the selection column.
  • the peristaltic pump controls the flow rate throughout the tubing set and, together with the pinch valves, ensures the controlled flow of buffer through the system and continual suspension of cells.
  • the CliniMACS system in some aspects uses antibody-coupled magnetizable particles that are supplied in a sterile, non-pyrogenic solution.
  • the cells after labelling of cells with magnetic particles the cells are washed to remove excess particles.
  • a cell preparation bag is then connected to the tubing set, which in turn is connected to a bag containing buffer and a cell collection bag.
  • the tubing set consists of pre-assembled sterile tubing, including a pre-column and a separation column, and are for single use only. After initiation of the separation program, the system automatically applies the cell sample onto the separation column. Labelled cells are retained within the column, while unlabeled cells are removed by a series of washing steps.
  • the cell populations for use with the methods described herein are unlabeled and are not retained in the column. In some embodiments, the cell populations for use with the methods described herein are labeled and are retained in the column. In some embodiments, the cell populations for use with the methods described herein are eluted from the column after removal of the magnetic field, and are collected within the cell collection bag.
  • separation and/or other steps are carried out using the CliniMACS Prodigy system (Miltenyi Biotec).
  • the CliniMACS Prodigy system in some aspects is equipped with a cell processing unity that permits automated washing and
  • the CliniMACS Prodigy system can also include an onboard camera and image recognition software that determines the optimal cell fractionation endpoint by discerning the macroscopic layers of the source cell product. For example, peripheral blood may be automatically separated into erythrocytes, white blood cells and plasma layers.
  • the CliniMACS Prodigy system can also include an integrated cell cultivation chamber which accomplishes cell culture protocols such as, e.g., cell differentiation and expansion, antigen loading, and long-term cell culture. Input ports can allow for the sterile removal and replenishment of media and cells can be monitored using an integrated microscope. See, e.g., Klebanoff et al. (2012) J Immunother. 35(9): 651-660, Terakuraet al.
  • a cell population described herein is collected and enriched (or depleted) via flow cytometry, in which cells stained for multiple cell surface markers are carried in a fluidic stream.
  • a cell population described herein is collected and enriched (or depleted) via preparative scale (FACS)-sorting.
  • a cell population described herein is collected and enriched (or depleted) by use of
  • MEMS microelectromechanical systems
  • the antibodies or binding partners are labeled with one or more detectable marker, to facilitate separation for positive and/or negative selection.
  • separation may be based on binding to fluorescently labeled antibodies.
  • separation of cells based on binding of antibodies or other binding partners specific for one or more cell surface markers are carried in a fluidic stream, such as by fluorescence- activated cell sorting (FACS), including preparative scale (FACS) and/or
  • MEMS microelectromechanical systems
  • the preparation methods include steps for freezing, e.g., cryopreserving, the cells, either before or after isolation, incubation, and/or engineering.
  • the freeze and subsequent thaw step removes granulocytes and, to some extent, monocytes in the cell population.
  • the cells are suspended in a freezing solution, e.g., following a washing step to remove plasma and platelets. Any of a variety of known freezing solutions and parameters in some aspects may be used.
  • a freezing solution e.g., following a washing step to remove plasma and platelets.
  • Any of a variety of known freezing solutions and parameters in some aspects may be used.
  • PBS containing 20% DMSO and 8% human serum albumin (HSA), or other suitable cell freezing media. This is then diluted 1: 1 with media so that the final concentration of DMSO and HSA are 10% and 4%, respectively.
  • the cells are then frozen to -80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage
  • the cells are incubated and/or cultured prior to or in connection with genetic engineering.
  • the incubation steps can include culture, cultivation, stimulation, activation, and/or propagation.
  • the compositions or cells are incubated in the presence of stimulating conditions or a stimulatory agent. Such conditions include those designed to induce proliferation, expansion, activation, and/or survival of cells in the population, to mimic antigen exposure, and/or to prime the cells for genetic engineering, such as for the introduction of a recombinant antigen receptor.
  • the conditions can include one or more of particular media, temperature, oxygen content, carbon dioxide content, time, agents, e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory factors, such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate the cells.
  • agents e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory factors, such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate the cells.
  • the stimulating conditions or agents include one or more agent, e.g., ligand, which is capable of activating an intracellular signaling domain of a TCR complex.
  • the agent turns on or initiates TCR/CD3 intracellular signaling cascade in a T cell.
  • agents can include antibodies, such as those specific for a TCR component and/or costimulatory receptor, e.g., anti-CD3, anti-CD28, for example, bound to solid support such as a bead, and/or one or more cytokines.
  • the expansion method may further comprise the step of adding anti-CD3 and/or anti CD28 antibody to the culture medium (e.g., at a concentration of at least about 0.5 ng/ml).
  • the stimulating agents include IL-2 and/or IL-15, for example, an IL-2 concentration of at least about 10 units/mL.
  • incubation is carried out in accordance with techniques such as those described in US Patent No. 6,040,1 77 to Riddell et al., Klebanoff et al.(2012) J
  • the T cells are expanded by adding to the composition feeder cells, such as non-dividing peripheral blood mononuclear cells (PBMC), (e.g., such that the resulting population of cells contains at least about 5, 10, 20, or 40 or more PBMC feeder cells for each T lymphocyte in the initial population to be expanded); and incubating the culture (e.g. for a time sufficient to expand the numbers of T cells).
  • the non-dividing feeder cells can comprise gamma- irradiated PBMC feeder cells.
  • the PBMC are irradiated with gamma rays in the range of about 3000 to 3600 rads to prevent cell division.
  • the feeder cells are added to culture medium prior to the addition of the populations of T cells.
  • the stimulating conditions include temperature suitable for the growth of human T lymphocytes, for example, at least about 25 degrees Celsius, generally at least about 30 degrees, and generally at or about 37 degrees Celsius.
  • the incubation may further comprise adding non-dividing EBV-transformed lymphoblastoid cells (LCL) as feeder cells.
  • LCL can be irradiated with gamma rays in the range of about 6000 to 10,000 rads.
  • the LCL feeder cells in some aspects is provided in any suitable amount, such as a ratio of LCL feeder cells to initial T lymphocytes of at least about 10: 1.
  • antigen-specific T cells such as antigen-specific CD4+ and/or CD8+ T cells
  • antigen-specific T cell lines or clones can be generated to cytomegalovirus antigens by isolating T cells from infected subjects and stimulating the cells in vitro with the same antigen.
  • an apparatus or article of manufacture in some embodiments, also provided is an arrangement of a bioreactor and a first stationary phase for chromatography.
  • the bioreactor is suitable for the expansion of cells, and the stationary phase is suitable for cell separation and removal of reagents.
  • the first stationary phase is a gel filtration matrix and/or affinity chromatography matrix, wherein the gel filtration and/or affinity chromatography matrix comprises an affinity reagent, wherein the affinity reagent comprises a binding site Zl specifically binding to a binding partner CI comprised in a first agent and/or the affinity reagent comprises a binding site Z2 specifically binding to a binding partner C2 comprised in a second agent.
  • the first stationary phase is thereby being suitable of immobilizing thereon the first agent and/or the second agent, the first binding partner CI and/or the free second binding partner C2.
  • the bioreactor and the stationary phase are fluidly connected. This arrangement can be used in the serial expansion as explained above and can be integrated into known cell expansion systems such as the Quantum® cell expansion system) or the Xuri Cell Expansion System W25.
  • the first stationary phase is either comprised in a chromatography column or is a planar stationary phase.
  • the arrangement may further comprise a second stationary phase which is fluidly connected to the first stationary phase.
  • the secondary stationary phase may be a gel filtration matrix and/or affinity chromatography matrix, wherein the gel filtration and/or affinity chromatography matrix comprises an affinity reagent.
  • This affinity reagent may comprise a binding partner D that (specifically) binds to the binding site Zl of the multimerization reagent, thereby being suitable of immobilizing the multimerization reagent on the stationary phase.
  • the invention is further directed to an apparatus for purification (e.g. selection) and culture, such as stimulation or expansion, of a composition of cells, the apparatus comprising at least one arrangement of a bioreactor and a first stationary phase or a second stationary phase for chromatography as defined above.
  • an apparatus for purification e.g. selection
  • culture such as stimulation or expansion
  • the apparatus may further comprise a plurality of arrangements of a bioreactor and a stationary phase being fluidly connected in series.
  • the apparatus may comprise a sample inlet being fluidly connected to the bioreactor of the arrangement of a bioreactor and the stationary phase for chromatography.
  • the apparatus may also comprise a sample outlet for purified and expanded target cells, the sample outlet being fluidly connected to the stationary phase of the last of the at least one arrangement of a bioreactor and the stationary phase for chromatography.
  • the apparatus may be designed as a functionally closed system.
  • the cultured target cells (e.g. cultured T cells), which can include cultured cells generated or produced in accord with the methods provided herein, exhibit one or more specified phenotypic and/or functional features, based on or related to their proliferation capacity, surface marker expression, differentiation state, activation state and/or metabolic profile.
  • the culturing of the target cells e.g. culturing of T cells
  • results in a change in a parameter associated with the function e.g. increase or decrease of a functional activity
  • phenotype e.g.
  • the cultured T cells exhibit the change with respect to a parameter from among expansion and/or proliferation capacity, CD4+/CD8+ T cell distribution or ratio, surface marker expression, functional activity, or metabolic profile.
  • the change in the parameter as measured in the cultured T cells is compared or with reference to the same or similar parameter as measured in a reference T cell composition or preparation.
  • T cells in the reference T cell composition or preparation include or are derived from the same or substantially the same composition of T cells prior to incubation with the reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin), except such cells were not subject to the incubation or were subject to a different incubation.
  • the reference T cell preparation is subject to the incubation using substantially the same protocol or conditions (e.g.
  • the reference T cell composition or preparation is the composition containing T cells prior to incubation with a reversibly-bound agent (e.g.
  • multimerized agent such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin).
  • the cultured T cells are generated by incubation with a reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin) for less than 5 days and/or where the association of such agent with one or more molecules on the cell is disrupted (e.g. in the presence of a competition reagent, e.g. biotin or a biotin analog), such as disrupted with 5 days of initiation of incubation with such agent.
  • a reversibly-bound agent e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin
  • a competition reagent e.g. biotin or a biotin analog
  • the multimerized agent such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin) as described herein, wherein the incubation is terminated and/or disrupted within 5 days after initiation of such incubation (such as within or about 4, 3, 2, or 1 day, or less), and/or where a competing agent (e.g. biotin) that dissociates the reversibly-bound agent from the cells is added to the incubated cells within 5 days after initiation of such incubation (such as within or about 4, 3, 2, or 1 day, or less).
  • the reference T cell preparation is generated or produced following incubation with the same or substantially the same reversibly- bound agent (e.g.
  • the multimerized agent such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin), but where the incubation is performed for greater than 5 days, is not terminated and/or disrupted to lessen or terminate the signal induced or modulated in the cell, and/or where the T cell preparation is produced without the addition of a competing agent (e.g. biotin or biotin analog) that dissociates the reagent from the cells.
  • a competing agent e.g. biotin or biotin analog
  • the cultured T cells are generated by incubation with a reversibly-bound agent (e.g.
  • the multimerized agent such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin) in which the receptor-binding agent (e.g. stimulatory agent) is one that does not bind to CD28 and/or induce signaling, i.e. is not an anti- CD28 antibody or fragment thereof.
  • the cultured T cells are produced or generated following incubation with a reversibly-bound reagent in which one or more stimulatory agents are reversibly bound to a mutein streptavidin in which at least one stimulatory agent is specific for CD3 (e.g.
  • the reference T cell preparation is a T cell culture generated or produced following incubation with a reversibly-bound agent (e.g.
  • the reagent comprises an agent that specifically binds CD28 and/or induces or modulates CD28 signaling.
  • the reference T cell preparation is generated or produced following incubation of a T cell composition with anti- CD3/anti-CD28 Dynabeads®, anti-CD3/anti-CD28 ExPact® beads or other anti-CD3/anti-CD28 stimulatory agent.
  • such other anti-CD3/anti-CD28 stimulatory agent is one in which the antibody reagents are bound to a support (e.g. solid support), e.g.
  • the cultured T cells are prepared by incubation with a reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin) that is soluble, i.e. not bound to a support (e.g. solid support).
  • a reversibly-bound agent e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin
  • cultured T cells such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin), in which the cultured T cells are characterized by an enhanced expansion and/or proliferation capacity compared to a reference T cell composition or preparation.
  • a reversibly-bound agent as described herein (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin)
  • the enhanced expansion and/or proliferation capacity comprises an increase in the number or percentage of CD3+ T cells, CD4+ T cells, and/or CD8+ T cells in the cultured T cells by at least about 2-fold (such as by at least about any of 3-fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD3+ T cells, CD4+ T cells, and/or CD8+ T cells, respectively, in the reference T cell composition or preparation.
  • cultured T cells such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g.
  • the multimerized agent such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin
  • the cultured T cells are characterized by an enhanced expansion and/or proliferation capacity of CD3+ T cells compared to a reference T cell culture.
  • the enhanced expansion and/or proliferation capacity comprises an increase in the number or percentage of CD3+ T cells in the cultured T cells by at least about 2- fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD3+ T cells in the reference T cell composition or preparation.
  • cultured T cells such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g.
  • the multimerized agent such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin
  • the cultured T cells are characterized by an enhanced expansion and/or proliferation capacity of CD4+ T cells compared to a reference T cell composition or preparation.
  • the enhanced expansion and/or proliferation capacity comprises an increase in the number or percentage of CD4+ T cells in the cultured T cells by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7- fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD4+ T cells in the reference T cell composition or preparation.
  • cultured T cells such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g.
  • the multimerized agent such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin
  • the cultured T cells are characterized by an enhanced expansion and/or proliferation capacity of CD8+ T cells compared to a reference T cell composition or preparation.
  • the enhanced expansion and/or proliferation capacity comprises an increase in the number or percentage of CD8+ T cells in the cultured T cells by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7- fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD8+ T cells in the reference T cell composition or preparation.
  • cultured T cells such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g.
  • multimerized agent such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin
  • the cultured T cells are characterized by an altered CD8+/CD4+ T cell distribution or normalized T cell distribution, such as an altered
  • CD8+/CD4+ ratio or normalized CD8+/CD4+ T cell ratio compared to a reference T cell composition or preparation.
  • the CD8+/CD4+ ratio or normalized ratio can be increased or decreased.
  • the altered CD8+/CD4+ T cell ratio results from an increase in the number or percentage or normalized number or percentage of CD8+ T cells in the cultured T cells relative or compared to the number or percentage or normalized number or percentage in a reference composition or preparation.
  • number of CD8+ T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD8+ T cells or the normalized number or percentage of CD8+ T cells in the reference T cell composition or preparation.
  • the ratio of CD8+/CD4+ T cells or the normalized ratio of CD8+/CD4+ is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the ratio of CD8+/CD4+ T cells or the normalized ratio of CD8+/CD4+ in the reference T cell composition or preparation.
  • the number, percentage or ratio in the cultured T cells or in a composition or preparation is normalized to the number, percentage or ratio in the starting composition containing the T cells prior to the incubation.
  • cultured T cells prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin), and wherein the cultured T cells are characterized by an altered surface marker expression profile compared to a reference T cell composition or preparation.
  • a reversibly-bound agent as described herein (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin)
  • the altered surface marker expression profile is due to a change in the number or percentage of one or more subsets of T cells that are positive, negative or low for one or more surface markers selected from CD45RA, CD45RO, CD62L, CD69, CCR7, CD27, CD28, CD122, t-bet, IL-7Ra, CD95, IL-2RP, CXCR3, LFA-1, KLRG1.
  • the number or percentage of the T cell subset in the cultured T cells is increased at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference
  • composition or preparation composition or preparation.
  • the T cell subset in the cultured T cells exhibits a decreased or reduced differentiation or activation state compared to the reference T cell composition or preparation.
  • the T cell subset is not or does not include an effector T cell (T E ) or effector memory T cell (T EM ) phenotype.
  • the subset of T cells contains a surface phenotype that is one or more of CD62L + , CCR7 + , CD27 + , CD28 + , or KLRGl low/" .
  • such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
  • the T cell subset in the cultured T cells is positive for CD62L and/or IL-7Ra (CD 127) and/or negative or low for t-bet.
  • the subset of T cells is positive for CD45RA and/or negative or low for CD45RO.
  • the subset of T cells is positive for one or more of CCR7, CD45RA, CD62L, CD27, CD28, IL-7Ra (CD 127), CD95, IL-2RP, CXCR3, and LFA-1, and/or negative for CD45RO.
  • such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8- fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
  • the T cell subset in the cultured T cells is or includes cells that are positive for CD62L (CD62L+).
  • a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
  • the T cell subset in the cultured T cells is or includes cells that are CD62L+ and a) any one or more of CD45RA low/+ , CD45RO low/+ , CCR7+ and CD27+ and b) any one or more of t-bet low , IL-7Ra+ (CD127+), CD95+, IL-2RP+, CXCR3+ and LFA-1+.
  • the T cell subset also can be CD3+, CD4+, or CD8+.
  • such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9- fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
  • the T cell subset such as a CD62L+ T cell subset, in the cultured T cells are or include or share phenotypic characteristics with memory T cells or particular subsets thereof, such as long-lived memory T cells.
  • such memory T cells are central memory T cells (Tcm) or T memory stem cells (Tscm) cells.
  • the memory T cells are Tscm cells.
  • Tscm cells may be described as having one or more phenotypic differences or functional features compared to other memory T cell subsets or compared to naive T cells, such as being less differentiated or more naive (see e.g., Ahlers and Belyakov (2010) Blood, 115: 1678); Cieri et al. (2015) Blood, 125:2865; Flynn et al. (2014) Clinical & Translational Immunology, 3, e20; Gattinoni et al. (2012) Nat. Med., 17: 1290-1297; Gattinoni et al. (2012) Nat. Reviews, 12:671; Li et al. (2013) PLOS ONE, 8:e67401; and published PCT Appl. No.
  • Tscm cells are thought to be the only memory T cells able to generate effector T cells and all three subsets of memory T cells (Tscm, Tcm, and Tern). In some aspects, Tscm cells have the highest survival and proliferation response to antigenic or homeostatic stimuli of all the memory T cell subsets, and the least attrition absent cognate antigen. In some embodiments, the less-differentiated Tscm cells may exhibit greater expansion, long-term viability, and target cell destruction following adoptive transfer than other memory T cells, and thus may be able to mediate more effective treatment with fewer transferred cells than would be possible for either Tcm or Tern cells.
  • examples of phenotypic or functional features that have been reported or are known for Tscm cells include, for example, that such cells a) are CD45RO " , CCR7 + , CD45RA + , CD62L + , CD27 + , CD28 + , IL-7Ra + , CD95 + , IL-2Rp + , CXCR3 + , and LFA-1 + ; b) are CD45RA + , CCR7 + , CD62L + , and CD95 + ; c) are CD45RA + , CD45RO + , CCR7 + , CD62L + , CD27 + , CD28 + , CD95 + , and IL-2Rp + ; d) are CD45RO " , CD45RA + , CCR7 + , CD62L + , CD27 + , CD28 + , CD127 + , and CD95 + ; e) are CD45RA + , CD44 +/
  • the T cell subset in the cultured T cells (e.g. a T cell subset that is increased in the cultured T cells compared to the reference composition or preparation) is or includes memory T cells, such as long-lived memory T cells.
  • the memory T cells are central memory (Tcm) T cells.
  • the T cell subset has a phenotypic characteristic CD45RA-, CD45R0 low/+ , CCR7+, CD62L+, CD27+, CD28+, CD95+ CD 122+ and/or KLGRl low .
  • such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
  • the memory T cells are stem central memory (Tscm) T cells.
  • the T cell subset has a phenotypic characteristic CD45RA low/+ ,
  • the T cell subset has a phenotypic characteristic CD45RA low/+ , CD45RO " , CCR7+, CD62L+, CD27+, CD28+, CD95+, CD122+ and/or KLGR1-.
  • the T cell subset has a phenotypic characteristic CD45RO " , CCR7 + , CD45RA + , CD62L + , CD27 + , CD28 + , IL-7Ra + , CD95 + , IL-2Rp + , CXCR3 + , and/or LFA-1 + .
  • the T cell subset has a phenotypic characteristic CD45RA + , CCR7 + , CD62L + , and/or CD95 + .
  • the T cell subset has a phenotypic characteristic CD45RA + , CD45RO + , CCR7 + , CD62L + , CD27 + , CD28 + , CD95 + , and/or IL-2Rp + .
  • the T cell subset has a phenotypic characteristic CD45RO " , CD45RA + , CCR7 + , CD62L + , CD27 + , CD28 + , CD127 + , and/or CD95 + .
  • the T cell subset has a phenotypic characteristic CD45RA + , CD44 +/” , CD62L + , CD127 + , IL-2Rp + , CD28 + , CD43 “ , KLRG1 " , Peforin , and/or GranzymeB " .
  • the T cell subset expresses high levels of CCR7, CD62L, CD27, and/or CD28, intermediate levels of CD95 and/or IL-2RP, low levels of CD45RA, and/or does not express CD45RO and/or KLRG-1.
  • the T cell subset expresses high levels of CD62L, low levels of CD44 and t-bet, and/or is Sca-1 + .
  • the T cell subset has a phenotypic characteristic intermediate IL-2 -producing capacity, low IFNy- producing capacity, low cytotoxicity, and/or high self -renewal capacity.
  • such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell
  • composition or culture composition or culture.
  • the subset of T cells is present at a greater percentage of the total T cells in the cultured T cells or a greater number of total T cells in the cultured T cells compared to a reference T cell composition or preparation.
  • the percentage of the T cell subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more, n some embodiments, the percentage of the T cell subset in the cultured cells, such as any T cell subset described above, is greater, e.g.
  • the total number, relative number or normalized number of the T cells subset in the cultured cells, such as any T cell subset described above, is greater, e.g.
  • a reference T cell composition or preparation such as any reference T cell composition or preparation described above, e.g. the T cell composition prior to the incubation with the reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin) in accord with any of the methods provided herein.
  • the reversibly-bound agent e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin
  • the number of T cells corresponding to the T cell subset present in the T cell culture is at least or at least about 1 xlO 6 cells, 2 xlO 6 cells, 3 x 10 6 cells, 4 x 10 6 cells, 5 x 10 6 cells or more.
  • the T cell subset is CD62L+ and/or IL-7Ra+ (CD 127+) and the percentage of the CD62L+ and/or IL-7Ra+ (CD 127+) subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
  • the T cell subset is CD45RA-, CD45R0 low/+ , and/or KLRGl low and the percentage of the CD45RA-,
  • CD45R0 low/+ , and/or KLRGl low subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
  • the T cell subset is CD45RA low/+ .
  • CD45R0 low/+ , and/or KLRG1 " and the percentage of the CD45RA low/+ , CD45R0 low/+ , and/or KLRG1 " subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
  • the T cell subset is or includes Tcm cells.
  • the percentage of the Tcm subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
  • the T cell subset is or includes Tscm cells.
  • the percentage of the Tscm subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
  • the subset of T cells have or exhibit a) a low level of TCR rearrangement excisions circles (TREC); and/or b) express a proliferation marker (e.g., Ki-67); and/or c) exhibit the capacity to proliferate in the presence of a stimulatory agent; and/or d) exhibit a capacity to produce a cytokine selected from among IFN-gamma, TNF and IL-2 in the presence of a stimulatory agent; and/or e) are refractory to attrition in the absence of a stimulatory agent; and/or f) are able to generate Tscm, Tcm, Tern, and Teff cells; and/or g) have low cytotoxicity; and/or h) can produce the same or greater response following adoptive transfer of fewer cells than with Tcm or Tern cells.
  • a proliferation marker e.g., Ki-67
  • the stimulatory agent is an antigen, a homeostatic cytokine (e.g. , IL- 15 or IL- 17), or is an agent that is capable of initiating a TCR/CD3 complex-associated signal in the T cells.
  • a homeostatic cytokine e.g. , IL- 15 or IL- 17
  • the capacity to produce a cytokine comprises a low capacity to produce IFNy and/or an intermediate capacity to produce IL-2.
  • cultured T cells such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation as described herein, and wherein the cultured T cells are characterized by a modified functional activity profile compared to a reference T cell composition or preparation.
  • the cultured T cells or a specific subset of T cells present in the culture exhibits an altered functional activity profile compared to a reference composition or preparation or compared to the subset of T cells in the reference composition or preparation, such as a functional activity that is altered (e.g. increased or decreased) at least 1.5- fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold.
  • the functional activity is selected from one or more of a) a low level of TCR rearrangement excisions circles (TREC); and/or b) expression of a proliferation marker (e.g. , Ki-67); and/or c) the capacity to proliferate in the presence of a stimulatory agent; and/or d) the capacity to produce a cytokine selected from among IFN-gamma, TNF and IL-2 in the presence of a stimulatory agent; and/or e) are refractory to attrition in the absence of a stimulatory agent; and/or f) are able to generate Tscm, Tcm, Tern, and Teff cells; and/or g) have low cytotoxicity.
  • a proliferation marker e.g. , Ki-67
  • the stimulatory agent is an antigen, a homeostatic cytokine (e.g. , IL-15 or IL- 17), or is an agent that is capable of initiating a TCR/CD3 complex-associated signal in the T cells.
  • the capacity to produce a cytokine comprises a low capacity to produce IFNy and/or an intermediate capacity to produce IL-2.
  • the subset of T cells comprises memory T cells, such as long-lived memory T cells, in the cultured T cells.
  • the memory T cells are Tscm cells
  • the cultured T cells or a specific subset of T cells present in the culture can produce the same or greater response following adoptive transfer of fewer cells than can be achieved by a reference composition or preparation or by the subset of T cells in the reference composition or preparation.
  • such response is achieved with at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9- fold, 10-fold, or more) fewer cells.
  • the response is increased or is greater by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8- fold, 9-fold, 10-fold, or more).
  • the percentage of the T cell subset in the cultured cells is greater, e.g. at least 1.5-fold greater, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold or more greater, than the corresponding subset of cells in a preparation of T cells that were incubated in the presence of a GSK-P inhibitor.
  • the composition of cultured T cells does not contain a GSK-P inhibitor.
  • the percentage of the T cell subset in the cultured cells is greater, e.g. at least 1.5-fold greater, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold or more greater, than the corresponding subset of cells that were incubated in the presence of a recombinant homeostatic cytokine, optionally IL-7 or IL-15.
  • the composition of cultured T cells does not contain a recombinant homeostatic cytokine, optionally IL-7 or IL-15.
  • recombinant e.g. exogenous
  • IL-7 cytokine
  • a recombinant e.g. exogenous
  • IL-15 cytokine
  • the composition of cultured T cells was produced or generated in accord with any of the methods provided herein in which a substance, such as a competition agent, was added to T cells to disrupt, such as to lessen and/or terminate, the signaling of the stimulatory agent or agents.
  • a substance such as a competition agent
  • the composition of cultured T cells contains the presence of a substance, such as a competition agent, e.g. biotin or a biotin analog, e.g. D- Biotin.
  • the substance, such as a competition agent e.g. biotin or a biotin analog, e.g.
  • D-Biotin is present in an amount that is at least 1.5-fold greater, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 100-fold, at least 1000-fold or more greater than the amount of the substance in a reference composition or preparation of cultured T cells in which the substance was not added exogenously during the incubation.
  • the amount of the substance, such as a competition agent, e.g. biotin or a biotin analog, e.g. D-Biotin, in the composition of cultured T cells is from or from about 10 ⁇ to 100 ⁇ , 100 ⁇ to 1 mM, 100 ⁇ to 500 ⁇ or 10 ⁇ to 100 ⁇ .
  • the cultured cells contain or are engineered to contain an engineered receptor, e.g., an engineered antigen receptor, such as a chimeric antigen receptor (CAR), or a T cell receptor (TCR).
  • an engineered receptor e.g., an engineered antigen receptor, such as a chimeric antigen receptor (CAR), or a T cell receptor (TCR).
  • populations of such cells compositions containing such cells and/or enriched for such cells, such as in which cells of a certain type such as T cells or CD8+ or CD4+ cells are enriched or selected.
  • pharmaceutical compositions and formulations for administration such as for adoptive cell therapy.
  • therapeutic methods for administering the cells and compositions to subjects e.g., patients.
  • the cultured cells include one or more nucleic acids introduced via genetic engineering, and thereby express recombinant or genetically engineered products of such nucleic acids.
  • gene transfer is accomplished by first stimulating the cultured cells, such as by combining it with a stimulus that induces a response such as proliferation, survival, and/or activation, e.g., as measured by expression of a cytokine or activation marker, followed by transduction of the activated cells, and expansion in culture to numbers sufficient for clinical applications.
  • the engineered cells include gene segments that cause the cells to be susceptible to negative selection in vivo, such as upon administration in adoptive immunotherapy.
  • the cultured cells are engineered so that they can be eliminated as a result of a change in the in vivo condition of the patient to which they are administered.
  • the negative selectable phenotype may result from the insertion of a gene that confers sensitivity to an administered agent, for example, a compound.
  • Negative selectable genes include the Herpes simplex virus type I thymidine kinase (HSV-I TK) gene (Wigler et al., Cell II: 223, 1977) which confers ganciclovir sensitivity; the cellular hypoxanthine phosphribosyltransferase (HPRT) gene, the cellular adenine
  • HSV-I TK Herpes simplex virus type I thymidine kinase
  • HPRT hypoxanthine phosphribosyltransferase
  • the cultured cells further are engineered to promote expression of cytokines or other factors.
  • the genetic engineering generally involves introduction of a nucleic acid encoding the recombinant or engineered component into a composition containing the cultured cells, such as by retroviral transduction, transfection, or transformation.
  • the nucleic acids are heterologous, i.e., normally not present in a cell or sample obtained from the cell, such as one obtained from another organism or cell, which for example, is not ordinarily found in the cell being engineered and/or an organism from which such cell is derived.
  • the nucleic acids are not naturally occurring, such as a nucleic acid not found in nature, including one comprising chimeric combinations of nucleic acids encoding various domains from multiple different cell types.
  • the cells generally express recombinant receptors, such as antigen receptors including functional non-TCR antigen receptors, e.g., chimeric antigen receptors (CARs), and other antigen-binding receptors such as transgenic T cell receptors (TCRs). Also among the receptors are other chimeric receptors.
  • antigen receptors including functional non-TCR antigen receptors, e.g., chimeric antigen receptors (CARs), and other antigen-binding receptors such as transgenic T cell receptors (TCRs).
  • CARs chimeric antigen receptors
  • TCRs transgenic T cell receptors
  • Exemplary antigen receptors including CARs, and methods for engineering and introducing such receptors into cells, include those described, for example, in international patent application publication numbers WO200014257, WO2013126726, WO2012/129514, WO2014031687, WO2013/166321, WO2013/071154, WO2013/123061 U.S. patent application publication numbers US2002131960, US2013287748, US20130149337, U.S.
  • the antigen receptors include a CAR as described in U.S. Patent No.: 7,446,190, and those described in International Patent Application Publication No.: WO/2014055668 Al.
  • Examples of the CARs include CARs as disclosed in any of the aforementioned publications, such as
  • the chimeric receptors such as CARs, generally include an extracellular antigen binding domain, such as a portion of an antibody molecule, generally a variable heavy (V H ) chain region and/or variable light (V L ) chain region of the antibody, e.g., an scFv antibody fragment.
  • V H variable heavy
  • V L variable light
  • the antigen targeted by the receptor is a polypeptide. In some embodiments, it is a carbohydrate or other molecule. In some embodiments, the antigen is selectively expressed or overexpressed on cells of the disease or condition, e.g., the tumor or pathogenic cells, as compared to normal or non-targeted cells or tissues. In other embodiments, the antigen is expressed on normal cells and/or is expressed on the engineered cells.
  • Antigens targeted by the receptors in some embodiments include orphan tyrosine kinase receptor ROR1, tEGFR, Her2, Ll-CAM, CD 19, CD20, CD22, mesothelin, CEA, and hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, 0EPHa2, ErbB2, 3, or 4, FBP, fetal acethycholine e receptor, GD2, GD3, HMW-MAA, IL-22R- alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, LI -cell adhesion molecule, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D Ligands, NY-ESO-1, MART-1, gplOO, oncofetal antigen, ROR1, TAG72,
  • the CAR binds a pathogen- specific antigen.
  • the CAR is specific for viral antigens (such as HIV, HCV, HBV, etc.), bacterial antigens, and/or parasitic antigens.
  • the antibody portion of the recombinant receptor e.g., CAR
  • an immunoglobulin constant region such as a hinge region, e.g., an IgG4 hinge region, and/or a CH1/CL and/or Fc region.
  • the constant region or portion is of a human IgG, such as IgG4 or IgGl.
  • the portion of the constant region serves as a spacer region between the antigen-recognition component, e.g., scFv, and transmembrane domain.
  • the spacer can be of a length that provides for increased responsiveness of the cell following antigen binding, as compared to in the absence of the spacer.
  • Exemplary spacers e.g., hinge regions, include those described in international patent application publication number WO2014031687.
  • the spacer is or is about 12 amino acids in length or is no more than 12 amino acids in length.
  • Exemplary spacers include those having at least about 10 to 229 amino acids, about 10 to 200 amino acids, about 10 to 175 amino acids, about 10 to 150 amino acids, about 10 to 125 amino acids, about 10 to 100 amino acids, about 10 to 75 amino acids, about 10 to 50 amino acids, about 10 to 40 amino acids, about 10 to 30 amino acids, about 10 to 20 amino acids, or about 10 to 15 amino acids, and including any integer between the endpoints of any of the listed ranges. In some
  • a spacer region has about 12 amino acids or less, about 119 amino acids or less, or about 229 amino acids or less.
  • Exemplary spacers include IgG4 hinge alone, IgG4 hinge linked to CH2 and CH3 domains, or IgG4 hinge linked to the CH3 domain.
  • This antigen recognition domain generally is linked to one or more intracellular signaling components, such as signaling components that mimic activation through an antigen receptor complex, such as a TCR complex, in the case of a CAR, and/or signal via another cell surface receptor.
  • the antigen-binding component e.g., antibody
  • the antigen-binding component is linked to one or more transmembrane and intracellular signaling domains.
  • the transmembrane domain is fused to the extracellular domain.
  • a transmembrane domain that naturally is associated with one of the domains in the receptor e.g., CAR
  • the transmembrane domain is selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
  • the transmembrane domain in some embodiments is derived either from a natural or from a synthetic source. Where the source is natural, the domain in some aspects is derived from any membrane-bound or transmembrane protein.
  • Transmembrane regions include those derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154.
  • the transmembrane domain in some embodiments is synthetic.
  • the synthetic transmembrane domain comprises predominantly hydrophobic residues such as leucine and valine. In some aspects, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. In some embodiments, the linkage is by linkers, spacers, and/or transmembrane domain(s).
  • intracellular signaling domains are those that mimic or approximate a signal through a natural antigen receptor, a signal through such a receptor in combination with a costimulatory receptor, and/or a signal through a costimulatory receptor alone.
  • a short oligo- or polypeptide linker for example, a linker of between 2 and 10 amino acids in length, such as one containing glycines and serines, e.g., glycine- serine doublet, is present and forms a linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR.
  • the receptor e.g., the CAR, generally includes at least one intracellular signaling component or components.
  • the receptor includes an intracellular component of a TCR complex, such as a TCR CD3 chain that mediates T-cell activation and cytotoxicity, e.g., CD3 zeta chain.
  • a TCR CD3 chain that mediates T-cell activation and cytotoxicity
  • the antigen-binding portion is linked to one or more cell signaling modules.
  • cell signaling modules include CD3 transmembrane domain, CD3 intracellular signaling domains, and/or other CD
  • the receptor e.g., CAR
  • the receptor further includes a portion of one or more additional molecules such as Fc receptor ⁇ , CD8, CD4, CD25, or CD16.
  • the CAR or other chimeric receptor includes a chimeric molecule between CD3-zeta (CD3-Q or Fc receptor ⁇ and CD8, CD4, CD25 or CD16.
  • the cytoplasmic domain or intracellular signaling domain of the receptor activates at least one of the normal effector functions or responses of the immune cell, e.g., T cell engineered to express the CAR.
  • the CAR induces a function of a T cell such as cytolytic activity or T-helper activity, such as secretion of cytokines or other factors.
  • a truncated portion of an intracellular signaling domain of an antigen receptor component or costimulatory molecule is used in place of an intact immuno stimulatory chain, for example, if it transduces the effector function signal.
  • the intracellular signaling domain or domains include the cytoplasmic sequences of the T cell receptor (TCR), and in some aspects also those of co-receptors that in the natural context act in concert with such receptors to initiate signal transduction following antigen receptor engagement.
  • full activation In the context of a natural TCR, full activation generally requires not only signaling through the TCR, but also a costimulatory signal.
  • a component for generating secondary or co- stimulatory signal is also included in the CAR.
  • the CAR does not include a component for generating a costimulatory signal.
  • an additional CAR is expressed in the same cell and provides the component for generating the secondary or costimulatory signal.
  • T cell activation is in some aspects described as being mediated by two classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences), and those that act in an antigen- independent manner to provide a secondary or co- stimulatory signal (secondary cytoplasmic signaling sequences).
  • primary cytoplasmic signaling sequences those that initiate antigen-dependent primary activation through the TCR
  • secondary cytoplasmic signaling sequences those that act in an antigen- independent manner to provide a secondary or co- stimulatory signal.
  • the CAR includes one or both of such signaling components.
  • the CAR includes a primary cytoplasmic signaling sequence that regulates primary activation of the TCR complex.
  • Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs.
  • ITAM containing primary cytoplasmic signaling sequences include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CDS, CD22, CD79a, CD79b, and CD66d.
  • cytoplasmic signaling molecule(s) in the CAR contain(s) a cytoplasmic signaling domain, portion thereof, or sequence derived from CD3 zeta.
  • the CAR includes a signaling domain and/or transmembrane portion of a costimulatory receptor, such as CD28, 4- IBB, OX40, DAP10, and ICOS.
  • a costimulatory receptor such as CD28, 4- IBB, OX40, DAP10, and ICOS.
  • the same CAR includes both the activating and costimulatory components.
  • the activating domain is included within one CAR, whereas the costimulatory component is provided by another CAR recognizing another antigen.
  • the CARs include activating or stimulatory CARs, costimulatory CARs, both expressed on the same cell (see WO2014/055668).
  • the cells include one or more stimulatory or activating CAR and/or a costimulatory CAR.
  • the cells further include inhibitory CARs (iCARs, see Fedorov et al., Sci. Transl.
  • the intracellular signaling domain comprises a CD28 transmembrane and signaling domain linked to a CD3 (e.g., CD3-zeta) intracellular domain.
  • the intracellular signaling domain comprises a chimeric CD28 and CD137 (4- IBB, TNFRSF9) co-stimulatory domains, linked to a CD3 zeta intracellular domain.
  • the CAR encompasses one or more, e.g., two or more, costimulatory domains and an activation domain, e.g., primary activation domain, in the cytoplasmic portion.
  • Exemplary CARs include intracellular components of CD3-zeta, CD28, and 4-1BB.
  • the CAR or other antigen receptor further includes a marker, such as a cell surface marker, which may be used to confirm transduction or engineering of the cell to express the receptor, such as a truncated version of a cell surface receptor, such as truncated EGFR (tEGFR).
  • the marker includes all or part (e.g., truncated form) of CD34, a NGFR, or epidermal growth factor receptor (e.g., tEGFR).
  • the nucleic acid encoding the marker is operably linked to a polynucleotide encoding for a linker sequence, such as a cleavable linker sequence, e.g., T2A. See WO2014031687.
  • the marker is a molecule, e.g., cell surface protein, not naturally found on T cells or not naturally found on the surface of T cells, or a portion thereof.
  • the molecule is a non-self molecule, e.g., non-self protein, i.e., one that is not recognized as "self by the immune system of the host into which the cells will be adoptively transferred.
  • the marker serves no therapeutic function and/or produces no effect other than to be used as a marker for genetic engineering, e.g., for selecting cells successfully engineered.
  • the marker may be a therapeutic molecule or molecule otherwise exerting some desired effect, such as a ligand for a cell to be encountered in vivo, such as a costimulatory or immune checkpoint molecule to enhance and/or dampen responses of the cells upon adoptive transfer and encounter with ligand.
  • CARs are referred to as first, second, and/or third generation CARs.
  • a first generation CAR is one that solely provides a CD3-chain induced signal upon antigen binding;
  • a second-generation CARs is one that provides such a signal and costimulatory signal, such as one including an intracellular signaling domain from a costimulatory receptor such as CD28 or CD 137;
  • a third generation CAR is one that includes multiple costimulatory domains of different costimulatory receptors.
  • the chimeric antigen receptor includes an extracellular portion containing an antibody or antibody fragment. In some aspects, the chimeric antigen receptor includes an extracellular portion containing the antibody or fragment and an intracellular signaling domain. In some embodiments, the antibody or fragment includes an scFv and the intracellular domain contains an ITAM. In some aspects, the intracellular signaling domain includes a signaling domain of a zeta chain of a CD3-zeta ⁇ 3 ⁇ ) chain. In some embodiments, the chimeric antigen receptor includes a transmembrane domain linking the extracellular domain and the intracellular signaling domain. In some aspects, the transmembrane domain contains a transmembrane portion of CD28. In some embodiments, the chimeric antigen receptor contains an intracellular domain of a T cell costimulatory molecule. In some aspects, the T cell costimulatory molecule is CD28 or 41BB.
  • polypeptide and “protein” are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length.
  • Polypeptides including the provided receptors and other polypeptides, e.g., linkers or peptides, may include amino acid residues including natural and/or non-natural amino acid residues.
  • the terms also include post- expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, and phosphorylation.
  • the polypeptides may contain modifications with respect to a native or natural sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR
  • the receptor, e.g., the CAR, expressed by the cells in the consecutive dose contains at least one immunoreactive epitope as the receptor, e.g., the CAR, expressed by the cells of the first dose.
  • the receptor, e.g., the CAR, expressed by the cells administered in the consecutive dose is identical to the receptor, e.g., the CAR, expressed by the first dose or is substantially identical to the receptor, e.g., the CAR, expressed by the cells of administered in the first dose.
  • the recombinant receptors, such as CARs, expressed by the cells administered to the subject in the various doses generally recognize or specifically bind to a molecule that is expressed in, associated with, and/or specific for the disease or condition or cells thereof being treated.
  • the receptor Upon specific binding to the molecule, e.g., antigen, the receptor generally delivers an immunostimulatory signal, such as an ITAM-transduced signal, into the cell, thereby promoting an immune response targeted to the disease or condition.
  • the cells in the first dose express a CAR that specifically binds to an antigen expressed by a cell or tissue of the disease or condition or associated with the disease or condition.
  • the genetically engineered antigen receptors include recombinant T cell receptors (TCRs) and/or TCRs cloned from naturally occurring T cells.
  • TCRs recombinant T cell receptors
  • a high-affinity T cell clone for a target antigen e.g., a cancer antigen
  • the TCR clone for a target antigen has been generated in transgenic mice engineered with human immune system genes (e.g., the human leukocyte antigen system, or HLA). See, e.g., tumor antigens (see, e.g., Parkhurst et al. (2009) Clin Cancer Res.
  • phage display is used to isolate TCRs against a target antigen (see, e.g., Varela-Rohena et al. (2008) Nat Med. 14: 1390-1395 and Li
  • the TCR alpha and beta chains are isolated and cloned into a gene expression vector.
  • the TCR alpha and beta genes are linked via a picornavirus 2A ribosomal skip peptide so that both chains are coexpression.
  • genetic transfer of the TCR is accomplished via retroviral or lentiviral vectors, or via transposons (see, e.g., Baum et al. (2006) Molecular Therapy: The Journal of the American Society of Gene Therapy. 13: 1050-1063; Frecha et al. (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18: 1748- 1757; an hackett et al. (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18:674-683.
  • the cells and methods include multi-targeting strategies, such as expression of two or more genetically engineered receptors on the cell, each recognizing the same of a different antigen and typically each including a different intracellular signaling component.
  • multi-targeting strategies are described, for example, in International Patent Application, Publication No.: WO 2014055668 Al (describing combinations of activating and costimulatory CARs, e.g., targeting two different antigens present individually on off-target, e.g., normal cells, but present together only on cells of the disease or condition to be treated) and Fedorov et al., Sci. Transl.
  • the cells include a receptor expressing a first genetically engineered antigen receptor (e.g., CAR or TCR) which is capable of inducing an activating signal to the cell, generally upon specific binding to the antigen recognized by the first receptor, e.g., the first antigen.
  • the cell further includes a second genetically engineered antigen receptor (e.g., CAR or TCR), e.g., a chimeric costimulatory receptor, which is capable of inducing a costimulatory signal to the immune cell, generally upon specific binding to a second antigen recognized by the second receptor.
  • the first antigen and second antigen are the same. In some embodiments, the first antigen and second antigen are different.
  • the first and/or second genetically engineered antigen receptor (e.g. CAR or TCR) is capable of inducing an activating signal to the cell.
  • the receptor includes an intracellular signaling component containing IT AM or ITAM-like motifs.
  • the activation induced by the first receptor involves a signal transduction or change in protein expression in the cell resulting in initiation of an immune response, such as ITAM phosphorylation and/or initiation of ITAM-mediated signal
  • transduction cascade formation of an immunological synapse and/or clustering of molecules near the bound receptor (e.g. CD4 or CD8, etc.), activation of one or more transcription factors, such as NF-KB and/or AP-1, and/or induction of gene expression of factors such as cytokines, proliferation, and/or survival.
  • bound receptor e.g. CD4 or CD8, etc.
  • transcription factors such as NF-KB and/or AP-1
  • induction of gene expression of factors such as cytokines, proliferation, and/or survival.
  • the first and/or second receptor includes intracellular signaling domains of costimulatory receptors such as CD28, CD137 (4-1 BB), OX40, and/or ICOS.
  • the first and second receptors include intracellular signaling domains of costimulatory receptors that are different.
  • the first receptor contains a CD28 costimulatory signaling region and the second receptor contain a 4- IBB costimulatory signaling region or vice versa.
  • the first and/or second receptor includes both an intracellular signaling domain containing ITAM or ITAM-like motifs and an intracellular signaling domain of a costimulatory receptor.
  • the first receptor contains an intracellular signaling domain containing ITAM or ITAM-like motifs and the second receptor contains an intracellular signaling domain of a costimulatory receptor.
  • the costimulatory signal in combination with the activating signal induced in the same cell is one that results in an immune response, such as a robust and sustained immune response, such as increased gene expression, secretion of cytokines and other factors, and T cell mediated effector functions such as cell killing.
  • neither ligation of the first receptor alone nor ligation of the second receptor alone induces a robust immune response.
  • the cell if only one receptor is ligated, the cell becomes tolerized or unresponsive to antigen, or inhibited, and/or is not induced to proliferate or secrete factors or carry out effector functions. In some such
  • a desired response is achieved, such as full immune activation or stimulation, e.g., as indicated by secretion of one or more cytokine, proliferation, persistence, and/or carrying out an immune effector function such as cytotoxic killing of a target cell.
  • the two receptors induce, respectively, an activating and an inhibitory signal to the cell, such that binding by one of the receptor to its antigen activates the cell or induces a response, but binding by the second inhibitory receptor to its antigen induces a signal that suppresses or dampens that response.
  • activating CARs and inhibitory CARs or iCARs are combinations of activating CARs and inhibitory CARs or iCARs.
  • Such a strategy may be used, for example, in which the activating CAR binds an antigen expressed in a disease or condition but which is also expressed on normal cells, and the inhibitory receptor binds to a separate antigen which is expressed on the normal cells but not cells of the disease or condition.
  • the multi-targeting strategy is employed in a case where an antigen associated with a particular disease or condition is expressed on a non-diseased cell and/or is expressed on the engineered cell itself, either transiently (e.g., upon stimulation in association with genetic engineering) or permanently.
  • an antigen associated with a particular disease or condition is expressed on a non-diseased cell and/or is expressed on the engineered cell itself, either transiently (e.g., upon stimulation in association with genetic engineering) or permanently.
  • the plurality of antigens are expressed on the cell, tissue, or disease or condition being targeted, such as on the cancer cell.
  • the cell, tissue, disease or condition is multiple myeloma or a multiple myeloma cell.
  • one or more of the plurality of antigens generally also is expressed on a cell which it is not desired to target with the cell therapy, such as a normal or non-diseased cell or tissue, and/or the engineered cells themselves. In such embodiments, by requiring ligation of multiple receptors to achieve a response of the cell, specificity and/or efficacy is achieved.
  • antigen receptors e.g., CARs or TCRs
  • exemplary methods include those for transfer of nucleic acids encoding the receptors, including via viral, e.g., retroviral or lentiviral, transduction,
  • recombinant nucleic acids are transferred into cultured cells using recombinant infectious virus particles, such as, e.g., vectors derived from simian virus 40 (SV40), adenoviruses, adeno-associated virus (AAV).
  • recombinant nucleic acids are transferred into T cells using recombinant lentiviral vectors or retroviral vectors, such as gamma-retroviral vectors (see, e.g., Koste et al. (2014) Gene Therapy 2014 Apr 3. doi: 10.1038/gt.2014.25; Carlens et al.
  • the retroviral vector has a long terminal repeat sequence (LTR), e.g., a retroviral vector derived from the Moloney murine leukemia virus (MoMLV), myeloproliferative sarcoma virus (MPSV), murine embryonic stem cell virus (MESV), murine stem cell virus (MSCV), spleen focus forming virus (SFFV), or adeno-associated virus (AAV).
  • LTR long terminal repeat sequence
  • MoMLV Moloney murine leukemia virus
  • MPSV myeloproliferative sarcoma virus
  • MMV murine embryonic stem cell virus
  • MSCV murine stem cell virus
  • SFFV spleen focus forming virus
  • AAV adeno-associated virus
  • retroviral vectors are derived from murine retroviruses.
  • the retroviruses include those derived from any avian or mammalian cell source.
  • the retroviruses typically are amphotropic, meaning that they are capable of
  • the gene to be expressed replaces the retroviral gag, pol and/or env sequences.
  • retroviral systems e.g., U.S. Pat. Nos. 5,219,740; 6,207,453; 5,219,740; Miller and Rosman (1989) BioTechniques 7:980-990; Miller, A. D. (1990) Human Gene Therapy 1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al. (1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; and Boris-Lawrie and Temin (1993) Cur. Opin. Genet. Develop. 3: 102-109.
  • recombinant nucleic acids are transferred into T cells via electroporation ⁇ see, e.g., Chicaybam et al, (2013) PLoS ONE 8(3): e60298 and Van Tedeloo et al. (2000) Gene Therapy 7(16): 1431-1437).
  • recombinant nucleic acids are transferred into T cells via transposition (see, e.g., Manuri et al. (2010) Hum Gene Ther 21(4): 427-437; Sharma et al. (2013) Molec Ther Nucl Acids 2, e74; and Huang et al. (2009) Methods Mol Biol 506: 115-126).
  • the cells may be transfected either during or after expansion e.g. with a T cell receptor (TCR) or a chimeric antigen receptor (CAR).
  • TCR T cell receptor
  • CAR chimeric antigen receptor
  • This transfection for the introduction of the gene of the desired receptor can be carried out with any suitable retroviral vector, for example.
  • the genetically modified cell population can then be liberated from the initial stimulus (the CD3/CD28 stimulus, for example) and subsequently be stimulated with a second type of stimulus e.g. via a de novo introduced receptor).
  • This second type of stimulus may include an antigenic stimulus in form of a peptide/MHC molecule, the cognate (cross-linking) ligand of the genetically introduced receptor (e.g.
  • genes for introduction are those to improve the efficacy of therapy, such as by promoting viability and/or function of transferred cells; genes to provide a genetic marker for selection and/or evaluation of the cells, such as to assess in vivo survival or localization; genes to improve safety, for example, by making the cell susceptible to negative selection in vivo as described by Lupton S. D. et al., Mol. and Cell Biol., 11:6 (1991); and Riddell et al., Human Gene Therapy 3:319-338 (1992); see also the publications of
  • a vector may be used that does not require that the cells, e.g., T cells, are activated. In some such instances, the cells may be selected and/or transduced prior to activation.
  • the cells may be engineered prior to, or subsequent to the culturing of the cells as described herein, and in some cases at the same time as or during at least a portion of the culturing.
  • the cells that to be engineered are the cultured cells, or in some cases, cells may be transduced prior to performing the culturing as described herein.
  • compositions containing the engineered receptor e.g., engineered antigen receptor
  • engineered antigen receptor such as CAR or TCR
  • compositions containing the engineered cells including pharmaceutical compositions and formulations.
  • methods of using and uses of the compositions such as in the treatment of diseases, conditions, and disorders in which the antigen is expressed, or in detection, diagnostic, and prognostic methods.
  • composition refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
  • a "pharmaceutically acceptable carrier” refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject.
  • a pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
  • the choice of carrier is determined in part by the particular cell and/or by the method of administration. Accordingly, there are a variety of suitable
  • the pharmaceutical composition can contain preservatives.
  • Suitable preservatives may include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride.
  • a mixture of two or more preservatives is used.
  • the preservative or mixtures thereof are typically present in an amount of about 0.0001 to about 2% by weight of the total composition. Carriers are described, e.g., by Remington's
  • Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins;
  • hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other
  • carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG).
  • chelating agents such as EDTA
  • sugars such as sucrose, mannitol, trehalose or sorbitol
  • salt-forming counter-ions such as sodium
  • metal complexes e.g. Zn-protein complexes
  • non-ionic surfactants such as polyethylene glycol (PEG).
  • Buffering agents in some aspects are included in the compositions. Suitable buffering agents include, for example, citric acid, sodium citrate, phosphoric acid, potassium phosphate, and various other acids and salts. In some aspects, a mixture of two or more buffering agents is used. The buffering agent or mixtures thereof are typically present in an amount of about 0.001 to about 4% by weight of the total composition. Methods for preparing administrable pharmaceutical compositions are known. Exemplary methods are described in more detail in, for example, Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins; 21st ed. (May 1, 2005).
  • the formulation or composition may also contain more than one active ingredient useful for the particular indication, disease, or condition being treated with the cells, preferably those with activities complementary to the cell, where the respective activities do not adversely affect one another.
  • active ingredients are suitably present in combination in amounts that are effective for the purpose intended.
  • the pharmaceutical composition further includes other pharmaceutically active agents or drugs, such as
  • chemotherapeutic agents e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc.
  • the cells or antibodies are administered in the form of a salt, e.g., a pharmaceutically acceptable salt.
  • Suitable pharmaceutically acceptable acid addition salts include those derived from mineral acids, such as hydrochloric, hydrobromic, phosphoric, metaphosphoric, nitric, and sulphuric acids, and organic acids, such as tartaric, acetic, citric, malic, lactic, fumaric, benzoic, glycolic, gluconic, succinic, and arylsulphonic acids, for example, p-toluenesulphonic acid.
  • Active ingredients may be entrapped in microcapsules, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions.
  • the pharmaceutical composition is formulated as an inclusion complex, such as cyclodextrin inclusion complex, or as a liposome.
  • Liposomes can serve to target the host cells (e.g., T-cells or NK cells) to a particular tissue.
  • host cells e.g., T-cells or NK cells
  • Many methods are available for preparing liposomes, such as those described in, for example, Szoka et al., Ann. Rev. Biophys. Bioeng., 9: 467 (1980), and U.S. Patents 4,235,871, 4,501,728, 4,837,028, and 5,019,369.
  • the pharmaceutical composition in some aspects can employ time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated.
  • time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated.
  • release delivery systems are available and known. Such systems can avoid repeated
  • the pharmaceutical composition in some embodiments contains cells in amounts effective to treat or prevent the disease or condition, such as a therapeutically effective or prophylactically effective amount.
  • Therapeutic or prophylactic efficacy in some embodiments is monitored by periodic assessment of treated subjects. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs.
  • other dosage regimens may be useful and can be determined.
  • the desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.
  • the cells may be administered using standard administration techniques,
  • formulations, and/or devices are provided.
  • formulations and devices such as syringes and vials, for storage and administration of the compositions.
  • Administration of the cells can be autologous or heterologous.
  • immunoresponsive cells or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject.
  • Peripheral blood derived immunoresponsive cells or their progeny e.g., in vivo, ex vivo or in vitro derived
  • a therapeutic composition e.g., a pharmaceutical composition containing a genetically modified immunoresponsive cell
  • a unit dosage injectable form solution, suspension, emulsion
  • Formulations include those for oral, intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration.
  • the cell populations are administered parenterally.
  • parenteral includes intravenous, intramuscular, subcutaneous, rectal, vaginal, and intraperitoneal administration.
  • the cell populations are administered to a subject using peripheral systemic delivery by intravenous, intraperitoneal, or subcutaneous injection.
  • compositions in some embodiments are provided as sterile liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may in some aspects be buffered to a selected pH.
  • sterile liquid preparations e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may in some aspects be buffered to a selected pH.
  • Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues.
  • Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyoi (for example, glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
  • carriers can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyoi (for example, glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
  • Sterile injectable solutions can be prepared by incorporating the cells in a solvent, such as in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like.
  • a suitable carrier such as a suitable carrier, diluent, or excipient
  • the compositions can also be lyophilized.
  • the compositions can contain auxiliary substances such as wetting, dispersing, or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired. Standard texts may in some aspects be consulted to prepare suitable preparations.
  • compositions including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added.
  • antimicrobial preservatives for example, parabens, chlorobutanol, phenol, sorbic acid, and the like.
  • Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin.
  • Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
  • the formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
  • the cells, populations, and compositions are administered to a subject or patient having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy.
  • adoptive cell therapy such as adoptive T cell therapy.
  • cells and compositions prepared by the provided methods such as engineered compositions and end-of- production compositions following incubation and/or other processing steps, are administered to a subject, such as a subject having or at risk for the disease or condition.
  • the methods thereby treat, e.g., ameliorate one or more symptom of, the disease or condition, such as by lessening tumor burden in a cancer expressing an antigen recognized by an engineered T cell.
  • a "subject" is a mammal, such as a human or other animal, and typically is human.
  • the subject e.g., patient, to whom the cells, cell populations, or compositions are administered is a mammal, typically a primate, such as a human.
  • the primate is a monkey or an ape.
  • the subject can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects.
  • the subject is a non-primate mammal, such as a rodent.
  • treatment refers to complete or partial amelioration or reduction of a disease or condition or disorder, or a symptom, adverse effect or outcome, or phenotype associated therewith.
  • Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis.
  • the terms do not imply complete curing of a disease or complete elimination of any symptom or effect(s) on all symptoms or outcomes.
  • delay development of a disease means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
  • Preventing includes providing prophylaxis with respect to the occurrence or recurrence of a disease in a subject that may be predisposed to the disease but has not yet been diagnosed with the disease.
  • the provided cells and compositions are used to delay development of a disease or to slow the progression of a disease.
  • a function or activity is to reduce the function or activity when compared to otherwise same conditions except for a condition or parameter of interest, or alternatively, as compared to another condition.
  • cells that suppress tumor growth reduce the rate of growth of the tumor compared to the rate of growth of the tumor in the absence of the cells.
  • an "effective amount" of an agent e.g., a pharmaceutical formulation, cells, or composition, in the context of administration, refers to an amount effective, at dosages/amounts and for periods of time necessary, to achieve a desired result, such as a therapeutic or
  • a "therapeutically effective amount" of an agent refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result, such as for treatment of a disease, condition, or disorder, and/or pharmacokinetic or pharmacodynamic effect of the treatment.
  • the therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the subject, and the populations of cells administered.
  • the provided methods involve administering the cells and/or compositions at effective amounts, e.g., therapeutically effective amounts.
  • a “prophylactic ally effective amount” refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
  • the disease or condition that is treated can be any in which expression of an antigen is associated with and/or involved in the etiology of a disease condition or disorder, e.g. causes, exacerbates or otherwise is involved in such disease, condition, or disorder.
  • exemplary diseases and conditions can include diseases or conditions associated with malignancy or transformation of cells (e.g. cancer), autoimmune or inflammatory disease, or an infectious disease, e.g. caused by a bacterial, viral or other pathogen.
  • Exemplary antigens which include antigens associated with various diseases and conditions that can be treated, are described above.
  • the chimeric antigen receptor or transgenic TCR specifically binds to an antigen associated with the disease or condition.
  • the provided methods and uses include methods and uses for adoptive cell therapy.
  • the methods include administration of the cells or a composition containing the cells to a subject, tissue, or cell, such as one having, at risk for, or suspected of having the disease, condition or disorder.
  • the cells, populations, and compositions are administered to a subject having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy.
  • the cells or compositions are administered to the subject, such as a subject having or at risk for the disease or condition, ameliorate one or more symptom of the disease or condition.
  • the cell therapy e.g., adoptive T cell therapy
  • the cell therapy is carried out by autologous transfer, in which the cells are isolated and/or otherwise prepared from the subject who is to receive the cell therapy, or from a sample derived from such a subject.
  • the cells are derived from a subject, e.g., patient, in need of a treatment and the cells, following isolation and processing are administered to the same subject.
  • the cell therapy e.g., adoptive T cell therapy
  • the cells are carried out by allogeneic transfer, in which the cells are isolated and/or otherwise prepared from a subject other than a subject who is to receive or who ultimately receives the cell therapy, e.g., a first subject.
  • the cells then are administered to a different subject, e.g., a second subject, of the same species.
  • the first and second subjects are genetically identical.
  • the first and second subjects are genetically similar.
  • the second subject expresses the same HLA class or supertype as the first subject.
  • the cells can be administered by any suitable means. Dosing and administration may depend in part on whether the administration is brief or chronic. Various dosing schedules include but are not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion.
  • the cells, or individual populations of sub-types of cells are administered to the subject at a range of about one million to about 100 billion cells and/or that amount of cells per kilogram of body weight, such as, e.g., 1 million to about 50 billion cells (e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any two of the foregoing values), such as about 10 million to about 100 billion cells (e.g., about 20 million cells, about 30 million cells, about 40 million cells, about 60 million cells, about 70 million cells, about 80 million cells, about 90 million cells, about 10 billion cells, about 25 billion cells, about 50 billion cells, about 75 billion cells, about 90 billion cells, or a range defined by any two of the foregoing values), and in some cases about 100 million cells to about 50 billion cells (e.g., about 120 million cells, about 250 million cells, about 350 million cells
  • the cells in some embodiments are co-administered with one or more additional therapeutic agents or in connection with another therapeutic intervention, either simultaneously or sequentially in any order. In some contexts, the cells are co-administered with another therapy sufficiently close in time such that the cell populations enhance the effect of one or more additional therapeutic agents, or vice versa. In some embodiments, the cells are administered prior to the one or more additional therapeutic agents. In some embodiments, the cells are administered after the one or more additional therapeutic agents. In some embodiments, the one or more additional agents include a cytokine, such as IL-2, for example, to enhance persistence. In some embodiments, the methods comprise administration of a chemotherapeutic agent.
  • the biological activity of the engineered cell populations in some embodiments is measured, e.g., by any of a number of known methods.
  • Parameters to assess include specific binding of an engineered or natural T cell or other immune cell to antigen, in vivo, e.g., by imaging, or ex vivo, e.g., by ELISA or flow cytometry.
  • the ability of the engineered cells to destroy target cells can be measured using any suitable method known in the art, such as cytotoxicity assays described in, for example, Kochenderfer et al., J. Immunotherapy, 32(7): 689-702 (2009), and Herman et al. J.
  • the biological activity of the cells is measured by assaying expression and/or secretion of one or more cytokines, such as CD 107a, IFNy, IL-2, and TNF.
  • the biological activity is measured by assessing clinical outcome, such as reduction in tumor burden or load.
  • the engineered cells are further modified in any number of ways, such that their therapeutic or prophylactic efficacy is increased.
  • the engineered CAR or TCR expressed by the population can be conjugated either directly or indirectly through a linker to a targeting moiety.
  • the practice of conjugating compounds, e.g., the CAR or TCR, to targeting moieties is known in the art. See, for instance, Wadwa et al., J. Drug Targeting 3: 1 1 1 (1995), and U.S. Patent 5,087,616.
  • composition refers to any mixture of two or more products, substances, or compounds, including cells. It may be a solution, a suspension, liquid, powder, a paste, aqueous, non-aqueous or any combination thereof.
  • enriching when referring to one or more particular cell type or cell population, refers to increasing the number or percentage of the cell type or population, e.g., compared to the total number of cells in or volume of the composition, or relative to other cell types, such as by positive selection based on markers expressed by the population or cell, or by negative selection based on a marker not present on the cell population or cell to be depleted.
  • the term does not require complete removal of other cells, cell type, or populations from the composition and does not require that the cells so enriched be present at or even near 100 % in the enriched composition.
  • a statement that a cell or population of cells is "positive" for a particular marker refers to the detectable presence on or in the cell of a particular marker, typically a surface marker.
  • a surface marker refers to the presence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is detectable by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions and/or at a level substantially similar to that for cell known to be positive for the marker, and/or at a level substantially higher than that for a cell known to be negative for the marker.
  • a statement that a cell or population of cells is "negative" for a particular marker refers to the absence of substantial detectable presence on or in the cell of a particular marker, typically a surface marker.
  • a surface marker refers to the absence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is not detected by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions, and/or at a level substantially lower than that for cell known to be positive for the marker, and/or at a level substantially similar as compared to that for a cell known to be negative for the marker.
  • expression refers to the process by which a polypeptide is produced based on the encoding sequence of a nucleic acid molecule, such as a gene.
  • the process may include transcription, post-transcriptional control, post-transcriptional modification, translation, post-translational control, post-translational modification, or any combination thereof.
  • a subject includes any living organism, such as humans and other mammals. Mammals include, but are not limited to, humans, and non-human animals, including farm animals, sport animals, rodents and pets.
  • a control refers to a sample that is substantially identical to the test sample, except that it is not treated with a test parameter, or, if it is a plasma sample, it can be from a normal volunteer not affected with the condition of interest.
  • a control also can be an internal control.
  • a method for culturing target cells comprising incubating a composition comprising target cells in the presence of:
  • a stimulatory agent which is i) reversibly bound to a reagent comprising a plurality of binding sites capable of reversibly binding to the stimulatory agent; and ii) is capable of reversibly binding to the stimulatory agent, under conditions whereby the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells; and
  • a selection agent that (i) is capable of specifically binding to a selection marker expressed by one or more of the at least a plurality of the target cells and ii) is reversibly bound to the reagent comprising a plurality of binding sites capable of reversibly binding to the selection agent, thereby generating cultured target cells.
  • a method for culturing cells comprising:
  • [0187] (1) combining (a) a composition comprising a plurality of target cells and (b) a selection agent that (i) is capable of specifically binding to a selection marker expressed by one or more of the at least a plurality of the target cells and ii) is reversibly bound to a reagent comprising a plurality of binding sites capable of reversibly binding to the selection agent; and
  • a method for culturing target cells comprising incubating a composition comprising target cells in the presence of a stimulatory agent and a selection agent each of which is i) reversibly bound to a reagent, which reagent comprises a plurality of binding sites capable of reversibly binding to the stimulatory agent, and one or more binding sites capable of binding to the selection agent,
  • the selection agent is capable of specifically binding to a selection marker expressed by at least a subpopulation of the target cells
  • the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells.
  • the reagent is not, and is not bound to or associated with, a solid support, stationary phase, a bead, a microparticle, a magnetic particle, and/or a matrix during said incubation;
  • the reagent is flexible, does not contain a metal or magnetic core, is comprised entirely or primarily of organic multimer, is not spherical, is not substantially spherical or uniform in shape and/or is not rigid.
  • the support is or comprises a stationary phase
  • the support is or comprises a solid support.
  • the selection agent comprises a binding partner CI and the plurality of binding sites comprises two or more binding sites, Zl, which each are capable of binding to the binding partner CI to form the reversible bond between the selection agent and the reagent;
  • the stimulatory agent comprises a binding partner CI or C2 and the and the plurality of binding sites comprises two or more binding sites, Zl or Z2, which each are capable of binding to the binding partner CI of C2, respectively, to form the reversible bond between the selection agent and the reagent.
  • CI and C2 are the same or substantially the same, or contain the same or
  • Zl and Z2 are the same or substantially the same or contain the same or substantially the same moiety.
  • the selection agent further comprises a binding site Bl, wherein the specific binding between the selection agent and the selection marker on the target cells comprises interaction between B 1 and the marker;
  • the stimulatory agent further comprises a binding site B2, wherein the specific binding between the stimulatory agent and the molecule on the target cells comprises interaction between B2 and the molecule.
  • selection marker is a first selection marker and the selection agent is further capable of binding to a second selection marker, which is expressed on the surface of at least a plurality of the target cells.
  • the selection marker which can be a first selection marker, and/or the second selection marker expressed on the surface of the target cells is a protein or polypeptide; and/or [0230] the selection marker, which can be a first selection marker, and/or the second selection marker is a protein or polypeptide.
  • target ce lis comprise blood cells
  • target ce lis comprise leukocytes
  • target ce lis comprise lymphocytes
  • target ce lis comprise B cells
  • target ce lis comprise a B cell population
  • target ce lis comprise T cells
  • target ce lis comprise a T cell population
  • target ce lis comprise natural killer (NK) cells
  • target ce lis comprise dendritic cells
  • target ce lis comprise macrophages.
  • the target cells comprise antigen-specific T cells or a population thereof, a T helper cell or population thereof, a cytotoxic T cell or population thereof, a memory T cell or population thereof, a regulatory T cell or population thereof, or a NK cell or population thereof, antigen-specific B cells or a population thereof, a memory B cell or population thereof, or a regulatory B cell or population thereof.
  • selection marker which can be the first selection marker, and/or the second selection marker are selected from among CD25, CD28, CD62L, CCR7, CD27, CD 127, CD3, CD4, CD8, CD45RA, and/or CD45RO.
  • the stimulatory agent is capable of initiating a TCR/CD3 complex-associated signal in the T cells.
  • the stimulatory agent specifically binds to a member of a TCR/CD3 complex
  • the stimulatory agent specifically binds to CD3.
  • the second signal is a signal other than a TCR/CD3 complex-associated signal
  • the second signal is capable of enhancing or potentiating a TCR/CD3 complex- associated signal
  • the second molecule is a costimulatory molecule, accessory molecule, cytokine receptor, chemokine receptor, immune checkpoint molecule or is a member of the TNF family or the TNF receptor family.
  • the selection agent and/or stimulatory agent comprise an antibody fragment
  • the selection agent and/or stimulatory agent comprise a Fab fragment
  • the selection agent and/or stimulatory agent are is a divalent antibody fragment selected from among a (Fab) 2 ' -fragment and a divalent single-chain Fv (scFv) fragment; [0272] the selection agent and/or stimulatory agent is a monovalent antibody fragment selected from among a Fab fragment, an Fv fragment and an scFv fragment; and/or
  • the selection agent and/or stimulatory agent is a proteinaceous binding molecule with antibody- like binding properties selected from among aptamers, muteins based on a polypeptide of the lipocalin family, glubodies, proteins based on the ankyrin scaffold, proteins based on the crystalline scaffold, adnectins and avimers.
  • the reagent is or comprises streptavidin, avidin, an analog or mutein of streptavidin that reversibly binds biotin, a biotin analog or a biologically active fragment thereof; an analog or mutein of avidin or streptavidin that reversibly binds a streptavidin-binding peptide; a reagent that comprises at least two chelating groups K, wherein the at least two chelating groups are capable of binding to a transition metal ion; an agent capable of binding to an oligohistidine affinity tag; an agent capable of binding to a glutathione-S-transferase; calmodulin or an analog thereof; an agent capable of binding to calmodulin binding peptide (CBP); an agent capable of binding to a FLAG-peptide; an agent capable of binding to an HA-tag; an agent capable of binding to maltose binding protein (MBP); an agent capable of
  • the reagent is or comprises a streptavidin analog or mutein or an avidin analog or mutein that reversibly binds to biotin or a biologically active fragment;
  • the reagent is or comprises a streptavidin analog or mutein or an avidin analog or mutein that reversibly binds to a biotin analog or a biologically active fragment; and/or
  • the reagent is or comprises a streptavidin analog or mutein or an avidin analog or mutein that reversibly binds to a streptavidin-binding peptide.
  • the reagent is an oligomer or polymer of streptavidin, avidin, an analog or mutein of streptavidin that reversibly binds biotin or a biologically active fragment; a streptavidin or avidin analog or mutein that reversibly binds a streptavidin-binding peptide; a reagent that comprises at least two chelating groups K, wherein the at least two chelating groups are capable of binding to a transition metal ion; an agent capable of binding to an oligohistidine affinity tag; an agent capable of binding to a glutathione- S-transferase; calmodulin or an analog thereof; an agent capable of binding to calmodulin binding peptide (CBP); an agent capable of binding to a FLAG-peptide; an agent capable of binding to an HA-tag; an agent capable of binding to maltose binding protein (MBP); an agent capable of binding
  • CBP calmodulin binding peptide
  • MBP mal
  • the reagent comprises an oligomer or polymer of streptavidin, avidin, a streptavidin analog or mutein or and an avidin analog or mutein.
  • streptavidin-binding peptide is selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer) 3 -Trp-Ser-His-Pro-Gln-Phe-Glu-Lys ((SEQ ID NO: 17), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer) 2 -Trp-Ser-His-Pro-Gln- Phe-Glu-Lys (SEQ ID NO: 18) and Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer) 2 Gly- Gly-Ser-Ala
  • the reagent comprises a streptavidin analog or mutein comprising the amino acid sequence Val 44 -Thr 45 -Ala 46 -Arg 47 or lle 44 -Gly 45 -Ala 46 -Arg 47 at sequence positions
  • the streptavidin analog or mutein comprises the amino acid sequence Val -Thr - Ala 46 -Arg 47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO: l.
  • streptavidin analog or mutein further comprises an amino acid replacement or replacements at a position corresponding to 117, 120 and/or 121 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO: l.
  • amino acid replacement or replacements are selected from among Glul 17, Aspl l7, Argl l7, Serl20, Alal20, Glyl20, Trpl21, Tyrl21 or Phel21; or
  • amino acid replacement or replacements are selected from one or more of Glul 17, Glyl20 or Tyrl21; or
  • amino acid replacements are selected from Glul 17, Glyl20 or Tyrl21.
  • Glu 117 , Gly 120 and Tyr 121 and reversibly binds to biotin or a biologically active fragment, a biotin analog or mutein or a biologically active fragment thereof or a streptavidin-binding peptide; or
  • the binding partner CI and/or the binding partner C2 independently, comprises a streptavidin-binding peptide selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro- Gln-Phe-Glu-Lys-(GlyGlyGlySer) 3 -Trp-Ser-His-Pro-Gln-Phe-Glu-Lys ((SEQ ID NO: 17), Trp- Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer) 2 -Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 18) and Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlyS)
  • [0321] 44 The method of embodiment 42 or embodiment 43, wherein the substance in the composition is not detrimental to the T cells or to the target cells and/or wherein the addition of said substance does not reduce the percentage of surviving T cells or target cells to less than 90 %, 80 %, 70 %, 60 %, or 50 %, as compared to incubation of the T cells or target cells, respectively, under comparable or the same conditions, without the substance.
  • the reagent is or comprises a streptavidin, avidin, a streptavidin analog or mutein or and an avidin analog or mutein or biologically active fragments thereof;
  • the substance comprises a streptavidin-binding peptide, biotin or a biologically active fragment, optionally a D-biotin, or a biotin analog or biologically active fragment.
  • the substance is a streptavidin-binding peptide is selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys- (GlyGlyGlySer) 3 -Trp-Ser-His-Pro-Gln-Phe-Glu-Lys ((SEQ ID NO: 17), Trp-Ser-His-Pro-Gln- Phe-Glu-Lys-(GlyGlyGlySer) 2 -Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 18) and Trp- Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer) 2 Gly-Gly-Ser-Ala-Trp-Ser-His-Pro
  • the substance is CI, C2 or C3 or an analog thereof.
  • the selection agent is capable of specifically binding to a selection marker expressed by at least a subpopulation of the target cells
  • the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells.
  • EXAMPLE 1 Generation of a soluble stimulatory reagent, containing multimerized anti- CD3 and anti-CD28 Fab fragments reversibly bound to an oligomeric streptavidin mutein reagent
  • Stimulatory agents (anti-CD3 and anti-CD28 Fab fragments) were multimerized by reversibly binding to a multimerization reagent, which was an oligomeric streptavidin mutein.
  • the reagent contained multiple binding sites for peptide tags, which were present on the Fab fragments.
  • the oligomeric streptavidin mutein was prepared by polymerizing the streptavidin mutein designated Strep-tactin® ml (a streptavidin homo-tetramer containing the mutein sequence of amino acids set forth in SEQ ID NO:6, see e.g. U.S. Patent No.
  • Anti-CD3 and anti-CD28 Fab fragments were reversibly bound to the oligomeric streptavidin mutein via a streptavidin peptide-binding partner fused to each Fab fragment.
  • the anti-CD3 Fab fragment was derived from the CD3 binding monoclonal antibody produced by the hybridoma cell line OKT3 (ATCC® CRL-8001TM; see also U.S. Patent No. 4,361,549), and contained the heavy chain variable domain and light chain variable domain of the anti-CD3 antibody OKT3 described in Arakawa et al J. Biochem. 120, 657-662 (1996). These sequences are set forth in SEQ ID NOs:31 and 32, respectively.
  • the anti-CD28 Fab fragment was derived from antibody CD28.3 (deposited as a synthetic single chain Fv construct under GenBank Accession No. AF451974.1; see also Vanhove et al, BLOOD, 15 July 2003, Vol. 102, No. 2, pages 564-570) and contained the heavy and light chain variable domains of the anti-CD28 antibody CD28.3 set forth in SEQ ID NOS: 33 and 34, respectively.
  • the Fab fragments were individually fused at the carboxy-terminus of their heavy chain to a streptavidin peptide-binding sequence containing a sequential arrangement of two streptavidin binding modules having the sequence of amino acids SAWSHPQFEK(GGGS) 2 GGSAWSHPQFEK (SEQ ID NO: 16).
  • the peptide-tagged Fab fragments were recombinantly produced (see International patent
  • peptide-tagged anti-CD3 and anti-CD28 Fab fragments were mixed with the multimerizing reagent, at approximately room temperature, thereby reversibly binding them to the reagent via interaction between twin-strep-tags on the Fab fragments, which were binding partners capable of reversibly binding to binding sites on the reagent, Specifically, in this study, approximately 0.5 ⁇ g of the anti-CD3 peptide tagged Fab fragment and approximately 0.5 ⁇ g of the anti-CD28 peptide-tagged Fab fragment were added to approximately 3 ⁇ g of soluble oligomeric Strep- tactin® at room temperature.
  • the peptide-tagged Fab fragments were pre-mixed prior to immobilization onto the soluble oligomeric mutein streptavidin backbone, which, in some instances, can result in a more uniform distribution of the different Fab molecules.
  • the resulting soluble anti-CD3/anti-CD28 multimerized agent was used to stimulate T cells.
  • the resulting soluble anti- CD3/anti-CD28 multimerized agent was stored on ice prior to stimulation of cells.
  • Example 2 Stimulation/expansion of CD3+ T responder cells with aCD3/aCD28 Fab fragments that were reversibly immobilized on beads coated with the streptavidin mutein Strep-tactin®.
  • CD3+CD62L-responder T cells (Tresp, isolated by serial magnetic enrichment from a non-mobilized donor apheresis product) were labeled with 3 ⁇ CFSE and stimulated with 5 ⁇ 1 of a 15 ⁇ 1 preparation of Strep tactin® beads (10 mg magnetic particles/ml, loaded with 35 ⁇ g Streptactin®/mg beads) either loaded with 0 ⁇ g aCD3 Fab fragment alone, 0 ⁇ g aCD28 Fab fragment alone, or a mixture of 0 ⁇ g aCD3 Fab fragment and 0 ⁇ g aCD28 Fab.
  • the aCD3 Fab fragment used was derived from the CD3 binding monoclonal antibody produced by the hybridoma cell line OKT3.
  • the hybridoma cell line OKT3 and the OKT3 antibody are described in US Patent 4,361,549, the cell line has been deposited under accession number ATCC® CRL-8001TM).
  • the CD28 Fab used was derived from the
  • Tresp cells stimulated with blank beads (no Fab) served as negative control.
  • Tresp cells were seeded in triplets in 48-well plates along with 300,000 CD3 cells autologous feeder cells (irradiated with 30Gy) in 3ml complete cell culture medium (RPMI (Gibco) supplemented with 10% (v/v) fetal calf serum, L-glutamine, b-mercapto ethanol, HEPES, penicillin, streptomycine and gentamycine) supplemented with lOU/ml interleukin 2 (IL-2).
  • RPMI complete cell culture medium
  • IL-2 interleukin 2
  • Fig. 5A FACS staining and analysis was done after lOmin incubation with ⁇ D- biotin.
  • Plots show live CD3+ cells that were stained with propidium iodide (PI) for live/dead discrimination.
  • Fig. 5A is a histogram showing size-distribution (forward scatter) of stimulated cells.
  • FIG. 5 A shows that a specific cell population of Tresp cells was stimulated and expanded (increase in size/number compared to the unstimulated "beads only” control) when incubated in the presence of beads on which a mixture of 0 ⁇ g aCD3 Fab fragment and 0 ⁇ g aCD28 Fab was immobilized, after being stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on beads coated with the streptavidin mutein Strep-tactin®.
  • Fig. 5B depicts histograms of the dilution of the proliferation dye CFSE representing the degree of proliferation according to the number of cells per cell division (indicated on top of Fig.
  • EXAMPLE 3 Stimulation/expansion of CD3+ T responder cells with aCD3/aCD28 Fab fragments that were reversibly immobilized on soluble Strep-tactin
  • CD3+ T responder cells isolated by magnetic selection from a sample of fresh PBMCs obtained from a Ficoll gradient
  • aCD3/aCD28 Fab fragments that were reversibly immobilized on soluble oligomeric Strep-tactin® acting as a soluble reagent.
  • the oligomeric streptavidin mutein was obtained by polymerizing Strep-tactin® with sulfo SMCC (sulfosuccinimidyl 4-(N- maleimidomethyl)cyclohexane-l-carboxylate, product # 22122 Thermo Scientific) and iminothiolan (product # 26101 Thermo Scientific) according to the protocol of the manufacturer (Thermo Scientific).
  • the oligomeric streptavidin muteins were separated from monomeric (unreacted) and dimeric streptavidin muteins by size exclusion chromatography and the so obtained fraction of the oligomeric streptavidin mutein (n> 3) was used as soluble reagent.
  • CD3+ responder T cells 300,000 CD3+ responder T cells (Tresp) were labeled with 2 ⁇ Carboxyfluorescein succinimidyl ester (CFSE) and stimulated with varying amounts of a preparation of soluble oligomeric streptavidin mutein on which a combination of the above described aCD3 OKT3 Fab fragment and the aCD28 Fab fragment of the antibody 28.3 (both carrying the above-mentioned Twin-Strep-tag® as streptavidin binding peptide at the heavy chain) were immobilized, ("lx" corresponds to 3 ⁇ g oligomeric streptavidin mutein
  • Tresp cells either left unstimulated or were stimulated with blank oligomeric streptavidin mutein (no Fab) served as negative controls. Tresp cells were seeded in duplicates in 48-well plates along with 300,000 CD3 negative autologous feeder cells (irradiated with 30Gy) in 1ml cell culture medium supplemented with 20U/ml IL-2. Cells were incubated at 37°C without media exchange and proliferation was analyzed according to CFSE dilution after 5 days by FACS analysis. Fig.
  • FIG. 6 A shows the increase in the size distribution of proliferating cells after 5 days in culture compared to the negative controls.
  • Fig. 6B shows that CD3+ Tresp cells were properly stimulated and proliferated vigorously when incubated with soluble oligomeric streptavidin mutein (as compared to solid Streptactin magnetic particles in Fig.5) on which a mixture of aCD3 Fab and aCD28 Fab fragments were immobilized.
  • soluble oligomeric streptavidin mutein as compared to solid Streptactin magnetic particles in Fig.5
  • Fig. 6D shows the absolute number of live (trypan blue negative) cells after 5 days. The number was counted using a Neubauer counting chamber and plotted against the respective stimulation condition. Median cell numbers are shown in Fig. 6D; error bars indicate standard deviation (SD). Fig.
  • 6D shows that all which mixtures of aCD3 Fab fragments and aCD28 Fab fragments that were immobilized on a soluble oligomeric streptavidin mutein reagent were equally effective in expanding the CD3+ cells and resulted in an approx. 4-fold increase of absolute cell numbers.
  • EXAMPLE 4 Kinetics of proliferation of purified CD4+ and CD8+ T responder cells stimulated in vitro with reversible aCD3/aCD28 Fab-Streptamer multimers without medium exchange
  • oligomeric Strep-tactin® mutein of two different sizes served as soluble reagent.
  • the first kind of oligomeric Strep-tactin® was the fraction of the oligomeric streptavidin mutein (n> 3) obtained in Example 3 (also referred herein as "conventional oligomeric streptavidin mutein backbone", illustrated by the triangle symbol with the tip on top in Fig.
  • the second kind of this oligomeric streptavidin mutein used as soluble reagent was an oligomeric streptavidin mutein (n> 3) that was reacted with biotinylated human serum albumin (also referred herein as "large oligomeric streptavidin mutein backbone).
  • oligomeric streptavidin mutein n> 3
  • biotinylated human serum albumin also referred herein as "large oligomeric streptavidin mutein backbone.
  • SAWSHPQFEK(GGGS)2GGSAWSHPQFEK (SEQ ID NO: 16) at the C-terminus of the heavy chain of the Fab fragment.
  • 4.5 ⁇ 1 of the conventional oligomeric streptavidin mutein backbone was loaded with 0 ⁇ g aCD3 Fab fragment, 0 ⁇ g aCD8 Fab fragment (IBA GmbH Gottingen, that also carries at the C-terminus of the Fab fragment the streptavidin binding peptide SAWSHPQFEK(GGGS)2GGSAWSHPQFEK (SEQ ID NO: 16) and 0 ⁇ g aCD28 Fab fragment.
  • Tresp cells served as negative control and Tresp cells stimulated with commercially available Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) as positive control.
  • Dynabeads beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized
  • Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium (RPMI 1640 (Gibco) supplemented with 10% (v/v fetal calf serum, 0.025% (w/v) L-glutamine, 0.025% (w/v) L-arginine, 0.1% (w/v) HEPES, 0.001% (w/v) gentamycine, 0.002% (w/v) streptomycine, 0.002% (w/v) peniciline) supplemented with 30U/ml IL-2. Cells were incubated at 37°C without media exchange and cell count was analyzed after 1, 3 and 6 days. In the experiments of Fig. 7 the expansion was carried out without medium exchange.
  • the results for the CD4+ T responder cells are shown in Fig.7A
  • the results for the CD8+ T responder cells are shown in Fig. 7B, with the graphs representing degree of proliferation according to the number of cells harvested per time point for CD4+ Tresp (Fig. 7 A) and for CD8+ Tresp in Fig.7B.
  • CD8+ T cells could be expanded within the first 3 days at least as efficiently as with Dynabeads.
  • the expansion experiment that used a soluble reagent that in addition to aCD3 and aCD28 Fab fragments (as first and second agent) carried reversibly immobilized thereon aCD8 Fab fragment showed the best degree of expansion under these culturing conditions. This indicates that it is possible by using a stimulus that is specific for a particular sub-population of cells (here the aCD8 Fab fragment) to increase or modulate the selectivity of the expansion, thereby being able to obtain larger amounts of a desired cell (sub)- population.
  • Example 4 shows that the functionality of the soluble multimerized agent in terms of triggering expansion of T cells is comparable to the current standard methodology of using Dynabeads for this purpose.
  • the stimulation can be controlled (and terminated, if wanted) by adding a competitor such as biotin in the case of a streptavidin based reversible interaction between the first and second agent and the reagent, the compositions and methods described herein provide a significant advantage over the Dynabeads technology since the expansion conditions can be optimized (it would for example be possible to stop the stimulation in the experiment of Fig.7B after 3 days).
  • the expansion methods disclosed herein can be carried out and automated in closed systems that are, for example, needed for GMP production of cells for therapeutic purposes, without having to deal with the removal of beads such as Dynabeads.
  • EXAMPLE 5 Kinetics of proliferation of purified CD4+ and CD8+ T responder cells stimulated in vitro with reversible aCD3/aCD28 Fab-Streptamer multimers with medium exchange
  • streptavidin mutein (n> 3) obtained in Example 3 (also referred herein as "conventional oligomeric streptavidin mutein backbone", illustrated by the triangle symbol with the tip down in Fig. 7).
  • the second kind of this oligomeric streptavidin mutein used as soluble reagent was obtained by reacting the oligomeric Strep-tactin (n> 3) obtained in Example 3 with biotinylated human serum albumin.
  • This soluble oligomeric reagent is also referred herein as "large oligomeric streptavidin mutein backbone.
  • 400,000 purified CD4+ or CD8+ responder T cells were separately stimulated with these two different oligomeric streptavidin muteins as explained above, i.e. with either the oligomeric streptavidin mutein backbone of Example 3 (1.0 mg/ml) or with the large oligomeric streptavidin mutein backbones (O.lmg/ml). 3 ⁇ 1 of both the different backbones were either loaded with a combination of 0 ⁇ g aCD3 and 0 ⁇ g aCD28 Fab fragments described above.
  • Tresp cells served as negative control and Tresp cells stimulated with Dynabeads (on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) as positive control.
  • Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37°C with media exchange on day 3 and cell count was analyzed after 1, 3 and 6 days.
  • the results for the CD4+ T responder cells are shown in Fig.8 A, the results for the CD8+ T responder cells are shown in Fig. 8B, with the graphs representing degree of proliferation according to the number of cells harvested per time point for CD4+ Tresp (Fig. 8A) and for CD8+ Tresp in Fig. 8B.
  • CD8+ T cells could be expanded within the first 6 days at least as efficiently as with Dynabeads.
  • the expansion experiment that used the larger soluble reagent that carried aCD3 and aCD28 Fab fragments (as first and second agent) showed the best degree of expansion under these culturing conditions. This might again be caused by the soluble "larger" multimerized agent being able to bind to more T cells at the same time than the "smaller” multimerized agent, thereby being able to stimulate more CD4+ T cells than the "smaller” multimerized agent.
  • EXAMPLE 6 Expansion kinetics of purified CD4+ and CD8+ T cell cultures with or without medium exchange
  • Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL- 2. Cells were incubated at 37°C with media exchange (straight lines in Fig. 9) or without media exchange (dashed lines in Fig. 9) on day 3 and cell count was analyzed after 1, 3 and 6 days.
  • the "smaller" soluble reagent on which aCD3 and aCD28 Fab fragments were reversibly immobilized yielded an about 2.5 fold expansion of CD4+ T cells, while the expansion using Dynabeads yielded an about 1.8 fold expansion rate.
  • Fig. 9B confirms that CD8+ T cells could be expanded using the multimerized agents within the first 3 days at least as efficiently as with Dynabeads.
  • EXAMPLE 7 Expansion kinetics & phenotype of polyclonal activated/expanded bulk CD3+ central memory T cells (Tcm)
  • Tresp cells served as negative control and Tresp cells stimulated with Dynabeads (on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) as positive control. Tresp cells were seeded in 48-well plates in 1ml cell culture medium
  • Fig. 10A only IL-2 supplemented media
  • Fig. 10B IL-2 and IL-15 supplemented media.
  • the soluble reagent that has reversibly bound thereon CD3 Fab fragment and aCD28 Fab fragment yields better cell expansion than the Dynabeads.
  • EXAMPLE 8 Yield and phenotype of expanded CD8+ T cells - size variation of soluble reagent and addition of aCD8-Fab addition for stimulation
  • oligomeric streptavidin mutein reagent backbones were either loaded with a combination of the 0 ⁇ g aCD3 and 0 ⁇ g aCD28 Fab fragments described above to form the multimerized agents.
  • 4.5 ⁇ 1 of the smaller oligomeric streptavidin mutein backbone was loaded with 0 ⁇ g aCD3, 0 ⁇ g aCD8 Fab and 0 ⁇ g aCD28 Fab fragments described above.
  • Tresp cells served as negative control and Tresp stimulated with Dynabeads served as positive control.
  • Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37°C with media exchange after 3 days and analyzed after 6 days.
  • Fig. 11A depicts the degree of proliferation according to the number of cells harvested at day 6 compared to the negative controls and normalized to the positive control.
  • Fig. 11 A shows that the expansion of the CD8+ T cells using the multimerized agents result in higher yields of the CD8+ T cells than expansion using dynabeads.
  • the FACS analysis of CD8 surface expression and CD45RO surface expression Fig.
  • EXAMPLE 9 Yield & phenotype of expanded CD8+ T cells - titration of separate soluble reagents with different ratios of aCD3- and aCD28 Fab fragment immobilized thereon
  • Tresp cells served as negative control and Tresp stimulated with Dynabeads as positive control.
  • Tresp cells were seeded in 48- well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37 °C without media exchange and analyzed after 5 days.
  • Fig. 12A depicts the degree of proliferation according to the number of cells harvested at day 5 compared to the negative controls and normalized to the positive control. Fig.
  • FIG. 12A shows that the expansion of the CD8+ T cells using the various multimerized agents result in higher yields of the CD8+ T cells than expansion using dynabeads (especially the cumulative total reagent amount of the 5x condition resulted in an optimal expansion of cells especially over time/increase in total cells by beginning cell division).
  • EXAMPLE 10 Yield and subset composition of expanded CD3+ T cells with addition of aCD8-Fab for stimulation
  • the experiment shows the expansion of purified CD3+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on the soluble oligomeric streptavidin muteins of Example 3 that served as a soluble reagent.
  • aCD3/aCD28 Fab fragment commercially available from IBA GmbH, Gottingen, Germany (catalogue number 6-8000-203) was immobilized on the soluble oligomeric streptavidin mutein in order to test whether it is possible to preferentially stimulate a specific T cell subpopulation in vitro with the reversible
  • aCD3/aCD28 multimerized agents 500,000 purified CD3+ responder T cells (Tresp) were stimulated with 3 ⁇ 1 of a preparation of oligomeric streptavidin muteins (lmg/ml) loaded with a combination of 0 ⁇ g of the aCD3 and 0 ⁇ g of the aCD28 Fab.
  • Resp purified CD3+ responder T cells
  • oligomeric streptavidin muteins lmg/ml
  • 4.5 ⁇ 1 of the oligomeric streptavidin muteins were loaded with 0 ⁇ g aCD3, 0 ⁇ g strep-tagged aCD8 Fab and 0 ⁇ g strep-tagged aCD28 Fab.
  • Unstimulated Tresp cells served as negative control and Tresp stimulated with Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) served as positive control.
  • the reagent that is reversibly loaded with the aCD3 Fab fragment, the aCD28 Fab fragment and also the aCD8 Fab fragment provided the highest number of expanded CD3+ T cells.
  • lx, lxlO 6 the number of expanded cells the yield was about 30 % higher than for expansion of these T cells using commercially available Dynabeads.
  • Fig. 13 A the reagent that is reversibly loaded with the aCD3 Fab fragment, the aCD28 Fab fragment and also the aCD8 Fab fragment provided the highest number of expanded CD3+ T cells.
  • lx, lxlO 6 the number of expanded cells the yield was about 30 % higher than for expansion of these T cells using commercially available Dynabeads.
  • compositions and methods described herein show the advantage of the compositions and methods described herein that in addition to a first agent that provides a primary activation signal to the desired cell population and optionally a second agent that provides a co-stimulatory signal, a further agent that is specific for the activation of the desired cell population can be immobilized on the reagent.
  • a further agent that is specific for the activation of the desired cell population can be immobilized on the reagent.
  • EXAMPLE 11 Analysis of the differential intracellular calcium mobilization in Jurkat cells
  • Jurkat cells were loaded with the calcium- sensitive dye Indo-l-AM and calcium release was triggered by injection of either aCD3 monoclonal antibody OKT3 (produced by the hybridoma cell line OKT3, see above, black squares) or aCD3 Fab fragments (derived from the parental cell line OKT3) that were multimerized by reversible binding of its streptavidin binding peptide to soluble Strep-Tactin fluorescently conjugated with
  • both the parental antibody OKT3 as well as the multimerized monovalent Fab fragment of OKT3 effected calcium release, meaning that the multimerized monovalent Fab fragment of OKT3 is essentially as functional as the parental antibody.
  • the multimeric OKT3 Fab fragment was not able to trigger calcium release if biotin was added to Strep-tactin on which the OKT3 Fab fragment was immobilized prior to the addition of the Streptactin- OKT3 Fab fragment.
  • the biotin disrupted the reversible bond formed between Strep- tactin as multimerization agent and the OKT3 Fab fragment.
  • the monovalent Fab fragment was therefore displaced from the multimerization agent and after dissociation was not able to trigger calcium release by binding to CD3 of the Jurkat cells.
  • indo-l-AM-labeled Jurkat cells were activated by OKT3 derived aCD3 Fab-Strep-Tactin-complexes as described in Fig. 14A.
  • Injection of intact (upper graph) or pre-dissociated complexes (lower graph) served as positive or negative controls respectively.
  • stimulation of cells with intact Fab-Strep Tactin-complexes followed by subsequent injection of D-biotin resulted in abrupt disruption of aCD3 Fab-multimer signaling (middle graph).
  • Injection of ionomycine into the pre-dissociated Fab complex group served as positive control.
  • Fig. 14B shows that the addition of D-biotin to the sample rapidly displaces the Fab fragment from the Strep-tactin multimerization agent, thereby effectively terminating the calcium release even under ongoing calcium stimulation and demonstrating that the dissociated OKT3 Fab fragment is not any longer biologically active.
  • the multimeric OKT3 Fab fragment was also not able to trigger calcium release when biotin was added to the Strep-tactin-OKT3 Fab fragment multimer prior to the addition of the Streptactin-OKT3 Fab sample to the Jurkat cells.
  • EXAMPLE 12 Reversible staining of cells by CD3 Fab-multimers
  • This Example examines the reversible staining of cells by CD3 Fab-multimers.
  • Freshly isolated PBMCs were stained with either the aCD3 monoclonal antibody clone OKT3 (left dot plot, parental clone for the Fab-multimers) or cognate phycoerythrine (PE)-labeled OKT3 Fab-multimers and analyzed either before (second left column) or after treatment with D- biotin (middle column). Remaining Fab monomers were then detected after subsequent washing steps using fresh PE-labeled Strep-Tactin® (second right column). Secondary Fab-multimer staining of reversibly stained cells served as control (right column). Only live CD3 cells which are negative in staining with propidium iodide (PI) for live/dead discrimination are shown in Fig. 15.
  • PI propidium iodide
  • This Example shows the isolation of cells by reversible binding of anti-CD28 Fab fragments multimerized with Strep-Tactin® magnetic particles (the magnetic particles are available from IB A GmbH Gottingen, Germany).
  • the Fab fragments derived from the antibody CD28.3 described in Example 2 above were used for this purpose.
  • CD28+ cells were
  • EXAMPLE 14 Early cluster formation after activation of purified CD4+ and CD8+ T responder cells stimulated in vitro with reversible aCD3/aCD28 Fab-Streptamer multimers
  • Tresp CD4+ or CD8+ responder T cells
  • Untreated (unstimulated) Tresp cells served as negative control and Tresp cells stimulated with Dynabeads as positive control.
  • Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37°C and microscopically analyzed after 1 and 2 days.
  • EXAMPLE 15 Selective Antigen-specific expansion of Tcm responder cells out of bulk CD3+ central memory T cells (kinetics & phenotype)
  • CD3+CD62L+CD45RA- Tcm responder cells were stimulated in vitro with both a peptide:MHC molecule complex (that acts as first agent that provides a primary activation signal to the cells) and an aCD28 Fab fragment (that acts as second reagent that stimulates an accessory molecule on the surface of the cells).
  • a peptide:MHC molecule complex that acts as first agent that provides a primary activation signal to the cells
  • aCD28 Fab fragment that acts as second reagent that stimulates an accessory molecule on the surface of the cells.
  • Both the complex of antigen specific peptide with the MHC molecule and the aCD28 Fab fragment were reversibly immobilized on the soluble oligomeric streptavidin mutein (with n> 3) described in Example 3.
  • the peptide that was used for the antigen specific expansion was the peptide CRVLCCYVL (SEQ ID NO: 06), amino acids 309-317 of the immediate-early 1 protein (described in Ameres et al, PLOS Pathogens, May 2013, vol. 9, issue 5, el003383) representing an HLA-C7/IE-1 epitope that is specific for cytomegalovirus (CMV).
  • CMV cytomegalovirus
  • the MHC I molecule that presents the peptide carries at the C-terminus of the a chain (heavy chain) the streptavidin binding peptide (SAWSHPQFEK(GGGS) 2 GGSAWSHPQFEK, (SEQ ID NO: 07) that is commercially available as "Twin-Strep-tag®” from IBA GmbH, Gottingen, Germany).
  • SAWSHPQFEK(GGGS) 2 GGSAWSHPQFEK (SEQ ID NO: 07) that is commercially available as "Twin-Strep-tag®” from IBA GmbH, Gottingen, Germany).
  • polyclonal stimulation was performed, using 3 ⁇ 1 of a preparation of Streptactin multimerization reagent (lmg/ml) either loaded with a combination of 0 ⁇ g aCD3 Fab and 0 ⁇ g aCD28 Fab.
  • a preparation of Streptactin multimerization reagent reversibly loaded with 0 ⁇ g aCD3 Fab, 0 ⁇ g aCD8 Fab and 0 ⁇ g aCD28 Fab was used.
  • Tresp cells served as negative control and Tresp cells stimulated polyclonal with Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) as positive control.
  • Tresp cells were seeded in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2 and 5ng/ml IL-15. Cells were incubated at 37°C with media exchange every 3 days and cell count was analyzed after 7 and 14 days.
  • EXAMPLE 16 Selective Ag-specific expansion kinetics & phenotype of bulk central memory T cells
  • This Example examines the kinetics of selective Ag-specific expansion out of purified CD3+CD62L+CD45RA-Tcm responder cells that were stimulated in vitro with a) antigen specific peptide MHC I complexes and b) aCD28 Fab fragments that were reversibly immobilized as first and second agent on soluble oligomeric streptavidin muteins.
  • CD3+CD62L+CD45RA- responder Tern cells were stimulated Ag-specifically using 3 ⁇ 1 of a preparation of Streptactin multimerization reagent functionalized with 0 ⁇ g peptide:MHC class I complexes equipped with a streptavidin binding peptide (the specific peptide represents amino acids 114-124 (CPYSGTAYNSL, SEQ ID NO: 10) of the Hexon 5 protein of adenovirus ) restricted by HLA-B07) and 0 ⁇ g aCD28 Fab.
  • Streptactin multimerization reagent functionalized with 0 ⁇ g peptide:MHC class I complexes equipped with a streptavidin binding peptide (the specific peptide represents amino acids 114-124 (CPYSGTAYNSL, SEQ ID NO: 10) of the Hexon 5 protein of adenovirus ) restricted by HLA-B07) and 0 ⁇ g aCD28 Fab.
  • polyclonal stimulation was performed, using 3 ⁇ 1 of a preparation of Streptactin multimerization reagent (lmg/ml) either loaded with a combination of 0 ⁇ g aCD3 Fab and 0 ⁇ g aCD28 Fab.
  • 4.5 ⁇ 1 of a preparation of Streptactin multimers loaded with 0 ⁇ g aCD3 Fab, 0 ⁇ g aCD8 Fab and 0 ⁇ g aCD28 Fab was used.
  • Tresp cells served as negative control and Tresp cells stimulated polyclonal with Dynabeads as positive control.
  • Tresp cells were seeded in 48- well plates in 1ml cell culture medium supplemented with 30U/ml IL-2 and 5ng/ml IL-15. Cells were incubated at 37°C with media exchange every 3 days and cell count was analyzed after 7 and 14 days.
  • the pictures shown in Fig. 19 represent degree of cluster formation on day 5, exemplary Ag-specific stimulation is illustrated for the HLA-B7/Hexon 5 epitope of adenovirus. As can be seen from Fig. 19, such adenovirus antigen specific cells could be specifically expanded from the original CD3+CD62L+CD45RA-Tcm responder population.
  • EXAMPLE 17 Activation of intracellular signaling cascades after Strep tamer multimers stimulation of aCD19-CAR transduced Jurkat cells
  • ECD of CD 19 equipped with a hexahistidine tag was obtained from Sino Biological/Life technologies (SEQ ID NO: 27) and was functionalized for binding to the streptavidin based multimerization reagent by mixing the ECD of CD 19 with the adapter molecule His-STREPPER (IBA GmbH, Germany, Order number 2-0920-005) at a molecular ratio of 1: 1 and incubating for 15 min at room temperature.
  • the His-STREPPER adapter molecule contains a chelating portion that binds to the hexahistidine tag and a streptavidin binding peptide, thereby temporarily providing the target molecule, here the ECD of CD 19 with a streptavidin binding peptide that can reversibly bind to a streptavidin mutein based
  • the Jurkat cells can be activated/expanded via the binding of the CD 19 extracellular domain to the CD 19 specific chimeric antigen receptor. Since genetic downstream processing of T cells is almost exclusively performed on pre-selected cell populations, a generic activation via cross-linking of introduced CARs via the IgG4 spacer domain (this is conserved within various CARs with different specificities) broadens the applicability for reversible cell stimulation/expansion in these in vitro cell-processing situations.
  • EXAMPLE 18 Parallel Antigen-specific expansion of Tcm responder cells out of a single pool
  • CD3+CD62L+CD45RA- responder Tern cells are simultaneously stimulated for multiple Ag-specificities using for each specificity, 3 ⁇ 1 of Streptactin multimers functionalized with 0 ⁇ g of the respective peptide:MHC class I complexes that carries a streptavidin binding peptide and 0 ⁇ g aCD28 Fab that also carries a streptavidin binding peptide.
  • Streptactin based multimerization reagent functionalized with 0 ⁇ g peptide:MHC class I complexes carrying a streptavidin binding peptide, 0 ⁇ g aCD8 Fab and 0 ⁇ g aCD28 Fab as described here are used for each specificity.
  • polyclonal stimulation is performed, using 3 ⁇ 1 of a preparation of Streptactin based multimerization reagent (lmg/ml) either reversibly loaded with a combination of 0 ⁇ g aCD3 Fab and 0 ⁇ g aCD28 Fab.
  • Tresp cells serve as negative control and Tresp cells stimulated polyclonal with Dynabeads (aCD3- and aCD28- mAb coated beads) as positive control.
  • Tresp cells are seeded in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2 and 5ng/ml IL-15. Cells are incubated at 37°C with media exchange every 3 days and cell count are analyzed after 7 and 14 days.
  • EXAMPLE 19 Preferential proliferation of CD8+ T cells among CD3+ T responder cells stimulated in vitro with streptavidin based multimerization reagents reversibly functionalized with aCD3/aCD8/aCD28 Fab fragments
  • CD3+ responder T cells are stimulated with 3 ⁇ 1 of a preparation of Streptactin multimerization (lmg/ml) or a preparation of a multimerization reagent using the large Streptactin backbone (0.
  • lmg/ml either loaded with a combination of 0 ⁇ g aCD3 and 0 ⁇ g aCD28 Fab, or 4.5 ⁇ 1 of a preparation of Streptactin based multimerization reagent loaded with 0 ⁇ g aCD3, 0 ⁇ g aCD8 Fab and 0 ⁇ g aCD28 Fab, or 3 ⁇ 1 of a mixture of preparations of Streptactin based multimerization reagent with 0 ⁇ g aCD3 Fab alone and 0 ⁇ g aCD28 Fab alone (each Fab fragment again carries a streptavidin binding peptide).
  • Tresp cells serve as negative control and Tresp stimulated with Dynabeads (aCD3- and aCD28- mAb coated beads) as positive control.
  • Tresp cells are seeded in duplicates in 48- well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells are incubated at 37 °C with media exchange after 3 days and analyzed after 6 days.
  • EXAMPLE 20 Preferential proliferation of CD8+ T cells among CD3+ T responder cells stimulated in vitro with streptavidin based multimerization reagents reversibly functionalized with aCD3 and aCD28 Fab fragments
  • CD3+ responder T cells are stimulated with varying amounts of a mixture of preparations of Streptactin based multimerization reagent (lmg/ml) functionalized with aCD3 Fab fragment alone and aCD28 Fab fragment alone (l ⁇ g Streptactin based multimerization reagent functionalized with 0 ⁇ g aCD3 Fab fragment alone and l ⁇ g
  • Tresp cells serve as negative control and Tresp stimulated with Dynabeads (aCD3- and aCD28- mAb coated beads) as positive control.
  • Tresp cells are seeded in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells are incubated at 37°C with media exchange after 3 days and analyzed after 6 days.

Abstract

Provided herein are methods for culturing cells, including stimulating or expanding (proliferating), a plurality of cells in a composition of cells such as a population of lymphocytes. In some aspects, provided methods and reagents for the culturing, such as stimulation or expansion (proliferation), of cell populations involve binding of agents to a molecule on the surface of the cells, thereby providing one or more signals to the cells. In some cases, the reagents are multimerization reagents and the one or more agents are multimerized by reversibly binding to the reagent. In some aspects, the multimerized agent can provide for expansion or proliferation or other stimulation of a population of cells, and then such stimulatory agents can be removed by disruption of the reversible bond. Also provided are compositions, apparatus and methods of use thereof.

Description

METHODS, KITS AND APPARATUS FOR EXPANDING A POPULATION OF
CELLS
Cross-Reference to Related Applications
[0001] This application claims priority from International PCT Appl. No.
PCT/EP2015/058339, filed April 16, 2015, entitled "Methods, Kits and Apparatus for
Expanding a Population of Cells," the contents of which are incorporated by reference in their entirety.
Incorporation By Reference of Sequence Listing
[0002] The present application is being filed with a Sequence Listing in electronic format. The Sequence Listing is provided as a file entitled 735042004040seqlist.txt, created October 22, 2015, which is 35 kilobytes in size. The information in electronic format of the Sequence Listing is incorporated by reference in its entirety.
Field
[0003] The present disclosure relates in some aspects to the incubation or culturing, such as to induce stimulation of expansion (proliferation), activation, costimulation and/or survival, of a composition of cells such as a population of lymphocytes. In some aspects, the disclosure provides methods and reagents for the stimulation, e.g., of expansion (proliferation), survival or persistence, activation, costimulation, or other effect, of cell populations that involve binding of agents to a molecule on the surface of the cells, thereby providing one or more signals to the cells. In some cases, the reagents are reagents containing a plurality of binding sites for agents, such as multimerization reagents, and thus the one or more agents are multimerized by reversibly binding to the reagent, e.g., thereby creating a stimulatory reagent (multimerized agent), having stimulatory agents multimerized thereon. In some aspects, the multimerized agent can provide for expansion or proliferation or other stimulation of a population of cells, and then such stimulatory agents can be removed by disruption of the reversible bond. Also provided are compositions, apparatus and methods of use thereof. Background
[0004] Various strategies are available for stimulating T cell populations in vitro, including for expanding antigen- specific T cells in vitro for use in adoptive cellular immunotherapy or cancer therapy in which infusions of such T cells have been shown to have anti-tumor reactivity in a tumor-bearing host or for use to treat viral infections. Improved strategies are needed for expanding cell populations in vitro, including for research, diagnostic and therapeutic purposes. Provided are reagents, methods, articles of manufacture and kits that meet such needs.
Brief Description of the Drawings
[0005] Figure 1 provides schematic representations of exemplary embodiments.
[0006] Figure 1A shows a schematic representation of a reagent (or representative portion thereof) with a plurality of binding sites for reversible binding to agents. In this case, the reagent is shown as capable of reversibly binding to two agents, each of which is capable of specifically binding to a molecule on a cell. The reagent has a plurality of binding sites, including a plurality of the binding site, Zl, each capable of reversibly binding to the agents. The first and second agents, which, in some cases, can be the same, in the schematic
representation shown each contain at least one binding partner CI. Binding partner CI reversibly binds to binding site Zl. The first and second agents each also contain a binding site, B2, which can specifically bind to a molecule on the surface of a cell, which, in some cases, can be on the same cell. Here, the first and second agents are shown specifically binding to molecules on the same cell.
[0007] Figure IB shows a schematic representation of a reagent with a plurality of binding sites, capable of reversibly binding to a first and second agent, which agents are each capable of specifically binding to a molecule on a first and second cell, respectively. The reagent has a plurality of binding sites Zl, each capable of reversibly binding to an agent. The first and second agents, which, in some cases, can be the same, each contain a binding partner CI, which reversibly binds to binding site Zl. The first and second agents each contain a binding site B2, which can specifically bind to a molecule on the surface of a cell, which, in some cases, can be on the same cell or a different cell. Here, the first agent is bound to a molecule on the surface of a first cell and the second agent is bound to a molecule on the surface of a second cell.
[0008] Figure 1C shows a reagent capable of reversibly binding to a first and second agents, which agents are each capable of specifically binding to a molecule on a first and second cell, respectively. The reagent has a plurality of binding sites Zl and Z2, which can be the same or different, each capable of reversibly binding to one or both of the agents. The first agent contains a binding partner CI, which reversibly binds to Zl; the second agent contains a binding partner C2, which can reversibly bind to Z2. In some cases, CI and C2 are different. In some cases, CI and C2 are the same or substantially the same. The first agent contains a binding site Bl, which can specifically bind to a molecule on the surface of a cell and the second agent contains at least one binding site B3, which can specifically bind to a molecule on the surface of a cell. Binding sites Bl and B3 in some cases bind to two different cell surface molecules, or different epitopes on a single molecule, or the same or different molecules on the surface of different cells. Here, the first agent is shown as being bound, via Bl, to a molecule on the surface of a first cell, and the second agent is bound to a molecule on the surface of a second cell.
[0009] Figure ID shows a reagent capable of reversibly binding to a first and second agent, such as selection agents, which are each capable of specifically binding to a molecule on a cell. The reagent has a plurality of binding sites, including Zl and Z2, which can be the same or different, each capable of reversibly binding to an agent. The first agent contains a binding partner CI that can specifically bind to binding site Zl and the second agent contains at least one binding partner C2 that can specifically bind to binding site Z2. In some cases, CI and C2 are different. In some cases, CI and C2 are the same or substantially the same. The first agent contains a binding site Bl, which can specifically bind to a molecule on the surface of a cell and the second agent contains a binding site B3, which can specifically bind to a molecule on the surface of a cell. In some embodiments, the first agent and second agent can be a selection agent. Binding sites Bland B3 can bind the same or different molecules (e.g. receptor) on the surface of a cell, the same or different epitopes on a molecule, or the same or different molecules on the surface of different cells. Here, the first agent is bound to a first molecule on the surface of a cell and the second agent is bound to a second molecule on the surface of the same cell.
[0010] Figure IE shows a reagent reversibly bound to a first and second agent, which agents are each capable of specifically binding to a molecule on a cell. The reagent has a plurality of binding sites, including Zl and Z2, which can be the same or different, each capable of reversibly binding to an agent. The first agent contains a binding partner CI that can reversibly bind to Zl of the reagent and the second agent contains a binding partner C2 that can reversibly bind to Z2. In some cases, CI and C2 are different. In some cases, CI and C2 are the same or substantially the same. The first agent contains at least one binding site B2, which can specifically bind to a molecule on the surface of a cell and the second agent contains at least one binding site B4, which can specifically bind to a molecule on the surface of a cell. In some embodiments, the first agent and second agent can be stimulatory agents. Binding sites B2 and B4 can bind the same or different molecules on the surface of a cell, the same or different epitopes on a molecule, or the same or different molecules on the surface of different cells. Here, the first agent is bound to a first molecule on the surface of a cell and the second agent is bound to a second molecule on the surface of the same cell.
[0011] Figure 2, which includes Figures 2A-2E, provide schematic representations of exemplary embodiments as shown in Figures 1A-1E, respectively, except that the depicted reagents are shown as being immobilized on a support, such as a stationary phase.
[0012] Figure 3 provides a schematic representation of exemplary embodiments in which oligomeric reagents are used to multimerize stimulatory agents and the resulting complexes incubated with cells to deliver signals to the cells, followed by reversal of the binding. Panel A shows an oligomeric reagent 1, which is shown as not bound to any support and as being flexible. Stimulatory agents 2, which are shown here as Fab fragments and are capable of specifically binding to a molecule on the surface of a cell, are combined with the reagent. The agents comprise a binding partner (e.g. binding partner C) that is capable of reversibly binding to a binding site (e.g. binding site Z) on the reagent, multimerizing the agents. Panel B depicts the binding partner reversibly binding to a binding site on the reagent. Cells 3 are added to the system. Panel C depicts the multimerized agents (Fab fragments) specifically binding to the molecules 4 on the surface of a cell 3. In Panel C, the depicted agents are stimulatory receptor- binding agents, (e.g. a first receptor-binding agent and/or a second receptor-binding agent), which can induce or modulate a signal in a cell upon binding of the agent, to the molecule on the cell. As shown in panel D, a substance 5, such as a competitive reagent (e.g. biotin), is added to the composition, which can be a substance that exhibits a higher binding affinity for the binding site on the reagent than for the binding partner on the agent, thereby disrupting the reversible binding between the reagent 1 and the agent 2. In some cases, the agent, e.g., Fab fragment also can dissociate from its interaction with the molecule 4 on the cell 3. In some cases, this can disrupt, lessen and/or terminate the signaling in the cell.
[0013] Figure 4 provides a schematic representation of exemplary embodiments of a reversible system attached to a support, such as a solid support or a surface, including a stationary phase. Panel A shows a support 6 containing the reagent 1. Agents 2, such as Fab fragments, that are capable of specifically binding to a molecule on the surface of a cell are added to the system. The agents 2, such as Fab fragments, comprise a binding partner (e.g. binding partner C) that is capable of reversibly binding to a binding site (e.g. binding site Z) on the reagent. Panel B depicts the binding partner reversibly binding to a binding site on the reagent. Cells 3 are added to the system. Panel C depicts the agents 2, e.g. Fab fragments, binding to the molecules 4 on the surface of a cell 3. In some embodiments, the scFvs comprise a receptor-binding agent or a selection agent. In some embodiments, the agents, e.g. Fab fragments, can be a receptor-binding agent or a selection agent. Panel C depicts an exemplary receptor-binding agent or agents (e.g. a first receptor-binding agent and/or a second receptor- binding agent), which can induce or modulate a signal in a cell upon binding of the agent, e.g. Fab fragment, to the molecule on the cell. A substance 5, such as a competitive reagent (e.g. biotin), is added, which can be a substance that exhibits a higher binding affinity for the binding site on the reagent than for the binding partner on the agent, e.g. Fab fragment, thereby disrupting binding between the reagent and the agent. Panel D depicts disruption of the binding between the agent 2, e.g. Fab fragment, and the reagent, thereby resulting in dissociation of the reagent from the agent, and thereby the cell. In some cases, the agent, e.g. Fab fragment, also can dissociate from its interaction with the molecule 4 on the cell 3. In some cases, this can disrupt, lessen and/or terminate the signaling in the cell.
[0014] Figure 5 shows the results of an experiment in which CD3+ T responder cells were proliferated after being stimulated in vitro with aCD3 and aCD28 Fab fragments that were reversibly immobilized on beads coated with the streptavidin mutein Strep-tactin®. Fig. 5 A is a histogram showing size-distribution (forward scatter) of stimulated cells, Fig. 5B depicts histograms representing the degree of proliferation according to the number of cells per cell division that are indicated on top of Fig. 5B (0 represents undivided cells; 5 represents cells that have gone through at least 5 divisions), and Fig. 5C shows a picture of the culture dish after 4 days of stimulation.
[0015] Figure 6 shows the results of an experiment in which CD3+ T responder cells were proliferated after being stimulated in vitro with reversible aCD3/aCD28 Fab fragments that were reversibly immobilized on soluble oligomeric streptavidin mutein acting a soluble reagent. For the experiments the results of which are shown in Fig. 6, 300,000 CD3+ responder T cells (Tresp) were labeled with 2μΜ Carboxyfluorescein succinimidyl ester (CFSE) and stimulated with varying amounts of a preparation of soluble oligomeric streptavidin mutein on which a combination of aCD3 Fab fragment and aCD28 Fab both carrying a Strep-tag as streptavidin binding peptide at the heavy chain were immobilized, ("lx" corresponds to 3μg oligomeric streptavidin mutein functionalized with O^g aCD3- and O^g aCD28 Fab; numbers indicate fold amount of "lx"). Tresp cells either left unstimulated or were stimulated with blank oligomeric streptavidin muteins (no Fab) served as negative control. Tresp cells were seeded in duplicates in 48-well plates along with 300,000 CD3 negative autologous feeder cells (irradiated with 30Gy) in 1ml cell culture medium supplemented with 20U/ml interleukin 2 (IL-2). Cells were incubated at 37 °C without media exchange and proliferation was analyzed according to CFSE dilution after 5 days by FACS analysis (Fig. 6B). Fig. 6A shows size distribution of cells after 5 days in culture. Histograms show live CD3+ cells, while Fig. 6C shows cells after culture that were liberated by stimulation reagents after treated with ImM D-biotin and washed. The dissociation and removal of monomeric Fab fragments was analyzed by restaining with oligomeric streptavidin mutein labeled with phycoerythrine (ST-PE) as a fluorescent label and a representative histogram is shown. Fig. 6D shows the absolute number of live (trypan blue negative) cells after 5 days was counted using a Neubauer counting chamber and plotted against the respective stimulation condition. Median cell numbers are shown in Fig. 6D; error bars indicate standard deviation (SD). Fig. 6E shows a picture of the culture dish after 5 days of stimulation.
[0016] Figure 7 shows the expansion kinetics of proliferation of purified CD4+ and CD8+ T responder cells (Tresp) that were stimulated in vitro either with aCD3/aCD28 Fab fragments or with aCD3/aCD28/aCD8 that were reversibly immobilized on two kinds of a soluble oligomeric streptavidin mutein acting as soluble reagent. The first kind of oligomeric streptavidin mutein was the fraction of the oligomeric streptavidin mutein (n> 3) obtained in Example 3 (also referred herein as "conventional" or "smaller" oligomeric streptavidin mutein backbone, illustrated by the triangle symbol with the tip down in Fig. 7), the second kind of this oligomeric streptavidin mutein used as soluble reagent was an oligomer that was obtained by reacting the soluble oligomeric streptavidin mutein with biotinylated human serum albumin (HSA). This HSA based soluble reagent is also referred herein as "larger" oligomeric streptavidin mutein backbone). In the experiments of Fig. 7 the expansion was carried out without medium exchange. The results for the CD4+ T responder cells are shown in Fig.7A, the results for the CD8+ T responder cells are shown in Fig. 7B. In this context, it is noted that the experimentally used soluble reagents that were functionalized by reversibly binding first agents, and optionally second and third agents are referred to in the Figures as "Streptamer® multimers."
[0017] Figure 8 shows the expansion kinetics of proliferation of purified CD4+ and CD8+ T responder cells (Tresp) that were stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized fragments that were reversibly immobilized with two kinds of soluble oligomeric streptavidin mutein acting as soluble reagent. The first kind of oligomeric Strep- tactin® was the fraction of the oligomeric streptavidin mutein (n> 3) obtained in Example 3 (also referred herein as "conventional oligomeric streptavidin mutein backbone", illustrated by the triangle symbol with the tip on top in Fig. 8), the second kind of this oligomeric streptavidin mutein used as soluble reagent was the HSA based soluble reagent, the above-mentioned "large backbone"). In the experiments of Fig. 8 the expansion was carried out with medium exchange. The results for the CD4+ T responder cells are shown in Fig. 8A, the results for the CD8+ T responder cells are shown in Fig. 8B.
[0018] Figure 9 shows the combined data from the results obtained in Figs 7 and 8 for the expansion kinetics of proliferation of purified CD4+ and CD8+ T responder cells, with Fig. 9A depicting the results for CD4+ T cells and Fig. 9B depicting the results for the CD8+ T cells. Straight lines are used for the culturing with medium exchange on day 3, while dashed lines depict the values obtained for the degree of expansion without media exchange on day 3. The data shown in Fig. 9 are normalized on the input cell number. Only data for the Tresp stimulated with the oligomeric streptavidin mutein (n> 3), the Tresp stimulated with the commercially available Dynabeads (positive control) and the unstimulated T cells (negative control) are shown but no data on the reagent with the "large backbone".
[0019] Figure 10 shows the expansion kinetics and phenotype of CD3+ central memory T cells (Tern) (CD3+CD62L+CD45RA-Tcm) polyclonally stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on the soluble oligomeric streptavidin mutein (with n> 3) described in Example 3. The graphs shown in Fig. 10 represent the degree of proliferation according to the number of cells harvested per time point, with Fig. 10A showing the proliferation in only IL-2 supplemented media and in Fig. 10B showing the proliferation in IL-2 and IL-15 supplemented media. Fig. IOC shows a flow-cytometric analysis of CD62L and CD 127 surface expression after 14 days of culture in these variable cytokine milieus.
[0020] Figure 11 shows the yield and phenotype of expansion of purified CD8+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on two kinds of soluble oligomeric streptavidin muteins acting a soluble reagent. The first kind of oligomeric streptavidin mutein was the fraction of the oligomeric streptavidin mutein (obtained in Example 3 (conventional backbone), the second kind of this oligomeric streptavidin mutein used as soluble reagent was the soluble oligomer described above and referred herein as "large" backbone. In these experiments, the fraction of the oligomeric conventional streptavidin mutein (n> 3) was also used as a reagent that were either functionalized with single Fab fragments (third bar in Fig. 11 A and Fig. 1 IB) or with a combination of aCD3 and aCD28 Fab-fragments.
Furthermore to the combined stimulation with aCD3/aCD28 Fab fragments, also an additional aCD8 Fab fragment (commercially available from IBA GmbH, Gottingen, Germany) was immobilized in order to test whether it is possible to preferentially stimulate a specific T cell subpopulation. Fig. 11 A shows a graph of bars that represent the degree of proliferation according to the number of cells harvested at day 6 compared to the negative controls
(unstimulated purified CD8+ T responder cells) and normalized to the positive control (purified CD8+ T responder stimulated with commercially available Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized). Fig. 11B shows flow- cytometric analysis of the surface expression of CD8 and the T cell surface molecule CD45RO (that is indicative of T cell proliferation and activation) after cell culture. The various stimulating conditions were compared using one-way ANOVA and no significant difference (n.s.) was detected.
[0021] Figure 12 shows the yield and phenotype for the expansion of purified CD8+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on soluble oligomeric streptavidin mutein acting as a soluble reagent that were either functionalized with single Fab fragments or with a combination of Fab-fragments (as already described above). In these experiments, the CD8+ T responder cells were stimulated with the soluble reagent (the soluble oligomeric streptavidin mutein (lmg/ml) of Example 3) which was functionalized with varying amounts of aCD3 and aCD28 Fab fragments, optionally together with the aCD8 Fab fragment described above. The term "lx" corresponds to l^g oligomeric streptavidin mutein functionalized with O^g aCD3 Fab fragment alone and l^g oligomeric streptavidin mutein functionalized with O^g aCD28 Fab alone), or 3μ1 of a preparation of oligomeric streptavidin mutein loaded with O^g aCD3 Fab fragment and O^g aCD28 Fab, or 4.5μ1 of a preparation of oligomeric streptavidin mutein loaded with O^g strep- tagged aCD3, O^g strep-tagged aCD8 and O^g strep-tagged aCD28 Fab. Accordingly, the term "2x" corresponds to 3.0 μg oligomeric streptavidin mutein functionalized with ^g aCD3 Fab fragment alone and 3.0 μg oligomeric streptavidin mutein functionalized with ^g aCD28 Fab alone, meaning that twice the amount of immobilized aCD3 Fab fragment was used.
Untreated Tresp cells served as negative control and purified CD8+ T responder stimulated with commercially available Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) as positive control. Fig. 12A shows a graph in which the bars represent the degree of proliferation according to the number of cells harvested at day 5 compared to the negative controls and normalized to the positive control. Fig. 12B shows FACS analysis of CD8 and CD45RO surface expression after cell culture.
[0022] Figure 13 shows the expansion of purified CD3+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on the soluble oligomeric streptavidin mutein of Example 3 that served as a soluble reagent. In one experiment, in addition to aCD3/aCD28 Fab fragments, also an aCD8 Fab fragment commercially available from IBA GmbH, Gottingen, Germany (catalogue number 6-8000-203) was immobilized on the soluble oligomer of the streptavidin mutein in order to test whether it is possible to preferentially stimulate in vitro the CD8+ T cell subpopulation within the bulk CD3+ culture with a reagent having reversibly immobilized thereon also an aCD8 Fab fragment. In more detail, 500,000 purified CD3+ responder T cells (Tresp) were stimulated with 3μ1 of a preparation of oligomeric streptavidin mutein (lmg/ml) loaded with a combination of 0^g of the aCD3 and 0^g of the aCD28 Fab. As an alternative approach, 4.5μ1 of the oligomeric streptavidin mutein were loaded with 0^g aCD3, 0^g aCD8 Fab and 0^g aCD28 Fab described above. Unstimulated Tresp cells served as negative control and Tresp stimulated with Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) served as positive control.
[0023] Figure 14 shows the results of the differential intracellular calcium mobilization in Jurkat cells that are either labelled with the aCD3 antibody OKT3 or with Fab fragments of OKT3 being multimerized with Strep-tactin® (also referred to as Fab multimers herein). Fig. 14A: Jurkat cells were loaded with the calcium- sensitive dye Indo-l-AM and calcium release was triggered by injection of either aCD3 mAb (black squares) or aCD3 OKT3 Fab multimers (derived from the parental cell line OKT3) with or without prior D-biotin disruption (dark grey triangles and light grey circles respectively) compared to injection of PBS (inverted white triangles). Application of ionomycine served as positive control. Time-resolved changes in intracellular Ca2+ concentration were monitored by flow-cytometry based on the change in FL6/FL7 ratio. Fig. 14B: Indo-l-AM-labeled Jurkat cells were activated by different aCD3 stimuli as described in Example 11; OKT3: upper graph and aCD3 Fab-multimer: middle graph) followed by subsequent (t=140s) D-biotin mediated disruption of aCD3 Fab-multimer signaling. Injection of PBS (lower graph) and ionomycine served as negative or positive control. Data are representative of three different experiments.
[0024] Figure 15 shows the result of the reversible staining of cells by anti CD3 OKT3 Fab- multimers. Freshly isolated PBMCs were stained with either a monoclonal antibody (left dot plot, parental clone for the Fab-multimers) or cognate PE-labeled Fab-multimers and analyzed either before (second left column) or after treatment with D-biotin (middle column). Remaining Fab monomers were then detected after subsequent washing steps using fresh PE-labeled Strep- Tactin® (second right column). Secondary Fab-multimer staining of reversibly stained cells served as control (right column). Only live (pine atlve) cells are shown. Numbers in dot plots indicate the percentage of cells within gates.
[0025] Figure 16 shows the isolation of cells by reversible binding of anti-CD28 Fab fragments multimerized with Strep-Tactin® labeled with phycoerythrine as a fluorescent label. CD28+ cells were selected/isolation by Fab-multimer magnetic cell selection from freshly isolated PMBCs as described in International Patent Application WO2013/011011. Before selection cells were control stained with either the cognate fluorescent aCD28-multimers (left dot plot) or with an antibody directed against the immunoglobulin kappa light chain (second left dot plot, a-Ig kappa mAb). After selection, cells were treated with D-biotin and subsequently washed to remove magnetic beads and Fab-monomers. Liberated CD28+ cells were
subsequently (re-)stained either with CD28 Fab-multimers (second right dot plot) or with the a- Ig kappa mAb (right dot plot) to detect potentially remaining Fab-monomers. Only live
(PInegatlve) CD3+ cells are shown. Numbers in dot plots indicate the percentage of cells within gates.
[0026] Figure 17 shows early cluster formation of T cells after activation of purified CD4+ and CD8+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on the soluble oligomeric streptavidin mutein (n> 3) described in Example 3. Fig. 17A depicts the results for CD4+ T cells and Fig. 17B depicts the results for the CD8+ T cells. Data for the Tresp stimulated with the soluble multimerization reagent (the oligomeric streptavidin mutein), the Tresp stimulated with the commercially available
Dynabeads (positive control) and the unstimulated T cells (negative control) are shown. [0027] Figure 18 shows the kinetics of selective antigen- specific (Ag- specific) expansion out of a bulk population of purified CD3+CD62L+CD45RA- Tcm responder cells that were stimulated in vitro with both a peptide:MHC molecule complex (that acts as first agent that provides a primary activation signal to the cells) and aCD28 Fab fragment (that acts as second agent that binds the accessory molecule on the surface of the cells) and unstimulated T cells (negative control) are shown. Both, the complex of antigen- specific peptide with the MHC molecule and the aCD28 Fab fragment were reversibly immobilized on the same soluble oligomeric streptavidin mutein (with n> 3) described in Example 3. The peptide used for the antigen-specific expansion in Fig. 18A was the peptide CRVLCCYVL (SEQ ID NO: 54), amino acids 309-317 of the immediate-early 1 protein restricted by the HLA-C702 MHC molecule (described in Ameres et al, PLOS Pathogens, May 2013, vol. 9, issue 5, el003383) representing an HLA-C7/IE-1 epitope that is specific for cytomegalovirus (CMV). The MHC I molecule that presents the peptide carries at its C-terminus of the heavy chain the streptavidin binding peptide (S AWSHPQFEK(GGGS )2GGS AWSHPQFEK (SEQ ID NO: 16), that is commercially available as "Twin-Strep-tag®" from IB A GmbH, Gottingen, Germany). Fig. 18A shows exemplary flow- cytometric analysis for the fraction of the Ag- specific cells that were proliferated using the peptide:MHC-I complex specific for this HLA-C7/IE-1 epitope as first agent that provides a primary activation signal to the cells reversibly immobilized on the soluble oligomeric streptavidin mutein. The graphs in Fig.l8B to Fig.l8E illustrates the expansion kinetics of further Ag- specificities according to the number of specific peptide:MHCI multimer-positive cells harvested per time point in analogy to Fig. 18A using distinct complexes of an antigen- specific peptide with the MHC I molecule as first agent that provides a primary activation signal to the cells reversibly immobilized on the soluble oligomeric streptavidin mutein. In more detail, Fig. 18B shows the expansion of Ag-specific cells that were expanded using the peptide:MHC-I complex specific for the pp65 epitope of CMV (amino acids 341-350 (QYDPVAALF) (SEQ ID NO: 55) restricted by HLA-A2402), Fig. 18C shows the expansion of Ag-specific cells that were expanded using another peptide:MHC-I complex specific for the pp65 epitope of CMV (amino acids 265-274 (RPHERNGFTV) (SEQ ID NO: 56) restricted by HLA-B702), Fig. 18D shows the expansion of Ag-specific cells that were proliferated using the peptide:MHC-I complex specific for the hexon 5 epitope of adenovirus (amino acids 114-124
(CPYSGTAYNSL)(SEQ ID NO: 57) restricted by HLA-B702), Fig. 18E shows the expansion of Ag-specific cells that were proliferated using the peptide:MHC-I complex specific for the HLA-B7/IE-l3o9-3i7 epitope of CMV (exemplary FACS data see above Fig. 18A). All peptide:MHC molecules bearing the Twin Strep®-Tag are commercially available from
IbaGmbH. In this context, the amino acid sequences of the HLA-A*2402, HLA-B*0702 and HLA-C*0702 molecules that carry the "Twin-Strep-tag®" as their C-terminus are shown as SEQ ID NO: 58, 59 and 60 in the accompanying Sequence Listings, while the amino acid sequence of the β2 microglobulin (which forms together with the a chain, that means the HLA encoded molecules the respective MHC I molecule) is shown as SEQ ID NO: 61 in the accompanying Sequence Listing. In addition, Fig. 18F shows exemplary flow-cytometric analysis of CD62L and CD 127 surface expression after 14 days of culture for HLA- B7/Hexon5114-124 stimulated/expanded cells from Fig. 18D.
[0028] Figure 19 shows the kinetics of selective Ag-specific expansion out of purified CD3+CD62L+CD45RA-Tcm responder cells that were stimulated in vitro with a) antigen specific peptide MHC I complexes and b) aCD28 Fab fragments that were reversibly
immobilized as first and second agent on soluble oligomeric streptavidin muteins. For this purpose 500.000 CD3+CD62L+CD45RA- responder Tern cells (Tresp) were stimulated Ag- specifically using 3μ1 of a preparation of Streptactin multimerization reagent functionalized with 0^g peptide:MHC class I complexes equipped with a streptavidin binding peptide (the specific peptide represents amino acids 114-124 (CPYSGTAYNSL, SEQ ID NO: 57) of the Hexon 5 protein of the adenovirus restricted by HLA-B0702, see above) and 0^g aCD28 Fab. As an alternative, 4.5μ1 of a preparation of Streptactin multimerization reagent loaded with 0^g this peptide:MHC class I complex, 0^g aCD8 Fab and 0^g aCD28 Fab. For comparison, polyclonal stimulation was performed, using 3μ1 of a preparation of Streptactin multimerization reagent (lmg/ml) either loaded with a combination of 0^g aCD3 Fab and 0^g aCD28 Fab. Again as the alternative stimulation condition described above, 4.5μ1 of a preparation of Streptactin multimers loaded with 0^g aCD3 Fab, 0^g aCD8 Fab and 0^g aCD28 Fab was used. Untreated (unstimulated) Tresp cells served as negative control and Tresp cells stimulated polyclonal with Dynabeads as positive control. Tresp cells were seeded in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2 and 5ng/ml IL-15. Cells were incubated at 37 °C with media exchange every 3 days and cell count was analyzed after 7 and 14 days. The photographs shown in Fig. 19 represent the degree of cluster formation on day 5 for Ag-specific stimulation as exemplified for the HLA-B7/Hexon 5 epitope of adenovirus. [0029] Figure 20 shows the activation of intracellular signaling cascades of transduced Jurkat cells that have been modified to express an aCD19 chimeric antigen receptor (CAR), and that were stimulated using the oligomeric Strep-tactin® of Example 3 as soluble multimerization reagent. The specificity of a CAR is typically derived from a scFv region assembled from the antigen-binding region of a monoclonal antibody (mAb) that specifically binds a target/tumor associated antigen such as CD 19 and links it to T cell specific signaling (described in Hudecek et al, Clin Cancer Res. 2013 June 15; 19(12): 3153-3164. In the experiments the extracellular domain (ECD) of CD 19, which contains the natural ligand of the ccCD19 CAR as well as the polyclonal algG F(ab)2 fragment that recognizes the IgG4 spacer (donkey- anti-human F(ab)2 is commercially available from Jackson Immuno Research) within the aCD19-CAR were also used in this experiment as first agent that provides a primary activation signal to the jurkat cells. The reversibly immobilization to the soluble oligomeric streptavidin mutein was provided by the streptavidin peptide SAWSHPQFEK(GGGS)2GGSAWSHPQFEK (SEQ ID NO: 16) that was fused to the C-terminus of the ECD of CD 19 or by the biotinylated (Fab)2 fragment of the algG (since the streptavidin mutein "m2" binds biotin with reduced affinity, this binding is reversible and can for example be displaced by addition of an excess of free biotin). In the control experiment of Fig.20A 300.000 CD3+ Jurkat responder cells (Jresp) were stimulated with varying amounts of a mixture of preparations of oligomeric Streptactin (lmg/ml) that was functionalized with the aCD3 Fab and the aCD28 Fab („xl" corresponds to 3μg multimerized Streptactin functionalized with 0^g aCD3- and 0^g aCD28 Fab - polyclonal Streptamer multimer). In the experiment of Fig. 20B 3μ1 of a preparation of the oligomeric Streptactin was functionalized with 0^g (xl) or ^g (x2) of the extracellular domain (ECD) of CD19 or with 3μ1 of a preparation of the oligomeric Streptactin loaded with 0^g (xl) or Ιμξ (x2) algG that recognizes the IgG4 spacer (which are both CAR- specific Streptamer® multimers). Jresp stimulated with Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) or PMA and ionomycin served as positive controls. Jresp cells were seeded in 1.5ml Eppendorf tubes in 200μ1 cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37°C and put on ice and lysed after 0 min to 20min of stimulation.
Detailed Description
[0030] Unless defined otherwise, all terms of art, notations and other technical and scientific terms or terminology used herein are intended to have the same meaning as is commonly understood by one of ordinary skill in the art to which the claimed subject matter pertains. In some cases, terms with commonly understood meanings are defined herein for clarity and/or for ready reference, and the inclusion of such definitions herein should not necessarily be construed to represent a substantial difference over what is generally understood in the art.
[0031] All publications, including patent documents, scientific articles and databases, referred to in this application are incorporated by reference in their entirety for all purposes to the same extent as if each individual publication were individually incorporated by reference. If a definition set forth herein is contrary to or otherwise inconsistent with a definition set forth in the patents, applications, published applications and other publications that are herein
incorporated by reference, the definition set forth herein prevails over the definition that is incorporated herein by reference. For example, the contents of International PCT Application No. PCT/EP2015/058339 is incorporated by reference in its entirety.
[0032] The section headings used herein are for organizational purposes only and are not to be construed as limiting the subject matter described.
I. OVERVIEW
[0033] Provided herein is a method for expanded a composition of target cells, such as T cells. In some embodiments, the methods relates to reversible reagent systems capable of binding to molecules on the surface of a target cells, such as a receptor binding molecule, thereby providing a signal to the cells, which, in some cases, can be a primary activation signal. In some embodiments, the methods employ reagents, which can be multimerization reagent having bound thereon one or more agents, e.g. a first agent, second agent, etc. that provides a signal to the cells, such as a primary activation signal and/or an accessory or costimulatory signal. In some embodiments, the primary activation signal may as such be sufficient to activate the cells to expand/proliferate. This first agent can either be bound reversibly or also irreversibly to the multimerization reagent. The multimerization reagent may have bound thereto also a second agent that stimulates an accessory molecule on the surface of the cells. The second agent, when binding to the accessory molecule on the surface on the surface of the cells, may thereby stimulate the activated cells to expand. Also this second agent can either be bound reversibly or also irreversibly to the multimerization reagent. The multimerization agent may either be immobilized on a solid support or soluble. In one aspect, the method disclosed herein is a serial expansion of a population of cells in which a complete population of lymphocytes is stimulated/expanded, the reagents necessary for the expansion are then removed by chromatography on a suitable stationary phase. In some embodiments, the expanded/stimulated cells, which are the cultured cells, are optionally transfected with e.g. a T cell receptor or a chimeric antigen receptor (CAR) and, in some aspects, can be subjected to a second stimulation expansion with a different stimulatory molecule that binds to the introduced T cell receptor or the chimeric antigen receptor.
[0034] Methods of expanding T cell populations in vitro in the absence of exogenous growth factors or low amounts of exogenous growth factors are known in the art (see e.g. US Patent 6,352,694 Bl and European Patent EP 0 700 430 Bl). In general, such methods employ a solid phase surfaces of greater than 1 μΜ to which various bind agents (e.g. anti-CD3 antibody and/or anti-CD28 antibody) are immobilized. For example, Dynabeads® CD3/CD28 (Invitrogen) are commercially available reagents for T cell expansion, which are uniform, 4.5 μιη
superparamagnetic, sterile, non-pyrogenic polystyrene beads coated with a mixture of affinity purified monoclonal antibodies against the CD3 and CD28 cell surface molecules on human T cells. However, in some cases, such magnetic beads are, for example, difficult to integrate into a method to expand cells under conditions required for clinical trials or therapeutic purposes since it has to be made sure that these magnetic beads are completely removed before administering the expanded T cells to a patient.
[0035] In some embodiments, the methods provided herein address these concerns. In some aspects, the provided reagents are reversible, such that the stimulating agents can be removed from the cell composition. Also, in some aspects, the reagent, e.g. multimerization reagent, to which the stimulating agents are bound is not immobilized on a support, such as not
immobilized on a solid support or surface. Thus, in some aspects, the reagent, e.g.
multimerization reagent, is flexible and not rigid. In some embodiments, the reagent can adapt or conform to the cell surface. In some embodiments, it is possible to immobilize the reagent on a support, such as a solid support, including a stationary phase. In some embodiments, such methods can be used in concert with selection methods using similar selection agents in which one or more target cells can be selected and, simultaneously or sequentially, exposed to the stimulatory agents. Hence, in some aspects, the stimulation of particular cells or subsets of cells can be biased by selection and isolation in together with stimulation.
[0036] In some embodiments, the provided methods involve culturing, e.g. contacting, a composition of cells with a reagent, e.g. multimerization reagent to which is bound one or more receptor-binding agents (e.g. stimulatory agents) (see e.g. Figure 4A and B). In some
embodiments, after contacting the cell composition with the multimerization reagent and usually incubating the cell population with the multimerization reagent, the population of cells forms complexes/is bound to the multimerization agent via the first agent. The other cell populations contained in the initial sample that lack the specific cell surface molecule do not bind to the multimerization reagent. In this respect, it is noted that the cell population usually has multiple copies of the cell surface molecule on its surface and binding of these multiple copies is typically needed for stimulation or activation.
[0037] Thus, the multimerization agent provide typically more than one binding site, e.g. Zl, in which, in some cases, a plurality of agents can be reversibly bound to present the first agent, second agent and/or other agents in a sufficient density to the population of cells. In this respect, it is noted that a multimerization agent can as such have multiple binding sites, e.g., Zl, for example, a streptavidin mutein (being a homo-tetramer) in its native state has four such binding sites, e.g. Zl, and can further be oligomerized. In some cases, a reagent may have only one binding site, e.g. Zl, for the reversible binding of a binding partner, e.g. CI. Such an example is multimeric calmodulin. Calmodulin as such has only one binding site for calmodulin binding peptides. However, calmodulin can be biotinylated and then reacted with streptavidin- oligomers (see also below), thereby providing a multimerization reagent in which multiple calmodulin molecules are presented in high density on a "scaffold", thereby providing multimeric calmodulin.
[0038] In some embodiments, after incubation or other suitable time at which stimulation is desired to be disrupted, the binding between the binding partner C, e.g. CI of a reversibly bound agent and the binding site Z, e.g. Zl, of the multimerization reagent is disrupted by disrupting the respective reversible bond. In some cases, the disruption may be achieved by adding a competitor to the incubation/reaction mixture containing the population of cells being bound to the multimerization reagent. For competitive disruption (which can be understood as being a competitive elution) of the reversible bond between the binding partner C, e.g.Cl, of a reversibly bound agent and the binding site Z, e.g. Zl of the multimerization reagent, the incubation mixture/population of cells can be contacted with a free first binding partner C, e.g. CI, or an analog of said first binding partner C that is capable of disrupting the bond between the first binding partner and the binding site Z, e.g. Zl. In the example of the binding partner C, e.g. CI, being a streptavidin binding peptide that binds to biotin binding site of streptavidin, the first free partner may be the corresponding free streptavidin binding peptide or an analogue that binds competitively. Such an analogue can, for example, be biotin or a biotin derivate such as desthiobiotin.
[0039] In some embodiments, the addition of the free partner or the analog thereof results in displacement of the binding partner C, e.g.Cl, from the multimerization reagent and thus, since the binding partner is comprised in the reversibly bound agent, displacement of such agent from the multimerization reagent is achieved. This displacement of the agent in turn results in a dissociation of the first agent from the cell surface molecule, in particular if the binding affinity of the bond between the first agent and the cell surface receptor has a dissociation constant (¾) in the range of 10 -"2 M to 10 -"13 M and is thus also reversible. Due to this dissociation, in some aspects, the stimulation of the cell population is also terminated.
[0040] In some embodiments, the binding affinity of antibody molecules towards their antigen, including for example, a cell surface receptor molecule is usually in the affinity range of the Kd of 10 -"7 M to 10 -"13 M. Thus, conventional monoclonal antibodies can be used as an agent (first or second, receptor-binding, e.g. stimulatory agent, or selection agent). In some embodiments, in order to avoid any unwanted avidity effects that lead to a stronger binding, monoclonal antibodies can also be used in form of their monovalent antibody fragments such as Fab-fragments or single chain Fv fragments.
[0041] In some embodiments, due to the dissociation of the reversibly bound agent or agents from the cell surface molecule, the provided method has the added advantage that the stimulated cell population is free of stimulating agents at the end of the stimulation period. Also, in some embodiments, all other reagents used in the method, namely the agents (e.g. first or second, receptor-binding agents, e.g. stimulatory agents, or selection agents) as well as the competition reagent of the binding partner C, e.g. CI, or the analog thereof can be easily removed from the stimulated cell population via a "removal cartridge" (see e.g. described in International patent application WO 2013/124474). In some cases, for example in which the multimerization reagent is immobilized on a solid support, such as a bioreactor surface or a magnetic bead, it is being held back. Thus, the use of a removal cartridge for removal of the free agent and the competition reagent, can include loading the elution sample (e.g. sample obtained after disruption of the reversible binding) onto a second chromatography column.
[0042] In some embodiments, this chromatography column has a suitable stationary phase that is both an affinity chromatography matrix and, at the same time, can act as gel permeation matrix. In some aspects, this affinity chromatography matrix has an affinity reagent immobilized thereon. In some embodiments, the affinity reagent may, for instance, be streptavidin, a streptavidin mutein, avidin, an avidin mutein or a mixture thereof. In some embodiments the agent (e.g. first or second, receptor-binding agents, e.g. stimulatory agents, or selection agents), the competition reagent of the binding partner C, CI, bind to the affinity reagent, thereby being immobilized on the chromatography matrix. As a result the elution sample containing the isolated and expanded cell population is being depleted of the agent (e.g. first or second, receptor-binding agents, e.g. stimulatory agents, or selection agents) and the competition reagent. In some embodiments, the cultured composition is free of any reactants, which in some aspects is an advantageous for use in connection with diagnostic applications (for example, further FACS™ sorting) or for any cell based therapeutic application.
[0043] In some embodiments, the ability to remove the reagent and other components form the composition has the further advantage of being able to avoid any solid support such as magnetic beads. In some embodiments, this means there is no risk or minimal risk of contamination of the activated T cells by such magnetic beads. In some embodiments, this also means that a process that is compliant with GMP standards can be more easily established compared to other methods, such as the use of Dynabeads® in which additional measures have to be taken to ensure that the final expanded T cell population is free of magnetic beads.
Furthermore, in some embodiments, the use of a soluble multimerization agent makes it much easier to remove the same from the activated cell population (T cells, B cells or also natural killer cells) since the cells can be simple sedimented by centrifugation and the supernatant, including the soluble multimerization agent can be discarded. Alternatively, the soluble multimerization agent can be removed from the expanded cell population in a gel permeations matrix of the removal cartridge, such as described above (e.g. International patent application WO 2013/124474). In some embodiments, since no solid phase (e.g. magnetic beads) are present, the present invention also provides for an automated closed system for expansion of the cells that can be integrated into known cell expansion systems such as the Xuri Cell Expansion System W25 and WAVE Bioreactor 2/10 System, available from GE Healthcare (Little Chalfont, Buckinghamshire, United Kingdom) or the Quantum® Cell Expansion System, available from TerumoBCT Inc. (Lakewood, CO, USA).
[0044] In some aspects, the methods provided herein can include a population of cells that carry at least two specific cell surface molecules. In some embodiments, a first cell surface molecule is involved in a primary activation signal to the cell population, while the second cell surface molecule is an accessory molecule on the cell surface that is involved in providing a stimulus to the cells. In some embodiments, the cell population is contacted with a
multimerization reagent in which is reversibly bound a first agent that provides a primary activation signal to the cells and a second agent that induces or modulates an additional signal, such as stimulates an accessory molecule on the surface of the cells. The population of cells may, for example, be a T cell population in which the cell surface molecule is a TCR/CD3 complex and the cell surface molecule is the accessory molecule CD28. In some aspects, stimulation through such other accessory molecules can result in an increase in a less- differentiated, and, in some cases, a long-lived population T cells such as long-lived memory T cells as compared to conventional stimulation through CD28. In some embodiments, binding of both the TCR/CD3 complex as the primary activation signal and binding of the accessory molecule (e.g. CD28 or other accessory molecule) can be necessary for expansion/proliferation of T cells.
[0045] In some embodiments, the methods provided herein also can be further combined to include at least one selection agent reversibly bound to the same reagent, e.g. same
multimerization reagent, as either or both of the first or second receptor-binding agent (e.g. stimulatory agent). In some cases, it is possible to enhance or increase one or more features resulting from the incubation or culture, such as stimulation of expansion (proliferation), activation, costimulation, and/or survival, in a subset of T cells which can be reversibly selected in the presence of the at least one or more selection agent in an incubation or culture that occurs also in the presence of the one or more stimulatory agents . For example, as shown in examples herein, the degree of expansion in a composition of T cells was selectively increased in CD8+ cells when such cells were incubated with a multimerized agent to which was reversibly bound an anti-CD8 antibody in addition to the anti-CD3 antibody and anti-CD28 antibody stimulatory agents. In some embodiments, one or more features resulting from the incubation or culture, such as stimulation of expansion (proliferation), activation, costimulation, and/or survival, can be increased at least 1.5-fold, at least 2.0-fold, at least 3.0-fold, at least 4.0-fold, at least 5.0-fold, at least 6.0-fold, at least 7.0-fold, at least 8.0-fold, at least 9.0-fold, at least 10-fold or more in a subset of T cell in the cultured composition that are positive for a selection marker when incubated in the presence of the one or more stimulatory agents and the selection agent that specifically binds to the selection marker compared to the incubation only in the presence of the one of more stimulatory agents but not the selection agent. This biasing or selectivity of cell, such as T cell, features permits one to control the end points features of specific subsets or populations of T cells. In some embodiments, the selection marker can be any selection marker as described herein. In some embodiments, the selection marker is selected from among CD25, CD28, CD62L, CCR7, CD27, CD 127, CD3, CD4, CD8, CD45RA, and/or CD45RO
[0046] In some embodiments, the multimerization reagent comprises at least one binding site Z, e.g. Zl, for the reversible binding of the first agent and the first agent also comprises at least one binding partner C, e.g. CI, wherein the binding partner C, e.g. CI, is able of reversibly binding to the binding site Z, e.g. Zl, of the multimerization reagent. Thus, the first agent, when contacted or incubated with the multimerization agent, can be reversibly bound to the multimerization reagent via the reversible bond formed between the binding partner C, e.g. CI, and the binding site Z, e.g. Zl. In addition, the second agent can comprises a binding partner C, e.g. C2, wherein the binding partner C2 is able of being reversibly bound to a binding site Z, e.g. Z2, respectively, of the multimerization reagent. In some embodiments, the second agent, when it is contacted or incubated with the multimerization agent, is reversibly bound to the
multimerization reagent via the reversible bond formed between the binding partner C, e.g. CI and the binding site Z, e.g. Z2. In some cases, CI and C2 can be the same or substantially the same and/or comprise the same or substantially the same moiety. In some cases, Zl and Z2 can be the same or substantially the same and/or comprise the same or substantially the same moiety.
[0047] In some embodiments, using as binding partners CI and C2, moieties that bind to the same binding site of the multimerization agent has the advantage that the same competition reagent (of the first binding partner CI and also of the second binding partner C2) or analog thereof can be used to disrupt, and in some cases terminate, the expansion of the population of target cells (e.g. T cells) and to release this population of target cells (e.g. T cells) from the multimerization agent.
[0048] In some cases for producing the binding agents (e.g. e.g. first or second, receptor- binding agents, e.g. stimulatory agents, or selection agents) to comprise a binding partner C, the binding partner C, e.g. CI or C2, can be provided by the respective expression vector used for the recombinant production of the agent (e.g. antibody fragment) so that the binding partner C, e.g. CI or C2, is part of a fusion peptide with the agent at either the N-terminus or C-terminus. In some embodiments, in the context of an agent that is an antibody or antigen-binding fragment, the binding partner C, e.g. CI or C2, can be present at the C-terminus of either the light or the heavy chain. Also this methodology of cloning a recombinant protein, such as the variable domains of an antibody molecule, and recombinantly producing a respective protein, e.g. antibody fragment, is well known to the person skilled in the art, see for example, Skerra, A. (1994). In some embodiments, an antibody molecule can be generated of artificial binding molecules with antibody like properties against a given target, such as CD3 or CD28 or other accessory or stimulatory agent molecules as described, such as by well-known evolutive methods such as phage display (reviewed, e.g., in Kay, B.K. et al. (1996) Phage Display of Peptides and Proteins - A Laboratory Manual, 1st Ed., Academic Press, New York NY;
Lowman, H.B. (1997) Annu. Rev. Biophys. Biomol. Struct. 26, 401-424, or Rodi, D.J., and Makowski, L. (1999) Curr. Opin. Biotechnol. 10, 87-93), ribosome display (reviewed in Amstutz, P. et al. (2001) Curr. Opin. Biotechnol. 12, 400-405) or mRNA display as reported in Wilson, D.S. et al. (2001) Proc. Natl. Acad. Sci. USA 98, 3750-3755.
II. Reversible Reagent Systems and Related Uses
[0049] In some embodiments, the methods employ reversible systems in which at least one agent (e.g., a receptor-binding agent or selection agent) capable of binding to a molecule on the surface of a cell (cell surface molecule), is reversibly associated with a reagent. In some cases, the reagent contains a plurality of binding sites capable of reversibly binding to the agent (e.g., receptor-binding agent or selection agent). In some cases, the reagent is a multimerization reagent. In some embodiments, the at least one agent (e.g., receptor-binding agent or selection agent) contains at least one binding site B that can specifically bind an epitope or region of the molecule and also contains a binding partner C that specifically binds to at least one binding site Z of the reagent. In some cases, the binding interaction between the binding partner C and the at least one binding site Z is a non-covalent interaction. In some embodiments, the binding interaction, such as non-covalent interaction, between the binding partner C and the at least one binding site Z is reversible.
[0050] In some embodiments, the reversible association can be mediated in the presence of a substance, such as a competition reagent (also called an eluent reagent), that is or contains a binding site that also is able to bind to the at least one binding site Z. Generally, the substance (e.g. competition reagent) can act as a competitor due to a higher binding affinity for the binding site Z present in the reagent and/or due to being present at higher concentrations than the binding partner C, thereby detaching and/or dissociating the binding partner C from the reagent. In some embodiments, the affinity of the substance (e.g. competition reagent) for the at least one binding site Z is greater than the affinity of the binding partner C of the agent (e.g., receptor- binding agent or selection agent) for the at least one binding site Z. Thus, in some cases, the bond between the binding site Z of the reagent and the binding partner C of the agent (e.g., receptor-binding agent or selection agent) can be disrupted by addition of the substance (e.g. competition reagent), thereby rendering the association of the agent (e.g., receptor-binding agent or selection agent) and reagent reversible.
[0051] Reagents that can be used in such reversible systems are described and known in the art, see e.g., U.S. Patent Nos. 5,168,049; 5,506,121; 6,103,493; 7,776,562; 7,981,632;
8,298,782; 8,735,540; 9,023,604; and International published PCT Appl. Nos. WO2013/124474 and WO2014/076277. Non-limiting examples of reagents and binding partners capable of forming a reversible interaction, as well as substances (e.g. competition reagents) capable of reversing such binding, are described below.
A. Reagent
[0052] In some embodiments, the reagent contains one or a plurality of binding sites Z that are capable of reversibly binding to a binding partners C comprised by the agent (e.g., receptor- binding agent or selection agent). In some embodiments, the reagent contains a plurality of binding sites Z, which each are able to specifically bind to the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent), such that the reagent is capable of reversibly binding to a plurality of agents (e.g., receptor-binding agent or selection agent), e.g., is a multimerization reagent. In some embodiments, the reagent is an oligomer or polymer of individual molecules (e.g. monomers) or complexes that make up an individual molecule (e.g. tetramer), each containing at least one binding site Z. In some embodiments, the reagent contains at least two binding sites Z, at least three binding sites Z, at least four binding sites Z, such as at least 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 68, 72 or more binding sites Z. The binding sites can all be the same or the plurality of binding sites can contain one or more different binding sites (e.g., Zl, Z2, Z3, etc.).
[0053] In some embodiments, two or more agents (e.g., receptor-binding agents or selection agents) associate with, such as are reversibly bound to, the reagent, such as via the one or plurality of binding sites Z present on the reagent. In some cases, this results in the agents (e.g., receptor-binding agents or selection agents) being closely arranged to each other such that an avidity effect can take place if a target cell having (at least two copies of) a cell surface molecule is brought into contact with the agent (e.g., receptor-binding agent or selection agent) that has one or more binding sites B able to bind the particular molecule.
[0054] In some embodiments, two or more different agents (e.g., receptor-binding agents or selection agents) that are the same, i.e. containing the same binding site B, can be reversibly bound to the reagent. In some embodiments, it is possible to use at least two different (kinds of) agents (e.g., receptor-binding agents or selection agents), and in some cases, three or four different (kinds of) agents, e.g. two or more different receptor-binding agents and/or selection agent. For example, in some embodiments, the reagent can be reversibly bound to a first agent (e.g., receptor-binding agent or selection agent) containing a binding site B l, B2, B3 or B4, etc. and a second agent (e.g., receptor-binding agent or selection agent) containing another binding site, e.g. another of a binding site Bl, B2, B3 or B4. In some cases, the binding site of the first agent and the second agent can be the same. For example, in some aspects, each of the at least two agents (e.g. receptor-binding agent or selection agent) can bind to the same molecule. In some cases, the binding site of the first agent and the second agent can be different. In some aspects, each of the at least two agents (e.g. receptor-binding agent or selection agent) can bind to a different molecule, such as a first molecule, second molecule and so on. In some cases, the different molecules, such as cell surface molecules, can be present on the same target cell. In other cases, the different molecules, such as cell surface molecules, can be present on different target cells that are present in the same population of cells. In some case, a third, fourth and so on agent (e.g., receptor-binding agent or selection agent) can be associated with the same reagent, each containing a further different binding site.
[0055] In some embodiments, the two or more different agents (e.g., receptor-binding agents or selection agents) contain the same binding partner C. In some embodiments, the two or more different agents (e.g., receptor-binding agents or selection agents) contain different binding partners. In some aspects, a first agent (e.g., receptor-binding agent or selection agent) can have a binding partner CI that can specifically bind to a binding site Zl present on the reagent and a second agent (e.g., receptor-binding agents or selection agent) can have a binding partner C2 that can specifically bind to the binding site Zl or to a binding site Z2 present on the reagent. Thus, in some instances, the plurality of binding sites Z comprised by the reagent includes binding sites Zl and Z2, which are capable of reversibly binding to binding partners CI and C2, respectively, comprised by the agent (e.g., receptor-binding agent or selection agent). In some embodiments, CI and C2 are the same, and/or Zl and Z2 are the same. In other aspects, one or more of the plurality of binding sites Z can be different. In other instances, one or more of the plurality of binding partners C may be different. It is within a level of a skilled artisan to choose any combination of different binding partners C that are compatible with a reagent containing the binding sites Z, as long as each of the binding partners C are able to interact, such as specifically bind, with one of the binding sites Z.
[0056] In some embodiments, the reagent is a streptavidin, a streptavidin mutein or analog, avidin, an avidin mutein or analog (such as neutravidin) or a mixture thereof, in which such reagent contains one or more binding sites Z for reversible association with a binding partner C. In some embodiments, the binding partner C can be a biotin, a biotin derivative or analog, or a streptavidin-binding peptide or other molecule that is able to specifically bind to streptavidin, a streptavidin mutein or analog, avidin or an avidin mutein or analog. In some embodiments, the reagent is or contains streptavidin, avidin, an analog or mutein of streptavidin, or an analog or mutein or avidin that reversibly binds biotin, a biotin analog or a biologically active fragment thereof. In some embodiments, the reagent is or contains an analog or mutein of streptavidin or an analog or mutein of avidin that reversibly binds a streptavidin-binding peptide. In some embodiments, the substance (e.g. competitive reagent) can be a biotin, a biotin derivative or analog or a streptavidin-binding peptide capable of competing for binding with the binding partner C for the one or more binding sites Z. In some embodiments, the binding partner C and the substance (e.g. competitive reagent) are different, and the substance (e.g. competitive reagent) exhibits a higher binding affinity for the one or more binding sites Z compared to the affinity of the binding partner.
[0057] In some embodiments, the streptavidin can be wild-type streptavidin, streptavidin muteins or analogs, such as streptavidin-like polypeptides. Likewise, avidin, in some aspects, includes wild-type avidin or muteins or analogs of avidin such as neutravidin, a deglycosylated avidin with modified arginines that typically exhibits a more neutral pi and is available as an alternative to native avidin. Generally, deglycosylated, neutral forms of avidin include those commercially available forms such as "Extravidin", available through Sigma Aldrich, or "NeutrAvidin" available from Thermo Scientific or Invitrogen, for example.
[0058] In some embodiments, the reagent is a streptavidin or a streptavidin mutein or analog. In some embodiments, wild-type streptavidin (wt- streptavidin) has the amino acid sequence disclosed by Argarana et al, Nucleic Acids Res. 14 (1986) 1871-1882 (SEQ ID NO: 1). In general, streptavidin naturally occurs as a tetramer of four identical subunits, i.e. it is a homo-tetramer, where each subunit contains a single binding site for biotin, a biotin derivative or analog or a biotin mimic. An exemplary sequence of a streptavidin subunit is the sequence of amino acids set forth in SEQ ID NO: 1, but such a sequence also can include a sequence present in homologs thereof from other Streptomyces species. In particular, each subunit of streptavidin may exhibit a strong binding affinity for biotin with a dissociation constant (¾) on the order of about 10"14 M. In some cases, streptavidin can exist as a monovalent tetramer in which only one of the four binding sites is functional (Howarth et al. (2006) Nat. Methods, 3:267-73; Zhang et al. (2015) Biochem. Biophys. Res. Commun., 463: 1059-63)), a divalent tetramer in which two of the four binding sites are functional (Fairhead et al. (2013) J. Mol. Biol., 426: 199-214), or can be present in monomeric or dimeric form (Wu et al. (2005) J. Biol. Chem., 280:23225-31; Lim et al. (2010) Biochemistry, 50:8682-91).
[0059] In some embodiments, streptavidin may be in any form, such as wild-type or unmodified streptavidin, such as a streptavidin from a Streptomyces species or a functionally active fragment thereof that includes at least one functional subunit containing a binding site for biotin, a biotin derivative or analog or a biotin mimic, such as generally contains at least one functional subunit of a wild-type streptavidin from Streptomyces avidinii set forth in SEQ ID NO: 1 or a functionally active fragment thereof. For example, in some embodiments, streptavidin can include a fragment of wild-type streptavidin, which is shortened at the N- and/or C-terminus. Such minimal streptavidins include any that begin N-terminally in the region of amino acid positions 10 to 16 of SEQ ID NO: 1 and terminate C-terminally in the region of amino acid positions 133 to 142 of SEQ ID NO: 1. In some embodiments, a functionally active fragment of streptavidin contains the sequence of amino acids set forth in SEQ ID NO: 2. In some embodiments, streptavidin, such as set forth in SEQ ID NO: 2, can further contain an N- terminal methionine at a position corresponding to Alal3 with numbering set forth in SEQ ID NO: 1. Reference to the position of residues in streptavidin or streptavidin muteins is with reference to numbering of residues in SEQ ID NO: 1.
[0060] In some aspects, streptavidin muteins include polypeptides that are distinguished from the sequence of an unmodified or wild-type streptavidin by one or more amino acid substitutions, deletions, or additions, but that include at least one functional subunit containing a binding site for biotin, a biotin derivative or analog or a streptavidin-binding peptide. In some aspects, streptavidin-like polypeptides and streptavidin muteins can be polypeptides which essentially are immunologically equivalent to wild-type streptavidin and are in particular capable of binding biotin, biotin derivatives or biotin analogues with the same or different affinity as wt- strep tavidin. In some cases, streptavidin-like polypeptides or streptavidin muteins may contain amino acids which are not part of wild-type streptavidin or they may include only a part of wild-type streptavidin. In some embodiments, streptavidin-like polypeptides are polypeptides which are not identical to wild-type streptavidin, since the host does not have the enzymes which are required in order to transform the host-produced polypeptide into the structure of wild-type streptavidin. In some embodiments, streptavidin also may be present as streptavidin tetramers and streptavidin dimers, in particular streptavidin homotetramers, streptavidin homodimers, streptavidin heterotetramers and streptavidin heterodimers. Generally, each subunit normally has a binding site for biotin or biotin analogues or for streptavidin- binding peptides. Examples of streptavidins or streptavidin muteins are mentioned, for example, in WO 86/02077, DE 19641876 Al, US 6,022,951, WO 98/40396 or WO 96/24606.
[0061] In some embodiments, a streptavidin mutein can contain amino acids that are not part of an unmodified or wild-type streptavidin or can include only a part of a wild-type or unmodified streptavidin. In some embodiments, a streptavidin mutein contains at least one subunit that can have one more amino acid substitutions (replacements) compared to a subunit of an unmodified or wild-type streptavidin, such as compared to the wild-type streptavidin subunit set forth in SEQ ID NO: 1 or a functionally active fragment thereof, e.g. set forth in SEQ ID NO: 2. In some embodiments, at least one subunit of a streptavidin mutein can have at least 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19 or 20 amino acid differences compared to a wild-type or unmodified streptavidin and/or contains at least one subunit that comprising an amino acid sequence that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the sequence of amino acids set forth in SEQ ID NO: 1 or 2, where such streptavidin mutein exhibits functional activity to bind biotin, a biotin derivative or analog or biotin mimic. In some embodiments, the amino acid replacements (substitutions) are conservative or non-conservative mutations.
Examples of streptavidin muteins are known in the art, see e.g., U.S. Pat. No. 5,168,049;
5,506,121; 6,022,951; 6,156,493; 6,165,750; 6,103,493; or 6,368,813; or International published PCT App. No. WO2014/076277.
[0062] In some embodiments, streptavidin or a streptavidin mutein includes proteins containing one or more than one functional subunit containing one or more binding sites Z for biotin, a biotin derivative or analog or a streptavidin-binding peptide, such as two or more, three or more, four or more, and, in some cases, 5, 6, 7, 8, 9, 10, 11, 12 or more functional subunits. In some embodiments, streptavidin or streptavidin mutein can include a monomer; a dimer, including a heterodimer or a homodimer; a tetramer, including a homotetramer, a
heterotetramer, a monovalent tetramer or a divalent tetramer; or can include higher ordered multimers or oligomers thereof.
[0063] In some embodiments, the binding affinity of streptavidin or a streptavidin mutein for a peptide ligand binding partner is less than 1 x 10"4 M, 5 x 10"4 M, 1 x 10"5 M, 5x 10"5 M, 1 x 10" 6 M, 5 x 10"6 M or 1 x 10"7 M, but generally greater than 1 x 10"13 M, 1 x 10"12 M or 1 x 10"11 M. For example, peptide sequences (Strep-tags), such as disclosed in U.S. Pat. No. 5,506,121, can act as biotin mimics and demonstrate a binding affinity for streptavidin, e.g., with a ¾ of approximately between 10"4 and 10"5. In some cases, the binding affinity can be further improved by making a mutation within the streptavidin molecule, see e.g. U.S. Pat. No.
6,103,493 or International published PCT App. No. WO2014/076277. In some embodiments, binding affinity can be determined by methods known in the art, such as any described below.
[0064] In some embodiments, the reagent, such as a streptavidin or streptavidin mutein, exhibits binding affinity for a peptide ligand binding partner, which peptide ligand binding partner can be the binding partner C present in the agent (e.g., receptor-binding agent or selection agent). In some embodiments, the peptide sequence contains a sequence with the general formula set forth in SEQ ID NO: 9, such as contains the sequence set forth in SEQ ID NO: 10. In some embodiments, the peptide sequence has the general formula set forth in SEQ ID NO: 11, such as set forth in SEQ ID NO: 12. In one example, the peptide sequence is Trp- Arg-His-Pro-Gln-Phe-Gly-Gly (also called Strep-tag®, set forth in SEQ ID NO: 7). In one example, the peptide sequence is Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (also called Strep-tag® II, set forth in SEQ ID NO: 8). In some embodiments, the peptide ligand contains a sequential arrangement of at least two streptavidin-binding modules, wherein the distance between the two modules is at least 0 and not greater than 50 amino acids, wherein one binding module has 3 to 8 amino acids and contains at least the sequence His-Pro-Xaa (SEQ ID NO: 9), where Xaa is glutamine, asparagine, or methionine, and wherein the other binding module has the same or different streptavidin peptide ligand, such as set forth in SEQ ID NO: 11 (see e.g. International Published PCT Appl. No. WO02/077018; U.S. Patent No. 7,981,632). In some embodiments, the peptide ligand contains a sequence having the formula set forth in any of SEQ ID NO: 13 or 14. In some embodiments, the peptide ligand has the sequence of amino acids set forth in any of SEQ ID NOS: 15-19. In most cases, all these streptavidin binding peptides bind to the same binding site, namely the biotin binding site of streptavidin. If one or more of such streptavidin binding peptides is used as binding partners C, e.g. CI and C2, the multimerization reagent is typically a streptavidin mutein.
[0065] In some embodiments, the reagent is or contains a streptavidin mutein. In some embodiments, the streptavidin muteins contain one or more mutations (e.g. amino acid replacements) compared to wild-type streptavidin set forth in SEQ ID NO: 1 or a biologically active portion thereof. For example, biologically active portions of streptavidin can include streptavidin variants that are shortened at the N- and/or the C-terminus, which in some cases is called a minimal streptavidin. In some embodiments, an N-terminally shortened minimal streptavidin, to which any of the mutations can be made, begins N-terminally in the region of the amino acid positions 10 to 16 and terminates C-terminally in the region of the amino acid positions 133 to 142 compared to the sequence set forth in SEQ ID NO: 1. In some
embodiments, an N-terminally shortened streptavidin, to which any of the mutations can be made, contains the amino acid sequence set forth in SEQ ID NO: 2. In some embodiments, the minimal streptavidin contains an amino acid sequence from position Alal3 to Serl39 and optionally has an N-terminal methionine residue instead of Alal3. For purposes herein, the numbering of amino acid positions refers throughout to the numbering of wt- streptavidin set forth in SEQ ID NO: 1 ( e.g. Argarana et al., Nucleic Acids Res. 14 (1986), 1871 -1882, cf. also Fig. 3).
[0066] In some embodiments, the streptavidin mutein is a mutant as described in U.S. Pat. No. 6,103,493. In some embodiments, the streptavidin mutein contains at least one mutation within the region of amino acid positions 44 to 53, based on the amino acid sequence of wild- type streptavidin, such as set forth in SEQ ID NO: 1. In some embodiments, the streptavidin mutein contains a mutation at one or more residues 44, 45, 46, and/or 47. In some
embodiments, the streptavidin mutein contains a replacement of Glu at position 44 of wild-type streptavidin with a hydrophobic aliphatic amino acid, e.g. Val, Ala, lie or Leu, any amino acid at position 45, an aliphatic amino acid, such as a hydrophobic aliphatic amino acid at position 46 and/or a replacement of Val at position 47 with a basic amino acid, e.g. Arg or Lys, such as generally Arg. In some embodiments, Ala is at position 46 and/or Arg is at position 47 and/or Val or He is at position 44. In some embodiments, the streptavidin mutant contains residues Val44-Thr45-Ala46-Arg47, such as set forth in exemplary streptavidin muteins containing the sequence of amino acids set forth in SEQ ID NO: 3 or SEQ ID NO: 4 (also known as streptavidin mutant 1, SAM1). In some embodiments, the streptavidin mutein contains residues Ile44-Gly45-Ala46-Arg47, such as set forth in exemplary streptavidin muteins containing the sequence of amino acids set forth in SEQ ID NO: 5 or 6 (also known as SAM2). In some cases, such streptavidin mutein are described, for example, in US patent 6,103,493, and are
commercially available under the trademark Strep-Tactin®.
[0067] In some embodiment, the streptavidin mutein is a mutant as described in
International Published PCT Appl. Nos. WO 2014/076277. In some embodiments, the streptavidin mutein contains at least two cysteine residues in the region of amino acid positions 44 to 53 with reference to amino acid positions set forth in SEQ ID NO: 1. In some
embodiments, the cysteine residues are present at positions 45 and 52 to create a disulfide bridge connecting these amino acids. In such an embodiment, amino acid 44 is typically glycine or alanine and amino acid 46 is typically alanine or glycine and amino acid 47 is typically arginine. In some embodiments, the streptavidin mutein contains at least one mutation or amino acid difference in the region of amino acids residues 115 to 121 with reference to amino acid positions set forth in SEQ ID NO: 1. In some embodiments, the streptavidin mutein contains at least one mutation at amino acid position 117, 120 and 121 and/or a deletion of amino acids 118 and 119 and substitution of at least amino acid position 121.
[0068] In some embodiments, the streptavidin mutein contains a mutation at a position corresponding to position 117, which mutation can be to a large hydrophobic residue like Trp, Tyr or Phe or a charged residue like Glu, Asp or Arg or a hydrophilic residue like Asn or Gin, or, in some cases, the hydrophobic residues Leu, Met or Ala, or the polar residues Thr, Ser or His. In some embodiments, the mutation at position 117 is combined with a mutation at a position corresponding to position 120, which mutation can be to a small residue like Ser or Ala or Gly, and a mutation at a position corresponding to position 121, which mutation can be to a hydrophobic residue, such as a bulky hydrophobic residue like Trp, Tyr or Phe. In some embodiments, the mutation at position 117 is combined with a mutation at a position
corresponding to position 120 of wildtype streptavidin set forth in SEQ ID NO: l or a
biologically active fragment thereof, which mutation can be a hydrophobic residue such as Leu, He, Met, or Val or, generally, Tyr or Phe, and a mutation at a position corresponding to position 121 compared to positions of wildtype streptavidin set forth in SEQ ID NO: 1 or a biologically active fragment thereof, which mutation can be to a small residue like Gly, Ala, or Ser, or with Gin, or with a hydrophobic residue like Leu, Val, He, Trp, Tyr, Phe, or Met. In some
embodiments, such muteins also can contain residues Val44-Thr45-Ala46-Arg47 or residues Ile44-Gly45-Ala46-Arg47. In some embodiments, the streptavidin mutein contains the residues Val44, Thr45, Ala46, Arg47, Glul l7, Glyl20 and Tyrl21. In some embodiments, the mutein streptavidin contains the sequence of amino acids set forth in SEQ ID NO:27 or SEQ ID NO:28, or a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the sequence of amino acids set forth in SEQ ID NO: 27 or SEQ ID NO: 28, contains the residues Val44, Thr45, Ala46, Arg47, Glul 17, Glyl20 and Tyr 121 and exhibits functional activity to bind to biotin, a biotin analog or a strep tavidin-binding peptide.
[0069] In some embodiments, a streptavidin mutein can contain any of the above mutations in any combination, and the resulting streptavidin mutein may exhibit a binding affinity that is less than 2.7 x 10"4 M for the peptide ligand (Trp Arg His Pro Gin Phe Gly Gly; also called Strep-tag®, set forth in SEQ ID NO: 7) and/or less than 1.4 x 10"4 M for the peptide ligand (Trp Ser His Pro Gin Phe Glu Lys; also called Strep-tag® II, set forth in SEQ ID NO: 8) and/or is less than 1 x 10"4 M, 5 x 10"4 M, 1 x 10"5 M, 5x 10"5 M, 1 x 10"6 M, 5 x 10"6 M or 1 x 10"7 M, but generally greater than 1 x 10 -"13 M, 1 x 10 -"12 M or 1 x 10 -"11 M for any of the peptide ligands set forth in any of SEQ ID NOS:7-19.
[0070] In some embodiments, the streptavidin mutein exhibits the sequence of amino acids set forth in any of SEQ ID NOs: 3-6, 27 or 28, or a sequence of amino acids that exhibits at least 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to the sequence of amino acids set forth in any of SEQ ID NO: 3-6, 27 or 28, and exhibits a binding affinity that is less than 2.7 x 10"4 M for the peptide ligand (Trp Arg His Pro Gin Phe Gly Gly; also called Strep-tag®, set forth in SEQ ID NO: 7) and/or less than 1.4 x 10"4 M for the peptide ligand (Trp Ser His Pro Gin Phe Glu Lys; also called Strep-tag® II, set forth in SEQ ID NO: 8) and/or is less than 1 x 10"4 M, 5 x 10"4 M, 1 x 10"5 M, 5x 10"5 M, 1 x 10"6 M, 5 x 10"6 M or 1 x 10" 7 M, but generally greater than 1 x 10"13 M, 1 x 10"12 M or 1 x 10"11 M for any of the peptide ligands set forth in any of SEQ ID NOS:7-19.
[0071] In some embodiments, the streptavidin mutein also exhibits binding to other streptavidin ligands, such as but not limited to, biotin, iminobiotin, lipoic acid, desthiobiotin, diaminobiotin, HABA (hydroxyazobenzene-benzoic acid) and/or dimethyl-HABA. In some embodiments, the streptavidin mutein exhibits a binding affinity for another streptavidin ligand, such as biotin or desthiobiotin, that is greater than the binding affinity of the streptavidin mutein for a biotin mimic peptide ligand, such as set forth in any of SEQ ID NOS: 7-19. Thus, in some embodiments, biotin or a biotin analog or derivative (e.g. desthiobiotin) can be employed as a competition reagent in the provided methods. For example, as an example, the interaction of a mutein streptavidin designated Strep-tactin® (e.g. containing the sequence set forth in SEQ ID NO: 4) with the peptide ligand designated Strep-tag® II (e.g. set forth in SEQ ID NO: 8) is characterized by a binding affinity with a K<j of approximately 10~6 M compared to
approximately 10 -"13 M for the bitoin- streptavidin interaction. In some cases, biotin, which can bind with high affinity to the Strep-tactin® with a ¾ of between or between about 10~10 and 10~13 M, can compete with Strep-tag® II for the binding site.
[0072] In some cases, the reagent contains at least two chelating groups K that may be capable of binding to a transition metal ion. In some embodiments, the reagent may be capable of binding to an oligohistidine affinity tag, a glutathione-S-transferase, calmodulin or an analog thereof, calmodulin binding peptide (CBP), a FLAG-peptide, an HA-tag, maltose binding protein (MBP), an HSV epitope, a myc epitope, and/or a biotinylated carrier protein.
[0073] In some embodiments, the reagent is an oligomer or polymer. In some embodiments, the oligomer or polymer can be generated by linking directly or indirectly individual molecules of the protein as it exists naturally, either by linking directly or indirectly individual molecules of a monomer or a complex of subunits that make up an individual molecule (e.g. linking directly or indirectly dimers, trimers, tetramers, etc. of a protein as it exists naturally). For example, a tetrameric homodimer or heterodimer of streptavidin or avidin may be referred to as an individual molecule or smallest building block of a respective oligomer or polymer. In some embodiments, the oligomer or polymer can contain linkage of at least 2 individual molecules of the protein (e.g. is a 2-mer), or can be at least a 3-mer, 4-mer, 5-mer, 6-mer, 7-mer, 8-mer, 9- mer, 10-mer, 11-mer, 12-mer, 13-mer, 14-mer, 15-mer, 16-mer, 17-mer, 18-mer, 19-mer, 20- mer, 25-mer, 30-mer, 35-mer, 40-mer, 45-mer or 50-mer of individual molecules of the protein (e.g., monomers, tetramers).
[0074] Oligomers can be generated using any methods known in the art, such as any described in published U.S. Patent Application No. US2004/0082012. In some embodiments, the oligomer or polymer contains two or more individual molecules that may be crosslinked, such as by a polysaccharide or a bifunctional linker. [0075] In some embodiments, the oligomer or polymer is obtained by crosslinking individual molecules or a complex of subunits that make up an individual molecule in the presence of a polysaccharide. In some embodiments, oligomers or polymers can be prepared by the introduction of carboxyl residues into a polysaccharide, e.g. dextran. In some aspects, individual molecules of the reagent (e.g., monomers, tetramers) can be coupled via primary amino groups of internal lysine residues and/or the free N-terminus to the carboxyl groups in the dextran backbone using conventional carbodiimide chemistry. In some embodiments, the coupling reaction is performed at a molar ratio of about 60 moles of individual molecules of the reagent (e.g., monomers, tetramers) per mole of dextran.
[0076] In some embodiments the reagent is an oligomer or a polymer of one or more streptavidin or avidin or of any analog or mutein of streptavidin or an analog or mutein of avidin (e.g. neutravidin). In some embodiments, the binding site Z is a natural biotin binding site of avidin or streptavidin for which there can be up to four binding sites in an individual molecule (e.g. a tetramer contains four binding sites Z), whereby a homo-tetramer can contain up to 4 binding sites that are the same, i.e. Zl, whereas a hetero-tetramer can contain up to 4 binding sites that may be different, e.g. containing Zl and Z2. In some embodiments, the oligomer is generated or produced from a plurality of individual molecules (e.g. a plurality of homo- tetramers) of the same streptavidin, streptavidin mutein, avidin or avidin mutein, in which case each binding site Z, e.g. Zl, of the oligomer is the same. For example, in some cases, an oligomer can contain a plurality of binding sites Zl, such as at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50 or more binding sites Zl. In some embodiments, the oligomer is generated or produced from a plurality of individual molecules that can be hetero-tetramers of a streptavidin, streptavidin mutein, avidin or avidin mutein and/or from a plurality of two or more different individual molecules (e.g. different homo-tetramers) of streptavidin, streptavidin mutein, avidin or avidin mutein that differ in their binding sites Z, e.g. Zl and Z2, in which case a plurality of different binding sites Z, e.g. Zl and Z2, may be present in the oligomer. For example, in some cases, an oligomer can contain a plurality of binding sites Zl and a plurality of binding sites Z, which, in combination, can include at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50 or more combined binding sites Zl and Z2. [0077] In some cases, the respective oligomer or polymer may be crosslinked by a polysaccharide. In one embodiment, oligomers or polymers of streptavidin or of avidin or of analogs of streptavidin or of avidin (e.g., neutravidin) can be prepared by the introduction of carboxyl residues into a polysaccharide, e. g. dextran, essentially as described in Noguchi, A, et al, Bioconjugate Chemistry (1992) 3,132-137 in a first step. In some such aspects, streptavidin or avidin or analogs thereof then may be linked via primary amino groups of internal lysine residue and/or the free N-terminus to the carboxyl groups in the dextran backbone using conventional carbodiimide chemistry in a second step. In some cases, cross-linked oligomers or polymers of streptavidin or avidin or of any analog of streptavidin or avidin may also be obtained by crosslinking via bifunctional molecules, serving as a linker, such as
glutardialdehyde or by other methods described in the art.
[0078] In some embodiments, the oligomer or polymer is obtained by crosslinking individual molecules or a complex of subunits that make up an individual molecule using a bifunctional linker or other chemical linker, such as glutardialdehyde or by other methods known in the art. In some aspects, cross-linked oligomers or polymers of streptavidin or avidin or of any mutein or analog of streptavidin or avidin may be obtained by crosslinking individual streptavidin or avidin molecules via bifunctional molecules, serving as a linker, such as glutardialdehyde or by other methods described in the art. It is, for example, possible to generate oligomers of streptavidin muteins by introducing thiol groups into the streptavidin mutein (this can, for example, be done by reacting the streptavidin mutein with 2-iminothiolan (Trauts reagent) and by activating, for example in a separate reaction, amino groups available in the streptavidin mutein. In some embodiments, this activation of amino groups can be achieved by reaction of the streptavidin mutein with a commercially available heterobifunctional crosslinker such as sulfosuccinimidyl 4-(N-maleimidomethyl)cyclohexane-l-carboxylate (sulfo SMCC) or Succinimidyl-6-[(P-maleimidopropionamido)hexanoate (SMPH). In some such embodiments, the two reaction products so obtained are mixed together, typically leading to the reaction of the thiol groups contained in the one batch of modified streptavidin mutein with the activated (such as by maleimide functions) amino acids of the other batch of modified streptavidin mutein. In some cases, by this reaction, multimers/oligomers of the streptavidin mutein are formed. These oligomers can have any suitable number of individual molecules, such as at least 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 40, 45, 50 or more, and the oligomerization degree can be varied according to the reaction condition.
[0079] In some embodiments, the oligomeric or polymeric reagent can be isolated via size exclusion chromatography and any desired fraction can be used as the reagent. For example, in some embodiments, after reacting the modified streptavidin mutein, in the presence of 2- iminothiolan and a heterobifunctional crosslinker such as sulfo SMCC, the oligomeric or polymeric reagent can be isolated via size exclusion chromatography and any desired fraction can be used as the reagent. In some embodiments, the oligomers do not have (and do not need to have) a single molecular weight but they may observe a statistical weight distribution such as Gaussian distribution. In some cases, any oligomer with more than three streptavidin or mutein tetramers, e.g., homotetramers or heterotetramers, can be used as a soluble reagent, such as generally 3 to 50 tetramers, e.g., homotetramers or heterotetramers, 10 to 40 tetramers, e.g., homotetramers or heterotetramers, or 25 to 35 tetramers, e.g., homotetramers or heterotetramers. The oligomers might have, for example, from 3 to 25 streptavidin mutein tetramers, e.g., homotetramers or heterotetramers. In some aspects, with a molecular weight of about 50 kDa for streptavidin muteins, the soluble oligomers can have a molecular weight from about 150 kDa to about 2000 kDa, about 150 kDa to about 1500 kDa, about 150 kDa to about 1250 kDa, about 150 kDa to 1000 kDa, about 150 kDa to about 500 kDa or about 150 kDa to about 300 kDa, about 300 kDa to about 2000 kDa, about 300 kDa to about 1500 kDa, about 300 kDa to about 1250 kDa, about 300 kDa to 1000 kDa, about 300 kDa to about 500 kDa, about 500 kDa to about 2000 kDa, about 500 kDa to about 1500 kDa, about 500 kDa to about 1250 kDa, about 500 kDa to 1000 kDa, about 1000 kDa to about 2000 kDa, about 1000 kDa to about 1500 kDa, about 1000 kDa to about 1250 kDa, about 1250 kDa to about 2000 kDa or about 1500 kDa to about 2000 kDa. Generally, because each streptavidin molecule/mutein has four biotin binding sites, such a reagent can provide 12 to 160 binding sites Z, such as 12 to 100 binding sites Z.
2. Format of Reagent
a. Support
[0080] In some embodiments, the reagent is comprised on a support, such as a solid support or surface, e.g., bead, or a stationary phase (chromatography matrix). In some such
embodiments, the reagent is reversibly immobilized on the support. In some cases, the reagent is immobilized to the support via covalent bonds. In some aspects, the reagent is reversibly immobilized to the support non-covalently.
[0081] In some embodiments, the support is a solid support. Any solid support (surface) can be used for the reversible immobilization of the reagent. Illustrative examples of solid supports on which the reagent can be immobilized include a magnetic bead, a polymeric bead, a cell culture plate, a microtiter plate, a membrane, or a hollow fiber. In some aspects, hollow fibers can be used as a bioreactor in the Quantum® Cell Expansion System, available from
TerumoBCT Inc. (Lakewood, CO, USA). In some embodiments, the reagent is covalently attached to the solid support. In other embodiments, non-covalent interactions can also be used for immobilization, for example on plastic substrates. In some embodiments, the reagent can, for example, be a streptavidin or avidin mutein that reversibly binds a streptavidin binding peptide. Such streptavidin muteins can be covalently attached to any surface, for example, resin (beads) used for chromatography purification and are commercially available in such form from IBA GmbH, Gottingen, for example, as Strep-Tactin® Sepharose, Strep-Tactin® Superflow®, Strep-Tactin® Superflow® high capacity or Strep-Tactin® MacroPrep®. Other illustrative examples that are readily commercially available are immobilized metal affinity
chromatography (IMAC) resins such as the TALON® resins (Westburg, Leusden, The
Netherlands) that can be used for the reversible immobilization of oligo-histidine tagged (his- tagged) proteins, such as for the reversible binding of an agent (e.g., receptor-binding agent or selection agent) that contains as a binding partner C an oligohistidine tag such as an penta- or hexa-histidine tag. Other examples include calmodulin sepharose available from GE Life Sciences which can be used together with an agent (e.g., receptor-binding agent or selection agent) that contains a calmodulin binding peptide as a binding partner C or sepharose, to which glutathion is coupled. In some such cases, the binding partner C is glutathion-S-transferase.
[0082] In some embodiments, the support contains a stationary phase. Thus, in some embodiments, the reagent is comprised on a stationary phase (also called chromatography matrix). In some such embodiments, the reagent is reversibly immobilized on the stationary phase. In some cases, the reagent is reversibly immobilized to the stationary phase via covalent bonds. In some aspects, the reagent is reversibly immobilized to the stationary phase non- covalently.
[0083] Any material may be employed as a chromatography matrix. In general, a suitable chromatography material is essentially innocuous, i.e. not detrimental to cell viability, such as when used in a packed chromatography column under desired conditions. In some embodiments, the stationary phase remains in a predefined location, such as a predefined position, whereas the location of the sample is being altered. Thus, in some embodiments the stationary phase is the part of a chromatographic system through which the mobile phase flows (either by flow through or in a batch mode) and where distribution of the components contained in the liquid phase (either dissolved or dispersed) between the phases occurs.
[0084] In some embodiments, the chromatography matrix has the form of a solid or semisolid phase, whereas the sample that contains the target cell to be isolated/separated is a fluid phase. The chromatography matrix can be a particulate material (of any suitable size and shape) or a monolithic chromatography material, including a paper substrate or membrane. Thus, in some aspects, the chromatography can be both column chromatography as well as planar chromatography. In some embodiments, in addition to standard chromatography columns, columns allowing a bidirectional flow such as PhyTip® columns available from PhyNexus, Inc. San Jose, CA, U.S.A. or pipette tips can be used for column based/flow through mode based methods. Thus, in some cases, pipette tips or columns allowing a bidirectional flow are also comprised by chromatography columns useful in the present methods. In some cases, such as where a particulate matrix material is used, the particulate matrix material may, for example, have a mean particle size of about 5 μιη to about 200 μιη, or from about 5 μιη to about 400 μιη, or from about 5 μιη to about 600 μιη. In some aspects, the chromatography matrix may, for example, be or include a polymeric resin or a metal oxide or a metalloid oxide. In some aspects, such as where planar chromatography is used, the matrix material may be any material suitable for planar chromatography, such as conventional cellulose-based or organic polymer based membranes (for example, a paper membrane, a nitrocellulose membrane or a polyvinylidene difluoride (PVDF) membrane) or silica coated glass plates. In one embodiment, the chromatography matrix/stationary phase is a non-magnetic material or non-magnetizable material.
[0085] In some embodiments, non-magnetic or non-magnetizable chromatography stationary phases that are suitable in the present methods include derivatized silica or a crosslinked gel. In some aspects, a crosslinked gel may be based on a natural polymer, such as on a polymer class that occurs in nature. For example, a natural polymer on which a chromatography stationary phase may be based is a polysaccharide. In some cases, a respective polysaccharide is generally crosslinked. An example of a polysaccharide matrix includes, but is not limited to, an agarose gel (for example, Superflow™ agarose or a Sepharose® material such as Superflow™ Sepharose® that are commercially available in different bead and pore sizes) or a gel of crosslinked dextran(s). A further illustrative example is a particulate cross-linked agarose matrix, to which dextran is covalently bonded, that is commercially available (in various bead sizes and with various pore sizes) as Sephadex® or Superdex®, both available from GE Healthcare. Another illustrative example of such a chromatography material is Sephacryl® which is also available in different bead and pore sizes from GE Healthcare.
[0086] In some embodiments, a crosslinked gel may also be based on a synthetic polymer, such as on a polymer class that does not occur in nature. In some aspects, such a synthetic polymer on which a chromatography stationary phase is based is a polymer that has polar monomer units, and which is therefore in itself polar. Thus, in some cases, such a polar polymer is hydrophilic. Hydrophilic molecules, also termed lipophobic, in some aspects contain moieties that can form dipole-dipole interactions with water molecules. In general, hydrophobic molecules, also termed lipophilic, have a tendency to separate from water.
[0087] Illustrative examples of suitable synthetic polymers are polyacrylamide(s), a styrene- divinylbenzene gel and a copolymer of an acrylate and a diol or of an acrylamide and a diol. An illustrative example is a polymethacrylate gel, commercially available as a Fractogel®. A further example is a copolymer of ethylene glycol and methacrylate, commercially available as a Toyopearl®. In some embodiments, a chromatography stationary phase may also include natural and synthetic polymer components, such as a composite matrix or a composite or a copolymer of a polysaccharide and agarose, e.g. a polyacrylamide/agarose composite, or of a polysaccharide and Ν,Ν'-methylenebisacrylamide. An illustrative example of a copolymer of a dextran and Ν,Ν'-methylenebisacrylamide is the above-mentioned Sephacryl® series of material. In some embodiments, a derivatized silica may include silica particles that are coupled to a synthetic or to a natural polymer. Examples of such embodiments include, but are not limited to, polysaccharide grafted silica, polyvinylpyrrolidone grafted silica, polyethylene oxide grafted silica, poly(2-hydroxyethylaspartamide) silica and poly(N-isopropylacrylamide) grafted silica.
[0088] In some embodiments, the chromatography matrix is a gel filtration matrix, for example, when used in a removal cartridge as described herein. Generally, a gel filtration can be characterized by the property that it is designed to undergo. Hence, a gel filtration matrix in some aspects allows the separation of cells or other biological entities largely on the basis of their size. In some such aspects, the respective chromatography matrix is typically a particulate porous material as mentioned above. The chromatography matrix may have a certain exclusion limit, which is typically defined in terms of a molecular weight above which molecules are entirely excluded from entering the pores. In some embodiments, the respective molecular weight defining the size exclusion limit may be selected to be below the weight corresponding to the weight of a target cell. In such an embodiment, the target cell is prevented from entering the pores of the size exclusion chromatography matrix. Likewise, a stationary phase may have pores that are of a size that is smaller than the size of a chosen target cell. In illustrative embodiments chromatography matrix has a mean pore size of 0 to about 500 nm.
[0089] In some embodiments, components present in a sample such as agents (e.g., receptor- binding agents or selection agents) or a competition reagent may have a size that is below the exclusion limit of the pores and thus can enter the pores of the chromatography matrix. In some aspects, of such components that are able to partially or fully enter the pore volume, larger molecules, with less access to the pore volume can elute first, whereas the smallest molecules typically elute last. In some embodiments, the exclusion limit of the chromatography matrix is selected to be below the maximal width of the target cell. Hence, in some aspects, components that have access to the pore volume can remain longer in/on the chromatography matrix than target cell. Thus, in some cases, target cells can be collected in the eluate of a chromatography column separately from other matter/components of a sample. Therefore, in some aspects, components such as an agent (e.g., receptor-binding agent or selection agent), or where applicable a competition reagent, may elute at a later point of time from a gel filtration matrix than the target cell. In some embodiments, this effect can be further increased, such as if the gel permeation matrix contains a reagent (such as covalently bound thereon) that contains binding sites Z that are able to bind agents (e.g., receptor-binding agents or selection agents) and/or a competition reagent present in a sample. In some cases, the agent (e.g., receptor-binding agent or selection agent) and/or the competition reagent can be bound by the binding sites Z of the reagent and thereby immobilized on the matrix. In some aspects, this method is carried out in a removal cartridge.
[0090] In some embodiments, a chromatography matrix employed in the present methods may also include magnetically attractable matter such as one or more magnetically attractable particles or a ferrofluid. A respective magnetically attractable particle may comprise a reagent with a binding site that is capable of binding a target cell. In some cases, magnetically attractable particles may contain diamagnetic, ferromagnetic, paramagnetic or
superparamagnetic material. In general, superparamagnetic material responds to a magnetic field with an induced magnetic field without a resulting permanent magnetization. Magnetic particles based on iron oxide are for example commercially available as Dynabeads® from Dynal Biotech, as magnetic MicroBeads from Miltenyi Biotec, as magnetic porous glass beads from CPG Inc., as well as from various other sources, such as Roche Applied Science,
BIOCLON, BioSource International Inc., micromod, AMBION, Merck, Bangs Laboratories, Polysciences, or Novagen Inc., to name only a few. Magnetic nanoparticles based on superparamagnetic Co and FeCo, as well as ferromagnetic Co nanocrystals have been described, for example by Hutten, A. et al. (J. Biotech. (2004), 112, 47-63). In other embodiments, a chromatography matrix employed in the present methods is void of any magnetically attractable matter.
[0091] In some embodiments, provided is an apparatus that contains at least one
arrangement of a first and a second stationary phase, such as chromatography column for selection of cells (a selection cartridge) and a second chromatography column (a removal cartridge) for removal of reagents. The apparatus may comprise a plurality of arrangements of first and second stationary phases (chromatography columns) being fluidly connected in series. The apparatus may comprise a sample inlet being fluidly connected to the first stationary phase of the first arrangement of the first and second stationary phases. In some embodiments, the apparatus may also comprise a sample outlet for cells, the sample outlet being fluidly connected to the second stationary phase of the last of the at least one arrangement of a first and second stationary phases for chromatography. In some aspects, the apparatus may also comprise a competition reagent container that is fluidly connected to at least one of the first stationary phases of the arrangements of the first and second stationary phases,
c. Soluble
[0092] In some embodiments, the reagent is not bound to a solid support, i.e. it is present in soluble form or is soluble. In principle, the same reagent can be used as in the case of a reagent that is immobilized on a support, such as a solid support or stationary phase. For example, any of the exemplary of reagents described above can be used without immobilizing or attaching such reagent to a support, e.g. not attaching solid support or stationary phase. In some embodiments, the reagent contains a plurality of binding sites, Z, for reversibly binding to a binding agent via interaction with a binding partner, C. In some cases, the reagent is an oligomer or polymer of individual molecules or an oligomer or polymer of a complex of subunits that make up the individual molecule (e.g. oligomers or polymers of a dimeric, trimeric or tetrameric protein). In some embodiments, the reagent can, for example, be a streptavidin mutein oligomer, a calmodulin oligomer, a compound (oligomer) that provides least two chelating groups K, wherein the at least two chelating groups are capable of binding to a transition metal ion, thereby rendering the reagent capable of binding to an oligohistidine affinity tag, multimeric glutathione-S-transferase, or a biotinylated carrier protein.
[0093] In some embodiments, the reagent is characterized by the absence of a solid support (surface) attached to the reagent. For example, in some embodiments, the reagent does not comprise or is not attached (directly or indirectly) to a particle, bead, nanoparticle, microsphere or other solid support. In some embodiments, the reagent is not rigid, inflexible or stiff or does not comprise or is not attached to a rigid, inflexible, or stiff surface. In some embodiments, the reagent is flexible or substantially flexible. In some cases, the reagent is able to adjust or adapt to the form of the surface of the cells. In some embodiments, the reagent does not or does not comprise a shape that is spherical or substantially spherical.
[0094] In some embodiments, substantially all, i.e. more than 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of the reagent is, is composed of or contains organic material. For example, in some embodiments, more than 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more of the reagent is, is composed of or contains lipids, carbohydrates, proteins, peptides or mixtures thereof. In some embodiments, the reagent is, is composed of or contains an essential absence of inorganic material, an inorganic core, e.g. metal, e.g. iron, synthetic or inorganic polymers, such as styrene polymers, e.g. polystyrene, latex, silica or magnetic cores. For example, in some embodiments, the relative percentage of inorganic material of the reagent or that is comprised as part of the reagent is less than 20%, 15%, 10%, 5% or less.
[0095] In some embodiments, the majority (i.e. more than 50%), such as more than 60%, 70%, 80%, 90%, 95%, 99% or more of the total volume of the reagent in aqueous solution consists of the individual protein molecules that comprise the reagent, such as oligomers or polymers of individual molecules or a complex of subunits that make up an individual molecule (e.g. tetrameric molecule). In some embodiments, the total density of the soluble reagent is less than 1.2 g/cm 3 , 1.1 g/cm 3 , 1.0 g/cm 3 or less. [0096] In some embodiments, the soluble reagent, e.g. not being attached to a support or solid support (e.g. is not attached to a bead), has a relatively small size, such as generally less than or about less than 20 nM in size, such as less than or about less than 15 nM, less than or about less than 10 nM, less than or about less than 5 nM or smaller.
[0097] In some embodiments, the soluble reagent, e.g. not being attached to a support or solid support (e.g. is not attached to a bead), is biologically inert, i.e. it is non-toxic to living cells. In some embodiments, the reagent may be biodegradable, for example, it can be degraded by enzymatic activity or cleared by phagocytic cells.
[0098] In some embodiments, it is possible to react the reagent (e.g. a streptavidin or mutein, such as tetrameric streptavidin muteins) to a carrier, such as an organic carrier. In some aspects, in addition to a reaction with a polysaccharide, it is also possible to use physiologically or pharmaceutically acceptable proteins such as serum albumin (for example human serum albumin (HSA) or bovine serum albumin (BSA)) as carrier protein. In such a case, the reagent, such as streptavidin or a streptavidin mutein (either as individual tetramer or also in the form of oligomers), can be coupled to the carrier protein via non-covalent interaction. In some such embodiments, biotinylated BSA (which is commercially available from various suppliers such as ThermoFisher Scientific, Sigma Aldrich or Vectorlabs, to name only a few) can be reacted with the reagent (e.g. streptavidin mutein). In some aspects, some of the reagent oligomers (e.g. streptavidin oligomers) can non-covalently bind via one or more binding sites Z to the biotinylated carrier protein, leaving the majority of the binding sites Z of the oligomer available for binding the agent (e.g., receptor-binding agent or selection agent) and any further agent as described herein. Thus, by such an approach a soluble reagent with a multitude of binding sites Z can be prepared.
[0099] In other embodiments, a reagent, such as a streptavidin mutein (either as an individual tetramer or also in the form of an oligomer), can be covalently coupled to a synthetic carrier such as a polyethylene glycol (PEG) molecule. Any suitable PEG molecule can be used for this purpose, for example, and the PEG molecule and the respective reagent can be soluble. Typically, PEG molecules up to a molecular weight of 1000 Da are soluble in water or culture media that may be used in the present methods. In some cases, such PEG based reagent can be prepared using commercially available activated PEG molecules (for example, PEG-NHS derivatives available from NOF North America Corporation, Irvine, California, USA, or activated PEG derivatives available from Creative PEGWorks, Chapel Hills, North Carolina, USA) with amino groups of the streptavidin mutein.
B. Agents
[00100] In some embodiments the agent (e.g., receptor-binding agent or selection agent) has one or binding sites, B, for binding to the molecule on the surface of the cell, e.g. cell surface molecule. Thus, in some instances, the agent (e.g., receptor-binding agent or selection agent) contains a binding site B or a plurality of binding sites B, wherein the specific binding between the agent (receptor-binding agent or selection agent) and the molecule on the surface of the target cells contains interaction between B and the molecule. In some embodiments, the agent contains only a single binding site, i.e. is monovalent. In some embodiments the agent (e.g., receptor-binding agent or selection agent) has at least two, such as a plurality of binding sites B including three, four or five binding sites B capable of binding to the cell surface molecule. In some such aspects, the at least two or plurality of binding sites B may be identical. In some embodiments, one or more of the at least two or plurality of binding sites B may be different (e.g. Bl and B2).
[00101] In some embodiments, one or more different agents (e.g. one or more different receptor-binding agent, selection agent or other agent that binds to a molecule on a cell) are reversibly bound to the reagent. In some embodiments, at least 2, 3, 4 or more different agents are reversibly bound to the same reagent. In some embodiments, at least two different agents are reversibly bound to the same reagent, whereby each reagent comprises a binding site B or a plurality of binding sites B for specific binding between the agent and the molecule. In some embodiments, the at least two or more agents contain the same binding site B, e.g. for the binding the same or substantially the same molecule. In some embodiments, the at least two or more agents contain different binding sites B, e.g. for the binding to different molecules. In some embodiments, a first agent (e.g. a first receptor-binding agent or a first selection agent) contains a binding site Bl, B2, B3, B4, etc. and a second agent (e.g. a second receptor-binding agent or second selection agent) contains another of a binding site Bl, B2, B3, B4, etc.. In some embodiments, a first agent (e.g. a first selection agent) contains a binding site Bl and a second agent (e.g. second selection agent) contains a binding site B3. In some embodiments, a first agent (e.g. a first receptor-binding agent) contains a binding site B2 and a second agent (e.g. a second receptor-binding agent) contains a binding site B4. In any of such embodiments, the first agent and second agent can contain a binding partner, CI or C2. In some embodiments, CI and C2 can be the same. In some embodiments, CI and C2 are different. In some embodiments, the first agent and second agent contain the same binding partner, CI.
[00102] In some cases, the dissociation constant (KD) of the binding between the agent (e.g., via the binding site B) and the binding site Z of the reagent may have a value in the range from about 10"2 M to about 10"13 M or from about 10"3 M to about 10"12 M or from about 10"4 M to about 10"UM, or from about 10"5M to about 10"10M. In some embodiments, the dissociation constant (Kd) for the binding between the binding agent and the molecule is of low affinity, for example, in the range of a Kd of about 10 —"3J to about 10—"7' M. In some embodiments, the dissociation constant (Kd) for the binding between the binding agent and the molecule is of high affinity, for example, in the range of a Kd of about 10 —"7' to about lxl0—"1l0u M.
[00103] In some embodiments, the dissociation of the binding of the agent via the binding site B and the molecule occurs sufficiently fast, for example, to allow the target cell to be only transiently stained or associated with the agent after disruption of the reversible bond between the reagent and the agent. In some cases, when expressed in terms of the kQff rate (also called dissociation rate constant for the binding between the agent (via the binding site B) and the molecule, the karate is about 0.5xl0~4 sec-1 or greater, about lxlO-4 sec-1 or greater, about 2x10~4 sec-1 or greater, about 3x10~4 sec-1 or greater, about 4x10~4 sec-1 of greater, about 5x10~4 sec-1 or greater, about lxlO-3 sec-1 or greater, about 1.5xl0~3 sec-1 or greater, about
—3 1 —3 1 —3 1 —3 1
2x10 sec or greater, about 3x10 sec or greater, about 4x10 sec , about 5x10 sec or greater, about 1x10 —2 sec or greater, or about 5x10 1 sec— 1 or greater. It is within the level of a skilled artisan to empirically determine the kQff rate range suitable for a particular agent and cell molecule interaction (see e.g. U.S. published application No. US2014/0295458). For example, an agent with a rather high kQff rate of, for example, greater than 4.0x10~4 sec-1 may be used so that, after the disruption of the binding complexes, most of the agent can be removed or dissociated within one hour. In other cases, an agent with a lower kQff rate of, for example, l.OxlO-4 sec-1, may be used, so that after the disruption of the binding complexes, most of the agent may be removed or dissociated from the cell within about 3 and a half hours.
[00104] In some embodiments, the KD of this bond as well as the KD, kQff and kon rate of the bond formed between the binding site B of the agent (e.g., receptor-binding agent or selection agent) and the cell surface molecule can be determined by any suitable means, for example, by fluorescence titration, equilibrium dialysis or surface plasmon resonance. [00105] In some aspects, the cell surface molecule is a molecule against which an agent (e.g., receptor-binding agent or selection agent) may be directed. In some embodiments, the cell surface molecule is a peptide or a protein, such as a receptor, e.g., a membrane receptor protein. In some embodiments, the receptor is a lipid, a polysaccharide or a nucleic acid. In some embodiments, a cell surface molecule that is a protein may be a peripheral membrane protein or an integral membrane protein. The cell surface molecule may in some embodiments have one or more domains that span the membrane. As a few illustrative examples, a membrane protein with a transmembrane domain may be a G-protein coupled receptor, such as an odorant receptors, a rhodopsin receptor, a rhodopsin pheromone receptor, a peptide hormone receptor, a taste receptor, a GABA receptor, an opiate receptor, a serotonin receptor, a Ca2+ receptor, melanopsin, a neurotransmitter receptor, such as a ligand gated, a voltage gated or a
mechanically gated receptor, including the acetylcholine, the nicotinic, the adrenergic, the norepinephrine, the catecholamines, the L-DOPA-, a dopamine and serotonin (biogenic amine, endorphin/enkephalin) neuropeptide receptor, a receptor kinase such as serine/threonine kinase, a tyrosine kinase, a porin/channel such as a chloride channel, a potassium channel, a sodium channel, an OMP protein, an ABC transporter (ATP-Binding Cassette-Transporter) such as amino acid transporter, the Na-glucose transporter, the Na/iodide transporter, an ion transporter such as Light Harvesting Complex, cytochrome c oxidase, ATPase Na/K, H/K, Ca, a cell adhesion receptor such as metalloprotease, an integrin or a catherin.
[00106] In some embodiments, the cell surface molecule may be an antigen defining a desired cell population or subpopulation, for instance a population or subpopulation of blood cells, e.g., lymphocytes (e.g., T cells, T-helper cells, for example, CD4+ T-helper cells, B cells or natural killer cells), monocytes, or stem cells, e.g. CD34-positive peripheral stem cells or Nanog or Oct- 4 expressing stem cells. Examples of T-cells include cells such as CM V- specific CD8+ T- lymphocytes, cytotoxic T-cells, memory T-cells and regulatory T-cells (Treg). An illustrative example of Treg is CD4 CD25 CD45RA Treg cells and an illustrative example of memory T- cells is CD62L CD8+ specific central memory T-cells. The cell surface molecule may also be a marker for a tumor cell.
[00107] As described above, in some embodiments, the agent (e.g., receptor-binding agent or selection agent) has, in addition to the binding site B that is able to bind the cell surface molecule, a binding partner C. In some aspects, this binding partner C is able to bind to a binding site Z of the reagent wherein the reagent has one or more binding sites for the binding partner C. In some embodiments, the non-covalent bond that may be formed between the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) and the binding site(s) Z of the reagent may be of any desired strength and affinity, and may be disruptable or reversible under conditions under which the method is performed. The agent (e.g., receptor-binding agent or selection agent) may include at least one, including two, three or more, additional binding partners C and the reagent may include at least two, such as three, four, five, six, seven, eight or more binding sites Z for the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent). As described in US patent 7,776,562, US patent 8,298,782 or International Patent application WO 2002/054065, any combination of a binding partner C and a reagent with one or more corresponding binding sites Z can be chosen, for example, such that the binding partner C and the binding site Z are able to reversibly bind in a complex, such as to cause an avidity effect.
[00108] The binding partner C included in the agent (e.g., receptor-binding agent or selection agent) may for instance be hydrocarbon-based (including polymeric) and include nitrogen-, phosphorus-, sulphur-, carben-, halogen- or pseudohalogen groups. In some aspects, it may be an alcohol, an organic acid, an inorganic acid, an amine, a phosphine, a thiol, a disulfide, an alkane, an amino acid, a peptide, an oligopeptide, a polypeptide, a protein, a nucleic acid, a lipid, a saccharide, an oligosaccharide, or a polysaccharide. As further examples, it may also be a cation, an anion, a polycation, a polyanion, a polycation, an electrolyte, a polyelectrolyte, a carbon nanotube or carbon nanofoam. Generally, such a binding partner C has a higher affinity to the binding site of the reagent than to other matter. Examples of a respective binding partner C include, but are not limited to, a crown ether, an immunoglobulin, a fragment thereof and a proteinaceous binding molecule with antibody-like functions.
[00109] In some embodiments, the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) includes biotin and the reagent includes a streptavidin analog or an avidin analog that reversibly binds to biotin. In some embodiments the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) includes a biotin analog that reversibly binds to streptavidin or avidin, and the reagent includes
streptavidin, avidin, a streptavidin analog or an avidin analog that reversibly binds to the respective biotin analog. In some embodiments, the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) includes a streptavidin or avidin binding peptide and the reagent includes streptavidin, avidin, a streptavidin analog or an avidin analog that reversibly binds to the respective streptavidin or avidin binding peptide.
[00110] In some embodiments, the reagent is a streptavidin, such as a streptavidin mutein including any described above (e.g. set forth in SEQ ID NOS: 3-6), and the binding partner C that is included in the agent (e.g. receptor-binding agent or selection agent) may include a streptavidin-binding peptide. In some embodiments, the streptavidin-binding peptide may include a sequence with the general formula set forth in SEQ ID NO: 9, such as contains the sequence set forth in SEQ ID NO: 10. In some embodiments, the peptide sequence has the general formula set forth in SEQ ID NO: 11, such as set forth in SEQ ID NO: 12. In one example, the peptide sequence is Trp-Arg-His-Pro-Gln-Phe-Gly-Gly (also called Strep-tag®, set forth in SEQ ID NO: 7). In one example, the peptide sequence is Trp-Ser-His-Pro-Gln-Phe-Glu- Lys (also called Strep-tag® II, set forth in SEQ ID NO: 8). In some embodiments, the peptide ligand contains a sequential arrangement of at least two streptavidin-binding modules, wherein the distance between the two modules is at least 0 and not greater than 50 amino acids, wherein one binding module has 3 to 8 amino acids and contains at least the sequence His-Pro-Xaa (SEQ ID NO: 9), where Xaa is glutamine, asparagine, or methionine, and wherein the other binding module has the same or different streptavidin peptide ligand, such as set forth in SEQ ID NO: 11 (see e.g. International Published PCT Appl. No. WO02/077018; U.S. Patent No. 7,981,632). In some embodiments, the peptide ligand contains a sequence having the formula set forth in any of SEQ ID NO: 13 or 14. In some embodiments, the peptide ligand has the sequence of amino acids set forth in any of SEQ ID NOS: 15-19.
[00111] In some embodiment the binding partner C of the agent (e.g., receptor-binding agent or selection agent) includes a moiety known to the skilled artisan as an affinity tag. In such an embodiment, the reagent may include a corresponding binding partner, for example, an antibody or an antibody fragment, known to bind to the affinity tag. As a few illustrative examples of known affinity tags, the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) may include dinitrophenol or digoxigenin, oligohistidine, polyhistidine, an immunoglobulin domain, maltose-binding protein, glutathione-S-transferase (GST), chitin binding protein (CBP) or thioredoxin, calmodulin binding peptide (CBP), FLAG '-peptide, the HA-tag (sequence: Tyr-Pro-Tyr-Asp-Val-Pro-Asp-Tyr-Ala) (SEQ ID NO: 20), the VSV-G-tag (sequence: Tyr-Thr-Asp-Ile-Glu-Met-Asn-Arg-Leu-Gly-Lys) (SEQ ID NO: 21), the HSV-tag (sequence: Gln-Pro-Glu-Leu-Ala-Pro-Glu-Asp-Pro-Glu-Asp) (SEQ ID NO: 22), the T7 epitope (Ala-Ser-Met-Thr-Gly-Gly-Gln-Gln-Met-Gly) (SEQ ID NO: 22), maltose binding protein (MBP), the HSV epitope of the sequence Gln-Pro-Glu-Leu-Ala-Pro-Glu-Asp-Pro-Glu-Asp (SEQ ID NO: 24) of herpes simplex virus glycoprotein D, the "myc" epitope of the transcription factor c-myc of the sequence Glu-Gln-Lys-Leu-Ile-Ser-Glu-Glu-Asp-Leu (SEQ ID NO: 25), the V5-tag (sequence: Gly-Lys-Pro-Ile-Pro-Asn-Pro-Leu-Leu-Gly-Leu-Asp-Ser-Thr) (SEQ ID NO: 26), or glutathione-S-transferase (GST). In such embodiments, the complex formed between the one or more binding sites Z of the reagent which may be an antibody or antibody fragment, and the antigen can be disrupted competitively by adding the free antigen, i.e. the free peptide (epitope tag) or the free protein (such as MBP or CBP). In some embodiments, the affinity tag might also be an oligonucleotide tag. In some cases, such an oligonucleotide tag may, for instance, be used to hybridize to an oligonucleotide with a complementary sequence, linked to or included in the reagent.
[00112] Further examples of a suitable binding partner C include, but are not limited to, a lectin, protein A, protein G, a metal, a metal ion, nitrilo triacetic acid derivatives (NT A), RGD- motifs, a dextrane, polyethyleneimine (PEI), a redox polymer, a glycoproteins, an aptamers, a dye, amylose, maltose, cellulose, chitin, glutathione, calmodulin, gelatine, polymyxin, heparin, NAD, NADP, lysine, arginine, benzamidine, poly U, or oligo-dT. Lectins such as Concavalin A are known to bind to polysaccharides and glycosylated proteins. An illustrative example of a dye is a triazine dye such as Cibacron blue F3G-A (CB) or Red HE-3B, which specifically bind NADH-dependent enzymes. Typically, Green A binds to Co A proteins, human serum albumin, and dehydrogenases. In some cases, the dyes 7-aminoactinomycin D and 4',6-diamidino-2- phenylindole bind to DNA. Generally, cations of metals such as Ni, Cd, Zn, Co, or Cu, are typically used to bind affinity tags such as an oligohistidine containing sequence, including the hexahistidine or the His-Asn-His-Arg-His-Lys-His-Gly-Gly-Gly-Cys tag (MAT tag) (SEQ ID NO: 35), and N-methacryloyl-(L)-cysteine methyl ester.
[00113] In some embodiments the binding between the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) and the one or more binding sites Z of the reagent occurs in the presence of a divalent, a trivalent or a tetravalent cation. In this regard, in some embodiments the reagent includes a divalent, a trivalent or a tetravalent cation, typically held, e.g. complexed, by means of a suitable chelator. In some embodiments, the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) may include a moiety that includes, e.g. complexes, a divalent, a trivalent or a tetravalent cation. Examples of a respective metal chelator, include, but are not limited to, ethylenediamine, ethylene-diaminetetraacetic acid (EDTA), ethylene glycol tetraacetic acid (EGTA),
diethylenetri-aminepentaacetic acid (DTPA), N,N-bis(carboxymethyl)glycine (also called nitrilotriacetic acid, NTA), l,2-bis(o-aminophenoxy)ethane-N,N,N',N'-tetraacetic acid (BAPTA), 2,3-dimer-capto-l-propanol (dimercaprol), porphine and heme. As an example, EDTA forms a complex with most monovalent, divalent, trivalent and tetravalent metal ions, such as e.g. silver (Ag+), calcium (Ca2+), manganese (Mn2+), copper (Cu2+), iron (Fe2+), cobalt (Co +) and zirconium (Zr4+), while BAPTA is specific for Ca2+. As an illustrative example, a standard method used in the art is the formation of a complex between an oligohistidine tag and copper (Cu2+), nickel (Ni2+), cobalt (Co2+), or zinc (Zn2+) ions, which are presented by means of the chelator nitrilotriacetic acid (NTA).
[00114] In some embodiments, the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) includes a calmodulin binding peptide and the reagent includes multimeric calmodulin as described in US Patent 5,985,658, for example. In some embodiments, the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) includes a FLAG peptide and the reagent includes an antibody that binds to the FLAG peptide, e.g. the FLAG peptide, which binds to the monoclonal antibody 4E11 as described in US Patent 4,851,341. In one embodiment, the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) includes an oligohistidine tag and the reagent includes an antibody or a transition metal ion binding the oligohistidine tag. In some cases, the disruption of all these binding complexes may be accomplished by metal ion chelation, e.g. calcium chelation, for instance by adding EDTA or EGTA. In some
embodiments, calmodulin, antibodies such as 4E11 or chelated metal ions or free chelators may be multimerized by conventional methods, e.g. by biotinylation and complexation with streptavidin or avidin or oligomers thereof or by the introduction of carboxyl residues into a polysaccharide, e.g. dextran, essentially as described in Noguchi, A, et al. Bioconjugate
Chemistry (1992) 3, 132-137 in a first step and linking calmodulin or antibodies or chelated metal ions or free chelators via primary amino groups to the carboxyl groups in the
polysaccharide, e.g. dextran, backbone using conventional carbodiimide chemistry in a second step. In some such embodiments, the binding between the binding partner C that is included in the agent (e.g., receptor-binding agent or selection agent) and the one or more binding sites Z of the reagent can be disrupted by metal ion chelation. The metal chelation may, for example, be accomplished by addition of EGTA or EDTA.
[00115] In some embodiments, the agent (e.g., receptor-binding agent or selection agent), which specifically bind to the cell surface molecule, may for instance be comprised by an antibody, a fragment thereof, or a proteinaceous binding molecule with antibody- like functions. In some embodiments, the binding site B of the agent is an antibody combining site, such as is or contains one or more complementarity determining regions (CDRs) of an antibody.
Examples of (recombinant) antibody fragments include, but are not limited to, Fab fragments, Fv fragments, single-chain Fv fragments (scFv), a divalent antibody fragment such as an
(Fab)2'-fragment, diabodies, triabodies (Iliades, P., et al, FEB S Lett (1997) 409, 437-441), decabodies (Stone, E., et al, Journal of Immunological Methods (2007) 318, 88-94) and other domain antibodies (Holt, L.J., et al, Trends Biotechnol. (2003), 21, 11, 484-490). In some embodiments, the agent (e.g., receptor-binding agent or selection agent) may comprise a bivalent proteinaceous artificial binding molecule such as a dimeric lipocalin mutein that is also known as "duocalin".
[00116] In some embodiments, the agent (e.g., receptor-binding agent or selection agent) may have a single binding site B, i.e., it may be monovalent. Examples of monovalent agents (e.g., receptor-binding agents or selection agents) include, but are not limited to, a monovalent antibody fragment, a proteinaceous binding molecule with antibody-like binding properties or an MHC molecule. Examples of monovalent antibody fragments include, but are not limited to a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv), including a divalent single-chain Fv fragment.
[00117] In some embodiments, the agent is an antibody or an antigen-binding fragment thereof, such as a Fab fragments, Fv fragments, single-chain Fv fragments (scFv), a divalent antibody fragment such as an (Fab)2'-fragment. In some embodiments, the agent is or is derived from a parental antibody that is known to bind to a cell molecule of interest. Various antibody molecules or fragments thereof against cell surface molecules are well known in the art and any of a variety of such can be used as agents in the methods herein. In some embodiments, the agent is an antibody or fragment thereof that contains one or more amino acid replacements in the variable heavy chain of a parental or reference antibody, for example, to generate an antibody with an altered affinity or that exhibits a sufficiently fast off-rate as described above. For example, exemplary of such mutations are known the context of mutants of the anti-CD4 antibody 13B8.2 (see e.g., U.S. Patent Nos. 7,482,000, U.S. Patent Appl. No. US2014/0295458 or International Patent Application No. WO2013/ 124474), and any of such mutations can be generated in another parental or reference antibody.
[00118]
[00119] In some aspects, the agent (e.g., receptor-binding agent or selection agent) that can be monovalent, for example comprise a monovalent antibody fragment or a monovalent artificial binding molecule (proteinaceous or other) such as a mutein based on a polypeptide of the lipocalin family (also known as "Anticalin®), or a bivalent molecule such as an antibody or a fragment in which both binding sites are retained such as an F(ab')2 fragment.
[00120] An example of a proteinaceous binding molecule with antibody- like functions includes a mutein based on a polypeptide of the lipocalin family (see for example, WO
03/029462, Beste et al, Proc. Natl. Acad. Sci. U.S.A. (1999) 96, 1898-1903). Generally, lipocalins, such as the bilin binding protein, the human neutrophil gelatinase-associated lipocalin, human Apo lipoprotein D or human tear lipocalin possess natural ligand-binding sites that can be modified so that they bind a given target. Further examples of a proteinaceous binding molecule with antibody-like binding properties that can be used as agent (e.g., receptor- binding agent or selection agent) that specifically binds to the cell surface molecule include, but are not limited to, the so-called glubodies (see e.g. international patent application WO
96/23879), proteins based on the ankyrin scaffold (Mosavi, L.K., et al, Protein Science (2004) 13, 6, 1435-1448) or crystalline scaffold (e.g. international patent application WO 01/04144) the proteins described in Skerra, J. Mol. Recognit. (2000) 13, 167-187, AdNectins, tetranectins and avimers. Generally, avimers, including multivalent avimer proteins evolved by exon shuffling of a family of human receptor domains, contain so called A-domains that occur as strings of multiple domains in several cell surface receptors (Silverman, J., et al, Nature Biotechnology (2005) 23, 1556-1561). Adnectins, generally derived from a domain of human fibronectin, typically contain three loops that can be engineered for immunoglobulin-like binding to targets (Gill, D.S. & Damle, N.K., Current Opinion in Biotechnology (2006) 17, 653-658).
Tetranectins, generally derived from the respective human homotrimeric protein, likewise typically contain loop regions in a C-type lectin domain that can be engineered for desired binding. Peptoids, which can, in some cases, act as protein ligands, typically are oligo(N-alkyl) glycines that differ from peptides in that the side chain is connected to the amide nitrogen rather than the carbon atom. Peptoids are typically resistant to proteases and other modifying enzymes and can have a much higher cell permeability than peptides (see e.g. Kwon, Y.-U., and Kodadek, T., J. Am. Chem. Soc. (2007) 129, 1508-1509).
[00121] Further examples of suitable proteinaceous binding molecules include, but are not limited to, an EGF-like domain, a Kringle-domain, a fibronectin type I domain, a fibronectin type II domain, a fibronectin type III domain, a PAN domain, a Gla domain, a SRCR domain, a Kunitz/Bovine pancreatic trypsin Inhibitor domain, tendamistat, a Kazal-type serine protease inhibitor domain, a Trefoil (P-type) domain, a von Willebrand factor type C domain, an
Anaphylatoxin-like domain, a CUB domain, a thyroglobulin type I repeat, LDL-receptor class A domain, a Sushi domain, a Link domain, a Thrombospondin type I domain, an immunoglobulin domain or a an immunoglobulin-like domain (for example, domain antibodies or camel heavy chain antibodies), a C-type lectin domain, a MAM domain, a von Willebrand factor type A domain, a Somatomedin B domain, a WAP -type four disulfide core domain, a F5/8 type C domain, a Hemopexin domain, an SH2 domain, an SH3 domain, a Laminin-type EGF-like domain, a C2 domain, "Kappabodies" (111 et al. Protein Eng (1997) 10, 949-57, a so called "minibody" (Martin et al, EMBO J (1994) 13, 5303-5309), a diabody (Holliger et al, PNAS USA (1993)90, 6444-6448), a so called "Janusis" (Traunecker et al, EMBO J (1991) 10, 3655- 3659, or Traunecker et al, Int J Cancer (1992) Suppl 7, 51-52), a nanobody, a microbody, an affilin, an affibody, a knottin, ubiquitin, a zinc-finger protein, an autofluorescent protein or a leucine-rich repeat protein. In some embodiments, a nucleic acid molecule with antibody-like functions can be an aptamer. Generally, an aptamer folds into a defined three-dimensional motif and shows high affinity for a given target structure.
1. Receptor-binding agents
[00122] In some embodiments, the agent is a receptor-binding agent. In some embodiments, the receptor-binding agent binds to a molecule (e.g. receptor) on the surface of a cell, which binding between the agent and the molecule is capable of inducing or modulating a signal in the cells. In some instances, the cell surface molecule (e.g. receptor) is a signaling molecule. In some such cases, the receptor-binding agent is capable of specifically binding to a signaling molecule expressed by one or more of the cells. In some instances, the receptor-binding agent is a stimulatory agent, which can be any agent that is capable of inducing a signal in a cell (e.g. a T cell) upon binding to a cell surface molecule, such as a receptor. In some embodiments, the signal can be immuno stimulatory, in which case the receptor-binding agent or stimulatory agent is capable of inducing or modulating a signal that is involved in or that does stimulate an immune response by the cell (e.g. T cell), e.g. increase immune cell proliferation or expansion, immune cell activation, immune cell differentiation, cytokine secretion, cytotoxic activity or one or more other functional activities of an immune cell. In some embodiment, the signal can be inhibitory, in which case the receptor-binding agent or stimulatory agent is capable of inducing or modulating a signal in the cell (e.g. T cell) that is involved in or that does inhibit an immune response, e.g. inhibits or decreases immune cell proliferation or expansion, immune cell activation, immune cell differentiation, cytokine secretion, cytotoxic activity or one or more other functional activities of an immune cell.
[00123] In some embodiments, the receptor-binding agent, e.g., stimulatory agent is a first receptor-binding agent, e.g., first stimulatory agent. In some aspects, the first receptor-binding agent, e.g., first stimulatory agent, binds to a receptor molecule on the surface of the cells. Thus, in some cases, the first receptor-binding agent, e.g., first stimulatory agent, induces or modulates a signal. In some aspects, the inducing or modulating of a signal by the first receptor-binding agent, e.g., first stimulatory agent, effects the activation, stimulation, and/or expansion
(proliferation) of the cells. Thus, in some cases, the first receptor-binding agent, e.g., first stimulatory agent, provides a primary activation signal to the cells, thereby activating the cells.
[00124] In some embodiments the cell population may be a population of lymphocytes including, but not limited a population of B cells, a population of T cells or a population of natural killer cells. Illustrative examples of cell populations are B cells carrying CD40 or CD 137 (both cell population can be proliferated upon binding of only a first agent that provides an activation signal, for example 4-1BB ligand; or an aCD40 antibody molecule or an aCD137 antibody molecule (see for example Zhang et al., 2010, J Immunol, 184:787-795)). Other illustrative examples for agents (either first or second) that may be used for the expansion of B cells are agents that bind to IgG, CD19, CD28 or CD14, for example aCD19, algG, aCD28, or aCD14 antibody molecules. It is also envisioned that first or second agents for the expansion of B cell may comprise ligands for toll like receptors or interleukins, such as IL-21 (see for example Dienz O, et al. 2009. J. Exp. Med. 206:69). It is noted that lipopolysaccharide dependent activation of B cells is also encompassed in the present invention, as a
lipopolysaccharide can also be used as first agent and can be equipped with a binding partner CI as used herein.
[00125] Other illustrative examples of suitable cell populations include T cell population that expand after being activated by binding of a first agent to TCR/CD3 and binding of a second agent to an accessory molecule on the T cell such as CD28. In this case, the first agent stimulates a TCR/CD3 complex-associated signal in the T cells and the second agent provides a secondary stimulus by binding CD28 as accessory molecule. Agents that can be used for the expansion of T cells may also include interleukins, such as IL-2, IL-7, IL-15, or IL-21 (see for example Cornish et al. 2006, Blood. 108(2):600-8, Bazdar and Sieg, 2007, Journal of Virology, 2007, 81(22): 12670-12674, Battalia et al, 2013, Immunology, 139(1): 109- 120). Other illustrative examples for agents that may be used for the expansion of T cells are agents that bind to CD8, CD45 or CD90, such as aCD8, aCD45 or aCD90 antibodies. Illustrative examples of T cell population including antigen- specific T cells, T helper cells, cytotoxic T cells, memory T cell (an illustrative example of memory T-cells are CD62L+CD8+ specific central memory T cells) or regulatory T cells (an illustrative example of Treg are CD4+CD25+CD45RA+ Treg cells).
[00126] Another illustrative example of a suitable cell population includes natural killer cells (NK cells), which may for example be expanded with agents that bind to CD 16 or CD56, such as for example aCD16 or aCD56 antibodies. In illustrative example for such an aCD16 antibody is the antibody 3G8 with a VH sequence set forth in SEQ ID NO: 52 and a VL sequence set forth in SEQ ID NO: 53 (see for example Hoshino et al, Blood. 1991 Dec 15;78(12):3232-40.). Another agent that may be used for expansion of NK cells may be IL-15 (see for example Vitale et al. 2002. The Anatomical Record. 266:87-92). Yet another illustrative example of a suitable cell population includes monocytes, which may for instance be expanded using an agent that binds to CD 14, such as an aCD14 antibody molecule.
[00127] In some embodiments, the first receptor-binding agent, e.g., first stimulatory agent, may stimulate a TCR/CD3 complex-associated signal in the cells, e.g., T cells. In some aspects, the first receptor-binding agent, e.g., first stimulatory agent, may be a binding agent that specifically binds CD3. In some cases, a first receptor-binding agent, e.g., first stimulatory agent, that specifically binds CD3 may be selected from the group consisting of an anti-CD3- antibody, a divalent antibody fragment of an anti-CD3 antibody, a monovalent antibody fragment of an anti-CD3-antibody, and a proteinaceous CD3 binding molecule with antibodylike binding properties. The divalent antibody fragment may be a (Fab)2' -fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv). In some cases, a proteinaceous CD3 binding molecule with antibody- like binding properties may be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, or an avimer.
[00128] In some embodiments, an anti-CD3 Fab fragment can be derived from the CD3 binding monoclonal antibody produced by the hybridoma cell line OKT3 (ATCC® CRL- 8001™; see also U.S. Patent No. 4,361,549). The variable domain of the heavy chain and the variable domain of the light chain of the anti-CD3 antibody OKT3 are described in Arakawa et al J. Biochem. 120, 657-662 (1996) and comprise the amino acid sequences set forth in SEQ ID NO: 31 and 32, respectively.
[00129] In some aspects, the receptor-binding agent, e.g., stimulatory agent, is a second receptor-binding agent, e.g., second stimulatory agent,. In some cases, the second receptor- binding agent, e.g., second stimulatory agent, binds to a molecule on the surface of the cells, such as a cell surface molecule, e.g., receptor molecule. In some embodiments, the second receptor-binding agent, e.g., second stimulatory agent, is capable of enhancing, dampening, or modifying a signal delivered through the first molecule. In some embodiments, the second receptor-binding agent, e.g., second stimulatory agent, induces or modulates a signal, e.g., a second or an additional signal. In some aspects, the second receptor-binding agent, e.g., second stimulatory agent, may enhance or potentiate a signal induced by the first receptor-binding agent, e.g., first stimulatory agent,. In some embodiments, the second receptor-binding agent, e.g., second stimulatory agent, binds to an accessory molecule and/or can stimulate or induce an accessory or secondary signal in the cell. In some aspects, the second receptor-binding agent, e.g., second stimulatory agent, binds to a co- stimulatory molecule and/or provides a
co stimulatory signal.
[00130] In some embodiments, the receptor-binding agent, e.g., stimulatory agent, which can be the second receptor-binding agent, e.g., second stimulatory agent, binds, e.g. specifically binds, to a second molecule that can be a costimulatory molecule, an accessory molecule, a cytokine receptor, a chemokine receptor, an immune checkpoint molecule, or a member of the TNF family or the TNF receptor family.
[00131] In some embodiments, the molecule on the cell, e.g., T cell, may be CD28 and the receptor-binding agent, e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) specifically binds CD28. In some aspects, the receptor- binding agent, e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) that specifically binds CD28 may be selected from the group consisting of an anti-CD28-antibody, a divalent antibody fragment of an anti-CD28 antibody, a monovalent antibody fragment of an anti-CD28-antibody, and a proteinaceous CD28 binding molecule with antibody- like binding properties. The divalent antibody fragment may be an (Fab)2' -fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv). A proteinaceous CD28 binding molecule with antibody- like binding properties may be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, and an avimer.
[00132] In some embodiments, an anti-CD28 Fab fragment can be derived from antibody CD28.3 (deposited as a synthetic single chain Fv construct under GenBank Accession No. AF451974.1; see also Vanhove et al, BLOOD, 15 July 2003, Vol. 102, No. 2, pages 564-570) the heavy and light chain of which comprise SEQ ID NO: 33 and 34, respectively.
[00133] In some embodiments, the molecule on the cell, e.g., T cell, may be CD90 and the receptor-binding agent, e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) specifically binds CD90. In some aspects, the receptor- binding agent, e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) that specifically binds CD90 may be selected from the group consisting of an anti-CD90-antibody, a divalent antibody fragment of an anti-CD90 antibody, a monovalent antibody fragment of an anti-CD90-antibody, and a proteinaceous CD90 binding molecule with antibody- like binding properties. The antibody or antigen-binding fragment can be derived from any known in the art. See e.g. anti-CD90 antibody G7 (Biolegend, cat. no. 105201).
[00134] In some embodiments, the molecule on the cell, e.g., T cell, may be CD95 and the receptor-binding agent, e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) specifically binds CD95. In some aspects, the receptor- binding agent, e.g., stimulatory agent (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent,) that specifically binds CD95 may be selected from the group consisting of an anti-CD95-antibody, a divalent antibody fragment of an anti-CD95 antibody, a monovalent antibody fragment of an anti-CD95-antibody, and a proteinaceous CD95 binding molecule with antibody- like binding properties. The antibody or antigen-binding fragment can be derived from any known in the art. For example, in some aspects, the anti-CD90 antibody can be monoclonal mouse anti-human CD95 CHI 1 (Upstate Biotechnology, Lake Placid, NY) or can be anti-CD95 mAb 7C11 or anti-APO-1, such as described in Paulsen et al. Cell Death & Differentiation 18.4 (2011): 619-631.
[00135] In some embodiments, the molecule on the cell, e.g., T cell or B cell, may be CD 137 and the receptor-binding agent, e.g., stimulatory agent (e.g. which can be the second receptor- binding agent, e.g., second stimulatory agent,) specifically binds CD137. In some aspects, the receptor-binding agent, e.g., stimulatory agent, (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent) that specifically binds CD 137 may be selected from the group consisting of an anti-CD 137-antibody, a divalent antibody fragment of an anti-CD 137 antibody, a monovalent antibody fragment of an anti-CD 137-antibody, and a proteinaceous CD 137 binding molecule with antibody-like binding properties. The antibody or antigen- binding fragment can be derived from any known in the art. For example, the anti-CD 137 antibody can be LOB 12, IgG2a or LOB 12.3, IgGl as described in Taraban et al. Eur J Immunol. 2002 Dec;32(12):3617-27. See also e.g. US6569997, US6303121, Mittler et al. Immunol Res. 2004;29(l-3): 197-208.
[00136] In some embodiments, the molecule on the cell, e.g. B cell, may be CD40 and the receptor-binding agent, e.g., stimulatory agent, (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent) specifically binds CD40. In some aspects, the receptor- binding agent (which can be the second receptor-binding agent, e.g., second stimulatory agent) that specifically binds CD40 may be selected from the group consisting of an anti-CD40- antibody, a divalent antibody fragment of an anti-CD40 antibody, a monovalent antibody fragment of an anti-CD40-antibody, and a proteinaceous CD40 binding molecule with antibodylike binding properties.
[00137] In some embodiments, the molecule on the cell, e.g., T cell, may be CD40L (CD 154) and the receptor-binding agent, e.g., stimulatory agent, (e.g. which can be the second receptor- binding agent, e.g., second stimulatory agent) specifically binds CD40L. In some aspects, the receptor-binding agent, e.g., stimulatory agent, (e.g. which can be the second receptor-binding agent, e.g., second stimulatory agent) that specifically binds CD40L may be selected from the group consisting of an anti-CD40L-antibody, a divalent antibody fragment of an anti-CD40L antibody, a monovalent antibody fragment of an anti-CD40L-antibody, and a proteinaceous CD40L binding molecule with antibody- like binding properties. The antibody or antigen- binding fragment can be derived from any known in the art. For example, the anti-CD40L antibody can in some aspects be Hu5C8, as described in Blair et al. JEM vol. 191 no. 4 651-660. See also e.g. WO1999061065, US20010026932, US7547438, WO2001056603.
[00138] In some embodiments, the receptor-binding agent, e.g., stimulatory agent is capable of binding to any one or more of CD28, CD5, CD4, CD8, MHCI, MHCII, CTLA-4, ICOS, PD- 1, OX40, CD27L (CD70), 4-lBBL, CD30L and LIGHT, and the receptor-binding agent, e.g. stimulatory agent, can be an antibody, divalent antibody (e.g. a (Fab)2' -fragment or a divalent single-chain Fv fragment), monovalent antibody (e.g. a Fab fragment, an Fv fragment, or a single-chain Fv fragment (scFv)) or ligand to any one or more of CD28, CD5, CD4, CD8, MHCI, MHCII, CTLA-4, ICOS, PD-1, OX40, CD27L (CD70), 4-lBBL, CD30L and LIGHT, in which such agent is capable of inducing or modeling a signal in the cells upon binding of the receptor-binding agent, e.g., stimulatory agent to the molecule.
[00139] In some embodiments, the receptor-binding agent, e.g., stimulatory agent, is capable of specifically binding to a molecule on the surface of the target cells other than CD28, CD3, CD137 or CD40. In some cases, the binding of the receptor-binding agent, e.g., stimulatory agent, to the molecule on the surface of the target cells other than CD28, CD3, CD 137 or CD40 induces or modulates a signal in the target cells and/or alters a function of the target cells, thereby generating cultured target cells.
[00140] In any of the above examples, the divalent antibody fragment may be an (Fab)2'- fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv). In any of the above examples, the proteinaceous binding molecule with antibody-like binding properties may be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, and an avimer.
2. Selection Agents
[00141] In some embodiments, the agent is a selection agent. In some embodiments, the selection agent binds to a molecule on the surface of a cell, such as a cell surface molecule. In some instances, the cell surface molecule is a selection marker. In some such cases, the selection agent is capable of specifically binding to a selection marker expressed by one or more of the cells. In some embodiments, a selection agent or agents that are reversibly bound to a reagent can be used to facilitate selection or isolation of cells. [00142] In some aspects, the cell surface molecule, e.g., selection marker, may be an antigen defining a desired cell population or subpopulation, for instance a population or subpopulation of blood cells, e. g. lymphocytes (e.g. T cells, T-helper cells, for example, CD4+ T-helper cells, B cells or natural killer cells), monocytes, or stem cells, e.g. CD34-positive peripheral stem cells or Nanog or Oct-4 expressing stem cells. In some embodiments, the selection marker can be a marker expressed on the surface of T cells or a subset of T cells, such as CD25, CD28, CD62L, CCR7, CD27, CD127, CD3, CD4, CD8, CD45RA, and/or CD45RO Examples of T-cells include cells such as CM V- specific CD8+ T-lymphocytes, cytotoxic T-cells, memory T-cells and regulatory T-cells (Treg). An illustrative example of Treg includes CD4 CD25 CD45RA Treg cells and an illustrative example of memory T-cells includes CD62L CD8+ specific central memory T-cells. The cell surface molecule, e.g., selection marker, may also be a marker for a tumor cell.
[00143] In some embodiments, the selection marker may be CD4 and the selection agent specifically binds CD4. In some aspects, the selection agent that specifically binds CD4 may be selected from the group consisting of an anti-CD4-antibody, a divalent antibody fragment of an anti-CD4 antibody, a monovalent antibody fragment of an anti-CD4-antibody, and a
proteinaceous CD4 binding molecule with antibody-like binding properties. In some
embodiments, an anti-CD4-antibody, such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD4 Fab fragment) can be derived from antibody 13B8.2 or a functionally active mutant of 13B8.2 that retains specific binding for CD4. For example, exemplary mutants of antibody 13B8.2 or ml3B8.2 are described in U.S. Patent Nos.
7,482,000, U.S. Patent Appl. No. US2014/0295458 or International Patent Application No. WO2013/124474; and Bes, C, et al. J Biol Chem 278, 14265-14273 (2003). The mutant Fab fragment termed "ml3B8.2" carries the variable domain of the CD4 binding murine antibody 13B8.2 and a constant domain containing constant human CHI domain of type gamma for the heavy chain and the constant human light chain domain of type kappa, as described in US Patent 7,482,000. In some embodiments, the anti-CD4 antibody, e.g. a mutant of antibody 13B8.2, contains the amino acid replacement H91A in the variable light chain, the amino acid replacement Y92A in the variable light chain, the amino acid replacement H35A in the variable heavy chain and/or the amino acid replacement R53A in the variable heavy chain, each by Kabat numbering. In some aspects, compared to variable domains of the 13B8.2 Fab fragment in ml3B8.2 the His residue at position 91 of the light chain (position 93 in SEQ ID NO: 30) is mutated to Ala and the Arg residue at position 53 of the heavy chain (position 55 in SEQ ID NO: 29) is mutated to Ala. In some embodiments, the reagent that is reversibly bound to anti- CD4 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-206 or 6-8000-205 or 6-8002-100; IBA GmbH, Gottingen, Germany).
[00144] In some embodiments, the selection marker may be CD8 and the selection agent specifically binds CD8. In some aspects, the selection agent that specifically binds CD8 may be selected from the group consisting of an anti-CD8-antibody, a divalent antibody fragment of an anti-CD8 antibody, a monovalent antibody fragment of an anti-CD8-antibody, and a
proteinaceous CD8 binding molecule with antibody-like binding properties. In some
embodiments, an anti-CD8-antibody, such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD8 Fab fragment) can be derived from antibody OKT8 (e.g. ATCC CRL-8014) or a functionally active mutant thereof that retains specific binding for CD8. In some embodiments, the reagent that is reversibly bound to anti-CD8 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8003 or 6-8000-201; IBA GmbH, Gottingen, Germany).
[00145] In some embodiments, the selection marker may be CD3 and the selection agent specifically binds CD3. In some aspects, the selection agent that specifically binds CD3 may be selected from the group consisting of an anti-CD3-antibody, a divalent antibody fragment of an anti-CD3 antibody, a monovalent antibody fragment of an anti-CD3-antibody, and a
proteinaceous CD3 binding molecule with antibody-like binding properties. In some
embodiments, an anti-CD3-antibody, such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD3 Fab fragment) can be derived from antibody OKT3 (e.g. ATCC CRL-8001; see e.g., Stemberger et al. PLoS One. 2012; 7(4): e35798) or a functionally active mutant thereof that retains specific binding for CD3. In some embodiments, the reagent that is reversibly bound to anti-CD3 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-201, 6-8001-100; IBA GmbH, Gottingen, Germany).
[00146] In some embodiments, the selection marker may be CD25 and the selection agent specifically binds CD25. In some aspects, the selection agent that specifically binds CD25 may be selected from the group consisting of an anti-CD25-antibody, a divalent antibody fragment of an anti-CD25 antibody, a monovalent antibody fragment of an anti-CD25-antibody, and a proteinaceous CD25 binding molecule with antibody-like binding properties. In some embodiments, an anti-CD25-antibody, such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD25 Fab fragment) can be derived from antibody FRT5 (See e.g., Stemberger et al. 20128) or a functionally active mutant thereof that retains specific binding for CD25. In some embodiments, the reagent that is reversibly bound to anti-CD4 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-205 or 6-8000-207 or 6-8004-050; IBA GmbH, Gottingen, Germany).
[00147] In some embodiments, the selection marker may be CD62L and the selection agent specifically binds CD62L. In some aspects, the selection agent that specifically binds CD62L may be selected from the group consisting of an anti-CD62L-antibody, a divalent antibody fragment of an anti-CD62L antibody, a monovalent antibody fragment of an anti-CD62L- antibody, and a proteinaceous CD62L binding molecule with antibody- like binding properties. In some embodiments, an anti-CD62L-antibody, such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD62L Fab fragment) can be derived from antibody DREG56 (e.g. ATCC HB300; see e.g. Stemberger et al. 2012) or a functionally active mutant thereof that retains specific binding for CD62L. In some embodiments, the reagent that is reversibly bound to anti-CD62L or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-204 or 6-8005-050; IBA GmbH, Gottingen, Germany).
[00148] In some embodiments, the selection marker may be CD45RA and the selection agent specifically binds CD45RA. In some aspects, the selection agent that specifically binds
CD45RA may be selected from the group consisting of an anti-CD45RA-antibody, a divalent antibody fragment of an anti-CD45RA antibody, a monovalent antibody fragment of an anti- CD45RA-antibody, and a proteinaceous CD45RA binding molecule with antibody-like binding properties. In some embodiments, an anti-CD45RA-antibody, such as a divalent antibody fragment or a monovalent antibody fragment (e.g. CD45RA Fab fragment) can be derived from antibody MEM56 (e.g. Millipore 05-1413; see e.g. Stemberger et al. 2012) or a functionally active mutant thereof that retains specific binding for CD45RA. In some embodiments, the reagent that is reversibly bound to anti-CD45RA or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-208 or 6-8007- 050; IBA GmbH, Gottingen, Germany). [00149] In some embodiments, the selection marker may be CD45RO and the selection agent specifically binds CD45RO. In some aspects, the selection agent that specifically binds CD45RO may be selected from the group consisting of an anti-CD45RO-antibody, a divalent antibody fragment of an anti-CD45RO antibody, a monovalent antibody fragment of an anti- CD45RO-antibody, and a proteinaceous CD45RO binding molecule with antibody-like binding properties. In some embodiments, the reagent that is reversibly bound to anti-CD45RO or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-209 or 6-8012-020; IBA GmbH, Gottingen, Germany).
[00150] In some embodiments, the selection marker may be CD 154 and the selection agent specifically binds CD 154. In some aspects, the selection agent that specifically binds CD 154 may be selected from the group consisting of an anti-CD 154-antibody, a divalent antibody fragment of an anti-CD 154 antibody, a monovalent antibody fragment of an anti-CD 154- antibody, and a proteinaceous CD 154 binding molecule with antibody- like binding properties. In some embodiments, the reagent that is reversibly bound to anti-CD 154 or a fragment thereof is commercially available or derived from a reagent that is commercially available (e.g. catalog No. 6-8000-202 or 6-5510-050; IBA GmbH, Gottingen, Germany).
[00151] In some embodiments, the selection marker may be CD 16 and the selection agent specifically binds CD 16. In some aspects, the selection agent that specifically binds CD 16 may be selected from the group consisting of an anti-CD 16-antibody, a divalent antibody fragment of an anti-CD 16 antibody, a monovalent antibody fragment of an anti-CD 16-antibody, and a proteinaceous CD 16 binding molecule with antibody-like binding properties. In some embodiments, the reagent that is reversibly bound to anti-CD 16 or a fragment thereof is commercially available or derived from a reagent that is commercially available. In some aspects, the CD 16 binding molecule comprises the heavy chain and/or light chain sequences set forth in SEQ ID NO: 52 and 53, respectively.
[00152] In any of the above examples, the divalent antibody fragment may be an (Fab)2'- fragment, or a divalent single-chain Fv fragment while the monovalent antibody fragment may be selected from the group consisting of a Fab fragment, an Fv fragment, and a single-chain Fv fragment (scFv). In any of the above examples, the proteinaceous binding molecule with antibody-like binding properties may be an aptamer, a mutein based on a polypeptide of the lipocalin family, a glubody, a protein based on the ankyrin scaffold, a protein based on the crystalline scaffold, an adnectin, and an avimer. III. Methods of Culturing Cells
[0100] Provided herein are methods of culturing cells which include incubating a composition containing target cells (e.g. T cells) in the presence of an agent (e.g. first or second, receptor-binding agents, e.g. stimulatory agents, or selection agents) that is capable of binding to a molecule on the surface of targets cells (e.g. T cells) in the composition and that is reversibly bound to a reagent containing a plurality of binding sites capable of reversibly binding to the agent. In some embodiments, the incubation is performed under conditions in which the agent binds, such as specifically binds, to the molecule on the cell. In some cases, for certain receptor-binding agents (e.g. stimulatory agents), such binding can induce or modulate a signal in target cells (e.g. T cells) in the compositions, such as a primary signal or accessory signal as described. In some embodiments, binding of the agent to the molecule results in one or more of the stimulation, activation, expansion (proliferation) and/or differentiation of target cells in the composition.
[0101] In some embodiments, the provided method can be used for selectively inducing ex vivo expansion of a population of cells such as B cells, T cells or natural killer cells. In some cases, the stimulation can be in the absence of exogenous growth factors, such as lymphokines, and accessory cells. In some embodiments, the proliferation of these cells such as B cells or T cells can be induced without the need for antigen, thus providing an expanded cell population such as a T cell population which is polyclonal with respect to antigen reactivity. The methods disclosed herein may provide for sustained proliferation of a selected population of T cells such as CD4+ or CD8+ T cells over an extended period of time to yield a multi-fold increase in the number of these cells relative to the original T cell population. In general, in case of a (clonal) expansion of a lymphocyte population as described herein, all progeny may share the same antigen specificity as the cell population that was selected for expansion.
[0102] In some embodiments, the methods relate to expanding a population of antigen specific T cells. In some embodiments, to produce a population of antigen specific T cells, T cells are contacted with an antigen in a form suitable to trigger a primary activation signal in the T cell, i.e., the antigen is presented to the T cell such that a signal is triggered in the T cell through the TCR/CD3 complex. For example, the antigen can be presented to the T cell by an antigen presenting cell in conjunction with an MHC molecule. An antigen presenting cell, such as a B cell, macrophage, monocyte, dendritic cell, Langerhans cell, or other cell which can present antigen to a T cell, can be incubated with the T cell in the presence of the antigen (e.g., a soluble antigen) such that the antigen presenting cell presents the antigen to the T cell.
Alternatively, a cell expressing an antigen of interest can be incubated with the T cell. For example, a tumor cell expressing tumor-associated antigens can be incubated with a T cell together to induce a tumor- specific response. Similarly, a cell infected with a pathogen, e.g., a virus, which presents antigens of the pathogen can be incubated with a T cell. Following antigen specific activation of a population of T cells, the cells can be expanded in accordance with the provided methods. For example, after antigen specificity has been established, T cells can be expanded by culture with an anti-CD3 antibody (used as first agent) and an anti-CD28 antibody (used as second agent) according to the methods described herein. In another embodiment, the first agent can be an MHC I: peptide complex, which binds to an antigen specific T cell population. In such an embodiment, any antigen specific peptide that is known and that can be complexed with the respective MHC I molecule can be used. Alternatively, it is also possible to use as first agent the natural ligand of a receptor that triggers of cell expansion. For example, the extracellular domain of CD 19 can be used to cause the activation of intracellular signaling cascades of cells transduced to express chimeric CD 19 binding antigen receptor (CAR).
Exemplary aspects of the above are shown in Examples.
[0103] In some embodiments, provided is an in viiro-method of culturing a population of cells, comprising contacting a sample comprising a composition comprising a plurality of cells with a multimerization reagent. The multimerization reagent has reversibly immobilized thereon (bound thereto) an agent (first or second, receptor-binding, e.g. stimulatory agent, or selection agent), which can be used for the selection, stimulation, expansion and/or differentiation of cells. In some embodiments, a first agent that provides a primary activation signal to the cells, wherein the multimerization reagent comprising at least one binding site Zl for the reversible binding of the first agent. The first agent comprises at least one binding partner CI, wherein the binding partner CI is able of reversibly binding to the binding site Zl of the multimerization reagent, wherein the first agent is bound to the multimerization reagent via the reversible bond formed between the binding partner CI and the binding site Zl. The first agent binds to a receptor molecule on the surface of the cells, thereby providing a primary activation signal to the cells and thereby activating the cells.
[0104] In some embodiments, the multimerization reagent is immobilized on a support, such as a solid surface. In some embodiments, the multimerization reagent is not bound to a support, such as not bound to a solid surface or stationary phase. [0105] For example, in some embodiments, provided is an in viiro-method of expanding a population of cells, comprising contacting a sample comprising a population of cells with a multimerization reagent, wherein the multimerization reagent is not immobilized on a solid support, i.e. is in a soluble form, and has bound thereto an agent (first or second, receptor- binding, e.g. stimulatory agent, or selection agent), which can be used for the selection, stimulation, expansion and/or differentiation of cells. In some embodiments, a first agent that provides a primary activation signal to the cells is reversibly bound to the multimerization reagent. The multimerization reagent comprises at least one binding site, e.g. Zl for the binding of the first agent, wherein the first agent comprises at least one binding partner, e.g. CI, wherein the binding partner CI is able of binding to the binding site Zl of the multimerization reagent. In some embodiments, the first agent is bound to the multimerization reagent via the bond formed between the binding partner CI and the binding site Zl, and the first agent binds to a receptor molecule on the surface of the cells, thereby providing a primary activation signal to the cells and thereby activating the cells. In some embodiments, when a soluble multimerization agent is used, the bond between the binding part C, e.g. CI and the binding site Z, e.g. Zl does not need to be reversible.
[0106] For example, in some embodiments, the provided methods also include the use of a multimerization reagent having bound thereto a second agent, such as an accessory or co- stimulatory molecules, that stimulates an accessory molecule on the surface of the cells. In some cases, the multimerization agent is immobilized on a support, e.g. a solid support or stationary phase. In some embodiments, the multimerization agent is not immobilized on a support, i.e. is in soluble form. In some embodiments, the second agent comprises a binding partner, e.g. C2, wherein the binding partner, e.g. C2 is able of being reversibly bound to a binding site, e.g. Z2 of the multimerization reagent, wherein the second agent is bound to the multimerization reagent via the reversible bond formed between the binding partner C2 and the binding site Z2. In some embodiments, the bond formed between the binding partner CI and the binding site Zl may be reversible and the bond formed between the binding partner C2 and the binding site Z2 may be reversible. In this case, the dissociation constant (Ka) for the reversible binding between said binding site Zl and said binding partner CI and/or for the reversible binding between said binding site Z2 and said binding partner C2 may be in the range of 10 -"2 M to 10 -"13 M. In some aspects, such as when the multimerization reagent is not bound to a support (e.g. not bound to a solid support or stationary phase), the bond formed between the binding partner CI and the binding site Zl may be irreversible and/or also the bond formed between the binding partner C2 and the binding site Z2 may be irreversible
[0107] In some cases, the second agent binds to the accessory molecule on the surface on the surface of the cells, thereby stimulating the activated cells. In this embodiment, the first agent may stimulate a TCR/CD3 complex-associated signal in the T cells and may be a binding agent that specifically binds CD3. In this embodiment the accessory molecule on the T cell may be CD28 and the second agent that binds the accessory molecule is a binding reagent that specifically binds CD28. Alternatively, in some embodiments, it is found that targeting other accessory molecules also can be employed, which can, in some cases, alter, such as improve, one or more features, properties or characteristics of the cultured cells. In some embodiments, the accessory molecule can be one or more of IL-12R, IFNyR, IL-4R, IL-17R, RORyt, RORa, CXCR3, CCR7, CD62L, CXCR1 or CXCR4 (e.g. an anti-IL-12R antibody, an anti- IFNyR antibody, an anti- IL-4R antibody, and an anti- IL-17R antibody, anti-RORyt antibody, anti- RORa antibody, anti-CXCR3 antibody, anti-CCR7 antibody, anti-CD62L antibody, anti- CXCR1 antibody or anti-CXCR4 antibody, respectively. Exemplary agents, such as receptor- binding agents (e.g. stimulatory agents), are described below.
[0108] In some embodiments, the provided method may be carried out at any temperature at which the viability of the cell population is at least essentially uncompromised. In some embodiments, the condition at which incubation or culture is carried out include any conditions that are at least essentially not harmful, not detrimental or at least essentially not compromising viability, for example, under which the percentage of the population of cells that are to be expanded with full viability, is at least 70 , including at least 75 , at least 80 , at least 85 %, at least 90 %, at least 92 %, at least 95 %, at least 97 %, at least 98 %, at least 99 % or at least 99.5 %. In some embodiments, the provided method is carried out at a temperature of about 20 °C or higher. Depending on the cell population to be expanded a suitable temperature range may for instance be from about 20 °C to about 45 °C, including from about 25 °C to about 40 °C, or from about 32 °C to 37 °C. In some embodiments a method according to the invention is carried out at a constant temperature value, or at a selected temperature value + about 5 °C, + about 4 °C, + about 3 °C, + about 2 °C, + about 1 °C or + about 0.5 °C. The person skilled in the art is able to empirically determine a suitable temperature, taking into account the nature of the cells and the expansion conditions. Typically human cells are expanded at a temperature such as 37 °C. [0109] In accordance with the disclosure herein, also provided are multimerized agents, or composition comprising multimerization reagents that care capable of expanding a population of cells. Such a multimerized agent that is capable of expanding a population of cells is a multimerization reagent that is not bound to a support (e.g. in soluble form) and comprises at least one binding site Z, e.g. Zl, for the reversible binding of a first agent that provides a primary activation signal to the cells, wherein the multimerization reagent has reversibly bound thereto said first agent that provides a primary activation signal to the cells; wherein the first agent comprises at least one binding partner C, e.g. CI, wherein the binding partner CI is able of reversibly binding to the at least one binding site Zl of the multimerization reagent, wherein the first agent is bound to the multimerization reagent via the reversible bond formed between the binding partner CI and the binding site Zl. It should be noted here that such a multimerization agent can have immobilized thereon any of the first agent that are described herein.
[0110] In some embodiments, a multimerized agent provided herein may further comprise at least one binding site, e.g. Z2 for the reversible binding of a second agent that stimulates an accessory molecule on the surface of the cells, wherein the multimerization reagent has reversibly bound thereto the second agent that stimulates an accessory molecule on the surface of the cells, wherein the second agent comprises a binding partner, e.g. C2, wherein the binding partner C2 is able of binding to the at least one binding site Z2 of the multimerization reagent. In this embodiment the second agent is bound to the multimerization reagent via the bond formed between the binding partner C2 and the binding site Z2. In some embodiments, the second agent is any that can bind to IL-12R, IFNyR, IL-4R, IL-17R, RORyt, RORa, CXCR3, CCR7, CD62L, CXCR1 or CXCR4 (e.g. an anti-IL-12R antibody, an anti- IFNyR antibody, an anti- IL- 4R antibody, and an anti- IL-17R antibody, anti-RORyt antibody, anti- RORa antibody, anti- CXCR3 antibody, anti-CCR7 antibody, anti-CD62L antibody, anti-CXCRl antibody or anti- CXCR4 antibody, respectively).
[0111] In some embodiments, the culturing of the composition containing target cells (e.g. T cells) with the multimerized agent (e.g. anti-CD3/anti-CD28 mutein streptavidin or oligomer thereof) can be carried out in a bioreactor such as a hollow-fiber bioreactor (e.g. hollow fiber bioreactor of the Quantum® cell expansion system) or a plastic bag bioreactor (e.g. Cellbag® used in Xuri Cell Expansion System W25 from GE Healthcare).
[0112] In some embodiments, the method further includes contacting the cultured target cells (e.g. T cells) in the reaction mixture (e.g. containing the target cells, e.g. T cells, bound to the multimerization reagent via, for example, the first agent and the second agent) with (i) a competition reagent (e.g. free first binding partner C, e.g. CI) or an analog thereof capable of disrupting the bond between the first binding partner, e.g. CI and the binding site, e.g. Zl and/or (such as if necessary) (ii) a second competition reagent, e.g. free second binding partner, e.g. C2, or an analog thereof, capable of disrupting the bond between the second binding partner C2 and the binding site Z2. By so doing the reversible bond between said binding partner CI of the first agent and said binding sites Zl as well as the reversible bond between said binding partner C2 of the second agent and said binding site Z2 of said multimerization reagent is disrupted, thereby releasing in an eluate the T cells bound to the multimerization reagent via the first agent and the second agent and disrupting the stimulation and/or expansion of the T cells.
[0113] In some embodiments, the method further includes separating or removing one or more of the components remaining after the reversible dissociation of components. In some embodiments, any unbound or residual biotin in the cultured target cells (e.g. T cells) can be separated or removed. In some embodiments, the multimerization reagent is removed or separated from the cells in the cultured target cell composition. For example, in some embodiments, the separation/removal might be carried out using a second stationary phase. For this purpose, a mixture comprising the target cells (e.g. T cells) and the soluble multimerization reagent are exposed, before or after being applied onto the first stationary phase described above, to chromatography on a suitable second stationary phase. This secondary stationary phase may be a gel filtration matrix and/or affinity chromatography matrix, wherein the gel filtration and/or affinity chromatography matrix comprises an affinity reagent. The affinity reagent comprised on the chromatography resin include a binding partner D that (specifically) binds to the binding site Zl and/or binding site Z2, if present, of the multimerization reagent, thereby immobilizing the multimerization reagent on the stationary phase. If a streptavidin based multimerization reagent is used and both first and second agents have a streptavidin binding peptide as binding partner CI or C2, the binding partner D that is comprised in the affinity reagent of this second stationary phase can be biotin. The soluble oligomer of streptavidin or of a streptavidin mutein that is used as multimerization reagent then binds to the biotin that is usually covalently coupled to a chromatography matrix such as biotin- sepharose™ that is commercially available. In some such embodiments, the cultured cells (e.g. cultured T cells) can be recovered away from the multimerization reagent.
A. Cells [0114] Cells contained in the composition containing target cells generally are eukaryotic cells, such as mammalian cells, and typically are human cells. In some embodiments, the cells are derived from the blood, bone marrow, lymph, or lymphoid organs, or are cells of the immune system, such as cells of the innate or adaptive immunity, e.g., myeloid or lymphoid cells, including lymphocytes, typically T cells and/or NK cells. Other exemplary cells include stem cells, such as multipotent and pluripotent stem cells, including induced pluripotent stem cells (iPSCs). The cells typically are primary cells, such as those isolated directly from a subject and/or isolated from a subject and frozen.
[0115] In some embodiments, the reversibly-bound agents, such as multimerized agents, provided herein are capable of expanding a lymphocyte population or a subpopulation contained in the lymphocyte population. The lymphocyte population to be expanded may any suitable population, for example, a B cell population, a T cell population, or a natural killer cell population. The T-cell population may be an antigen-specific T cell population, a T helper cell population, a cytotoxic T cell, a memory T cell, a regulatory T cell, or a natural killer T cell population. Accordingly, in such embodiments of the multimerized agent the first agent is able to stimulate a TCR/CD3 complex-associated signal in the T cells. The first agent present in the multimerized agent may thus be binding reagent that specifically binds CD3, while the second agent that binds the accessory molecule, such as may be a binding agent that specifically binds CD28, CD137, IL-12R, IFNyR, IL-4R, IL-17R, RORyt, RORa, CXCR3, CCR7, CD62L, CXCR1 or CXCR4.
[0116] In some embodiments, the cells include one or more subsets of T cells or other cell types, such as whole T cell populations, CD4+ cells, CD8+ cells, and subpopulations thereof, such as those defined by function, activation state, maturity, potential for differentiation, expansion, recirculation, localization, and/or persistence capacities, antigen-specificity, type of antigen receptor, presence in a particular organ or compartment, marker or cytokine secretion profile, and/or degree of differentiation. With reference to the subject to be treated, the cells may be allogeneic and/or autologous. Among the methods include off-the-shelf methods. In some aspects, such as for off-the-shelf technologies, the cells are pluripotent and/or multipotent, such as stem cells, such as induced pluripotent stem cells (iPSCs). In some embodiments, the methods include isolating cells from the subject, preparing, processing, culturing, and/or engineering them, as described herein, and re-introducing them into the same patient, before or after cryopreservation. [0117] Among the sub-types and subpopulations of T cells and/or of CD4+ and/or of CD8+ T cells are naive T (TN) cells, effector T cells (TEFF), memory T cells and sub-types thereof, such as stem cell memory T (TSCM), central memory T (TCM), effector memory T (TEM), or terminally differentiated effector memory T cells, tumor- infiltrating lymphocytes (TIL), immature T cells, mature T cells, helper T cells, cytotoxic T cells, mucosa-associated invariant T (MAIT) cells, naturally occurring and adaptive regulatory T (Treg) cells, helper T cells, such as TH1 cells, TH2 cells, TH3 cells, TH17 cells, TH9 cells, TH22 cells, follicular helper T cells, alpha/beta T cells, and delta/gamma T cells.
[0118] In some embodiments, the cells are natural killer (NK) cells. In some embodiments, the cells are monocytes or granulocytes, e.g., myeloid cells, macrophages, neutrophils, dendritic cells, mast cells, eosinophils, and/or basophils.
Preparation of cells
[0119] In some embodiments, preparation of the cells includes one or more culture and/or preparation steps. The cells may be isolated from a sample, such as a biological sample, e.g., one obtained from or derived from a subject. In some embodiments, the subject from which the cells are isolated is one having the disease or condition or in need of a cell therapy or to which cell therapy will be administered. The subject in some embodiments is a human in need of a particular therapeutic intervention, such as the adoptive cell therapy for which cells are being isolated, processed, and/or engineered.
[0120] Accordingly, the cells in some embodiments are primary cells, e.g., primary human cells. The samples include tissue, fluid, and other samples taken directly from the subject, as well as samples resulting from one or more processing steps, such as separation, centrifugation, genetic engineering (e.g. transduction with viral vector), washing, and/or incubation. The biological sample can be a sample obtained directly from a biological source or a sample that is processed. Biological samples include, but are not limited to, body fluids, such as blood, plasma, serum, cerebrospinal fluid, synovial fluid, urine and sweat, tissue and organ samples, including processed samples derived therefrom.
[0121] In some aspects, the sample from which the cells are derived or isolated is blood or a blood-derived sample, or is or is derived from an apheresis or leukapheresis product. Exemplary samples include whole blood, peripheral blood mononuclear cells (PBMCs), leukocytes, bone marrow, thymus, tissue biopsy, tumor, leukemia, lymphoma, lymph node, gut associated lymphoid tissue, mucosa associated lymphoid tissue, spleen, other lymphoid tissues, liver, lung, stomach, intestine, colon, kidney, pancreas, breast, bone, prostate, cervix, testes, ovaries, tonsil, or other organ, and/or cells derived therefrom. Samples include, in the context of cell therapy, e.g., adoptive cell therapy, samples from autologous and allogeneic sources.
[0122] In some embodiments, the cells are derived from cell lines, e.g., T cell lines. The cells in some embodiments are obtained from a xenogeneic source, for example, from mouse, rat, non-human primate, or pig.
[0123] In some embodiments, isolation of the cells includes one or more preparation and/or non-affinity based cell separation steps. In some examples, cells are washed, centrifuged, and/or incubated in the presence of one or more reagents, for example, to remove unwanted
components, enrich for desired components, lyse or remove cells sensitive to particular reagents. In some examples, cells are separated based on one or more property, such as density, adherent properties, size, sensitivity and/or resistance to particular components.
[0124] In some examples, cells from the circulating blood of a subject are obtained, e.g., by apheresis or leukapheresis. The samples, in some aspects, contain lymphocytes, including T cells, monocytes, granulocytes, B cells, other nucleated white blood cells, red blood cells, and/or platelets, and in some aspects contains cells other than red blood cells and platelets.
[0125] In some embodiments, the blood cells collected from the subject are washed, e.g., to remove the plasma fraction and to place the cells in an appropriate buffer or media for subsequent processing steps. In some embodiments, the cells are washed with phosphate buffered saline (PBS). In some embodiments, the wash solution lacks calcium and/or magnesium and/or many or all divalent cations. In some aspects, a washing step is
accomplished a semi-automated "flow-through" centrifuge (for example, the Cobe 2991 cell processor, Baxter) according to the manufacturer's instructions. In some aspects, a washing step is accomplished by tangential flow filtration (TFF) according to the manufacturer's instructions. In some embodiments, the cells are resuspended in a variety of biocompatible buffers after washing, such as, for example, Ca++/Mg++ free PBS. In certain embodiments, components of a blood cell sample are removed and the cells directly resuspended in culture media.
[0126] In some embodiments, the methods include density-based cell separation methods, such as the preparation of white blood cells from peripheral blood by lysing the red blood cells and centrifugation through a Percoll or Ficoll gradient.
[0127] In some embodiments, the isolation methods include the separation of different cell types based on the expression or presence in the cell of one or more specific molecules, such as surface markers, e.g., surface proteins, intracellular markers, or nucleic acid. In some embodiments, any known method for separation based on such markers may be used.
Separation methods may include any of those disclosed herein, including methods using reversible reagent systems, e.g., agents (such as receptor binding agents or selection agents) and reagents as described herein.
[0128] In some embodiments, the separation is affinity- or immunoaffinity-based separation. For example, the isolation in some aspects includes separation of cells and cell populations based on the cells' expression or expression level of one or more markers, typically cell surface markers, for example, by incubation with an antibody or binding partner that specifically binds to such markers, followed generally by washing steps and separation of cells having bound the antibody or binding partner, from those cells having not bound to the antibody or binding partner.
[0129] Such separation steps can be based on positive selection, in which the cells having bound the reagents are retained for further use, and/or negative selection, in which the cells having not bound to the antibody or binding partner are retained. In some examples, both fractions are retained for further use. In some aspects, negative selection can be particularly useful where no antibody is available that specifically identifies a cell type in a heterogeneous population, such that separation is best carried out based on markers expressed by cells other than the desired population.
[0130] The separation need not result in 100% enrichment or removal of a particular cell population or cells expressing a particular marker. For example, positive selection of or enrichment for cells of a particular type, such as those expressing a marker, refers to increasing the number or percentage of such cells, but need not result in a complete absence of cells not expressing the marker. Likewise, negative selection, removal, or depletion of cells of a particular type, such as those expressing a marker, refers to decreasing the number or percentage of such cells, but need not result in a complete removal of all such cells.
[0131] In some examples, multiple rounds of separation steps are carried out, where the positively or negatively selected fraction from one step is subjected to another separation step, such as a subsequent positive or negative selection. In some examples, a single separation step can deplete cells expressing multiple markers simultaneously, such as by incubating cells with a plurality of antibodies or binding partners, each specific for a marker targeted for negative selection. Likewise, multiple cell types can simultaneously be positively selected by incubating cells with a plurality of antibodies or binding partners expressed on the various cell types.
[0132] For example, in some aspects, specific subpopulations of T cells, such as cells positive or expressing high levels of one or more surface markers, e.g., CD28+, CD62L+, CCR7+, CD27+, CD127+, CD4+, CD8+, CD45RA+, and/or CD45RO+ T cells, are isolated by positive or negative selection techniques.
[0133] For example, CD3+, CD28+ T cells can be positively selected using CD3/CD28 conjugated magnetic beads (e.g., DYNABEADS® M-450 CD3/CD28 T Cell Expander).
[0134] In some embodiments, isolation is carried out by enrichment for a particular cell population by positive selection, or depletion of a particular cell population, by negative selection. In some embodiments, positive or negative selection is accomplished by incubating cells with one or more antibodies or other binding agent that specifically bind to one or more surface markers expressed or expressed (marker"1") at a relatively higher level (markerhlgh) on the positively or negatively selected cells, respectively.
[0135] In some embodiments, T cells are separated from a PBMC sample by negative selection of markers expressed on non-T cells, such as B cells, monocytes, or other white blood cells, such as CD 14. In some aspects, a CD4+ or CD8+ selection step is used to separate CD4+ helper and CD8+ cytotoxic T cells. Such CD4+ and CD8+ populations can be further sorted into sub-populations by positive or negative selection for markers expressed or expressed to a relatively higher degree on one or more naive, memory, and/or effector T cell subpopulations.
[0136] In some embodiments, CD8+ cells are further enriched for or depleted of naive, central memory, effector memory, and/or central memory stem cells, such as by positive or negative selection based on surface antigens associated with the respective subpopulation. In some embodiments, enrichment for central memory T (TCM) cells is carried out to increase efficacy, such as to improve long-term survival, expansion, and/or engraftment following administration, which in some aspects is particularly robust in such sub-populations. See Terakuraet al. (2012) Blood.1:72-82; Wang et al. (2012) J Immunother. 35(9):689-701. In some embodiments, combining TcM-enriched CD8+ T cells and CD4+ T cells further enhances efficacy.
[0137] In embodiments, memory T cells are present in both CD62L"1" and CD62L" subsets of CD8+ peripheral blood lymphocytes. PBMC can be enriched for or depleted of CD62L CD8"1" and/or CD62L+CD8+ fractions, such as using anti-CD8 and anti-CD62L antibodies. [0138] In some embodiments, the enrichment for central memory T (TCM) cells is based on positive or high surface expression of CD45RO, CD62L, CCR7, CD28, CD3, and/or CD 127; in some aspects, it is based on negative selection for cells expressing or highly expressing
CD45RA and/or granzyme B. In some aspects, isolation of a CD8+ population enriched for TCM cells is carried out by depletion of cells expressing CD4, CD 14, CD45RA, and positive selection or enrichment for cells expressing CD62L. In one aspect, enrichment for central memory T (TCM) cells is carried out starting with a negative fraction of cells selected based on CD4 expression, which is subjected to a negative selection based on expression of CD 14 and
CD45RA, and a positive selection based on CD62L. Such selections in some aspects are carried out simultaneously and in other aspects are carried out sequentially, in either order. In some aspects, the same CD4 expression-based selection step used in preparing the CD8+ cell population or subpopulation, also is used to generate the CD4+ cell population or sub- population, such that both the positive and negative fractions from the CD4-based separation are retained and used in subsequent steps of the methods, optionally following one or more further positive or negative selection steps.
[0139] CD4+ T helper cells are sorted into naive, central memory, and effector cells by identifying cell populations that have cell surface antigens. CD4+ lymphocytes can be obtained by standard methods. In some embodiments, naive CD4+ T lymphocytes are CD45RO", CD45RA+, CD62L+, CD4+ T cells. In some embodiments, central memory CD4+ cells are CD62L+ and CD45RO+. In some embodiments, effector CD4+ cells are CD62L" and CD45RO".
[0140] In one example, to enrich for CD4+ cells by negative selection, a monoclonal antibody cocktail typically includes antibodies to CD14, CD20, CDl lb, CD16, HLA-DR, and CD8. In some embodiments, the antibody or binding partner is bound to a solid support or matrix, such as a magnetic bead or paramagnetic bead, to allow for separation of cells for positive and/or negative selection. For example, in some embodiments, the cells and cell populations are separated or isolated using immunomagnetic (or affinitymagnetic) separation techniques (reviewed in Methods in Molecular Medicine, vol. 58: Metastasis Research
Protocols, Vol. 2: Cell Behavior In Vitro and In Vivo, p 17-25 Edited by: S. A. Brooks and U. Schumacher © Humana Press Inc., Totowa, NJ).
[0141] In some aspects, the sample or composition of cells to be separated is incubated with small, magnetizable or magnetically responsive material, such as magnetically responsive particles or microp articles, such as paramagnetic beads (e.g., such as Dynalbeads or MACS beads). The magnetically responsive material, e.g., particle, generally is directly or indirectly attached to a binding partner, e.g., an antibody, that specifically binds to a molecule, e.g., surface marker, present on the cell, cells, or population of cells that it is desired to separate, e.g., that it is desired to negatively or positively select.
[0142] In some embodiments, the magnetic particle or bead contains a magnetically responsive material bound to a specific binding member, such as an antibody or other binding partner. There are many well-known magnetically responsive materials used in magnetic separation methods. Suitable magnetic particles include those described in Molday, U.S. Pat. No. 4,452,773, and in European Patent Specification EP 452342 B, which are hereby
incorporated by reference. Colloidal sized particles, such as those described in Owen U.S. Pat. No. 4,795,698, and Liberti et al., U.S. Pat. No. 5,200,084 are other examples.
[0143] The incubation generally is carried out under conditions whereby the antibodies or binding partners, or molecules, such as secondary antibodies or other reagents, which specifically bind to such antibodies or binding partners, which are attached to the magnetic particle or bead, specifically bind to cell surface molecules if present on cells within the sample.
[0144] In some aspects, the sample is placed in a magnetic field, and those cells having magnetically responsive or magnetizable particles attached thereto will be attracted to the magnet and separated from the unlabeled cells. For positive selection, cells that are attracted to the magnet are retained; for negative selection, cells that are not attracted (unlabeled cells) are retained. In some aspects, a combination of positive and negative selection is performed during the same selection step, where the positive and negative fractions are retained and further processed or subject to further separation steps.
[0145] In certain embodiments, the magnetically responsive particles are coated in primary antibodies or other binding partners, secondary antibodies, lectins, enzymes, or streptavidin. In certain embodiments, the magnetic particles are attached to cells via a coating of primary antibodies specific for one or more markers. In certain embodiments, the cells, rather than the beads, are labeled with a primary antibody or binding partner, and then cell-type specific secondary antibody- or other binding partner (e.g., streptavidin)-coated magnetic particles, are added. In certain embodiments, streptavidin-coated magnetic particles are used in conjunction with biotinylated primary or secondary antibodies.
[0146] In some embodiments, the magnetically responsive particles are left attached to the cells that are to be subsequently incubated, cultured and/or engineered; in some aspects, the particles are left attached to the cells for administration to a patient. In some embodiments, the magnetizable or magnetically responsive particles are removed from the cells. Methods for removing magnetizable particles from cells are known and include, e.g., the use of competing non-labeled antibodies, magnetizable particles or antibodies conjugated to cleavable linkers, etc. In some embodiments, the magnetizable particles are biodegradable.
[0147] In some embodiments, the affinity-based selection is via magnetic-activated cell sorting (MACS) (Miltenyi Biotech, Auburn, CA). Magnetic Activated Cell Sorting (MACS) systems are capable of high-purity selection of cells having magnetized particles attached thereto. In certain embodiments, MACS operates in a mode wherein the non-target and target species are sequentially eluted after the application of the external magnetic field. That is, the cells attached to magnetized particles are held in place while the unattached species are eluted. Then, after this first elution step is completed, the species that were trapped in the magnetic field and were prevented from being eluted are freed in some manner such that they can be eluted and recovered. In certain embodiments, the non-target cells are labelled and depleted from the heterogeneous population of cells.
[0148] In certain embodiments, the isolation or separation is carried out using a system, device, or apparatus that carries out one or more of the isolation, cell preparation, separation, processing, incubation, culture, and/or formulation steps of the methods. In some aspects, the system is used to carry out each of these steps in a closed or sterile environment, for example, to minimize error, user handling and/or contamination. In one example, the system is a system as described in International Patent Application, Publication Number WO2009/072003, or US 20110003380 Al.
[0149] In some embodiments, the system or apparatus carries out one or more, e.g., all, of the isolation, processing, engineering, and formulation steps in an integrated or self-contained system, and/or in an automated or programmable fashion. In some aspects, the system or apparatus includes a computer and/or computer program in communication with the system or apparatus, which allows a user to program, control, assess the outcome of, and/or adjust various aspects of the processing, isolation, engineering, and formulation steps.
[0150] In some aspects, the separation and/or other steps is carried out using CliniMACS system (Miltenyi Biotic), for example, for automated separation of cells on a clinical-scale level in a closed and sterile system. Components can include an integrated microcomputer, magnetic separation unit, peristaltic pump, and various pinch valves. The integrated computer in some aspects controls all components of the instrument and directs the system to perform repeated procedures in a standardized sequence. The magnetic separation unit in some aspects includes a movable permanent magnet and a holder for the selection column. The peristaltic pump controls the flow rate throughout the tubing set and, together with the pinch valves, ensures the controlled flow of buffer through the system and continual suspension of cells.
[0151] The CliniMACS system in some aspects uses antibody-coupled magnetizable particles that are supplied in a sterile, non-pyrogenic solution. In some embodiments, after labelling of cells with magnetic particles the cells are washed to remove excess particles. A cell preparation bag is then connected to the tubing set, which in turn is connected to a bag containing buffer and a cell collection bag. The tubing set consists of pre-assembled sterile tubing, including a pre-column and a separation column, and are for single use only. After initiation of the separation program, the system automatically applies the cell sample onto the separation column. Labelled cells are retained within the column, while unlabeled cells are removed by a series of washing steps. In some embodiments, the cell populations for use with the methods described herein are unlabeled and are not retained in the column. In some embodiments, the cell populations for use with the methods described herein are labeled and are retained in the column. In some embodiments, the cell populations for use with the methods described herein are eluted from the column after removal of the magnetic field, and are collected within the cell collection bag.
[0152] In certain embodiments, separation and/or other steps are carried out using the CliniMACS Prodigy system (Miltenyi Biotec). The CliniMACS Prodigy system in some aspects is equipped with a cell processing unity that permits automated washing and
fractionation of cells by centrifugation. The CliniMACS Prodigy system can also include an onboard camera and image recognition software that determines the optimal cell fractionation endpoint by discerning the macroscopic layers of the source cell product. For example, peripheral blood may be automatically separated into erythrocytes, white blood cells and plasma layers. The CliniMACS Prodigy system can also include an integrated cell cultivation chamber which accomplishes cell culture protocols such as, e.g., cell differentiation and expansion, antigen loading, and long-term cell culture. Input ports can allow for the sterile removal and replenishment of media and cells can be monitored using an integrated microscope. See, e.g., Klebanoff et al. (2012) J Immunother. 35(9): 651-660, Terakuraet al. (2012) Blood.1:72-82, and Wang et al. (2012) J Immunother. 35(9):689-701. [0153] In some embodiments, a cell population described herein is collected and enriched (or depleted) via flow cytometry, in which cells stained for multiple cell surface markers are carried in a fluidic stream. In some embodiments, a cell population described herein is collected and enriched (or depleted) via preparative scale (FACS)-sorting. In certain embodiments, a cell population described herein is collected and enriched (or depleted) by use of
microelectromechanical systems (MEMS) chips in combination with a FACS-based detection system (see, e.g., WO 2010/033140, Cho et al. (2010) Lab Chip 10, 1567-1573; and Godin et al. (2008) J Biophoton. l(5):355-376. In both cases, cells can be labeled with multiple markers, allowing for the isolation of well-defined T cell subsets at high purity.
[0154] In some embodiments, the antibodies or binding partners are labeled with one or more detectable marker, to facilitate separation for positive and/or negative selection. For example, separation may be based on binding to fluorescently labeled antibodies. In some examples, separation of cells based on binding of antibodies or other binding partners specific for one or more cell surface markers are carried in a fluidic stream, such as by fluorescence- activated cell sorting (FACS), including preparative scale (FACS) and/or
microelectromechanical systems (MEMS) chips, e.g., in combination with a flow-cytometric detection system. Such methods allow for positive and negative selection based on multiple markers simultaneously.
[0155] In some embodiments, the preparation methods include steps for freezing, e.g., cryopreserving, the cells, either before or after isolation, incubation, and/or engineering. In some embodiments, the freeze and subsequent thaw step removes granulocytes and, to some extent, monocytes in the cell population. In some embodiments, the cells are suspended in a freezing solution, e.g., following a washing step to remove plasma and platelets. Any of a variety of known freezing solutions and parameters in some aspects may be used. One example involves using PBS containing 20% DMSO and 8% human serum albumin (HSA), or other suitable cell freezing media. This is then diluted 1: 1 with media so that the final concentration of DMSO and HSA are 10% and 4%, respectively. The cells are then frozen to -80° C. at a rate of 1° per minute and stored in the vapor phase of a liquid nitrogen storage tank.
[0156] In some embodiments, the cells are incubated and/or cultured prior to or in connection with genetic engineering. The incubation steps can include culture, cultivation, stimulation, activation, and/or propagation. In some embodiments, the compositions or cells are incubated in the presence of stimulating conditions or a stimulatory agent. Such conditions include those designed to induce proliferation, expansion, activation, and/or survival of cells in the population, to mimic antigen exposure, and/or to prime the cells for genetic engineering, such as for the introduction of a recombinant antigen receptor.
[0157] The conditions can include one or more of particular media, temperature, oxygen content, carbon dioxide content, time, agents, e.g., nutrients, amino acids, antibiotics, ions, and/or stimulatory factors, such as cytokines, chemokines, antigens, binding partners, fusion proteins, recombinant soluble receptors, and any other agents designed to activate the cells.
[0158] In some embodiments, the stimulating conditions or agents include one or more agent, e.g., ligand, which is capable of activating an intracellular signaling domain of a TCR complex. In some aspects, the agent turns on or initiates TCR/CD3 intracellular signaling cascade in a T cell. Such agents can include antibodies, such as those specific for a TCR component and/or costimulatory receptor, e.g., anti-CD3, anti-CD28, for example, bound to solid support such as a bead, and/or one or more cytokines. Optionally, the expansion method may further comprise the step of adding anti-CD3 and/or anti CD28 antibody to the culture medium (e.g., at a concentration of at least about 0.5 ng/ml). In some embodiments, the stimulating agents include IL-2 and/or IL-15, for example, an IL-2 concentration of at least about 10 units/mL.
[0159] In some aspects, incubation is carried out in accordance with techniques such as those described in US Patent No. 6,040,1 77 to Riddell et al., Klebanoff et al.(2012) J
Immunother. 35(9): 651-660, Terakuraet al. (2012) Blood.1:72-82, and/or Wang et al. (2012) J Immunother. 35(9):689-701.
[0160] In some embodiments, the T cells are expanded by adding to the composition feeder cells, such as non-dividing peripheral blood mononuclear cells (PBMC), (e.g., such that the resulting population of cells contains at least about 5, 10, 20, or 40 or more PBMC feeder cells for each T lymphocyte in the initial population to be expanded); and incubating the culture (e.g. for a time sufficient to expand the numbers of T cells). In some aspects, the non-dividing feeder cells can comprise gamma- irradiated PBMC feeder cells. In some embodiments, the PBMC are irradiated with gamma rays in the range of about 3000 to 3600 rads to prevent cell division. In some aspects, the feeder cells are added to culture medium prior to the addition of the populations of T cells.
[0161] In some embodiments, the stimulating conditions include temperature suitable for the growth of human T lymphocytes, for example, at least about 25 degrees Celsius, generally at least about 30 degrees, and generally at or about 37 degrees Celsius. Optionally, the incubation may further comprise adding non-dividing EBV-transformed lymphoblastoid cells (LCL) as feeder cells. LCL can be irradiated with gamma rays in the range of about 6000 to 10,000 rads. The LCL feeder cells in some aspects is provided in any suitable amount, such as a ratio of LCL feeder cells to initial T lymphocytes of at least about 10: 1.
[0162] In embodiments, antigen- specific T cells, such as antigen-specific CD4+ and/or CD8+ T cells, are obtained by stimulating naive or antigen specific T lymphocytes with antigen. For example, antigen- specific T cell lines or clones can be generated to cytomegalovirus antigens by isolating T cells from infected subjects and stimulating the cells in vitro with the same antigen.
B. Apparatus and Articles of Manufactures
[0163] In some embodiments, also provided is an apparatus or article of manufacture. In some embodiments, provided is an arrangement of a bioreactor and a first stationary phase for chromatography. The bioreactor is suitable for the expansion of cells, and the stationary phase is suitable for cell separation and removal of reagents. The first stationary phase is a gel filtration matrix and/or affinity chromatography matrix, wherein the gel filtration and/or affinity chromatography matrix comprises an affinity reagent, wherein the affinity reagent comprises a binding site Zl specifically binding to a binding partner CI comprised in a first agent and/or the affinity reagent comprises a binding site Z2 specifically binding to a binding partner C2 comprised in a second agent. The first stationary phase is thereby being suitable of immobilizing thereon the first agent and/or the second agent, the first binding partner CI and/or the free second binding partner C2. In addition the bioreactor and the stationary phase are fluidly connected. This arrangement can be used in the serial expansion as explained above and can be integrated into known cell expansion systems such as the Quantum® cell expansion system) or the Xuri Cell Expansion System W25.
[0164] In this arrangement the first stationary phase is either comprised in a chromatography column or is a planar stationary phase. The arrangement may further comprise a second stationary phase which is fluidly connected to the first stationary phase. The secondary stationary phase may be a gel filtration matrix and/or affinity chromatography matrix, wherein the gel filtration and/or affinity chromatography matrix comprises an affinity reagent. This affinity reagent may comprise a binding partner D that (specifically) binds to the binding site Zl of the multimerization reagent, thereby being suitable of immobilizing the multimerization reagent on the stationary phase.
[0165] The invention is further directed to an apparatus for purification (e.g. selection) and culture, such as stimulation or expansion, of a composition of cells, the apparatus comprising at least one arrangement of a bioreactor and a first stationary phase or a second stationary phase for chromatography as defined above.
[0166] The apparatus may further comprise a plurality of arrangements of a bioreactor and a stationary phase being fluidly connected in series.
[0167] The apparatus may comprise a sample inlet being fluidly connected to the bioreactor of the arrangement of a bioreactor and the stationary phase for chromatography. The apparatus may also comprise a sample outlet for purified and expanded target cells, the sample outlet being fluidly connected to the stationary phase of the last of the at least one arrangement of a bioreactor and the stationary phase for chromatography.
[0168] Finally, the apparatus may be designed as a functionally closed system.
C. Exemplary Features of Cultured Cells
[00153] In some embodiments, the cultured target cells, (e.g. cultured T cells), which can include cultured cells generated or produced in accord with the methods provided herein, exhibit one or more specified phenotypic and/or functional features, based on or related to their proliferation capacity, surface marker expression, differentiation state, activation state and/or metabolic profile. In some embodiments, the culturing of the target cells (e.g. culturing of T cells) in accord with any of the provided methods results in a change in a parameter associated with the function (e.g. increase or decrease of a functional activity) or phenotype (e.g. higher or lower expression of a marker or markers) of cells compared to the corresponding or respective function or phenotype of cells in the composition prior to incubation in accord with methods provided herein. In some embodiments, the cultured T cells exhibit the change with respect to a parameter from among expansion and/or proliferation capacity, CD4+/CD8+ T cell distribution or ratio, surface marker expression, functional activity, or metabolic profile.
[00154] In some embodiments, the change in the parameter as measured in the cultured T cells is compared or with reference to the same or similar parameter as measured in a reference T cell composition or preparation. Typically, T cells in the reference T cell composition or preparation include or are derived from the same or substantially the same composition of T cells prior to incubation with the reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin), except such cells were not subject to the incubation or were subject to a different incubation. In some embodiments, the reference T cell preparation is subject to the incubation using substantially the same protocol or conditions (e.g. type of stimulatory agents or agent, format of stimulatory agent or agents, substantially the same starting cell numbers, washes, presence or absence of additional reagents, timing of incubation, temperature of incubation), except at least one aspect, and in some cases only one aspect, of such incubation in a reference T cell preparation is different than in the incubation producing the cultured T cells.
[00155] In some embodiments, the reference T cell composition or preparation is the composition containing T cells prior to incubation with a reversibly-bound agent (e.g.
multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin).
[00156] In some embodiments, the cultured T cells are generated by incubation with a reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin) for less than 5 days and/or where the association of such agent with one or more molecules on the cell is disrupted (e.g. in the presence of a competition reagent, e.g. biotin or a biotin analog), such as disrupted with 5 days of initiation of incubation with such agent. For example, in some aspects, cultured T cells are generated or produced following incubation with a reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin) as described herein, wherein the incubation is terminated and/or disrupted within 5 days after initiation of such incubation (such as within or about 4, 3, 2, or 1 day, or less), and/or where a competing agent (e.g. biotin) that dissociates the reversibly-bound agent from the cells is added to the incubated cells within 5 days after initiation of such incubation (such as within or about 4, 3, 2, or 1 day, or less). In some embodiments, the reference T cell preparation is generated or produced following incubation with the same or substantially the same reversibly- bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin), but where the incubation is performed for greater than 5 days, is not terminated and/or disrupted to lessen or terminate the signal induced or modulated in the cell, and/or where the T cell preparation is produced without the addition of a competing agent (e.g. biotin or biotin analog) that dissociates the reagent from the cells. [00157] In some embodiments, the cultured T cells are generated by incubation with a reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin) in which the receptor-binding agent (e.g. stimulatory agent) is one that does not bind to CD28 and/or induce signaling, i.e. is not an anti- CD28 antibody or fragment thereof. For example, in some embodiments, the cultured T cells are produced or generated following incubation with a reversibly-bound reagent in which one or more stimulatory agents are reversibly bound to a mutein streptavidin in which at least one stimulatory agent is specific for CD3 (e.g. anti-CD3 antibody or fragment thereof) and a second stimulatory agent can be specific for one or more of CD90, CD95, CD137, CD154, ICOS, LAT, CD27, OX40 or HVEM (e.g. an anti-CD90 antibody, an anti-CD95 antibody, an anti-CD137 antibody, and an anti-CD 154 antibody, anti-ICOS antibody, anti-LAT antibody, anti-CD27 antibody, anti-OX40 antibody or anti-HVEM antibody, respectively, or antigen-binding fragments thereof). In some embodiments, the reference T cell preparation is a T cell culture generated or produced following incubation with a reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin), but where the reagent comprises an agent that specifically binds CD28 and/or induces or modulates CD28 signaling. For example, in some embodiments, the reference T cell preparation is generated or produced following incubation of a T cell composition with anti- CD3/anti-CD28 Dynabeads®, anti-CD3/anti-CD28 ExPact® beads or other anti-CD3/anti-CD28 stimulatory agent. In some embodiments, such other anti-CD3/anti-CD28 stimulatory agent is one in which the antibody reagents are bound to a support (e.g. solid support), e.g. a bead, particle, magnetic particle or bead, nanoparticle or microsphere. In some embodiments, the cultured T cells are prepared by incubation with a reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin) that is soluble, i.e. not bound to a support (e.g. solid support).
[00158] For example, in some embodiments, there are provided cultured T cells, such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein streptavidin), in which the cultured T cells are characterized by an enhanced expansion and/or proliferation capacity compared to a reference T cell composition or preparation. In some embodiments, the enhanced expansion and/or proliferation capacity comprises an increase in the number or percentage of CD3+ T cells, CD4+ T cells, and/or CD8+ T cells in the cultured T cells by at least about 2-fold (such as by at least about any of 3-fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD3+ T cells, CD4+ T cells, and/or CD8+ T cells, respectively, in the reference T cell composition or preparation.
[00159] In some embodiments, there are provided cultured T cells, such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g.
multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin), in which the cultured T cells are characterized by an enhanced expansion and/or proliferation capacity of CD3+ T cells compared to a reference T cell culture. In some embodiments, the enhanced expansion and/or proliferation capacity comprises an increase in the number or percentage of CD3+ T cells in the cultured T cells by at least about 2- fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD3+ T cells in the reference T cell composition or preparation.
[00160] In some embodiments, there are provided cultured T cells, such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g.
multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin), in which the cultured T cells are characterized by an enhanced expansion and/or proliferation capacity of CD4+ T cells compared to a reference T cell composition or preparation. In some embodiments, the enhanced expansion and/or proliferation capacity comprises an increase in the number or percentage of CD4+ T cells in the cultured T cells by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7- fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD4+ T cells in the reference T cell composition or preparation.
[00161] In some embodiments, there are provided cultured T cells, such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g.
multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin), in which the cultured T cells are characterized by an enhanced expansion and/or proliferation capacity of CD8+ T cells compared to a reference T cell composition or preparation. In some embodiments, the enhanced expansion and/or proliferation capacity comprises an increase in the number or percentage of CD8+ T cells in the cultured T cells by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7- fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD8+ T cells in the reference T cell composition or preparation.
[00162] In some embodiments, there are provided cultured T cells, such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g.
multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin), in which the cultured T cells are characterized by an altered CD8+/CD4+ T cell distribution or normalized T cell distribution, such as an altered
CD8+/CD4+ ratio or normalized CD8+/CD4+ T cell ratio, compared to a reference T cell composition or preparation. The CD8+/CD4+ ratio or normalized ratio can be increased or decreased. In some embodiments, the altered CD8+/CD4+ T cell ratio results from an increase in the number or percentage or normalized number or percentage of CD8+ T cells in the cultured T cells relative or compared to the number or percentage or normalized number or percentage in a reference composition or preparation. In some embodiments, number of CD8+ T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of CD8+ T cells or the normalized number or percentage of CD8+ T cells in the reference T cell composition or preparation. In some embodiments, the ratio of CD8+/CD4+ T cells or the normalized ratio of CD8+/CD4+ is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the ratio of CD8+/CD4+ T cells or the normalized ratio of CD8+/CD4+ in the reference T cell composition or preparation. In some embodiments, the number, percentage or ratio in the cultured T cells or in a composition or preparation is normalized to the number, percentage or ratio in the starting composition containing the T cells prior to the incubation.
[00163] In some embodiments, there are provided cultured T cells prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation with a reversibly-bound agent as described herein (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin), and wherein the cultured T cells are characterized by an altered surface marker expression profile compared to a reference T cell composition or preparation. In some embodiments, the altered surface marker expression profile is due to a change in the number or percentage of one or more subsets of T cells that are positive, negative or low for one or more surface markers selected from CD45RA, CD45RO, CD62L, CD69, CCR7, CD27, CD28, CD122, t-bet, IL-7Ra, CD95, IL-2RP, CXCR3, LFA-1, KLRG1. In some embodiments, the number or percentage of the T cell subset in the cultured T cells is increased at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference
composition or preparation.
[00164] In some embodiments, the T cell subset in the cultured T cells (e.g. a T cell subset that is increased in the cultured T cells compared to the reference composition or preparation) exhibits a decreased or reduced differentiation or activation state compared to the reference T cell composition or preparation. In some embodiments, the T cell subset is not or does not include an effector T cell (TE) or effector memory T cell (TEM) phenotype. In some
embodiments, the subset of T cells contains a surface phenotype that is one or more of CD62L+, CCR7+, CD27+, CD28+, or KLRGllow/". In some embodiments, such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
[00165] In some embodiments, the T cell subset in the cultured T cells (e.g. a T cell subset that is increased in the cultured T cells compared to the reference composition or preparation) is positive for CD62L and/or IL-7Ra (CD 127) and/or negative or low for t-bet. In some embodiments, the subset of T cells is positive for CD45RA and/or negative or low for CD45RO. In some embodiments, the subset of T cells is positive for one or more of CCR7, CD45RA, CD62L, CD27, CD28, IL-7Ra (CD 127), CD95, IL-2RP, CXCR3, and LFA-1, and/or negative for CD45RO. In some embodiments, such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8- fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
[00166] In some embodiments, the T cell subset in the cultured T cells (e.g. a T cell subset that is increased in the cultured T cells compared to the reference composition or preparation) is or includes cells that are positive for CD62L (CD62L+). In some embodiments, such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
[00167] In some embodiments, the T cell subset in the cultured T cells (e.g. a T cell subset that is increased in the cultured T cells compared to the reference composition or preparation) is or includes cells that are CD62L+ and a) any one or more of CD45RA low/+, CD45RO low/+, CCR7+ and CD27+ and b) any one or more of t-betlow, IL-7Ra+ (CD127+), CD95+, IL-2RP+, CXCR3+ and LFA-1+. In some embodiments, the T cell subset also can be CD3+, CD4+, or CD8+. In some embodiments, such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9- fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
[00168] In some embodiments, the T cell subset, such as a CD62L+ T cell subset, in the cultured T cells are or include or share phenotypic characteristics with memory T cells or particular subsets thereof, such as long-lived memory T cells. In some embodiments, such memory T cells are central memory T cells (Tcm) or T memory stem cells (Tscm) cells. In some embodiments, the memory T cells are Tscm cells. Tscm cells may be described as having one or more phenotypic differences or functional features compared to other memory T cell subsets or compared to naive T cells, such as being less differentiated or more naive (see e.g., Ahlers and Belyakov (2010) Blood, 115: 1678); Cieri et al. (2015) Blood, 125:2865; Flynn et al. (2014) Clinical & Translational Immunology, 3, e20; Gattinoni et al. (2012) Nat. Med., 17: 1290-1297; Gattinoni et al. (2012) Nat. Reviews, 12:671; Li et al. (2013) PLOS ONE, 8:e67401; and published PCT Appl. No. WO2014/039044). In some cases, Tscm cells are thought to be the only memory T cells able to generate effector T cells and all three subsets of memory T cells (Tscm, Tcm, and Tern). In some aspects, Tscm cells have the highest survival and proliferation response to antigenic or homeostatic stimuli of all the memory T cell subsets, and the least attrition absent cognate antigen. In some embodiments, the less-differentiated Tscm cells may exhibit greater expansion, long-term viability, and target cell destruction following adoptive transfer than other memory T cells, and thus may be able to mediate more effective treatment with fewer transferred cells than would be possible for either Tcm or Tern cells. [00169] In some aspects, examples of phenotypic or functional features that have been reported or are known for Tscm cells include, for example, that such cells a) are CD45RO", CCR7+, CD45RA+, CD62L+, CD27+, CD28+, IL-7Ra+, CD95+, IL-2Rp+, CXCR3+, and LFA-1+; b) are CD45RA+, CCR7+, CD62L+, and CD95+; c) are CD45RA+, CD45RO+, CCR7+, CD62L+, CD27+, CD28+, CD95+, and IL-2Rp+; d) are CD45RO", CD45RA+, CCR7+, CD62L+, CD27+, CD28+, CD127+, and CD95+; e) are CD45RA+, CD44+/", CD62L+, CD127+, IL-2Rp+, CD28+, CD43", KLRGl", Peforin", and GranzymeB"; f) express high levels of CCR7, CD62L, CD27, and CD28, intermediate levels of CD95 and IL-2RP, low levels of CD45RA, and do not express CD45RO or KLRG-1; or g) express high levels of CD62L, low levels of CD44 and t-bet, and are Sca-1+; and/or have intermediate IL-2 -producing capacity, low IFNy-producing capacity, low cytotoxicity, and high self -renewal capacity.
[00170] In some embodiments, the T cell subset in the cultured T cells (e.g. a T cell subset that is increased in the cultured T cells compared to the reference composition or preparation) is or includes memory T cells, such as long-lived memory T cells. In some embodiments, the memory T cells are central memory (Tcm) T cells. In some embodiments, the T cell subset has a phenotypic characteristic CD45RA-, CD45R0low/+, CCR7+, CD62L+, CD27+, CD28+, CD95+ CD 122+ and/or KLGRllow. In some embodiments, such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4- fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell composition or culture.
[00171] In some embodiments, the memory T cells are stem central memory (Tscm) T cells. In some embodiments, the T cell subset has a phenotypic characteristic CD45RAlow/+,
CD45R0low/+, CCR7+, CD62L+, CD27+, CD28+, CD95+, CD122+ and/or KLGR1-. In some embodiments, the T cell subset has a phenotypic characteristic CD45RAlow/+, CD45RO", CCR7+, CD62L+, CD27+, CD28+, CD95+, CD122+ and/or KLGR1-. In some embodiments, the T cell subset has a phenotypic characteristic CD45RO", CCR7+, CD45RA+, CD62L+, CD27+, CD28+, IL-7Ra+, CD95+, IL-2Rp+, CXCR3+, and/or LFA-1+. In some embodiments, the T cell subset has a phenotypic characteristic CD45RA+, CCR7+, CD62L+, and/or CD95+. In some embodiments, the T cell subset has a phenotypic characteristic CD45RA+, CD45RO+, CCR7+, CD62L+, CD27+, CD28+, CD95+, and/or IL-2Rp+. In some embodiments, the T cell subset has a phenotypic characteristic CD45RO", CD45RA+, CCR7+, CD62L+, CD27+, CD28+, CD127+, and/or CD95+. In some embodiments, the T cell subset has a phenotypic characteristic CD45RA+, CD44+/", CD62L+, CD127+, IL-2Rp+, CD28+, CD43", KLRG1", Peforin , and/or GranzymeB". In some embodiments, the T cell subset expresses high levels of CCR7, CD62L, CD27, and/or CD28, intermediate levels of CD95 and/or IL-2RP, low levels of CD45RA, and/or does not express CD45RO and/or KLRG-1. In some embodiments, the T cell subset expresses high levels of CD62L, low levels of CD44 and t-bet, and/or is Sca-1+. In some embodiments, the T cell subset has a phenotypic characteristic intermediate IL-2 -producing capacity, low IFNy- producing capacity, low cytotoxicity, and/or high self -renewal capacity. In some embodiments, such a subset of T cells in the cultured T cells is increased by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold, or more) compared to the number or percentage of the subset of T cells in the reference T cell
composition or culture.
[00172] In some embodiments, the subset of T cells, such as any subset of T cells described above, is present at a greater percentage of the total T cells in the cultured T cells or a greater number of total T cells in the cultured T cells compared to a reference T cell composition or preparation. In some embodiments, the percentage of the T cell subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more, n some embodiments, the percentage of the T cell subset in the cultured cells, such as any T cell subset described above, is greater, e.g. at least 1.5-fold greater, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold or more greater, than the corresponding percentage of the subset of cells in a T cell in a T cell composition isolated or enriched directly from a human subject based on surface expression of one or markers comprising the phenotype, but without the incubation or culture. In some embodiments, the total number, relative number or normalized number of the T cells subset in the cultured cells, such as any T cell subset described above, is greater, e.g. at least 1.5-fold greater, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold or more greater, than the number, relative number or normalized number of the T cell subset in a reference T cell composition or preparation, such as any reference T cell composition or preparation described above, e.g. the T cell composition prior to the incubation with the reversibly-bound agent (e.g. multimerized agent, such as incubation with a stimulatory agent reversibly bound to an oligomeric mutein strep tavidin) in accord with any of the methods provided herein. In some embodiments, the number of T cells corresponding to the T cell subset present in the T cell culture is at least or at least about 1 xlO6 cells, 2 xlO6 cells, 3 x 106 cells, 4 x 106 cells, 5 x 106 cells or more.
[00173] In some embodiments, the T cell subset is CD62L+ and/or IL-7Ra+ (CD 127+) and the percentage of the CD62L+ and/or IL-7Ra+ (CD 127+) subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more. In some embodiments, the T cell subset is CD45RA-, CD45R0low/+, and/or KLRGllow and the percentage of the CD45RA-,
CD45R0low/+, and/or KLRGllow subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more. In some embodiments, the T cell subset is CD45RA low/+,
CD45R0low/+, and/or KLRG1" and the percentage of the CD45RA low/+, CD45R0low/+, and/or KLRG1" subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
[00174] In some embodiments, the T cell subset is or includes Tcm cells. In some embodiments, the percentage of the Tcm subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
[00175] In some embodiments, the T cell subset is or includes Tscm cells. In some embodiments, the percentage of the Tscm subset in the cultured T cells as a percentage of the total T cells or total cells in the culture is at least 35%, 40%, 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 95% or more.
[00176] In some embodiments, the subset of T cells, such as CD62L+ T cells, have or exhibit a) a low level of TCR rearrangement excisions circles (TREC); and/or b) express a proliferation marker (e.g., Ki-67); and/or c) exhibit the capacity to proliferate in the presence of a stimulatory agent; and/or d) exhibit a capacity to produce a cytokine selected from among IFN-gamma, TNF and IL-2 in the presence of a stimulatory agent; and/or e) are refractory to attrition in the absence of a stimulatory agent; and/or f) are able to generate Tscm, Tcm, Tern, and Teff cells; and/or g) have low cytotoxicity; and/or h) can produce the same or greater response following adoptive transfer of fewer cells than with Tcm or Tern cells. In some embodiments, the stimulatory agent is an antigen, a homeostatic cytokine (e.g. , IL- 15 or IL- 17), or is an agent that is capable of initiating a TCR/CD3 complex-associated signal in the T cells. In some embodiments, the capacity to produce a cytokine comprises a low capacity to produce IFNy and/or an intermediate capacity to produce IL-2.
[00177] In some embodiments, there are provided cultured T cells, such as prepared according to any of the methods provided herein, wherein the cultured T cells are generated or produced following incubation as described herein, and wherein the cultured T cells are characterized by a modified functional activity profile compared to a reference T cell composition or preparation. In some embodiments, the cultured T cells or a specific subset of T cells present in the culture exhibits an altered functional activity profile compared to a reference composition or preparation or compared to the subset of T cells in the reference composition or preparation, such as a functional activity that is altered (e.g. increased or decreased) at least 1.5- fold, 2-fold, 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9-fold, 10-fold. In some embodiments, the functional activity is selected from one or more of a) a low level of TCR rearrangement excisions circles (TREC); and/or b) expression of a proliferation marker (e.g. , Ki-67); and/or c) the capacity to proliferate in the presence of a stimulatory agent; and/or d) the capacity to produce a cytokine selected from among IFN-gamma, TNF and IL-2 in the presence of a stimulatory agent; and/or e) are refractory to attrition in the absence of a stimulatory agent; and/or f) are able to generate Tscm, Tcm, Tern, and Teff cells; and/or g) have low cytotoxicity. In some embodiments, the stimulatory agent is an antigen, a homeostatic cytokine (e.g. , IL-15 or IL- 17), or is an agent that is capable of initiating a TCR/CD3 complex-associated signal in the T cells. In some embodiments, the capacity to produce a cytokine comprises a low capacity to produce IFNy and/or an intermediate capacity to produce IL-2. In some embodiments, the subset of T cells comprises memory T cells, such as long-lived memory T cells, in the cultured T cells. In some embodiments, the memory T cells are Tscm cells
[00178] In some embodiments, the cultured T cells or a specific subset of T cells present in the culture can produce the same or greater response following adoptive transfer of fewer cells than can be achieved by a reference composition or preparation or by the subset of T cells in the reference composition or preparation. In some embodiments, such response is achieved with at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8-fold, 9- fold, 10-fold, or more) fewer cells. In some embodiments, the response is increased or is greater by at least about 2-fold (such as by at least about any of 3-fold, 4-fold, 5-fold, 6-fold, 7-fold, 8- fold, 9-fold, 10-fold, or more). [00179] In some embodiments, the percentage of the T cell subset in the cultured cells, such as any T cell subset described above, is greater, e.g. at least 1.5-fold greater, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold or more greater, than the corresponding subset of cells in a preparation of T cells that were incubated in the presence of a GSK-P inhibitor. In some embodiments, the composition of cultured T cells does not contain a GSK-P inhibitor.
[00180] In some embodiments, the percentage of the T cell subset in the cultured cells, such as any T cell subset described above, is greater, e.g. at least 1.5-fold greater, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold or more greater, than the corresponding subset of cells that were incubated in the presence of a recombinant homeostatic cytokine, optionally IL-7 or IL-15. In some embodiments, the composition of cultured T cells does not contain a
recombinant (e.g. exogenous) IL-7 cytokine or a recombinant (e.g. exogenous) IL-15 cytokine.
[00181] In some embodiments, the composition of cultured T cells was produced or generated in accord with any of the methods provided herein in which a substance, such as a competition agent, was added to T cells to disrupt, such as to lessen and/or terminate, the signaling of the stimulatory agent or agents. In some embodiments, the composition of cultured T cells contains the presence of a substance, such as a competition agent, e.g. biotin or a biotin analog, e.g. D- Biotin. In some embodiments, the substance, such as a competition agent, e.g. biotin or a biotin analog, e.g. D-Biotin, is present in an amount that is at least 1.5-fold greater, at least 2-fold, at least 3-fold, at least 4-fold, at least 5-fold, at least 10-fold, at least 100-fold, at least 1000-fold or more greater than the amount of the substance in a reference composition or preparation of cultured T cells in which the substance was not added exogenously during the incubation. In some embodiments, the amount of the substance, such as a competition agent, e.g. biotin or a biotin analog, e.g. D-Biotin, in the composition of cultured T cells is from or from about 10 μΜ to 100 μΜ, 100 μΜ to 1 mM, 100 μΜ to 500 μΜ or 10 μΜ to 100 μΜ.
IV. Methods of Genetically Engineering Cultured Cells, Antigen Receptors and
Genetically Engineered Cells
[0100] In some embodiments, the cultured cells contain or are engineered to contain an engineered receptor, e.g., an engineered antigen receptor, such as a chimeric antigen receptor (CAR), or a T cell receptor (TCR). Also provided are populations of such cells, compositions containing such cells and/or enriched for such cells, such as in which cells of a certain type such as T cells or CD8+ or CD4+ cells are enriched or selected. Among the compositions are pharmaceutical compositions and formulations for administration, such as for adoptive cell therapy. Also provided are therapeutic methods for administering the cells and compositions to subjects, e.g., patients.
[0101] Thus, in some embodiments, the cultured cells include one or more nucleic acids introduced via genetic engineering, and thereby express recombinant or genetically engineered products of such nucleic acids. In some embodiments, gene transfer is accomplished by first stimulating the cultured cells, such as by combining it with a stimulus that induces a response such as proliferation, survival, and/or activation, e.g., as measured by expression of a cytokine or activation marker, followed by transduction of the activated cells, and expansion in culture to numbers sufficient for clinical applications.
[0102] In some contexts, overexpression of a stimulatory factor (for example, a lymphokine or a cytokine) may be toxic to a subject. Thus, in some contexts, the engineered cells include gene segments that cause the cells to be susceptible to negative selection in vivo, such as upon administration in adoptive immunotherapy. For example, in some aspects, the cultured cells are engineered so that they can be eliminated as a result of a change in the in vivo condition of the patient to which they are administered. The negative selectable phenotype may result from the insertion of a gene that confers sensitivity to an administered agent, for example, a compound. Negative selectable genes include the Herpes simplex virus type I thymidine kinase (HSV-I TK) gene (Wigler et al., Cell II: 223, 1977) which confers ganciclovir sensitivity; the cellular hypoxanthine phosphribosyltransferase (HPRT) gene, the cellular adenine
phosphoribosyltransferase (APRT) gene, bacterial cytosine deaminase, (Mullen et al., Proc. Natl. Acad. Sci. USA. 89:33 (1992)). In some aspects, the cultured cells further are engineered to promote expression of cytokines or other factors.
A. Nucleic acids encoding Antigen Receptors, e.g. chimeric antigen receptors
[0103] Provided are methods, nucleic acids, compositions, and kits for producing the genetically engineered cells. The genetic engineering generally involves introduction of a nucleic acid encoding the recombinant or engineered component into a composition containing the cultured cells, such as by retroviral transduction, transfection, or transformation.
[0104] In some embodiments, the nucleic acids are heterologous, i.e., normally not present in a cell or sample obtained from the cell, such as one obtained from another organism or cell, which for example, is not ordinarily found in the cell being engineered and/or an organism from which such cell is derived. In some embodiments, the nucleic acids are not naturally occurring, such as a nucleic acid not found in nature, including one comprising chimeric combinations of nucleic acids encoding various domains from multiple different cell types.
1. Chimeric Antigen Receptors ( CARs )
[0105] The cells generally express recombinant receptors, such as antigen receptors including functional non-TCR antigen receptors, e.g., chimeric antigen receptors (CARs), and other antigen-binding receptors such as transgenic T cell receptors (TCRs). Also among the receptors are other chimeric receptors.
[0106] Exemplary antigen receptors, including CARs, and methods for engineering and introducing such receptors into cells, include those described, for example, in international patent application publication numbers WO200014257, WO2013126726, WO2012/129514, WO2014031687, WO2013/166321, WO2013/071154, WO2013/123061 U.S. patent application publication numbers US2002131960, US2013287748, US20130149337, U.S. Patent Nos.: 6,451,995, 7,446,190, 8,252,592, , 8,339,645, 8,398,282, 7,446,179, 6,410,319, 7,070,995, 7,265,209, 7,354,762, 7,446,191, 8,324,353, and 8,479,118, and European patent application number EP2537416,and/or those described by Sadelain et al., Cancer Discov. 2013 April; 3(4): 388-398; Davila et al. (2013) PLoS ONE 8(4): e61338; Turtle et al., Curr. Opin. Immunol., 2012 October; 24(5): 633-39; Wu et al., Cancer, 2012 March 18(2): 160-75. In some aspects, the antigen receptors include a CAR as described in U.S. Patent No.: 7,446,190, and those described in International Patent Application Publication No.: WO/2014055668 Al. Examples of the CARs include CARs as disclosed in any of the aforementioned publications, such as
WO2014031687, US 8,339,645, US 7,446,179, US 2013/0149337, U.S. Patent No.: 7,446,190, US Patent No.: 8,389,282, Kochenderfer et al., 2013, Nature Reviews Clinical Oncology, 10, 267-276 (2013); Wang et al. (2012) J. Immunother. 35(9): 689-701; and Brentjens et al., Sci Transl Med. 2013 5(177). See also WO2014031687, US 8,339,645, US 7,446,179, US
2013/0149337, U.S. Patent No.: 7,446,190, and US Patent No.: 8,389,282. The chimeric receptors, such as CARs, generally include an extracellular antigen binding domain, such as a portion of an antibody molecule, generally a variable heavy (VH) chain region and/or variable light (VL) chain region of the antibody, e.g., an scFv antibody fragment.
[0107] In some embodiments, the antigen targeted by the receptor is a polypeptide. In some embodiments, it is a carbohydrate or other molecule. In some embodiments, the antigen is selectively expressed or overexpressed on cells of the disease or condition, e.g., the tumor or pathogenic cells, as compared to normal or non-targeted cells or tissues. In other embodiments, the antigen is expressed on normal cells and/or is expressed on the engineered cells.
[0108] Antigens targeted by the receptors in some embodiments include orphan tyrosine kinase receptor ROR1, tEGFR, Her2, Ll-CAM, CD 19, CD20, CD22, mesothelin, CEA, and hepatitis B surface antigen, anti-folate receptor, CD23, CD24, CD30, CD33, CD38, CD44, EGFR, EGP-2, EGP-4, 0EPHa2, ErbB2, 3, or 4, FBP, fetal acethycholine e receptor, GD2, GD3, HMW-MAA, IL-22R- alpha, IL-13R-alpha2, kdr, kappa light chain, Lewis Y, LI -cell adhesion molecule, MAGE-A1, mesothelin, MUC1, MUC16, PSCA, NKG2D Ligands, NY-ESO-1, MART-1, gplOO, oncofetal antigen, ROR1, TAG72, VEGF-R2, carcinoembryonic antigen (CEA), prostate specific antigen, PSMA, Her2/neu, estrogen receptor, progesterone receptor, ephrinB2, CD123, c-Met, GD-2, and MAGE A3, CE7, Wilms Tumor 1 (WT-1), a cyclin, such as cyclin Al (CCNA1), and/or biotinylated molecules, and/or molecules expressed by HIV, HCV, HBV or other pathogens.
[0109] In some embodiments, the CAR binds a pathogen- specific antigen. In some embodiments, the CAR is specific for viral antigens (such as HIV, HCV, HBV, etc.), bacterial antigens, and/or parasitic antigens.
[0110] In some embodiments, the antibody portion of the recombinant receptor, e.g., CAR, further includes at least a portion of an immunoglobulin constant region, such as a hinge region, e.g., an IgG4 hinge region, and/or a CH1/CL and/or Fc region. In some embodiments, the constant region or portion is of a human IgG, such as IgG4 or IgGl. In some aspects, the portion of the constant region serves as a spacer region between the antigen-recognition component, e.g., scFv, and transmembrane domain. The spacer can be of a length that provides for increased responsiveness of the cell following antigen binding, as compared to in the absence of the spacer. Exemplary spacers, e.g., hinge regions, include those described in international patent application publication number WO2014031687. In some examples, the spacer is or is about 12 amino acids in length or is no more than 12 amino acids in length. Exemplary spacers include those having at least about 10 to 229 amino acids, about 10 to 200 amino acids, about 10 to 175 amino acids, about 10 to 150 amino acids, about 10 to 125 amino acids, about 10 to 100 amino acids, about 10 to 75 amino acids, about 10 to 50 amino acids, about 10 to 40 amino acids, about 10 to 30 amino acids, about 10 to 20 amino acids, or about 10 to 15 amino acids, and including any integer between the endpoints of any of the listed ranges. In some
embodiments, a spacer region has about 12 amino acids or less, about 119 amino acids or less, or about 229 amino acids or less. Exemplary spacers include IgG4 hinge alone, IgG4 hinge linked to CH2 and CH3 domains, or IgG4 hinge linked to the CH3 domain.
[0111] This antigen recognition domain generally is linked to one or more intracellular signaling components, such as signaling components that mimic activation through an antigen receptor complex, such as a TCR complex, in the case of a CAR, and/or signal via another cell surface receptor. Thus, in some embodiments, the antigen-binding component (e.g., antibody) is linked to one or more transmembrane and intracellular signaling domains. In some
embodiments, the transmembrane domain is fused to the extracellular domain. In one embodiment, a transmembrane domain that naturally is associated with one of the domains in the receptor, e.g., CAR, is used. In some instances, the transmembrane domain is selected or modified by amino acid substitution to avoid binding of such domains to the transmembrane domains of the same or different surface membrane proteins to minimize interactions with other members of the receptor complex.
[0112] The transmembrane domain in some embodiments is derived either from a natural or from a synthetic source. Where the source is natural, the domain in some aspects is derived from any membrane-bound or transmembrane protein. Transmembrane regions include those derived from (i.e. comprise at least the transmembrane region(s) of) the alpha, beta or zeta chain of the T-cell receptor, CD28, CD3 epsilon, CD45, CD4, CD5, CDS, CD9, CD 16, CD22, CD33, CD37, CD64, CD80, CD86, CD 134, CD137, CD 154. Alternatively the transmembrane domain in some embodiments is synthetic. In some aspects, the synthetic transmembrane domain comprises predominantly hydrophobic residues such as leucine and valine. In some aspects, a triplet of phenylalanine, tryptophan and valine will be found at each end of a synthetic transmembrane domain. In some embodiments, the linkage is by linkers, spacers, and/or transmembrane domain(s).
[0113] Among the intracellular signaling domains are those that mimic or approximate a signal through a natural antigen receptor, a signal through such a receptor in combination with a costimulatory receptor, and/or a signal through a costimulatory receptor alone. In some embodiments, a short oligo- or polypeptide linker, for example, a linker of between 2 and 10 amino acids in length, such as one containing glycines and serines, e.g., glycine- serine doublet, is present and forms a linkage between the transmembrane domain and the cytoplasmic signaling domain of the CAR. [0114] The receptor, e.g., the CAR, generally includes at least one intracellular signaling component or components. In some embodiments, the receptor includes an intracellular component of a TCR complex, such as a TCR CD3 chain that mediates T-cell activation and cytotoxicity, e.g., CD3 zeta chain. Thus, in some aspects, the antigen-binding portion is linked to one or more cell signaling modules. In some embodiments, cell signaling modules include CD3 transmembrane domain, CD3 intracellular signaling domains, and/or other CD
transmembrane domains. In some embodiments, the receptor, e.g., CAR, further includes a portion of one or more additional molecules such as Fc receptor γ, CD8, CD4, CD25, or CD16. For example, in some aspects, the CAR or other chimeric receptor includes a chimeric molecule between CD3-zeta (CD3-Q or Fc receptor γ and CD8, CD4, CD25 or CD16.
[0115] In some embodiments, upon ligation of the CAR or other chimeric receptor, the cytoplasmic domain or intracellular signaling domain of the receptor activates at least one of the normal effector functions or responses of the immune cell, e.g., T cell engineered to express the CAR. For example, in some contexts, the CAR induces a function of a T cell such as cytolytic activity or T-helper activity, such as secretion of cytokines or other factors. In some
embodiments, a truncated portion of an intracellular signaling domain of an antigen receptor component or costimulatory molecule is used in place of an intact immuno stimulatory chain, for example, if it transduces the effector function signal. In some embodiments, the intracellular signaling domain or domains include the cytoplasmic sequences of the T cell receptor (TCR), and in some aspects also those of co-receptors that in the natural context act in concert with such receptors to initiate signal transduction following antigen receptor engagement.
[0116] In the context of a natural TCR, full activation generally requires not only signaling through the TCR, but also a costimulatory signal. Thus, in some embodiments, to promote full activation, a component for generating secondary or co- stimulatory signal is also included in the CAR. In other embodiments, the CAR does not include a component for generating a costimulatory signal. In some aspects, an additional CAR is expressed in the same cell and provides the component for generating the secondary or costimulatory signal.
[0117] T cell activation is in some aspects described as being mediated by two classes of cytoplasmic signaling sequences: those that initiate antigen-dependent primary activation through the TCR (primary cytoplasmic signaling sequences), and those that act in an antigen- independent manner to provide a secondary or co- stimulatory signal (secondary cytoplasmic signaling sequences). In some aspects, the CAR includes one or both of such signaling components.
[0118] In some aspects, the CAR includes a primary cytoplasmic signaling sequence that regulates primary activation of the TCR complex. Primary cytoplasmic signaling sequences that act in a stimulatory manner may contain signaling motifs which are known as immunoreceptor tyrosine-based activation motifs or ITAMs. Examples of IT AM containing primary cytoplasmic signaling sequences include those derived from TCR zeta, FcR gamma, FcR beta, CD3 gamma, CD3 delta, CD3 epsilon, CDS, CD22, CD79a, CD79b, and CD66d. In some embodiments, cytoplasmic signaling molecule(s) in the CAR contain(s) a cytoplasmic signaling domain, portion thereof, or sequence derived from CD3 zeta.
[0119] In some embodiments, the CAR includes a signaling domain and/or transmembrane portion of a costimulatory receptor, such as CD28, 4- IBB, OX40, DAP10, and ICOS. In some aspects, the same CAR includes both the activating and costimulatory components.
[0120] In some embodiments, the activating domain is included within one CAR, whereas the costimulatory component is provided by another CAR recognizing another antigen. In some embodiments, the CARs include activating or stimulatory CARs, costimulatory CARs, both expressed on the same cell (see WO2014/055668). In some aspects, the cells include one or more stimulatory or activating CAR and/or a costimulatory CAR. In some embodiments, the cells further include inhibitory CARs (iCARs, see Fedorov et al., Sci. Transl. Medicine, 5(215) (December, 2013), such as a CAR recognizing an antigen other than the one associated with and/or specific for the disease or condition whereby an activating signal delivered through the disease-targeting CAR is diminished or inhibited by binding of the inhibitory CAR to its ligand, e.g., to reduce off-target effects.
[0121] In certain embodiments, the intracellular signaling domain comprises a CD28 transmembrane and signaling domain linked to a CD3 (e.g., CD3-zeta) intracellular domain. In some embodiments, the intracellular signaling domain comprises a chimeric CD28 and CD137 (4- IBB, TNFRSF9) co-stimulatory domains, linked to a CD3 zeta intracellular domain.
[0122] In some embodiments, the CAR encompasses one or more, e.g., two or more, costimulatory domains and an activation domain, e.g., primary activation domain, in the cytoplasmic portion. Exemplary CARs include intracellular components of CD3-zeta, CD28, and 4-1BB. [0123] In some embodiments, the CAR or other antigen receptor further includes a marker, such as a cell surface marker, which may be used to confirm transduction or engineering of the cell to express the receptor, such as a truncated version of a cell surface receptor, such as truncated EGFR (tEGFR). In some aspects, the marker includes all or part (e.g., truncated form) of CD34, a NGFR, or epidermal growth factor receptor (e.g., tEGFR). In some embodiments, the nucleic acid encoding the marker is operably linked to a polynucleotide encoding for a linker sequence, such as a cleavable linker sequence, e.g., T2A. See WO2014031687.
[0124] In some embodiments, the marker is a molecule, e.g., cell surface protein, not naturally found on T cells or not naturally found on the surface of T cells, or a portion thereof.
[0125] In some embodiments, the molecule is a non-self molecule, e.g., non-self protein, i.e., one that is not recognized as "self by the immune system of the host into which the cells will be adoptively transferred.
[0126] In some embodiments, the marker serves no therapeutic function and/or produces no effect other than to be used as a marker for genetic engineering, e.g., for selecting cells successfully engineered. In other embodiments, the marker may be a therapeutic molecule or molecule otherwise exerting some desired effect, such as a ligand for a cell to be encountered in vivo, such as a costimulatory or immune checkpoint molecule to enhance and/or dampen responses of the cells upon adoptive transfer and encounter with ligand.
[0127] In some cases, CARs are referred to as first, second, and/or third generation CARs. In some aspects, a first generation CAR is one that solely provides a CD3-chain induced signal upon antigen binding; in some aspects, a second-generation CARs is one that provides such a signal and costimulatory signal, such as one including an intracellular signaling domain from a costimulatory receptor such as CD28 or CD 137; in some aspects, a third generation CAR is one that includes multiple costimulatory domains of different costimulatory receptors.
[0128] In some embodiments, the chimeric antigen receptor includes an extracellular portion containing an antibody or antibody fragment. In some aspects, the chimeric antigen receptor includes an extracellular portion containing the antibody or fragment and an intracellular signaling domain. In some embodiments, the antibody or fragment includes an scFv and the intracellular domain contains an ITAM. In some aspects, the intracellular signaling domain includes a signaling domain of a zeta chain of a CD3-zeta ^ϋ3ζ) chain. In some embodiments, the chimeric antigen receptor includes a transmembrane domain linking the extracellular domain and the intracellular signaling domain. In some aspects, the transmembrane domain contains a transmembrane portion of CD28. In some embodiments, the chimeric antigen receptor contains an intracellular domain of a T cell costimulatory molecule. In some aspects, the T cell costimulatory molecule is CD28 or 41BB.
[0129] The terms "polypeptide" and "protein" are used interchangeably to refer to a polymer of amino acid residues, and are not limited to a minimum length. Polypeptides, including the provided receptors and other polypeptides, e.g., linkers or peptides, may include amino acid residues including natural and/or non-natural amino acid residues. The terms also include post- expression modifications of the polypeptide, for example, glycosylation, sialylation, acetylation, and phosphorylation. In some aspects, the polypeptides may contain modifications with respect to a native or natural sequence, as long as the protein maintains the desired activity. These modifications may be deliberate, as through site-directed mutagenesis, or may be accidental, such as through mutations of hosts which produce the proteins or errors due to PCR
amplification.
[0130] In some embodiments, the receptor, e.g., the CAR, expressed by the cells in the consecutive dose contains at least one immunoreactive epitope as the receptor, e.g., the CAR, expressed by the cells of the first dose. In some aspects, the receptor, e.g., the CAR, expressed by the cells administered in the consecutive dose is identical to the receptor, e.g., the CAR, expressed by the first dose or is substantially identical to the receptor, e.g., the CAR, expressed by the cells of administered in the first dose.
[0131] The recombinant receptors, such as CARs, expressed by the cells administered to the subject in the various doses generally recognize or specifically bind to a molecule that is expressed in, associated with, and/or specific for the disease or condition or cells thereof being treated. Upon specific binding to the molecule, e.g., antigen, the receptor generally delivers an immunostimulatory signal, such as an ITAM-transduced signal, into the cell, thereby promoting an immune response targeted to the disease or condition. For example, in some embodiments, the cells in the first dose express a CAR that specifically binds to an antigen expressed by a cell or tissue of the disease or condition or associated with the disease or condition.
2. TCRs
[0132] In some embodiments, the genetically engineered antigen receptors include recombinant T cell receptors (TCRs) and/or TCRs cloned from naturally occurring T cells. In some embodiments, a high-affinity T cell clone for a target antigen (e.g., a cancer antigen) is identified, isolated from a patient, and introduced into the cells. In some embodiments, the TCR clone for a target antigen has been generated in transgenic mice engineered with human immune system genes (e.g., the human leukocyte antigen system, or HLA). See, e.g., tumor antigens (see, e.g., Parkhurst et al. (2009) Clin Cancer Res. 15: 169-180 and Cohen et al. (2005) J Immunol. 175:5799-5808. In some embodiments, phage display is used to isolate TCRs against a target antigen (see, e.g., Varela-Rohena et al. (2008) Nat Med. 14: 1390-1395 and Li
(2005) Nat Biotechnol. 23:349-354.
[0133] In some embodiments, after the T-cell clone is obtained, the TCR alpha and beta chains are isolated and cloned into a gene expression vector. In some embodiments, the TCR alpha and beta genes are linked via a picornavirus 2A ribosomal skip peptide so that both chains are coexpression. In some embodiments, genetic transfer of the TCR is accomplished via retroviral or lentiviral vectors, or via transposons (see, e.g., Baum et al. (2006) Molecular Therapy: The Journal of the American Society of Gene Therapy. 13: 1050-1063; Frecha et al. (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18: 1748- 1757; an Hackett et al. (2010) Molecular Therapy: The Journal of the American Society of Gene Therapy. 18:674-683.
3. Multi-targeting
[0134] In some embodiments, the cells and methods include multi-targeting strategies, such as expression of two or more genetically engineered receptors on the cell, each recognizing the same of a different antigen and typically each including a different intracellular signaling component. Such multi-targeting strategies are described, for example, in International Patent Application, Publication No.: WO 2014055668 Al (describing combinations of activating and costimulatory CARs, e.g., targeting two different antigens present individually on off-target, e.g., normal cells, but present together only on cells of the disease or condition to be treated) and Fedorov et al., Sci. Transl. Medicine, 5(215) (December, 2013) (describing cells expressing an activating and an inhibitory CAR, such as those in which the activating CAR binds to one antigen expressed on both normal or non-diseased cells and cells of the disease or condition to be treated, and the inhibitory CAR binds to another antigen expressed only on the normal cells or cells which it is not desired to treat).
[0135] For example, in some embodiments, the cells include a receptor expressing a first genetically engineered antigen receptor (e.g., CAR or TCR) which is capable of inducing an activating signal to the cell, generally upon specific binding to the antigen recognized by the first receptor, e.g., the first antigen. In some embodiments, the cell further includes a second genetically engineered antigen receptor (e.g., CAR or TCR), e.g., a chimeric costimulatory receptor, which is capable of inducing a costimulatory signal to the immune cell, generally upon specific binding to a second antigen recognized by the second receptor. In some embodiments, the first antigen and second antigen are the same. In some embodiments, the first antigen and second antigen are different.
[0136] In some embodiments, the first and/or second genetically engineered antigen receptor (e.g. CAR or TCR) is capable of inducing an activating signal to the cell. In some embodiments, the receptor includes an intracellular signaling component containing IT AM or ITAM-like motifs. In some embodiments, the activation induced by the first receptor involves a signal transduction or change in protein expression in the cell resulting in initiation of an immune response, such as ITAM phosphorylation and/or initiation of ITAM-mediated signal
transduction cascade, formation of an immunological synapse and/or clustering of molecules near the bound receptor (e.g. CD4 or CD8, etc.), activation of one or more transcription factors, such as NF-KB and/or AP-1, and/or induction of gene expression of factors such as cytokines, proliferation, and/or survival.
[0137] In some embodiments, the first and/or second receptor includes intracellular signaling domains of costimulatory receptors such as CD28, CD137 (4-1 BB), OX40, and/or ICOS. In some embodiments, the first and second receptors include intracellular signaling domains of costimulatory receptors that are different. In one embodiment, the first receptor contains a CD28 costimulatory signaling region and the second receptor contain a 4- IBB costimulatory signaling region or vice versa.
[0138] In some embodiments, the first and/or second receptor includes both an intracellular signaling domain containing ITAM or ITAM-like motifs and an intracellular signaling domain of a costimulatory receptor.
[0139] In some embodiments, the first receptor contains an intracellular signaling domain containing ITAM or ITAM-like motifs and the second receptor contains an intracellular signaling domain of a costimulatory receptor. The costimulatory signal in combination with the activating signal induced in the same cell is one that results in an immune response, such as a robust and sustained immune response, such as increased gene expression, secretion of cytokines and other factors, and T cell mediated effector functions such as cell killing.
[0140] In some embodiments, neither ligation of the first receptor alone nor ligation of the second receptor alone induces a robust immune response. In some aspects, if only one receptor is ligated, the cell becomes tolerized or unresponsive to antigen, or inhibited, and/or is not induced to proliferate or secrete factors or carry out effector functions. In some such
embodiments, however, when the plurality of receptors are ligated, such as upon encounter of a cell expressing the first and second antigens, a desired response is achieved, such as full immune activation or stimulation, e.g., as indicated by secretion of one or more cytokine, proliferation, persistence, and/or carrying out an immune effector function such as cytotoxic killing of a target cell.
[0141] In some embodiments, the two receptors induce, respectively, an activating and an inhibitory signal to the cell, such that binding by one of the receptor to its antigen activates the cell or induces a response, but binding by the second inhibitory receptor to its antigen induces a signal that suppresses or dampens that response. Examples are combinations of activating CARs and inhibitory CARs or iCARs. Such a strategy may be used, for example, in which the activating CAR binds an antigen expressed in a disease or condition but which is also expressed on normal cells, and the inhibitory receptor binds to a separate antigen which is expressed on the normal cells but not cells of the disease or condition.
[0142] In some embodiments, the multi-targeting strategy is employed in a case where an antigen associated with a particular disease or condition is expressed on a non-diseased cell and/or is expressed on the engineered cell itself, either transiently (e.g., upon stimulation in association with genetic engineering) or permanently. In such cases, by requiring ligation of two separate and individually specific antigen receptors, specificity, selectivity, and/or efficacy may be improved.
[0143] In some embodiments, the plurality of antigens, e.g., the first and second antigens, are expressed on the cell, tissue, or disease or condition being targeted, such as on the cancer cell. In some aspects, the cell, tissue, disease or condition is multiple myeloma or a multiple myeloma cell. In some embodiments, one or more of the plurality of antigens generally also is expressed on a cell which it is not desired to target with the cell therapy, such as a normal or non-diseased cell or tissue, and/or the engineered cells themselves. In such embodiments, by requiring ligation of multiple receptors to achieve a response of the cell, specificity and/or efficacy is achieved.
B. Vectors and methods for genetic engineering
[0144] Various methods for the introduction of genetically engineered components, e.g., antigen receptors, e.g., CARs or TCRs, are well known and may be used with the provided methods and compositions. Exemplary methods include those for transfer of nucleic acids encoding the receptors, including via viral, e.g., retroviral or lentiviral, transduction,
transposons, and electroporation.
[0145] In some embodiments, recombinant nucleic acids are transferred into cultured cells using recombinant infectious virus particles, such as, e.g., vectors derived from simian virus 40 (SV40), adenoviruses, adeno-associated virus (AAV). In some embodiments, recombinant nucleic acids are transferred into T cells using recombinant lentiviral vectors or retroviral vectors, such as gamma-retroviral vectors (see, e.g., Koste et al. (2014) Gene Therapy 2014 Apr 3. doi: 10.1038/gt.2014.25; Carlens et al. (2000) Exp Hematol 28(10): 1137-46; Alonso-Camino et al. (2013) Mol Ther Nucl Acids 2, e93; Park et al., Trends Biotechnol. 2011 November 29(11): 550-557.
[0146] In some embodiments, the retroviral vector has a long terminal repeat sequence (LTR), e.g., a retroviral vector derived from the Moloney murine leukemia virus (MoMLV), myeloproliferative sarcoma virus (MPSV), murine embryonic stem cell virus (MESV), murine stem cell virus (MSCV), spleen focus forming virus (SFFV), or adeno-associated virus (AAV). Most retroviral vectors are derived from murine retroviruses. In some embodiments, the retroviruses include those derived from any avian or mammalian cell source. The retroviruses typically are amphotropic, meaning that they are capable of infecting host cells of several species, including humans. In one embodiment, the gene to be expressed replaces the retroviral gag, pol and/or env sequences. A number of illustrative retroviral systems have been described (e.g., U.S. Pat. Nos. 5,219,740; 6,207,453; 5,219,740; Miller and Rosman (1989) BioTechniques 7:980-990; Miller, A. D. (1990) Human Gene Therapy 1:5-14; Scarpa et al. (1991) Virology 180:849-852; Burns et al. (1993) Proc. Natl. Acad. Sci. USA 90:8033-8037; and Boris-Lawrie and Temin (1993) Cur. Opin. Genet. Develop. 3: 102-109.
[0147] Methods of lentiviral transduction are known. Exemplary methods are described in, e.g., Wang et al. (2012) J. Immunother. 35(9): 689-701; Cooper et al. (2003) Blood. 101: 1637- 1644; Verhoeyen et al. (2009) Methods Mol Biol. 506: 97-114; and Cavalieri et al. (2003) Blood. 102(2): 497-505.
[0148] In some embodiments, recombinant nucleic acids are transferred into T cells via electroporation {see, e.g., Chicaybam et al, (2013) PLoS ONE 8(3): e60298 and Van Tedeloo et al. (2000) Gene Therapy 7(16): 1431-1437). In some embodiments, recombinant nucleic acids are transferred into T cells via transposition (see, e.g., Manuri et al. (2010) Hum Gene Ther 21(4): 427-437; Sharma et al. (2013) Molec Ther Nucl Acids 2, e74; and Huang et al. (2009) Methods Mol Biol 506: 115-126). Other methods of introducing and expressing genetic material in immune cells include calcium phosphate transfection (e.g., as described in Current Protocols in Molecular Biology, John Wiley & Sons, New York. N.Y.), protoplast fusion, cationic liposome-mediated transfection; tungsten particle-facilitated microparticle bombardment (Johnston, Nature, 346: 776-777 (1990)); and strontium phosphate DNA co-precipitation (Brash et al., Mol. Cell Biol., 7: 2031-2034 (1987)).
[0149] Other approaches and vectors for transfer of the nucleic acids encoding the recombinant products are those described, e.g., in international patent application, Publication No.: WO2014055668, and U.S. Patent No. 7,446,190.
[0150] In some embodiments, the cells, e.g., T cells, may be transfected either during or after expansion e.g. with a T cell receptor (TCR) or a chimeric antigen receptor (CAR). This transfection for the introduction of the gene of the desired receptor can be carried out with any suitable retroviral vector, for example. The genetically modified cell population can then be liberated from the initial stimulus (the CD3/CD28 stimulus, for example) and subsequently be stimulated with a second type of stimulus e.g. via a de novo introduced receptor). This second type of stimulus may include an antigenic stimulus in form of a peptide/MHC molecule, the cognate (cross-linking) ligand of the genetically introduced receptor (e.g. natural ligand of a CAR) or any ligand (such as an antibody) that directly binds within the framework of the new receptor (e.g. by recognizing constant regions within the receptor). See, for example, Cheadle et al, "Chimeric antigen receptors for T-cell based therapy" Methods Mol Biol. 2012; 907:645-66 or Barrett et al., Chimeric Antigen Receptor Therapy for Cancer Annual Review of Medicine Vol. 65: 333-347 (2014).
[0151] Among additional nucleic acids, e.g., genes for introduction are those to improve the efficacy of therapy, such as by promoting viability and/or function of transferred cells; genes to provide a genetic marker for selection and/or evaluation of the cells, such as to assess in vivo survival or localization; genes to improve safety, for example, by making the cell susceptible to negative selection in vivo as described by Lupton S. D. et al., Mol. and Cell Biol., 11:6 (1991); and Riddell et al., Human Gene Therapy 3:319-338 (1992); see also the publications of
PCT/US91/08442 and PCT/US94/05601 by Lupton et al. describing the use of bifunctional selectable fusion genes derived from fusing a dominant positive selectable marker with a negative selectable marker. See, e.g., Riddell et al., US Patent No. 6,040,177, at columns 14-17. [0152] In some cases, a vector may be used that does not require that the cells, e.g., T cells, are activated. In some such instances, the cells may be selected and/or transduced prior to activation. Thus, the cells may be engineered prior to, or subsequent to the culturing of the cells as described herein, and in some cases at the same time as or during at least a portion of the culturing. In some embodiments, the cells that to be engineered are the cultured cells, or in some cases, cells may be transduced prior to performing the culturing as described herein.
VI. Compositions, Formulations and Methods of Administration
[0153] Also provided are compositions containing the engineered receptor (e.g., engineered antigen receptor), such as CAR or TCR, and compositions containing the engineered cells, including pharmaceutical compositions and formulations. Also provided are methods of using and uses of the compositions, such as in the treatment of diseases, conditions, and disorders in which the antigen is expressed, or in detection, diagnostic, and prognostic methods.
1. Compositions/Formulations
[0154] The term "pharmaceutical formulation" refers to a preparation which is in such form as to permit the biological activity of an active ingredient contained therein to be effective, and which contains no additional components which are unacceptably toxic to a subject to which the formulation would be administered.
[0155] A "pharmaceutically acceptable carrier" refers to an ingredient in a pharmaceutical formulation, other than an active ingredient, which is nontoxic to a subject. A pharmaceutically acceptable carrier includes, but is not limited to, a buffer, excipient, stabilizer, or preservative.
[0156] In some aspects, the choice of carrier is determined in part by the particular cell and/or by the method of administration. Accordingly, there are a variety of suitable
formulations. For example, the pharmaceutical composition can contain preservatives. Suitable preservatives may include, for example, methylparaben, propylparaben, sodium benzoate, and benzalkonium chloride. In some aspects, a mixture of two or more preservatives is used. The preservative or mixtures thereof are typically present in an amount of about 0.0001 to about 2% by weight of the total composition. Carriers are described, e.g., by Remington's
Pharmaceutical Sciences 16th edition, Osol, A. Ed. (1980). Pharmaceutically acceptable carriers are generally nontoxic to recipients at the dosages and concentrations employed, and include, but are not limited to: buffers such as phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives (such as octadecyldimethylbenzyl ammonium chloride; hexamethonium chloride; benzalkonium chloride; benzethonium chloride; phenol, butyl or benzyl alcohol; alkyl parabens such as methyl or propyl paraben; catechol; resorcinol; cyclohexanol; 3-pentanol; and m-cresol); low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins;
hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, histidine, arginine, or lysine; monosaccharides, disaccharides, and other
carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugars such as sucrose, mannitol, trehalose or sorbitol; salt-forming counter-ions such as sodium; metal complexes (e.g. Zn-protein complexes); and/or non-ionic surfactants such as polyethylene glycol (PEG).
[0157] Buffering agents in some aspects are included in the compositions. Suitable buffering agents include, for example, citric acid, sodium citrate, phosphoric acid, potassium phosphate, and various other acids and salts. In some aspects, a mixture of two or more buffering agents is used. The buffering agent or mixtures thereof are typically present in an amount of about 0.001 to about 4% by weight of the total composition. Methods for preparing administrable pharmaceutical compositions are known. Exemplary methods are described in more detail in, for example, Remington: The Science and Practice of Pharmacy, Lippincott Williams & Wilkins; 21st ed. (May 1, 2005).
[0158] The formulation or composition may also contain more than one active ingredient useful for the particular indication, disease, or condition being treated with the cells, preferably those with activities complementary to the cell, where the respective activities do not adversely affect one another. Such active ingredients are suitably present in combination in amounts that are effective for the purpose intended. Thus, in some embodiments, the pharmaceutical composition further includes other pharmaceutically active agents or drugs, such as
chemotherapeutic agents, e.g., asparaginase, busulfan, carboplatin, cisplatin, daunorubicin, doxorubicin, fluorouracil, gemcitabine, hydroxyurea, methotrexate, paclitaxel, rituximab, vinblastine, vincristine, etc. In some embodiments, the cells or antibodies are administered in the form of a salt, e.g., a pharmaceutically acceptable salt. Suitable pharmaceutically acceptable acid addition salts include those derived from mineral acids, such as hydrochloric, hydrobromic, phosphoric, metaphosphoric, nitric, and sulphuric acids, and organic acids, such as tartaric, acetic, citric, malic, lactic, fumaric, benzoic, glycolic, gluconic, succinic, and arylsulphonic acids, for example, p-toluenesulphonic acid. [0159] Active ingredients may be entrapped in microcapsules, in colloidal drug delivery systems (for example, liposomes, albumin microspheres, microemulsions, nano-particles and nanocapsules) or in macroemulsions. In certain embodiments, the pharmaceutical composition is formulated as an inclusion complex, such as cyclodextrin inclusion complex, or as a liposome. Liposomes can serve to target the host cells (e.g., T-cells or NK cells) to a particular tissue. Many methods are available for preparing liposomes, such as those described in, for example, Szoka et al., Ann. Rev. Biophys. Bioeng., 9: 467 (1980), and U.S. Patents 4,235,871, 4,501,728, 4,837,028, and 5,019,369.
[0160] The pharmaceutical composition in some aspects can employ time-released, delayed release, and sustained release delivery systems such that the delivery of the composition occurs prior to, and with sufficient time to cause, sensitization of the site to be treated. Many types of release delivery systems are available and known. Such systems can avoid repeated
administrations of the composition, thereby increasing convenience to the subject and the physician.
[0161] The pharmaceutical composition in some embodiments contains cells in amounts effective to treat or prevent the disease or condition, such as a therapeutically effective or prophylactically effective amount. Therapeutic or prophylactic efficacy in some embodiments is monitored by periodic assessment of treated subjects. For repeated administrations over several days or longer, depending on the condition, the treatment is repeated until a desired suppression of disease symptoms occurs. However, other dosage regimens may be useful and can be determined. The desired dosage can be delivered by a single bolus administration of the composition, by multiple bolus administrations of the composition, or by continuous infusion administration of the composition.
[0162] The cells may be administered using standard administration techniques,
formulations, and/or devices. Provided are formulations and devices, such as syringes and vials, for storage and administration of the compositions. Administration of the cells can be autologous or heterologous. For example, immunoresponsive cells or progenitors can be obtained from one subject, and administered to the same subject or a different, compatible subject. Peripheral blood derived immunoresponsive cells or their progeny (e.g., in vivo, ex vivo or in vitro derived) can be administered via localized injection, including catheter
administration, systemic injection, localized injection, intravenous injection, or parenteral administration. When administering a therapeutic composition (e.g., a pharmaceutical composition containing a genetically modified immunoresponsive cell), it will generally be formulated in a unit dosage injectable form (solution, suspension, emulsion).
[0163] Formulations include those for oral, intravenous, intraperitoneal, subcutaneous, pulmonary, transdermal, intramuscular, intranasal, buccal, sublingual, or suppository administration. In some embodiments, the cell populations are administered parenterally. The term "parenteral," as used herein, includes intravenous, intramuscular, subcutaneous, rectal, vaginal, and intraperitoneal administration. In some embodiments, the cell populations are administered to a subject using peripheral systemic delivery by intravenous, intraperitoneal, or subcutaneous injection.
[0164] Compositions in some embodiments are provided as sterile liquid preparations, e.g., isotonic aqueous solutions, suspensions, emulsions, dispersions, or viscous compositions, which may in some aspects be buffered to a selected pH. Liquid preparations are normally easier to prepare than gels, other viscous compositions, and solid compositions. Additionally, liquid compositions are somewhat more convenient to administer, especially by injection. Viscous compositions, on the other hand, can be formulated within the appropriate viscosity range to provide longer contact periods with specific tissues. Liquid or viscous compositions can comprise carriers, which can be a solvent or dispersing medium containing, for example, water, saline, phosphate buffered saline, polyoi (for example, glycerol, propylene glycol, liquid polyethylene glycol) and suitable mixtures thereof.
[0165] Sterile injectable solutions can be prepared by incorporating the cells in a solvent, such as in admixture with a suitable carrier, diluent, or excipient such as sterile water, physiological saline, glucose, dextrose, or the like. The compositions can also be lyophilized. The compositions can contain auxiliary substances such as wetting, dispersing, or emulsifying agents (e.g., methylcellulose), pH buffering agents, gelling or viscosity enhancing additives, preservatives, flavoring agents, colors, and the like, depending upon the route of administration and the preparation desired. Standard texts may in some aspects be consulted to prepare suitable preparations.
[0166] Various additives which enhance the stability and sterility of the compositions, including antimicrobial preservatives, antioxidants, chelating agents, and buffers, can be added. Prevention of the action of microorganisms can be ensured by various antibacterial and antifungal agents, for example, parabens, chlorobutanol, phenol, sorbic acid, and the like. Prolonged absorption of the injectable pharmaceutical form can be brought about by the use of agents delaying absorption, for example, aluminum monostearate and gelatin.
[0167] Sustained-release preparations may be prepared. Suitable examples of sustained- release preparations include semipermeable matrices of solid hydrophobic polymers containing the antibody, which matrices are in the form of shaped articles, e.g. films, or microcapsules.
[0168] The formulations to be used for in vivo administration are generally sterile. Sterility may be readily accomplished, e.g., by filtration through sterile filtration membranes.
2. Methods of Administration
[0169] Provided are methods of administering the cells, populations, and compositions, and uses of such cells, populations, and compositions to treat or prevent diseases, conditions, and disorders, including cancers. In some embodiments, the cells, populations, and compositions are administered to a subject or patient having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy. In some embodiments, cells and compositions prepared by the provided methods, such as engineered compositions and end-of- production compositions following incubation and/or other processing steps, are administered to a subject, such as a subject having or at risk for the disease or condition. In some aspects, the methods thereby treat, e.g., ameliorate one or more symptom of, the disease or condition, such as by lessening tumor burden in a cancer expressing an antigen recognized by an engineered T cell.
[0170] Methods for administration of cells for adoptive cell therapy are known and may be used in connection with the provided methods and compositions. For example, adoptive T cell therapy methods are described, e.g., in US Patent Application Publication No. 2003/0170238 to Gruenberg et al; US Patent No. 4,690,915 to Rosenberg; Rosenberg (2011) Nat Rev Clin Oncol. 8(10):577-85). See, e.g., Themeli et al. (2013) Nat Biotechnol. 31(10): 928-933; Tsukahara et al. (2013) Biochem Biophys Res Commun 438(1): 84-9; Davila et al. (2013) PLoS ONE 8(4): e61338.
[0171] As used herein, a "subject" is a mammal, such as a human or other animal, and typically is human. In some embodiments, the subject, e.g., patient, to whom the cells, cell populations, or compositions are administered is a mammal, typically a primate, such as a human. In some embodiments, the primate is a monkey or an ape. The subject can be male or female and can be any suitable age, including infant, juvenile, adolescent, adult, and geriatric subjects. In some embodiments, the subject is a non-primate mammal, such as a rodent. [0172] As used herein, "treatment" (and grammatical variations thereof such as "treat" or "treating") refers to complete or partial amelioration or reduction of a disease or condition or disorder, or a symptom, adverse effect or outcome, or phenotype associated therewith.
Desirable effects of treatment include, but are not limited to, preventing occurrence or recurrence of disease, alleviation of symptoms, diminishment of any direct or indirect pathological consequences of the disease, preventing metastasis, decreasing the rate of disease progression, amelioration or palliation of the disease state, and remission or improved prognosis. The terms do not imply complete curing of a disease or complete elimination of any symptom or effect(s) on all symptoms or outcomes.
[0173] As used herein, "delaying development of a disease" means to defer, hinder, slow, retard, stabilize, suppress and/or postpone development of the disease (such as cancer). This delay can be of varying lengths of time, depending on the history of the disease and/or individual being treated. As is evident to one skilled in the art, a sufficient or significant delay can, in effect, encompass prevention, in that the individual does not develop the disease. For example, a late stage cancer, such as development of metastasis, may be delayed.
[0174] "Preventing," as used herein, includes providing prophylaxis with respect to the occurrence or recurrence of a disease in a subject that may be predisposed to the disease but has not yet been diagnosed with the disease. In some embodiments, the provided cells and compositions are used to delay development of a disease or to slow the progression of a disease.
[0175] As used herein, to "suppress" a function or activity is to reduce the function or activity when compared to otherwise same conditions except for a condition or parameter of interest, or alternatively, as compared to another condition. For example, cells that suppress tumor growth reduce the rate of growth of the tumor compared to the rate of growth of the tumor in the absence of the cells.
[0176] An "effective amount" of an agent, e.g., a pharmaceutical formulation, cells, or composition, in the context of administration, refers to an amount effective, at dosages/amounts and for periods of time necessary, to achieve a desired result, such as a therapeutic or
prophylactic result.
[0177] A "therapeutically effective amount" of an agent, e.g., a pharmaceutical formulation or cells, refers to an amount effective, at dosages and for periods of time necessary, to achieve a desired therapeutic result, such as for treatment of a disease, condition, or disorder, and/or pharmacokinetic or pharmacodynamic effect of the treatment. The therapeutically effective amount may vary according to factors such as the disease state, age, sex, and weight of the subject, and the populations of cells administered. In some embodiments, the provided methods involve administering the cells and/or compositions at effective amounts, e.g., therapeutically effective amounts.
[0178] A "prophylactic ally effective amount" refers to an amount effective, at dosages and for periods of time necessary, to achieve the desired prophylactic result. Typically but not necessarily, since a prophylactic dose is used in subjects prior to or at an earlier stage of disease, the prophylactically effective amount will be less than the therapeutically effective amount.
[01] The disease or condition that is treated can be any in which expression of an antigen is associated with and/or involved in the etiology of a disease condition or disorder, e.g. causes, exacerbates or otherwise is involved in such disease, condition, or disorder. Exemplary diseases and conditions can include diseases or conditions associated with malignancy or transformation of cells (e.g. cancer), autoimmune or inflammatory disease, or an infectious disease, e.g. caused by a bacterial, viral or other pathogen. Exemplary antigens, which include antigens associated with various diseases and conditions that can be treated, are described above. In particular embodiments, the chimeric antigen receptor or transgenic TCR specifically binds to an antigen associated with the disease or condition.
[02] Thus, the provided methods and uses include methods and uses for adoptive cell therapy. In some embodiments, the methods include administration of the cells or a composition containing the cells to a subject, tissue, or cell, such as one having, at risk for, or suspected of having the disease, condition or disorder. In some embodiments, the cells, populations, and compositions are administered to a subject having the particular disease or condition to be treated, e.g., via adoptive cell therapy, such as adoptive T cell therapy. In some embodiments, the cells or compositions are administered to the subject, such as a subject having or at risk for the disease or condition, ameliorate one or more symptom of the disease or condition.
[03] In some embodiments, the cell therapy, e.g., adoptive T cell therapy, is carried out by autologous transfer, in which the cells are isolated and/or otherwise prepared from the subject who is to receive the cell therapy, or from a sample derived from such a subject. Thus, in some aspects, the cells are derived from a subject, e.g., patient, in need of a treatment and the cells, following isolation and processing are administered to the same subject.
[04] In some embodiments, the cell therapy, e.g., adoptive T cell therapy, is carried out by allogeneic transfer, in which the cells are isolated and/or otherwise prepared from a subject other than a subject who is to receive or who ultimately receives the cell therapy, e.g., a first subject. In such embodiments, the cells then are administered to a different subject, e.g., a second subject, of the same species. In some embodiments, the first and second subjects are genetically identical. In some embodiments, the first and second subjects are genetically similar. In some embodiments, the second subject expresses the same HLA class or supertype as the first subject. The cells can be administered by any suitable means. Dosing and administration may depend in part on whether the administration is brief or chronic. Various dosing schedules include but are not limited to single or multiple administrations over various time-points, bolus administration, and pulse infusion.
[0179] In certain embodiments, the cells, or individual populations of sub-types of cells, are administered to the subject at a range of about one million to about 100 billion cells and/or that amount of cells per kilogram of body weight, such as, e.g., 1 million to about 50 billion cells (e.g., about 5 million cells, about 25 million cells, about 500 million cells, about 1 billion cells, about 5 billion cells, about 20 billion cells, about 30 billion cells, about 40 billion cells, or a range defined by any two of the foregoing values), such as about 10 million to about 100 billion cells (e.g., about 20 million cells, about 30 million cells, about 40 million cells, about 60 million cells, about 70 million cells, about 80 million cells, about 90 million cells, about 10 billion cells, about 25 billion cells, about 50 billion cells, about 75 billion cells, about 90 billion cells, or a range defined by any two of the foregoing values), and in some cases about 100 million cells to about 50 billion cells (e.g., about 120 million cells, about 250 million cells, about 350 million cells, about 450 million cells, about 650 million cells, about 800 million cells, about 900 million cells, about 3 billion cells, about 30 billion cells, about 45 billion cells) or any value in between these ranges and/or per kilogram of body weight. Again, dosages may vary depending on attributes particular to the disease or disorder and/or patient and/or other treatments. In some embodiments, the cells are administered as part of a combination treatment, such as
simultaneously with or sequentially with, in any order, another therapeutic intervention, such as an antibody or engineered cell or receptor or agent, such as a cytotoxic or therapeutic agent. The cells in some embodiments are co-administered with one or more additional therapeutic agents or in connection with another therapeutic intervention, either simultaneously or sequentially in any order. In some contexts, the cells are co-administered with another therapy sufficiently close in time such that the cell populations enhance the effect of one or more additional therapeutic agents, or vice versa. In some embodiments, the cells are administered prior to the one or more additional therapeutic agents. In some embodiments, the cells are administered after the one or more additional therapeutic agents. In some embodiments, the one or more additional agents include a cytokine, such as IL-2, for example, to enhance persistence. In some embodiments, the methods comprise administration of a chemotherapeutic agent.
[0180] Following administration of the cells, the biological activity of the engineered cell populations in some embodiments is measured, e.g., by any of a number of known methods. Parameters to assess include specific binding of an engineered or natural T cell or other immune cell to antigen, in vivo, e.g., by imaging, or ex vivo, e.g., by ELISA or flow cytometry. In certain embodiments, the ability of the engineered cells to destroy target cells can be measured using any suitable method known in the art, such as cytotoxicity assays described in, for example, Kochenderfer et al., J. Immunotherapy, 32(7): 689-702 (2009), and Herman et al. J.
Immunological Methods, 285(1): 25-40 (2004). In certain embodiments, the biological activity of the cells is measured by assaying expression and/or secretion of one or more cytokines, such as CD 107a, IFNy, IL-2, and TNF. In some aspects the biological activity is measured by assessing clinical outcome, such as reduction in tumor burden or load.
[0181] In certain embodiments, the engineered cells are further modified in any number of ways, such that their therapeutic or prophylactic efficacy is increased. For example, the engineered CAR or TCR expressed by the population can be conjugated either directly or indirectly through a linker to a targeting moiety. The practice of conjugating compounds, e.g., the CAR or TCR, to targeting moieties is known in the art. See, for instance, Wadwa et al., J. Drug Targeting 3: 1 1 1 (1995), and U.S. Patent 5,087,616.
VI. Definitions
[01] As used herein, the singular forms "a," "an," and "the" include plural referents unless the context clearly dictates otherwise. For example, "a" or "an" means "at least one" or "one or more." It is understood that aspects and variations described herein include "consisting" and/or "consisting essentially of aspects and variations.
[02] Throughout this disclosure, various aspects of the claimed subject matter are presented in a range format. It should be understood that the description in range format is merely for convenience and brevity and should not be construed as an inflexible limitation on the scope of the claimed subject matter. Accordingly, the description of a range should be considered to have specifically disclosed all the possible sub-ranges as well as individual numerical values within that range. For example, where a range of values is provided, it is understood that each intervening value, between the upper and lower limit of that range and any other stated or intervening value in that stated range is encompassed within the claimed subject matter. The upper and lower limits of these smaller ranges may independently be included in the smaller ranges, and are also encompassed within the claimed subject matter, subject to any specifically excluded limit in the stated range. Where the stated range includes one or both of the limits, ranges excluding either or both of those included limits are also included in the claimed subject matter. This applies regardless of the breadth of the range.
[03] The term "about" as used herein refers to the usual error range for the respective value readily known to the skilled person in this technical field. Reference to "about" a value or parameter herein includes (and describes) embodiments that are directed to that value or parameter per se. For example, description referring to "about X" includes description of "X".
[04] As used herein, a composition refers to any mixture of two or more products, substances, or compounds, including cells. It may be a solution, a suspension, liquid, powder, a paste, aqueous, non-aqueous or any combination thereof.
[05] As used herein, "enriching" when referring to one or more particular cell type or cell population, refers to increasing the number or percentage of the cell type or population, e.g., compared to the total number of cells in or volume of the composition, or relative to other cell types, such as by positive selection based on markers expressed by the population or cell, or by negative selection based on a marker not present on the cell population or cell to be depleted. The term does not require complete removal of other cells, cell type, or populations from the composition and does not require that the cells so enriched be present at or even near 100 % in the enriched composition.
[06] As used herein, a statement that a cell or population of cells is "positive" for a particular marker refers to the detectable presence on or in the cell of a particular marker, typically a surface marker. When referring to a surface marker, the term refers to the presence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is detectable by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions and/or at a level substantially similar to that for cell known to be positive for the marker, and/or at a level substantially higher than that for a cell known to be negative for the marker. [07] As used herein, a statement that a cell or population of cells is "negative" for a particular marker refers to the absence of substantial detectable presence on or in the cell of a particular marker, typically a surface marker. When referring to a surface marker, the term refers to the absence of surface expression as detected by flow cytometry, for example, by staining with an antibody that specifically binds to the marker and detecting said antibody, wherein the staining is not detected by flow cytometry at a level substantially above the staining detected carrying out the same procedure with an isotype-matched control under otherwise identical conditions, and/or at a level substantially lower than that for cell known to be positive for the marker, and/or at a level substantially similar as compared to that for a cell known to be negative for the marker.
[08] The term "expression", as used herein, refers to the process by which a polypeptide is produced based on the encoding sequence of a nucleic acid molecule, such as a gene. The process may include transcription, post-transcriptional control, post-transcriptional modification, translation, post-translational control, post-translational modification, or any combination thereof.
[09] As used herein, a subject includes any living organism, such as humans and other mammals. Mammals include, but are not limited to, humans, and non-human animals, including farm animals, sport animals, rodents and pets.
[010] As used herein, a control refers to a sample that is substantially identical to the test sample, except that it is not treated with a test parameter, or, if it is a plasma sample, it can be from a normal volunteer not affected with the condition of interest. A control also can be an internal control.
VII. EXEMPLARY EMBODIMENTS
[0182] 1. A method for culturing target cells, comprising incubating a composition comprising target cells in the presence of:
[0183] a stimulatory agent which is i) reversibly bound to a reagent comprising a plurality of binding sites capable of reversibly binding to the stimulatory agent; and ii) is capable of reversibly binding to the stimulatory agent, under conditions whereby the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells; and
[0184] a selection agent that (i) is capable of specifically binding to a selection marker expressed by one or more of the at least a plurality of the target cells and ii) is reversibly bound to the reagent comprising a plurality of binding sites capable of reversibly binding to the selection agent, thereby generating cultured target cells.
[0185]
[0186] 2. A method for culturing cells, the method comprising:
[0187] (1) combining (a) a composition comprising a plurality of target cells and (b) a selection agent that (i) is capable of specifically binding to a selection marker expressed by one or more of the at least a plurality of the target cells and ii) is reversibly bound to a reagent comprising a plurality of binding sites capable of reversibly binding to the selection agent; and
[0188] (2) incubating at least a plurality of the target cells in the presence of a stimulatory agent reversibly bound to the reagent, the reagent comprising a plurality of binding sites each capable of reversibly binding to the stimulatory agent, under conditions whereby the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells,
[0189] wherein the contacting in (1) and the incubating in (2) are carried out simultaneously or sequentially, in either order, wherein the method generates cultured target cells.
[0190]
[0191] 3. A method for culturing target cells, comprising incubating a composition comprising target cells in the presence of a stimulatory agent and a selection agent each of which is i) reversibly bound to a reagent, which reagent comprises a plurality of binding sites capable of reversibly binding to the stimulatory agent, and one or more binding sites capable of binding to the selection agent,
[0192] wherein the selection agent is capable of specifically binding to a selection marker expressed by at least a subpopulation of the target cells,
[0193] whereby the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells.
[0194]
[0195] 4. The method of any of embodiments 1-4, wherein a further subpopulation of the target cells do not express the molecule on their surfaces, or express it to a lower degree compared to the subpopulation of target cells expressing the molecule on their surfaces.
[0196]
[0197] 5. The method of any of embodiments 1-4, wherein the method results in the preferential induction or modulation of the signal in preferentially induces or modulates the signal in the subpopulation expressing the molecule on the cell surface or expressing it to a higher degree.
[0198]
[0199] 6. The method of any of embodiments 1-5, wherein:
[0200] the reagent is not, and is not bound to or associated with, a solid support, stationary phase, a bead, a microparticle, a magnetic particle, and/or a matrix during said incubation;
and/or
[0201] the reagent is flexible, does not contain a metal or magnetic core, is comprised entirely or primarily of organic multimer, is not spherical, is not substantially spherical or uniform in shape and/or is not rigid.
[0202]
[0203] 7. The method of any of embodiments 1-5, wherein the reagent is immobilized, or is capable of being immobilized, on a support, directly or indirectly, whereby the selection agent is immobilized, or is capable of being immobilized on the support.
[0204]
[0205] 8. The method of embodiment 7, wherein:
[0206] the support is or comprises a stationary phase; and/or
[0207] the support is or comprises a solid support.
[0208]
[0209] 9. The method of any of embodiments 1-8, wherein the reagent comprises a plurality of binding sites, Zl, capable of reversibly binding to the selection agent and the reagent comprise a plurality of binding sites, Zl or Z2, capable of reversibly binding to the stimulatory agent.
[0210] 10. The method of any of embodiments 1-9, wherein:
[0211] the selection agent comprises a binding partner CI and the plurality of binding sites comprises two or more binding sites, Zl, which each are capable of binding to the binding partner CI to form the reversible bond between the selection agent and the reagent; and
[0212] the stimulatory agent comprises a binding partner CI or C2 and the and the plurality of binding sites comprises two or more binding sites, Zl or Z2, which each are capable of binding to the binding partner CI of C2, respectively, to form the reversible bond between the selection agent and the reagent.
[0213] [0214] 11. The method of embodiment 10, wherein:
[0215] CI and C2 are the same or substantially the same, or contain the same or
substantially the same moiety; and/or
[0216] Zl and Z2 are the same or substantially the same or contain the same or substantially the same moiety.
[0217]
[0218] 12. The method of any of embodiments 1-15, wherein:
[0219] the selection agent further comprises a binding site Bl, wherein the specific binding between the selection agent and the selection marker on the target cells comprises interaction between B 1 and the marker; and
[0220] the stimulatory agent further comprises a binding site B2, wherein the specific binding between the stimulatory agent and the molecule on the target cells comprises interaction between B2 and the molecule.
[0221]
[0222] 13. The method of any of embodiments 1-12, wherein the selection marker is a first selection marker and the selection agent is further capable of binding to a second selection marker, which is expressed on the surface of at least a plurality of the target cells.
[0223]
[0224] 14. The method of any of embodiments 1-13, wherein the selection agent is a first selection agent, the selection marker is a first selection marker and the incubation is further carried out in the presence of a second selection agent, which is capable of specifically binding to a second selection marker which is expressed on the surface of at least a plurality of the target cells.
[0225]
[0226] 15. The method of embodiment 14, wherein the reagent comprises a plurality of binding sites capable of reversibly binding to the second selection agent, whereby the second selection agent is reversibly bound to the reagent.
[0227]
[0228] 16. The method of any of embodiments 1-15, wherein:
[0229] the selection marker, which can be a first selection marker, and/or the second selection marker expressed on the surface of the target cells is a protein or polypeptide; and/or [0230] the selection marker, which can be a first selection marker, and/or the second selection marker is a protein or polypeptide.
[0231]
[0232] 17. The method of any of embodiments 1-16, wherein:
[0233 target ce lis comprise blood cells;
[0234 target ce lis comprise leukocytes;
[0235 target ce lis comprise lymphocytes;
[0236 target ce lis comprise B cells;
[0237 target ce lis comprise a B cell population
[0238 target ce lis comprise T cells;
[0239 target ce lis comprise a T cell population; and/or
[0240 target ce lis comprise natural killer (NK) cells;
[0241 target ce lis comprise dendritic cells;
[0242 target ce lis comprise macrophages.
[0243
[0244] 18. The method of any of embodiments 1-17, wherein the target cells comprise antigen- specific T cells or a population thereof, a T helper cell or population thereof, a cytotoxic T cell or population thereof, a memory T cell or population thereof, a regulatory T cell or population thereof, or a NK cell or population thereof, antigen-specific B cells or a population thereof, a memory B cell or population thereof, or a regulatory B cell or population thereof.
[0245]
[0246] 19. The method of any of embodiments 1-18, wherein the target cells comprise T cells.
[0247]
[0248] 20. The method of embodiment 18, wherein the plurality of binding sites capable of reversibly binding to the first selection agent and the plurality of binding sites capable of reversibly binding to the second selection agent can be the same or different.
[0249]
[0250] 21. The method of any of embodiments 1-20, wherein the selection marker, which can be the first selection marker, and/or the second selection marker are selected from among CD25, CD28, CD62L, CCR7, CD27, CD 127, CD3, CD4, CD8, CD45RA, and/or CD45RO.
[0251] [0252] 22. The method of any of embodiments 1-21, wherein:
[0253] the stimulatory agent is capable of initiating a TCR/CD3 complex-associated signal in the T cells; and/or
[0254] the stimulatory agent specifically binds to a member of a TCR/CD3 complex; and/or
[0255] the stimulatory agent specifically binds to CD3.
[0256]
[0257] 23. The method of any of embodiments 20-22, wherein the incubation is further carried out in the presence of a second stimulatory agent, which is capable of specifically binding to a second molecule on the surface of one or more of the T cells, which second molecule is optionally capable of inducing or modulating a signal in target cells in the composition to enhance, dampen or modify a signal delivered through the first molecule.
[0258]
[0259] 24. The method of embodiment 23, wherein:
[0260] the second signal is a signal other than a TCR/CD3 complex-associated signal;
[0261] the second signal is capable of enhancing or potentiating a TCR/CD3 complex- associated signal; or
[0262] the second molecule is a costimulatory molecule, accessory molecule, cytokine receptor, chemokine receptor, immune checkpoint molecule or is a member of the TNF family or the TNF receptor family.
[0263]
[0264] 25. The method of any of embodiments 23 or embodiment 24, wherein the second molecule is selected from among CD28 and CD 137.
[0265]
[0266] 26. The method of any of embodiments 24-25, wherein the second molecule is CD28.
[0267]
[0268] 27. The method of any of embodiments 1-26, wherein:
[0269] the selection agent and/or stimulatory agent comprise an antibody fragment;
[0270] the selection agent and/or stimulatory agent comprise a Fab fragment;
[0271] the selection agent and/or stimulatory agent are is a divalent antibody fragment selected from among a (Fab)2' -fragment and a divalent single-chain Fv (scFv) fragment; [0272] the selection agent and/or stimulatory agent is a monovalent antibody fragment selected from among a Fab fragment, an Fv fragment and an scFv fragment; and/or
[0273] the selection agent and/or stimulatory agent is a proteinaceous binding molecule with antibody- like binding properties selected from among aptamers, muteins based on a polypeptide of the lipocalin family, glubodies, proteins based on the ankyrin scaffold, proteins based on the crystalline scaffold, adnectins and avimers.
[0274]
[0275] 28. The method of any of embodiments 1-27, wherein the reagent is or comprises streptavidin, avidin, an analog or mutein of streptavidin that reversibly binds biotin, a biotin analog or a biologically active fragment thereof; an analog or mutein of avidin or streptavidin that reversibly binds a streptavidin-binding peptide; a reagent that comprises at least two chelating groups K, wherein the at least two chelating groups are capable of binding to a transition metal ion; an agent capable of binding to an oligohistidine affinity tag; an agent capable of binding to a glutathione-S-transferase; calmodulin or an analog thereof; an agent capable of binding to calmodulin binding peptide (CBP); an agent capable of binding to a FLAG-peptide; an agent capable of binding to an HA-tag; an agent capable of binding to maltose binding protein (MBP); an agent capable of binding to an HSV epitope; an agent capable of binding to a myc epitope; or an agent capable of binding to a biotinylated carrier protein.
[0276]
[0277] 29. The method of any of embodiments 1-28, wherein:
[0278] the reagent is or comprises a streptavidin analog or mutein or an avidin analog or mutein that reversibly binds to biotin or a biologically active fragment;
[0279] the reagent is or comprises a streptavidin analog or mutein or an avidin analog or mutein that reversibly binds to a biotin analog or a biologically active fragment; and/or
[0280] the reagent is or comprises a streptavidin analog or mutein or an avidin analog or mutein that reversibly binds to a streptavidin-binding peptide.
[0281]
[0282] 30. The method of any of embodiments 1-29, wherein the reagent is an oligomer or polymer of streptavidin, avidin, an analog or mutein of streptavidin that reversibly binds biotin or a biologically active fragment; a streptavidin or avidin analog or mutein that reversibly binds a streptavidin-binding peptide; a reagent that comprises at least two chelating groups K, wherein the at least two chelating groups are capable of binding to a transition metal ion; an agent capable of binding to an oligohistidine affinity tag; an agent capable of binding to a glutathione- S-transferase; calmodulin or an analog thereof; an agent capable of binding to calmodulin binding peptide (CBP); an agent capable of binding to a FLAG-peptide; an agent capable of binding to an HA-tag; an agent capable of binding to maltose binding protein (MBP); an agent capable of binding to an HSV epitope; an agent capable of binding to a myc epitope; or an agent capable of binding to a biotinylated carrier protein.
[0283]
[0284] 31. The method of any of embodiments 1-30, wherein the reagent comprises an oligomer or polymer of streptavidin, avidin, a streptavidin analog or mutein or and an avidin analog or mutein.
[0285]
[0286] 32. The method of embodiment 30 or embodiment 31, wherein individual molecules of the oligomer or polymer are crosslinked by a polysaccharide or a bifunctional linker.
[0287]
[0288] 33. The method of any of embodiments 1-32, wherein the plurality of binding sites comprises at least 2, 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 72 or more binding sites.
[0289]
[0290] 34. The method of any of embodiments 28-33, wherein the streptavidin-binding peptide is selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)3-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys ((SEQ ID NO: 17), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2-Trp-Ser-His-Pro-Gln- Phe-Glu-Lys (SEQ ID NO: 18) and Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2Gly- Gly-Ser-Ala-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 19).
[0291]
[0292] 35. The method of any of embodiments 1-34, wherein:
[0293] the reagent comprises a streptavidin analog or mutein comprising the amino acid sequence Val44-Thr45-Ala46-Arg47 or lle44-Gly45-Ala46-Arg47 at sequence positions
corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO: l;or [0294] the streptavidin analog or mutein comprises the amino acid sequence Val -Thr - Ala46-Arg47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO: l.
[0295]
[0296] 36. The method of any of embodiments 1-35, wherein the streptavidin analog or mutein comprises:
[0297] a) the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 or 28;
[0298] b) a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to any of SEQ ID NOS:3-6, 27 or 28 and contains the amino acid sequence corresponding to Val^-Thr45- Ala46-Arg47 or lle44-Gly45-Ala46-Arg47 and that reversibly binds to biotin or a biologically active form thereof, a biotin analog or mutein or a biologically active fragment thereof or a
strep tavidin-binding peptide; or
[0299] c) a functional fragment of a) or b) that reversibly binds to biotin or a biologically active form thereof, a biotin analog or mutein or a biologically active fragment thereof or a streptavidin-binding peptide.
[0300]
[0301] 37. The method of embodiment 35 or embodiment 36, wherein the streptavidin analog or mutein further comprises an amino acid replacement or replacements at a position corresponding to 117, 120 and/or 121 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO: l.
[0302]
[0303] 38. The method of embodiment 37, wherein:
[0304] the amino acid replacement or replacements are selected from among Glul 17, Aspl l7, Argl l7, Serl20, Alal20, Glyl20, Trpl21, Tyrl21 or Phel21; or
[0305] the amino acid replacement or replacements are selected from one or more of Glul 17, Glyl20 or Tyrl21; or
[0306] the amino acid replacements are selected from Glul 17, Glyl20 or Tyrl21.
[0307]
[0308] 39. The method of any of embodiments 1-38, wherein the streptavidin analog or mutein comprises:
[0309] a) the sequence of amino acids set forth in SEQ ID NO: 27 or 28; [0310] b) a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NOS:28 and contains the amino acid sequence corresponding to Val44, Thr45, Ala46, Arg47,
Glu 117 , Gly 120 and Tyr 121 and reversibly binds to biotin or a biologically active fragment, a biotin analog or mutein or a biologically active fragment thereof or a streptavidin-binding peptide; or
[0311] c) a functional fragment of a) or b) that reversibly binds to biotin or a biologically active fragment, a biotin analog or mutein or a biologically active fragment thereof or a streptavidin-binding peptide.
[0312]
[0313] 40. The method of any of embodiments 1-39, wherein the binding partner CI and/or the binding partner C2, independently, comprises a streptavidin-binding peptide selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro- Gln-Phe-Glu-Lys-(GlyGlyGlySer)3-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys ((SEQ ID NO: 17), Trp- Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 18) and Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2Gly-Gly-Ser-Ala-Trp-Ser-His- Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 19).
[0314]
[0315] 41. The method of any of embodiments 1-40, further comprising disrupting the reversible binding between the first and/or second receptor-binding agent and the reagent.
[0316]
[0317] 42. The method of embodiment 41, wherein said disruption comprises introducing to the cells a composition comprising a substance capable of reversing the bond between the receptor-binding agent, which can be the first receptor-binding agent, and/or the second- receptor-binding agent and the reagent.
[0318]
[0319] 43. The method of embodiment 42, wherein the substance is a free binding partner and/or is a competition agent.
[0320]
[0321] 44. The method of embodiment 42 or embodiment 43, wherein the substance in the composition is not detrimental to the T cells or to the target cells and/or wherein the addition of said substance does not reduce the percentage of surviving T cells or target cells to less than 90 %, 80 %, 70 %, 60 %, or 50 %, as compared to incubation of the T cells or target cells, respectively, under comparable or the same conditions, without the substance.
[0322]
[0323] 45. The method of any of embodiments 41-44-, wherein said disruption terminates or lessens the signal induced or modulated by one or both of the receptor-binding agent or second receptor-binding agent in the T cells or the target cells.
[0324]
[0325] 46. The method of any of embodiments 41-45, wherein:
[0326] the reagent is or comprises a streptavidin, avidin, a streptavidin analog or mutein or and an avidin analog or mutein or biologically active fragments thereof; and
[0327] the substance comprises a streptavidin-binding peptide, biotin or a biologically active fragment, optionally a D-biotin, or a biotin analog or biologically active fragment.
[0328]
[0329] 47. The method of embodiment 46, wherein:
[0330] the substance is a streptavidin-binding peptide is selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys- (GlyGlyGlySer)3-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys ((SEQ ID NO: 17), Trp-Ser-His-Pro-Gln- Phe-Glu-Lys-(GlyGlyGlySer)2-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 18) and Trp- Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2Gly-Gly-Ser-Ala-Trp-Ser-His-Pro-Gln-Phe-Glu- Lys (SEQ ID NO: 19); and/or
[0331] the substance is CI, C2 or C3 or an analog thereof.
[0332]
[0333] 48. An article of manufacture, comprising a reagent comprising a plurality of binding sites capable of binding to a stimulatory agent and a plurality of binding sites capable of binding to a selection marker, wherein:
[0334] wherein the selection agent is capable of specifically binding to a selection marker expressed by at least a subpopulation of the target cells,
[0335] whereby the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells.
VIII. EXAMPLES [0336] The following examples are included for illustrative purposes only and are not intended to limit the scope of the invention.
EXAMPLE 1 - Generation of a soluble stimulatory reagent, containing multimerized anti- CD3 and anti-CD28 Fab fragments reversibly bound to an oligomeric streptavidin mutein reagent
[0337] Stimulatory agents (anti-CD3 and anti-CD28 Fab fragments) were multimerized by reversibly binding to a multimerization reagent, which was an oligomeric streptavidin mutein. The reagent contained multiple binding sites for peptide tags, which were present on the Fab fragments. The oligomeric streptavidin mutein was prepared by polymerizing the streptavidin mutein designated Strep-tactin® ml (a streptavidin homo-tetramer containing the mutein sequence of amino acids set forth in SEQ ID NO:6, see e.g. U.S. Patent No. 6,103,493 and Voss and Skerra (1997) Protein Eng., 1:975-982) with sulfo-SMCC (sulfosuccinimidyl 4- (N-maleimidomethyl)cyclohexane-l-carboxylate, product #22122 Thermo Scientific) and iminothiolan (product # 26101 Thermo Scientific) according to the manufacturer's instructions (Thermo Scientific). The oligomeric streptavidin mutein molecules were separated from monomeric (unreacted) and dimeric streptavidin mutein by size exclusion chromatography.
[0338] Anti-CD3 and anti-CD28 Fab fragments were reversibly bound to the oligomeric streptavidin mutein via a streptavidin peptide-binding partner fused to each Fab fragment. The anti-CD3 Fab fragment was derived from the CD3 binding monoclonal antibody produced by the hybridoma cell line OKT3 (ATCC® CRL-8001™; see also U.S. Patent No. 4,361,549), and contained the heavy chain variable domain and light chain variable domain of the anti-CD3 antibody OKT3 described in Arakawa et al J. Biochem. 120, 657-662 (1996). These sequences are set forth in SEQ ID NOs:31 and 32, respectively. The anti-CD28 Fab fragment was derived from antibody CD28.3 (deposited as a synthetic single chain Fv construct under GenBank Accession No. AF451974.1; see also Vanhove et al, BLOOD, 15 July 2003, Vol. 102, No. 2, pages 564-570) and contained the heavy and light chain variable domains of the anti-CD28 antibody CD28.3 set forth in SEQ ID NOS: 33 and 34, respectively. The Fab fragments were individually fused at the carboxy-terminus of their heavy chain to a streptavidin peptide-binding sequence containing a sequential arrangement of two streptavidin binding modules having the sequence of amino acids SAWSHPQFEK(GGGS)2GGSAWSHPQFEK (SEQ ID NO: 16). The peptide-tagged Fab fragments were recombinantly produced (see International patent
applications, publication numbers WO 2013/011011 and WO 2013/124474).
[0339] To effect reversible binding, peptide-tagged anti-CD3 and anti-CD28 Fab fragments were mixed with the multimerizing reagent, at approximately room temperature, thereby reversibly binding them to the reagent via interaction between twin-strep-tags on the Fab fragments, which were binding partners capable of reversibly binding to binding sites on the reagent, Specifically, in this study, approximately 0.5 μg of the anti-CD3 peptide tagged Fab fragment and approximately 0.5 μg of the anti-CD28 peptide-tagged Fab fragment were added to approximately 3 μg of soluble oligomeric Strep- tactin® at room temperature. In some cases, the peptide-tagged Fab fragments were pre-mixed prior to immobilization onto the soluble oligomeric mutein streptavidin backbone, which, in some instances, can result in a more uniform distribution of the different Fab molecules. The resulting soluble anti-CD3/anti-CD28 multimerized agent was used to stimulate T cells. In some cases, the resulting soluble anti- CD3/anti-CD28 multimerized agent was stored on ice prior to stimulation of cells.
Example 2: Stimulation/expansion of CD3+ T responder cells with aCD3/aCD28 Fab fragments that were reversibly immobilized on beads coated with the streptavidin mutein Strep-tactin®.
[0340] 300,000 CD3+CD62L-responder T cells (Tresp, isolated by serial magnetic enrichment from a non-mobilized donor apheresis product) were labeled with 3μΜ CFSE and stimulated with 5μ1 of a 15μ1 preparation of Strep tactin® beads (10 mg magnetic particles/ml, loaded with 35 μg Streptactin®/mg beads) either loaded with 0^g aCD3 Fab fragment alone, 0^g aCD28 Fab fragment alone, or a mixture of 0^g aCD3 Fab fragment and 0^g aCD28 Fab.
[0341] The aCD3 Fab fragment used was derived from the CD3 binding monoclonal antibody produced by the hybridoma cell line OKT3. The hybridoma cell line OKT3 and the OKT3 antibody are described in US Patent 4,361,549, the cell line has been deposited under accession number ATCC® CRL-8001™). The CD28 Fab used was derived from the
monoclonal anti-human CD28 antibody CD28.3 (Vanhove et al, BLOOD, 15 July 2003, Vol. 102, No. 2, pages 564-570). The nucleotide sequence of the variable domains of this antibody CD28.3 has been deposited in GenBank in the form of a synthetic single chain Fv construct anti- human CD28 antibody scFv28.3 under GenBank accession number AF451974.1). [0342] Both Fab fragments were recombinantly produced in E. coli as described in
International patent applications WO2013/011011 and WO 2013/124474 carrying as constant domains (CHI and Ckappa) an IgGl consensus sequence. The heavy chain of both Fab fragments was carboxy-terminally fused with a sequential arrangement of two streptavidin binding modules (SAWSHPQFEK(GGGS)2GGSAWSHPQFEK)(SEQ ID NO: 16), that is commercially available as "Twin-Strep-tag® from IBA GmbH, Gottingen, Germany). The aCD3 Fab fragment was used as first agent with the streptavidin binding peptide serving as binding partner CI and the aCD28 Fab fragment was used as second agent with the streptavidin binding peptide serving as binding partner C2. The (tetrameric) streptavidin mutein "Strep- tactin® serves as the reagent on which both Fab fragments were reversibly immobilized.
[0343] In the expansion experiment, Tresp cells stimulated with blank beads (no Fab) served as negative control. Tresp cells were seeded in triplets in 48-well plates along with 300,000 CD3 cells autologous feeder cells (irradiated with 30Gy) in 3ml complete cell culture medium (RPMI (Gibco) supplemented with 10% (v/v) fetal calf serum, L-glutamine, b-mercapto ethanol, HEPES, penicillin, streptomycine and gentamycine) supplemented with lOU/ml interleukin 2 (IL-2). The cells were incubated at 37 °C without media exchange and analyzed after 4 days by FACS analysis. FACS staining and analysis was done after lOmin incubation with ΙΟΟμΜ D- biotin. One representative plot for each condition is shown in Fig. 5A. Plots show live CD3+ cells that were stained with propidium iodide (PI) for live/dead discrimination. Fig. 5A is a histogram showing size-distribution (forward scatter) of stimulated cells. Fig. 5 A shows that a specific cell population of Tresp cells was stimulated and expanded (increase in size/number compared to the unstimulated "beads only" control) when incubated in the presence of beads on which a mixture of 0^g aCD3 Fab fragment and 0^g aCD28 Fab was immobilized, after being stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on beads coated with the streptavidin mutein Strep-tactin®. Fig. 5B depicts histograms of the dilution of the proliferation dye CFSE representing the degree of proliferation according to the number of cells per cell division (indicated on top of Fig. 5B, 0 represents undivided cells; 5 represents cells that have gone through at least 5 divisions). It can be seen from Fig. 5B that the population of T cells stimulated with the beads on which a mixture of 0^g aCD3 Fab fragment and 0^g aCD28 Fab was immobilized have mostly gone through three cell divisions and represent a more uniform proliferation pattern than with a single stimulus alone (small number of cells within the undivided peak "0"). The increased absolute amount of proliferation (more cells have proliferated uniformly after 4d stimulation with aCD3 and aCD28 functionalized beads) is also represented by a more intense consumption of media as depicted by an indicator color change to yellow (depicted as lighter liquid in wells in Fig. 5C).
EXAMPLE 3: Stimulation/expansion of CD3+ T responder cells with aCD3/aCD28 Fab fragments that were reversibly immobilized on soluble Strep-tactin
[0344] In this example CD3+ T responder cells (isolated by magnetic selection from a sample of fresh PBMCs obtained from a Ficoll gradient) were expanded after in vitro stimulation with aCD3/aCD28 Fab fragments that were reversibly immobilized on soluble oligomeric Strep-tactin® acting as a soluble reagent. The oligomeric streptavidin mutein was obtained by polymerizing Strep-tactin® with sulfo SMCC (sulfosuccinimidyl 4-(N- maleimidomethyl)cyclohexane-l-carboxylate, product # 22122 Thermo Scientific) and iminothiolan (product # 26101 Thermo Scientific) according to the protocol of the manufacturer (Thermo Scientific). The oligomeric streptavidin muteins were separated from monomeric (unreacted) and dimeric streptavidin muteins by size exclusion chromatography and the so obtained fraction of the oligomeric streptavidin mutein (n> 3) was used as soluble reagent.
[0345] For the in vitro expansion, 300,000 CD3+ responder T cells (Tresp) were labeled with 2μΜ Carboxyfluorescein succinimidyl ester (CFSE) and stimulated with varying amounts of a preparation of soluble oligomeric streptavidin mutein on which a combination of the above described aCD3 OKT3 Fab fragment and the aCD28 Fab fragment of the antibody 28.3 (both carrying the above-mentioned Twin-Strep-tag® as streptavidin binding peptide at the heavy chain) were immobilized, ("lx" corresponds to 3μg oligomeric streptavidin mutein
functionalized with 0.5μ§ of the aCD3- and 0.5μ§ aCD28 monomeric Fab fragment, the numbers "0.5x", "2x" and "5x" indicate the respective n-fold amount of "lx"). Tresp cells either left unstimulated or were stimulated with blank oligomeric streptavidin mutein (no Fab) served as negative controls. Tresp cells were seeded in duplicates in 48-well plates along with 300,000 CD3 negative autologous feeder cells (irradiated with 30Gy) in 1ml cell culture medium supplemented with 20U/ml IL-2. Cells were incubated at 37°C without media exchange and proliferation was analyzed according to CFSE dilution after 5 days by FACS analysis. Fig. 6 A shows the increase in the size distribution of proliferating cells after 5 days in culture compared to the negative controls. Fig. 6B shows that CD3+ Tresp cells were properly stimulated and proliferated vigorously when incubated with soluble oligomeric streptavidin mutein (as compared to solid Streptactin magnetic particles in Fig.5) on which a mixture of aCD3 Fab and aCD28 Fab fragments were immobilized. The results in Fig. 6 A and 6B indicate that under these in vitro conditions most of the CD3+ T responder cells divided (2 to 5 cell divisions) after engagement of the surface CD28 and TCR/CD3 complex with the aCD3 and aCD28 Fab fragments that were reversibly immobilized on soluble oligomeric streptavidin mutein. After in vitro expansion the soluble multimerized agents were dissociated and removed after D-biotin treatment. The dissociation and removal of monomeric Fab fragments was flow-cytometrically analyzed by restaining cells with phycoerythrine label Strep-Tactin®) (ST-PE). A
representative histogram (dark grey histogram) is shown compared to the appropriate ST-PE only negative control (light gray histogram). It can be seen from Fig. 6C that both Fab fragments had completely dissociated and were entirely removed from the expanded cells. Fig. 6D shows the absolute number of live (trypan blue negative) cells after 5 days. The number was counted using a Neubauer counting chamber and plotted against the respective stimulation condition. Median cell numbers are shown in Fig. 6D; error bars indicate standard deviation (SD). Fig. 6D shows that all which mixtures of aCD3 Fab fragments and aCD28 Fab fragments that were immobilized on a soluble oligomeric streptavidin mutein reagent were equally effective in expanding the CD3+ cells and resulted in an approx. 4-fold increase of absolute cell numbers.
EXAMPLE 4: Kinetics of proliferation of purified CD4+ and CD8+ T responder cells stimulated in vitro with reversible aCD3/aCD28 Fab-Streptamer multimers without medium exchange
[0346] In this example the expansion kinetics of proliferation of purified CD4+ and CD8+ T responder cells (Tresp) that were stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized soluble oligomeric streptavidin muteins were examined. For this purpose, soluble oligomeric Strep-tactin® mutein of two different sizes served as soluble reagent. The first kind of oligomeric Strep-tactin® was the fraction of the oligomeric streptavidin mutein (n> 3) obtained in Example 3 (also referred herein as "conventional oligomeric streptavidin mutein backbone", illustrated by the triangle symbol with the tip on top in Fig. 7). The second kind of this oligomeric streptavidin mutein used as soluble reagent was an oligomeric streptavidin mutein (n> 3) that was reacted with biotinylated human serum albumin (also referred herein as "large oligomeric streptavidin mutein backbone). [0347] In this example 500,000 purified CD4+ or CD8+ responder T cells (Tresp) were separately stimulated with these two different Streptamer multimers as explained above, i.e. with either the oligomeric streptavidin mutein backbone of Example 3 (using a solution with a concentration of lmg oligomeric streptavidin mutein/ml)) or with the large oligomeric streptavidin mutein backbones (O. lmg/ml). 3μ1 of the both different backbones were either loaded with a combination of 0^g of the aCD3 and 0^g aCD28 Fab used in the earlier Examples that carried a streptavidin binding peptide
SAWSHPQFEK(GGGS)2GGSAWSHPQFEK (SEQ ID NO: 16) at the C-terminus of the heavy chain of the Fab fragment. In addition, 4.5μ1 of the conventional oligomeric streptavidin mutein backbone was loaded with 0^g aCD3 Fab fragment, 0^g aCD8 Fab fragment (IBA GmbH Gottingen, that also carries at the C-terminus of the Fab fragment the streptavidin binding peptide SAWSHPQFEK(GGGS)2GGSAWSHPQFEK (SEQ ID NO: 16) and 0^g aCD28 Fab fragment. Untreated (unstimulated) Tresp cells served as negative control and Tresp cells stimulated with commercially available Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) as positive control. Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium (RPMI 1640 (Gibco) supplemented with 10% (v/v fetal calf serum, 0.025% (w/v) L-glutamine, 0.025% (w/v) L-arginine, 0.1% (w/v) HEPES, 0.001% (w/v) gentamycine, 0.002% (w/v) streptomycine, 0.002% (w/v) peniciline) supplemented with 30U/ml IL-2. Cells were incubated at 37°C without media exchange and cell count was analyzed after 1, 3 and 6 days. In the experiments of Fig. 7 the expansion was carried out without medium exchange. The results for the CD4+ T responder cells are shown in Fig.7A, the results for the CD8+ T responder cells are shown in Fig. 7B, with the graphs representing degree of proliferation according to the number of cells harvested per time point for CD4+ Tresp (Fig. 7 A) and for CD8+ Tresp in Fig.7B.
[0348] As can be seen from Fig. 7A the "smaller" soluble reagent on which aCD3 and aCD28 Fab fragments were reversibly immobilized provided for the same amount of expansion of CD4+ T cells as Dynabeads (which are so far the standard reagent for the expansion of T cells), while the "larger" soluble multimerized agent provided for even better expansion compared to Dynabead. This improvement might be caused by the soluble "larger" multimerized being able to bind to more T cells at the same time than the "smaller" multimerized agent, thereby being able to stimulate more CD4+ T cells than the "smaller" multimerized agent. [0349] As evident from Fig. 7B, using the soluble multimerized agents disclosed herein, CD8+ T cells could be expanded within the first 3 days at least as efficiently as with Dynabeads. Notably, in this time period, the expansion experiment that used a soluble reagent that in addition to aCD3 and aCD28 Fab fragments (as first and second agent) carried reversibly immobilized thereon aCD8 Fab fragment, showed the best degree of expansion under these culturing conditions. This indicates that it is possible by using a stimulus that is specific for a particular sub-population of cells (here the aCD8 Fab fragment) to increase or modulate the selectivity of the expansion, thereby being able to obtain larger amounts of a desired cell (sub)- population.
[0350] Thus, summarizing the above, Example 4 shows that the functionality of the soluble multimerized agent in terms of triggering expansion of T cells is comparable to the current standard methodology of using Dynabeads for this purpose. However, since the stimulation can be controlled (and terminated, if wanted) by adding a competitor such as biotin in the case of a streptavidin based reversible interaction between the first and second agent and the reagent, the compositions and methods described herein provide a significant advantage over the Dynabeads technology since the expansion conditions can be optimized (it would for example be possible to stop the stimulation in the experiment of Fig.7B after 3 days). In addition, since the soluble reagent can be easily removed from the reaction (for example, by immobilizing the reagent on a biotinylated column after the expansion reaction), the expansion methods disclosed herein can be carried out and automated in closed systems that are, for example, needed for GMP production of cells for therapeutic purposes, without having to deal with the removal of beads such as Dynabeads.
EXAMPLE 5: Kinetics of proliferation of purified CD4+ and CD8+ T responder cells stimulated in vitro with reversible aCD3/aCD28 Fab-Streptamer multimers with medium exchange
[0351] In this example the expansion kinetics of proliferation of purified CD4+ and CD8+ T responder cells (Tresp) that were stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on soluble oligomeric streptavidin muteins were examined. For this purpose, soluble oligomeric Strep-tactin® mutein of two different sizes served as soluble reagent. The first kind of oligomeric Strep-tactin® was the fraction of the oligomeric
streptavidin mutein (n> 3) obtained in Example 3 (also referred herein as "conventional oligomeric streptavidin mutein backbone", illustrated by the triangle symbol with the tip down in Fig. 7). The second kind of this oligomeric streptavidin mutein used as soluble reagent was obtained by reacting the oligomeric Strep-tactin (n> 3) obtained in Example 3 with biotinylated human serum albumin. This soluble oligomeric reagent is also referred herein as "large oligomeric streptavidin mutein backbone.
[0352] In this example, 400,000 purified CD4+ or CD8+ responder T cells (Tresp) were separately stimulated with these two different oligomeric streptavidin muteins as explained above, i.e. with either the oligomeric streptavidin mutein backbone of Example 3 (1.0 mg/ml) or with the large oligomeric streptavidin mutein backbones (O.lmg/ml). 3μ1 of both the different backbones were either loaded with a combination of 0^g aCD3 and 0^g aCD28 Fab fragments described above. In addition, 4.5μ1 of the oligomeric streptavidin mutein backbone of Example 3 was loaded with 0^g aCD3, 0^g aCD8 Fab and 0^g aCD28 Fab fragment as described above. Untreated (unstimulated) Tresp cells served as negative control and Tresp cells stimulated with Dynabeads (on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) as positive control. Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37°C with media exchange on day 3 and cell count was analyzed after 1, 3 and 6 days. The results for the CD4+ T responder cells are shown in Fig.8 A, the results for the CD8+ T responder cells are shown in Fig. 8B, with the graphs representing degree of proliferation according to the number of cells harvested per time point for CD4+ Tresp (Fig. 8A) and for CD8+ Tresp in Fig. 8B.
[0353] As can be seen from Fig. 8A the soluble reagents on which aCD3 and aCD28 Fab fragments were reversibly immobilized (the multimerized agents) provided for better expansion of CD4+ T cells than Dynabeads.
[0354] As evident from Fig. 8B, using the multimerized agents, CD8+ T cells could be expanded within the first 6 days at least as efficiently as with Dynabeads. Notably, in this time period, the expansion experiment that used the larger soluble reagent that carried aCD3 and aCD28 Fab fragments (as first and second agent) showed the best degree of expansion under these culturing conditions. This might again be caused by the soluble "larger" multimerized agent being able to bind to more T cells at the same time than the "smaller" multimerized agent, thereby being able to stimulate more CD4+ T cells than the "smaller" multimerized agent. EXAMPLE 6: Expansion kinetics of purified CD4+ and CD8+ T cell cultures with or without medium exchange
[0355] In this Example the combined data from Examples 4 and 5 were normalized on input cell number for the "smaller" multimerized agent and positive and negative control. No normalization data was obtained on the "larger" multimerized agent. As explained in Examples 4 and 5, 400,000 to 500,000 CD4+ or CD8+ responder T cells (Tresp) were stimulated with 3μ1 of a preparation of multimerized agent (lmg/ml; on which 0^g aCD3 Fab fragment and 0^g aCD28 Fab fragment were immobilized). Untreated (unstimulated) Tresp cells served as negative control and Tresp cells stimulated with Dynabeads as positive control. Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL- 2. Cells were incubated at 37°C with media exchange (straight lines in Fig. 9) or without media exchange (dashed lines in Fig. 9) on day 3 and cell count was analyzed after 1, 3 and 6 days. As evident from the normalized data of Fig. 9A, the "smaller" soluble reagent on which aCD3 and aCD28 Fab fragments were reversibly immobilized yielded an about 2.5 fold expansion of CD4+ T cells, while the expansion using Dynabeads yielded an about 1.8 fold expansion rate. Thus, the use of a multimerized agent even provides for an improvement in the expansion of CD4+ T cells over Dynabeads. Similarly, Fig. 9B, confirms that CD8+ T cells could be expanded using the multimerized agents within the first 3 days at least as efficiently as with Dynabeads.
EXAMPLE 7: Expansion kinetics & phenotype of polyclonal activated/expanded bulk CD3+ central memory T cells (Tcm)
[0356] In this Example, 500,000 CD3+CD62L+CD45RA- responder Tcm cells (Tresp) were stimulated with 3μ1 of a preparation of the soluble oligomeric streptavidin mutein of Example 3 (lmg/ml) that was either loaded with a combination of 0^g aCD3 and 0^g aCD28 Fab. Furthermore, 4.5μ1 of a preparation of oligomeric streptavidin mutein loaded with 0^g aCD3, 0^g aCD8 Fab and 0^g aCD28 Fab was used as an additional stimulation condition.
Untreated (unstimulated) Tresp cells served as negative control and Tresp cells stimulated with Dynabeads (on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) as positive control. Tresp cells were seeded in 48-well plates in 1ml cell culture medium
supplemented with 30U/ml IL-2 only or 30U/ml IL-2 and 5ng/ml IL-15. Cells were incubated at 37 °C with media exchange every 3 days and cell count was analyzed after 7 and 14 days. Graphs represent degree of proliferation according to the number of cells harvested per time point, in Fig. 10A only IL-2 supplemented media and in Fig. 10B IL-2 and IL-15 supplemented media. As can be seen from both Fig. 10A and Fig. 10B, the soluble reagent that has reversibly bound thereon CD3 Fab fragment and aCD28 Fab fragment yields better cell expansion than the Dynabeads. As further shown by the flow-cytometric analysis of CD62L and CD 127 surface expression after 14 days of culture in variable cytokine milieus of Fig. IOC, the experimental approaches using multimerized agents retain, under both conditions chosen here, a higher content of CD127-expressing long-lived memory T cells than expansion with Dynabeads. This illustrates a further advantage of the methods of the present compositions and methods described herein.
EXAMPLE 8: Yield and phenotype of expanded CD8+ T cells - size variation of soluble reagent and addition of aCD8-Fab addition for stimulation
[0357] In this Example, the expansion of purified CD8+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized soluble oligomeric streptavidin muteins were examined. In addition, the effect of adding aCD8-Fab to the reagent for increasing the specificity of the expansion for CD8+ T cells was examined.
[0358] For this purpose, 300,000 purified CD8+ responder T cells (Tresp) were separately stimulated with two different Streptactin based reagents, namely either the small multimerized agent of Example 3 (lmg/ml) or the larger multimerized agent described above (O.lmg/ml). 3μ1 of both oligomeric streptavidin mutein reagent backbones were either loaded with a combination of the 0^g aCD3 and 0^g aCD28 Fab fragments described above to form the multimerized agents. In addition, 4.5μ1 of the smaller oligomeric streptavidin mutein backbone was loaded with 0^g aCD3, 0^g aCD8 Fab and 0^g aCD28 Fab fragments described above.
Furthermore 3μ1 of the "smaller" oligomeric streptavidin mutein backbone only functionalized with 0^g aCD3 Fab fragment alone or 0^g aCD28 Fab fragment alone was used.
Unstimulated Tresp cells served as negative control and Tresp stimulated with Dynabeads served as positive control. Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37°C with media exchange after 3 days and analyzed after 6 days. Fig. 11A depicts the degree of proliferation according to the number of cells harvested at day 6 compared to the negative controls and normalized to the positive control. Fig. 11 A shows that the expansion of the CD8+ T cells using the multimerized agents result in higher yields of the CD8+ T cells than expansion using dynabeads. The FACS analysis of CD8 surface expression and CD45RO surface expression (Fig. 1 IB) after cell culture shows that the same phenotype of CD8+ T cells were expanded by either the multimerized agents or Dynabeads (the various stimulating conditions were compared using one-way ANOVA and no significant difference (n.s.) was detected). The improved yield of the CD8+ cells using the expansion methods disclosed herein compared to the Dynabeads might be due to the fact that the soluble multimerized agents can access their target receptors on the cell surface better than the antibodies that are immobilized on the Dynabeads. This improved yield might become very advantageous when expanding rare population of cells from an initial sample.
[0359] In addition, comparing the yield of expansion achieved with the reagent on which both the O^g aCD3 and O^g aCD28 Fab fragments were jointly immobilized (second column from the left in Fig. 1 IB) to the yield using two reagents which were functionalized only with the aCD3 Fab fragment alone or the aCD28 Fab fragment alone (third column from the left in Fig. 1 IB), it can be seen that both experiments had the same expansion efficiency. Thus, these experiments show that using one reagent on which both the first agent and the second agent are jointly immobilized is functionally equivalent to using for the expansion two separate reagents which are loaded with only the first agent and the second agent, respectively.
EXAMPLE 9: Yield & phenotype of expanded CD8+ T cells - titration of separate soluble reagents with different ratios of aCD3- and aCD28 Fab fragment immobilized thereon
[0360] In this Example, the yield and the phenotype of expanded CD8+ T responder cells (Tresp) that were stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized in different amounts on soluble oligomeric streptavidin muteins were examined.
[0361] For this purpose 300,000 CD8+ responder T cells (Tresp) were stimulated with varying amounts of a mixture of preparations of the "small" oligomeric streptavidin muteins (lmg/ml) functionalized with aCD3 Fab alone and aCD28 Fab alone ("lx" corresponds to l^g oligomeric streptavidin mutein functionalized with 0^g aCD3 alone and l^g oligomeric streptavidin mutein functionalized with 0^g aCD28 Fab fragment alone), or 3μ1 of a preparation of the oligomeric streptavidin mutein loaded with 0^g aCD3 and aO^g CD28 Fab, or 4.5μ1 of a preparation of the oligomeric streptavidin mutein loaded with 0^g aCD3, 0^g strep-tagged aCD8 and 0^g aCD28 Fab. Untreated Tresp cells served as negative control and Tresp stimulated with Dynabeads as positive control. Tresp cells were seeded in 48- well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37 °C without media exchange and analyzed after 5 days. Fig. 12A depicts the degree of proliferation according to the number of cells harvested at day 5 compared to the negative controls and normalized to the positive control. Fig. 12A shows that the expansion of the CD8+ T cells using the various multimerized agents result in higher yields of the CD8+ T cells than expansion using dynabeads (especially the cumulative total reagent amount of the 5x condition resulted in an optimal expansion of cells especially over time/increase in total cells by beginning cell division). The FACS analysis of CD8 surface expression and CD45RO (Fig. 12B) surface expression after cell culture shows that the same phenotype of CD8+ T cells were expanded by either the multimerized agents or by the commercially available Dynabeads.
EXAMPLE 10: Yield and subset composition of expanded CD3+ T cells with addition of aCD8-Fab for stimulation
[0362] The experiment shows the expansion of purified CD3+ T responder cells stimulated in vitro with aCD3/aCD28 Fab fragments that were reversibly immobilized on the soluble oligomeric streptavidin muteins of Example 3 that served as a soluble reagent. In one experiment, in addition to aCD3/aCD28 Fab fragments, a aCD8 Fab fragment commercially available from IBA GmbH, Gottingen, Germany (catalogue number 6-8000-203) was immobilized on the soluble oligomeric streptavidin mutein in order to test whether it is possible to preferentially stimulate a specific T cell subpopulation in vitro with the reversible
aCD3/aCD28 multimerized agents. In more detail, 500,000 purified CD3+ responder T cells (Tresp) were stimulated with 3μ1 of a preparation of oligomeric streptavidin muteins (lmg/ml) loaded with a combination of 0^g of the aCD3 and 0^g of the aCD28 Fab. As an alternative approach, 4.5μ1 of the oligomeric streptavidin muteins were loaded with 0^g aCD3, 0^g strep-tagged aCD8 Fab and 0^g strep-tagged aCD28 Fab. Unstimulated Tresp cells served as negative control and Tresp stimulated with Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) served as positive control. As can be seen from Fig. 13 A, the reagent that is reversibly loaded with the aCD3 Fab fragment, the aCD28 Fab fragment and also the aCD8 Fab fragment provided the highest number of expanded CD3+ T cells. With lx, lxlO6 the number of expanded cells the yield was about 30 % higher than for expansion of these T cells using commercially available Dynabeads. In addition and more important, as shown in Fig. 13B with this reagent that caries the aCD3 Fab fragment, the aCD28 Fab fragment and the aCD8 Fab fragment, the amount of CD8+ T cells were the highest, compared to both the expansion with Dynabeads or a soluble reagent that caries only the aCD3 Fab fragment and the aCD28 Fab fragment as first and second agent as described herein. Thus, also this experiment shows the advantage of the compositions and methods described herein that in addition to a first agent that provides a primary activation signal to the desired cell population and optionally a second agent that provides a co-stimulatory signal, a further agent that is specific for the activation of the desired cell population can be immobilized on the reagent. Thus, by so doing, the compositions and methods described herein provide for the possibility of preferentially expanding or selectively enriching any desired cell population or subpopulation from an sample that, for example, comprises a variety of different subpopulations.
EXAMPLE 11: Analysis of the differential intracellular calcium mobilization in Jurkat cells
[0363] Real-time low-cytometric analysis of the differential intracellular calcium
mobilization induced in Jurkat cells that are either labeled with the aCD3 antibody clone OKT3 or with Fab fragments of OKT3 being multimerized with Strep-tactin® was examined here.
[0364] For this purpose, Jurkat cells were loaded with the calcium- sensitive dye Indo-l-AM and calcium release was triggered by injection of either aCD3 monoclonal antibody OKT3 (produced by the hybridoma cell line OKT3, see above, black squares) or aCD3 Fab fragments (derived from the parental cell line OKT3) that were multimerized by reversible binding of its streptavidin binding peptide to soluble Strep-Tactin fluorescently conjugated with
phycoerythrin. In the case of the intact multimeric OKT3 Fab-Strep-Tactin complexes, the calcium release was triggered over an identical time period as with the parental antibody clone (dark grey triangles). Activation of cells could be completely avoided by injection of D-biotin treated, pre-dissociated Fab-Strep-Tactin complexes (light grey circles) identical to injection of the PBS negative control (inverted white triangles). Application of ionomycine served as positive control for calcium influx. Time-resolved changes in intracellular Ca2+ concentration were monitored by flow-cytometry based on the change in FL6/FL7 ratio. It can be seen from Fig. 14A that both the parental antibody OKT3 as well as the multimerized monovalent Fab fragment of OKT3 effected calcium release, meaning that the multimerized monovalent Fab fragment of OKT3 is essentially as functional as the parental antibody. Notably, the multimeric OKT3 Fab fragment was not able to trigger calcium release if biotin was added to Strep-tactin on which the OKT3 Fab fragment was immobilized prior to the addition of the Streptactin- OKT3 Fab fragment. In this case, the biotin disrupted the reversible bond formed between Strep- tactin as multimerization agent and the OKT3 Fab fragment. The monovalent Fab fragment was therefore displaced from the multimerization agent and after dissociation was not able to trigger calcium release by binding to CD3 of the Jurkat cells.
[0365] In the experiments shown in Fig. 14B indo-l-AM-labeled Jurkat cells were activated by OKT3 derived aCD3 Fab-Strep-Tactin-complexes as described in Fig. 14A. Injection of intact (upper graph) or pre-dissociated complexes (lower graph) served as positive or negative controls respectively. In addition, stimulation of cells with intact Fab-Strep Tactin-complexes followed by subsequent injection of D-biotin (near the peak activation at t=140s) resulted in abrupt disruption of aCD3 Fab-multimer signaling (middle graph). Injection of ionomycine into the pre-dissociated Fab complex group served as positive control. Data are representative of three different experiments. Importantly, Fig. 14B shows that the addition of D-biotin to the sample rapidly displaces the Fab fragment from the Strep-tactin multimerization agent, thereby effectively terminating the calcium release even under ongoing calcium stimulation and demonstrating that the dissociated OKT3 Fab fragment is not any longer biologically active. Likewise, the multimeric OKT3 Fab fragment was also not able to trigger calcium release when biotin was added to the Strep-tactin-OKT3 Fab fragment multimer prior to the addition of the Streptactin-OKT3 Fab sample to the Jurkat cells.
EXAMPLE 12: Reversible staining of cells by CD3 Fab-multimers
[0366] This Example examines the reversible staining of cells by CD3 Fab-multimers.
Freshly isolated PBMCs were stained with either the aCD3 monoclonal antibody clone OKT3 (left dot plot, parental clone for the Fab-multimers) or cognate phycoerythrine (PE)-labeled OKT3 Fab-multimers and analyzed either before (second left column) or after treatment with D- biotin (middle column). Remaining Fab monomers were then detected after subsequent washing steps using fresh PE-labeled Strep-Tactin® (second right column). Secondary Fab-multimer staining of reversibly stained cells served as control (right column). Only live CD3 cells which are negative in staining with propidium iodide (PI) for live/dead discrimination are shown in Fig. 15. Numbers in dot plots indicate the percentage of cells within gates. This experiment shows that the staining of CD3+ PBMCs with an anti-CD3 Fab fragment multimerized with Streptactin as multimerization reagent is fully reversible by addition of D-biotin and that the monovalent Fab fragment alone does not bind to the CD3 molecule present on PBMCs.
EXAMPLE 13: Reversible isolation of cells by CD28 Fab-multimers
[0367] This Example shows the isolation of cells by reversible binding of anti-CD28 Fab fragments multimerized with Strep-Tactin® magnetic particles (the magnetic particles are available from IB A GmbH Gottingen, Germany). The Fab fragments derived from the antibody CD28.3 described in Example 2 above were used for this purpose. CD28+ cells were
selected/isolation by Fab-multimer magnetic cell selection from freshly isolated PMBCs as essentially described in International Patent Application WO2013/011011. Before selection cells were control stained with either the cognate fluorescent aCD28-multimers (left dot plot) or with an antibody directed against the immunoglobulin kappa light chain (second left dot plot, a-Ig kappa mAb) as a control staining. After selection, CD28+ cells were treated with D-biotin and subsequently washed to remove magnetic beads and Fab-monomers. Liberated CD28+ cells were subsequently (re-) stained either with CD28 Fab-multimers (second right dot plot) or with the a-Igkappa mAb (right dot plot) to detect potentially remaining Fab-monomers. Only live (PInegatlve) CD3+ cells are shown. Numbers in dot plots indicate the percentage of cells within gates. Fig. 16 shows that CD28+ cells can be isolated from PMBC using such multimerized anti- CD28 Fab fragment and that all isolation reagents including the anti CD28 Fab-monomers can be removed after selection.
EXAMPLE 14: Early cluster formation after activation of purified CD4+ and CD8+ T responder cells stimulated in vitro with reversible aCD3/aCD28 Fab-Streptamer multimers
[0368] In this Example, 400.000 CD4+ or CD8+ responder T cells (Tresp) were stimulated with 3μ1 of a preparation of oligomeric Streptactin multimerization reagent (lmg/ml) loaded with a combination of 0^g aCD3- and 0^g aCD28 Fab. Untreated (unstimulated) Tresp cells served as negative control and Tresp cells stimulated with Dynabeads as positive control. Tresp cells were seeded in duplicates in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37°C and microscopically analyzed after 1 and 2 days. Stimulation of CD4+ Tresp (Fig. 17A) and CD8+ Tresp (Fig. 17B) are shown for Dynabeads (middle row) and Streptamer multimers (lower row) respectively. The photographs represent degree of cluster formation: For better visibility exemplary clusters are indicated by circles for the stimulation with soluble streptavidin mutein oligomers in Fig. 17A and Fig. 17B. Clusters within the Dynabead stimulation are readily visibly by accumulation of dark stimulatory particles. As evident, both for CD4+ and CD8+ T cells early clusters formed when using the expansion method of the invention that employs a soluble oligomeric multimerization reagent.
EXAMPLE 15: Selective Antigen-specific expansion of Tcm responder cells out of bulk CD3+ central memory T cells (kinetics & phenotype)
[0369] In this Example, the kinetics and the phenotype of selective Antigen specific (Ag- specific) expansion out of purified CD3+CD62L+CD45RA- Tcm responder cells was examined.
[0370] In more detail, CD3+CD62L+CD45RA- Tcm responder cells were stimulated in vitro with both a peptide:MHC molecule complex (that acts as first agent that provides a primary activation signal to the cells) and an aCD28 Fab fragment (that acts as second reagent that stimulates an accessory molecule on the surface of the cells). Both the complex of antigen specific peptide with the MHC molecule and the aCD28 Fab fragment were reversibly immobilized on the soluble oligomeric streptavidin mutein (with n> 3) described in Example 3. The peptide that was used for the antigen specific expansion was the peptide CRVLCCYVL (SEQ ID NO: 06), amino acids 309-317 of the immediate-early 1 protein (described in Ameres et al, PLOS Pathogens, May 2013, vol. 9, issue 5, el003383) representing an HLA-C7/IE-1 epitope that is specific for cytomegalovirus (CMV). The MHC I molecule that presents the peptide carries at the C-terminus of the a chain (heavy chain) the streptavidin binding peptide (SAWSHPQFEK(GGGS)2GGSAWSHPQFEK, (SEQ ID NO: 07) that is commercially available as "Twin-Strep-tag®" from IBA GmbH, Gottingen, Germany).
[0371] For this purpose, 500.000 CD3+CD62L+CD45RA- responder Tcm cells (Tresp) were stimulated Ag- specifically using 3μ1 of a preparation of soluble oligomeric Streptactin multimerization reagent functionalized with 0^g of the peptide:MHC class I complexes equipped with the streptavidin binding peptide and with 0^g of the aCD28 Fab described above. As an alternative, 4.5μ1 of a preparation of the Streptactin multimerization reagent were loaded with 0^g of these peptide:MHC class I complexes, 0^g CD8 aFab and 0^g aCD28 Fab. For comparison, polyclonal stimulation was performed, using 3μ1 of a preparation of Streptactin multimerization reagent (lmg/ml) either loaded with a combination of 0^g aCD3 Fab and 0^g aCD28 Fab. Again as the alternative stimulation condition described above, 4.5μ1 of a preparation of Streptactin multimerization reagent reversibly loaded with 0^g aCD3 Fab, 0^g aCD8 Fab and 0^g aCD28 Fab was used. Untreated (unstimulated) Tresp cells served as negative control and Tresp cells stimulated polyclonal with Dynabeads (beads on which aCD3 and aCD28 monoclonal antibodies are irreversible immobilized) as positive control. Tresp cells were seeded in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2 and 5ng/ml IL-15. Cells were incubated at 37°C with media exchange every 3 days and cell count was analyzed after 7 and 14 days. The exemplary flow-cytometric analysis for the fraction of Ag-specific cells that was stimulated/expanded via the soluble strept-tactin oligomer on which the peptide:MHC-I complex for an HLA-C7/IE-1 epitope (for CMV) was immobilized (Fig. 18A) show that these antigen- specific T cells were specifically expanded. The graphs of Fig. 18B to Fig. 18E (that represent the degree of expansion of distinct Ag- specificities according to the number of peptide :MHCI multimer-positive cells harvested per time point in analogy to the expansion experiment shown in Fig.l8A) show that, the multimerization reagent that uses the respective complex of the Ag-specific peptide and MHC 1 molecule provided for the highest number of expanded cells (ranging from an twentyfold increase in the number of cells for the Ag-specific cells that recognize the pp65 epitope of CMV (amino acids 341-350 (QYDPVAALF, (SEQ ID NO: 08)) restricted by HLA-A2402) (see Fig. 18B) to an 98 fold increase in the number of Ag-specific cells that recognize the HLA-B7/IE- I 309-317 epitope (CRVLCCYVL (SEQ ID NO: 06)) of CMV (see Fig. 18E), thereby showing that the expansion method of the present invention is fully applicable to the expansion of Ag-specific cells. Finally, the exemplary flow-cytometric analysis of CD62L and CD 127 surface expression after 14 days of culture for HLA-B7/Hexon5 epitope (for adenovirus) shown in Fig. 18F further confirms that experimental approaches using the soluble multimerization reagents of the present invention retain a higher content of CD127-expressing long-lived memory T cells in polyclonal and Ag- specific stimulatory conditions.
EXAMPLE 16: Selective Ag-specific expansion kinetics & phenotype of bulk central memory T cells
[0372] This Example examines the kinetics of selective Ag-specific expansion out of purified CD3+CD62L+CD45RA-Tcm responder cells that were stimulated in vitro with a) antigen specific peptide MHC I complexes and b) aCD28 Fab fragments that were reversibly immobilized as first and second agent on soluble oligomeric streptavidin muteins. [0373] For this purpose 500.000 CD3+CD62L+CD45RA- responder Tern cells (Tresp) were stimulated Ag-specifically using 3μ1 of a preparation of Streptactin multimerization reagent functionalized with 0^g peptide:MHC class I complexes equipped with a streptavidin binding peptide (the specific peptide represents amino acids 114-124 (CPYSGTAYNSL, SEQ ID NO: 10) of the Hexon 5 protein of adenovirus ) restricted by HLA-B07) and 0^g aCD28 Fab. As an alternative, 4.5μ1 of a preparation of Streptactin multimerization reagent loaded with 0^g this peptide:MHC class I complex, 0^g aCD8 Fab and 0^g aCD28 Fab. For comparison, polyclonal stimulation was performed, using 3μ1 of a preparation of Streptactin multimerization reagent (lmg/ml) either loaded with a combination of 0^g aCD3 Fab and 0^g aCD28 Fab. Again as the alternative stimulation condition described above, 4.5μ1 of a preparation of Streptactin multimers loaded with 0^g aCD3 Fab, 0^g aCD8 Fab and 0^g aCD28 Fab was used. Untreated (unstimulated) Tresp cells served as negative control and Tresp cells stimulated polyclonal with Dynabeads as positive control. Tresp cells were seeded in 48- well plates in 1ml cell culture medium supplemented with 30U/ml IL-2 and 5ng/ml IL-15. Cells were incubated at 37°C with media exchange every 3 days and cell count was analyzed after 7 and 14 days. The pictures shown in Fig. 19 represent degree of cluster formation on day 5, exemplary Ag-specific stimulation is illustrated for the HLA-B7/Hexon 5 epitope of adenovirus. As can be seen from Fig. 19, such adenovirus antigen specific cells could be specifically expanded from the original CD3+CD62L+CD45RA-Tcm responder population.
EXAMPLE 17: Activation of intracellular signaling cascades after Strep tamer multimers stimulation of aCD19-CAR transduced Jurkat cells
[0374] In this Example the activation of intracellular signaling cascades of transduced Jurkat cells that have been modified to express a tumor- specific chimeric antigen receptor (CAR), namely here CD 19 and that were stimulated using the oligomeric Strep-tactin® of Example 3 as soluble multimerization reagent was examined.
[0375] For this purpose, 300.000 Jurkat responder cells (Jresp) were stimulated with (A) varying amounts of a mixture of preparations of Streptactin multimerization reagent (lmg/ml) functionalized with aCD3 Fab and aCD28 Fab fragments described here („xl" corresponds to 3μg Streptactin multimerization reagent functionalized with 0^g aCD3- and 0^g aCD28 Fab - this provides a "polyclonal Streptactin based multimerization reagent"), or (B) 3μ1 of a preparation of Streptactin multimerization reagent functionalized with 0^g (xl) or ^g (x2) of the extracellular domain (ECD) of CD 19 (the natural ligand for the aCD19-CAR - this provides a "CAR-specific Streptactin based multimerization reagent"), or 3μ1 of a preparation of
Streptactin multimerization reagent loaded with O^g (xl) or ^g (x2) algG recognizing the IgG4 spacer within the aCD19-CAR - this also provides a "CAR-specific Streptavidin mutein based multimerization reagent). ECD of CD 19 equipped with a hexahistidine tag was obtained from Sino Biological/Life technologies (SEQ ID NO: 27) and was functionalized for binding to the streptavidin based multimerization reagent by mixing the ECD of CD 19 with the adapter molecule His-STREPPER (IBA GmbH, Germany, Order number 2-0920-005) at a molecular ratio of 1: 1 and incubating for 15 min at room temperature. The His-STREPPER adapter molecule contains a chelating portion that binds to the hexahistidine tag and a streptavidin binding peptide, thereby temporarily providing the target molecule, here the ECD of CD 19 with a streptavidin binding peptide that can reversibly bind to a streptavidin mutein based
multimerization reagent. Jresp stimulated with Dynabeads (beads having irreversibly
immobilized thereon aCD3- and aCD28- monoclonal antibodies) or PMA and lonomycin served as positive controls. Jresp cells were seeded in 1.5ml Eppendorf tubes in 200μ1 cell culture medium supplemented with 30U/ml IL-2. Cells were incubated at 37°C and put on ice and lysed after Omin to 20min of stimulation. Detection of phosphorylated ERK indicates active MAPK signaling, staining of the housekeeper β-Actin indicates loading of equal amounts of total protein per condition and time point. As can be seen from the comparison of Fig. 20A showing activation of the Jurkat cells via the "polyclonal Streptactin multimerization reagent" and Fig. 20B showing activation of the Jurkat cells via the two "CAR-specific Streptactin based multimerization reagents", the Jurkat cells can be activated/expanded via the binding of the CD 19 extracellular domain to the CD 19 specific chimeric antigen receptor. Since genetic downstream processing of T cells is almost exclusively performed on pre-selected cell populations, a generic activation via cross-linking of introduced CARs via the IgG4 spacer domain (this is conserved within various CARs with different specificities) broadens the applicability for reversible cell stimulation/expansion in these in vitro cell-processing situations.
[0376] Thus, this experiment shows that in principle any cell population that is activated by binding of an agent (ligand) that provides a primary activation signal to the cell population can be expanded using a first agent reversibly immobilized on a multimerization reagent as described here.
EXAMPLE 18: Parallel Antigen-specific expansion of Tcm responder cells out of a single pool
[0377] In this Example, the kinetics of parallel Antigen specific (Ag-specific) expansion out of a single pool of T responder cells stimulated in vitro with multiple reversible peptide :MHC/ aCH28 Fab-Streptamer multimers is examined.
[0378] 500.000 CD3+CD62L+CD45RA- responder Tern cells (Tresp) are simultaneously stimulated for multiple Ag-specificities using for each specificity, 3μ1 of Streptactin multimers functionalized with 0^g of the respective peptide:MHC class I complexes that carries a streptavidin binding peptide and 0^g aCD28 Fab that also carries a streptavidin binding peptide. As an alternative approach, 4.5μ1 of Streptactin based multimerization reagent functionalized with 0^g peptide:MHC class I complexes carrying a streptavidin binding peptide, 0^g aCD8 Fab and 0^g aCD28 Fab as described here are used for each specificity. For comparison, polyclonal stimulation is performed, using 3μ1 of a preparation of Streptactin based multimerization reagent (lmg/ml) either reversibly loaded with a combination of 0^g aCD3 Fab and 0^g aCD28 Fab. Again as the alternative stimulation condition described above, 4.5μ1 of a preparation of the Streptactin based multimerization reagent reversibly loaded with 0^g aCD3 Fab, 0^g aCD8 Fab and 0^g aCD28 Fab (each of them carrying a streptavidin binding peptide can be used. Untreated (unstimulated) Tresp cells serve as negative control and Tresp cells stimulated polyclonal with Dynabeads (aCD3- and aCD28- mAb coated beads) as positive control. Tresp cells are seeded in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2 and 5ng/ml IL-15. Cells are incubated at 37°C with media exchange every 3 days and cell count are analyzed after 7 and 14 days.
EXAMPLE 19: Preferential proliferation of CD8+ T cells among CD3+ T responder cells stimulated in vitro with streptavidin based multimerization reagents reversibly functionalized with aCD3/aCD8/aCD28 Fab fragments
[0379] 300.000 CD3+ responder T cells (Tresp) are stimulated with 3μ1 of a preparation of Streptactin multimerization (lmg/ml) or a preparation of a multimerization reagent using the large Streptactin backbone (0. lmg/ml) either loaded with a combination of 0^g aCD3 and 0^g aCD28 Fab, or 4.5μ1 of a preparation of Streptactin based multimerization reagent loaded with 0^g aCD3, 0^g aCD8 Fab and 0^g aCD28 Fab, or 3μ1 of a mixture of preparations of Streptactin based multimerization reagent with 0^g aCD3 Fab alone and 0^g aCD28 Fab alone (each Fab fragment again carries a streptavidin binding peptide). Untreated Tresp cells serve as negative control and Tresp stimulated with Dynabeads (aCD3- and aCD28- mAb coated beads) as positive control. Tresp cells are seeded in duplicates in 48- well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells are incubated at 37 °C with media exchange after 3 days and analyzed after 6 days.
EXAMPLE 20: Preferential proliferation of CD8+ T cells among CD3+ T responder cells stimulated in vitro with streptavidin based multimerization reagents reversibly functionalized with aCD3 and aCD28 Fab fragments
[0380] 300.000 CD3+ responder T cells (Tresp) are stimulated with varying amounts of a mixture of preparations of Streptactin based multimerization reagent (lmg/ml) functionalized with aCD3 Fab fragment alone and aCD28 Fab fragment alone (l^g Streptactin based multimerization reagent functionalized with 0^g aCD3 Fab fragment alone and l^g
Streptactin based multimerization reagent functionalized with 0^g aCD28 Fab fragment alone), or varying amounts of a mixture of preparations of Streptactin based multimerization reagent functionalized with aCD3 Fab fragment and aCD28 Fab fragment with or without aCD8 Fab fragment (each Fab fragment again carries a streptavidin binding peptide) (3μg Streptactin based multimerization reagent functionalized with 0^g aCD3- and 0^g aCD28 Fab fragment - without aCD8 Fab fragment, or 4.5μ1 of a preparation of Streptactin multimerization reagent loaded with 0^g aCD3 Fab fragment, 0^g aCD8 Fab fragment and 0^g aCD28 Fab fragment, wherein Fab fragment again carries a streptavidin binding peptide). Untreated Tresp cells serve as negative control and Tresp stimulated with Dynabeads (aCD3- and aCD28- mAb coated beads) as positive control. Tresp cells are seeded in 48-well plates in 1ml cell culture medium supplemented with 30U/ml IL-2. Cells are incubated at 37°C with media exchange after 3 days and analyzed after 6 days.
[0381] The present invention is not intended to be limited in scope to the particular disclosed embodiments, which are provided, for example, to illustrate various aspects of the invention. Various modifications to the compositions and methods described will become apparent from the description and teachings herein. Such variations may be practiced without departing from the true scope and spirit of the disclosure and are intended to fall within the scope of the present disclosure.
82] SEQUENCES
Figure imgf000150_0001
Figure imgf000151_0001
Figure imgf000152_0001
GGRHELRRNIAVTTSMSCTDFSFHFPVCVQDLISPINVSL
NFSLWEEEGTPRDQRAQGKDIPPILRPSLHSETWEIPFEK
NCGEDKKCE ANLR VS FS P ARS R ALRLT AF AS LS VELS LSN
LEEDAYWVQLDLHFPPGLSFRKVEMLKPHSQIPVSCEEL
PEES RLLS R ALS CN V S S PIFK AGHS V ALQMMFNTL VN S S
WGDSVELHANVTCNNEDSDLLEDNSATTIIPILYPINILIQ
DQEDSTLYVSFTPKGPKIHQVKHMYQVRIQPSIHDHNIPT
LEAVVGVPQPPSEGPITHQWSVQMEPPVPCHYEDLERLP
DAAEPCLPGALFRCPVVFRQEILVQVIGTLELVGEIEASS
MFSLCSSLSISFNSSKHFHLYGSNASLAQVVMKVDVVYE
KQMLYLYVLSGIGGLLLLLLIFIVLYKVGFFKRNLKEKM
EAGRGVPNGIPAEDSEQLASGQEAGDPGCLKPLHEKDSE
SGGGKD
QECTKFKVSSCRECIESGPGCTWCQKLNFTGPGDPDSIRC LFA-Ιβ
DTRPQLLMRGCAADDIMDPTSLAETQEDHNGGQKQLSP
QKVTLYLRPGQAAAFNVTFRRAKGYPIDLYYLMDLSYS (homo sapiens)
MLDDLRNVKKLGGDLLRALNEITESGRIGFGSFVDKTVL
PFVNTHPDKLRNPCPNKEKECQPPFAFRHVLKLTNNSNQ
FQTEVGKQLISGNLDAPEGGLDAMMQVAACPEEIGWRN
VTRLLVFATDDGFHFAGDGKLGAILTPNDGRCHLEDNL
YKRSNEFDYPSVGQLAHKLAENNIQPIFAVTSRMVKTYE
KLTEIIPKSAVGELSEDSSNVVQLIKNAYNKLSSRVFLDH
NALPDTLKVTYDSFCSNGVTHRNQPRGDCDGVQINVPIT
FQVKVTATECIQEQSFVIRALGFTDIVTVQVLPQCECRCR
DQSRDRSLCHGKGFLECGICRCDTGYIGKNCECQTQGRS
SQELEGSCRKDNNSIICSGLGDCVCGQCLCHTSDVPGKLI
YGQYCECDTINCERYNGQVCGGPGRGLCFCGKCRCHPG
FEGS ACQCERTTEGCLNPRR VEC S GRGRCRCN VCECH S G
YQLPLCQECPGCPSPCGKYISCAECLKFEKGPFGKNCSAA
CPGLQLSNNPVKGRTCKERDSEGCWVAYTLEQQDGMD
RYLIYVDESRECVAGPNIAAIVGGTVAGIVLIGILLLVIWK
ALIHLS DLRE YRRFEKEKLKS Q WNNDNPLFKS ATTT VMN
PKFAES
DFLAHHGTDCWTYHYSEKPMNWQRARRFCRDNYTDLV L-selectin
AIQNK AEIE YLEKTLPFS RS Y Y WIGIRKIGGI WT W VGTNK
SLTEEAENWGDGEPNNKKNKEDCVEIYIKRNKDAGKWN (homo sapiens)
DDACHKLKAALCYTASCQPWSCSGHGECVEIINNYTCN
CDVGYYGPQCQFVIQCEPLEAPELGTMDCTHPLGNFSFS
SQCAFSCSEGTNLTGIEETTCGPFGNWSSPEPTCQVIQCEP
LSAPDLGIMNCSHPLASFSFTSACTFICSEGTELIGKKKTIC
ESSGIWSNPSPICQKLDKSFSMIKEGDYNPLFIPVAVMVT
AFSGLAFIIWLARRLKKGKKSKRSMNDPY
FKIETTPESRYLAQIGDSVSLTCSTTGCESPFFSWRTQIDSP VCAM-1
LNGKVTNEGTTSTLTMNPVSFGNEHSYLCTATCESRKLE
KGIQVEIYSFPKDPEIHLSGPLEAGKPITVKCSVADVYPFD (homo sapiens)
RLEIDLLKGDHLMKSQEFLEDADRKSLETKSLEVTFTPVI
EDIGKVLVCRAKLHIDEMDSVPTVRQAVKELQVYISPKN
TVISVNPSTKLQEGGSVTMTCSSEGLPAPEIFWSKKLDNG
NLQHLSGNATLTLIAMRMEDSGIYVCEGVNLIGKNRKEV
ELIVQEKPFTVEISPGPRIAAQIGDSVMLTCSVMGCESPSF
SWRTQIDSPLSGKVRSEGTNSTLTLSPVSFENEHSYLCTV
TCGHKKLEKGIQVELYSFPRDPEIEMSGGLVNGSSVTVSC
KVPSVYPLDRLEIELLKGETILENIEFLEDTDMKSLENKSL
EMTFIPTIEDTGKALVCQAKLHIDDMEFEPKQRQSTQTLY
VNVAPRDTTVLVSPSSILEEGSSVNMTCLSQGFPAPKILW
SRQLPNGELQPLSENATLTLISTKMEDSGVYLCEGINQAG
RSRKEVELIIQVTPKDIKLTAFPSESVKEGDTVIISCTCGN
VPETWIILKKKAETGDTVLKSIDGAYTIRKAQLKDAGVY ECESKNKVGSQLRSLTLDVQGRENNKDYFSPELLVLYFA
S S LIIP AIGMII YF ARK ANMKGS YS L VE AQKS K V
YNVDTESALLYQGPHNTLFGYSVVLHSHGANRWLLVGA VLA-4
PTANWLANASVINPGAIYRCRIGKNPGQTCEQLQLGSPN
GEPCGKTCLEERDNQWLGVTLSRQPGENGSIVTCGHRW (homo sapiens)
KNIFYIKNENKLPTGGCYGVPPDLRTELSKRIAPCYQDYV
KKFGENFASCQAGISSFYTKDLIVMGAPGSSYWTGSLFV
YNITTNKYKAFLDKQNQVKFGSYLGYSVGAGHFRSQHT
TEVVGGAPQHEQIGKAYIFSIDEKELNILHEMKGKKLGS
YFGASVCAVDLNADGFSDLLVGAPMQSTIREEGRVFVYI
NS GS G A VMN AMETNL VG S DK Y A ARFGES I VNLGDIDND
GFEDVAIGAPQEDDLQGAIYIYNGRADGISSTFSQRIEGL
QISKSLSMFGQSISGQIDADNNGYVDVAVGAFRSDSAVL
LRTRPVVIVDASLSHPESVNRTKFDCVENGWPSVCIDLTL
CFS YKGKE VPG YI VLF YNMSLD VNRK AES PPRF YFS S NG
TSDVITGSIQVSSREANCRTHQAFMRKDVRDILTPIQIEAA
YHLGPHVISKRSTEEFPPLQPILQQKKEKDIMKKTINFARF
C AHENCS ADLQ VS AKIGFLKPHENKT YL AVGSMKTLML
NVSLFNAGDDAYETTLHVKLPVGLYFIKILELEEKQINCE
VTDNS G V VQLDC S IG YI Y VDHLS RIDIS FLLD VS S LS R AEE
DLSITVHATCENEEEMDNLKHSRVTVAIPLKYEVKLTVH
GFVNPTSFVYGSNDENEPETCMVEKMNLTFHVINTGNS
MAPNVSVEIMVPNSFSPQTDKLFNILDVQTTTGECHFEN
YQRVCALEQQKSAMQTLKGIVRFLSKTDKRLLYCIKADP
HCLNFLCNFGKMESGKEASVHIQLEGRPSILEMDETSAL
KFEIRATGFPEPNPRVIELNKDENVAHVLLEGLHHQRPKR
YFTI VIIS S SLLLGLI VLLLIS Y VMWK AGFFKRQ YKSILQEE
NRRDSWSYINSKSNDD
APTSSSTKKTQLQLEHLLLDLQMILNGINNYKNPKLTRM IL-2
LTFKFYMPKKATELKHLQCLE
EELKPLEEVLNLAQSKNFHLRPRDLISNINVIVLELKGSET
TFMCEYADETATIVEFLNR
WITFCQSIISTLT
HKCDITLQEIIKTLNSLTEQKTLCTELTVTDIFAASKNTTE IL-4
KETFCRAATVLRQFYSHHE
KDTRCLGATAQQFHRHKQLIRFLKRLDRNLWGLAGLNS
CPVKEANQSTLENFLERLKTIM
REKYSKCSS
DCDIEGKDGKQYESVLMVSIDQLLDSMKEIGSNCLNNEF IL-7
NFFKRHICDANKEGMFLFRAA
RKLRQFLKMNSTGDFDLHLLKVSEGTTILLNCTGQVKGR
KPAALGEAQPTKSLEENKSLK
EQKKLNDLCFLKRLLQEIKTCWNKILMGTKEH
SPGQGTQSENSCTHFPGNLPNMLRDLRDAFSRVKTFFQM IL-10
KDQLDNLLLKESLLEDFKGYL
GCQALSEMIQFYLEEVMPQAENQDPDIKAHVNSLGENL KTLRLRLRRCHRFLPCENKSKA
VEQVKNAFNKLQEKGIYKAMSEFDIFINYIEAYMTMKIR N
GIHVFILGCFSAGLPKTEANWVNVISDLKKIEDLIQSMHI IL-15
DATLYTESDVHPSCKVTAMKCFLLELQVISLESGDASIH DTVENLIILANNSLSSNGNVTESGCKECEELEEKNIKEFL QSFVHIVQMFINTS
GITIPRNPGCPNSEDKNFPRTVMVNLNIHNRNTNTNPKRS IL-17
SDYYNRSTSPWNLHRNEDPE
RYPSVIWEAKCRHLGCINADGNVDYHMNSVPIQQEILVL
RREPPHCPNSFRLEKILVS VG
CTCVTPIVHHVA
Figure imgf000155_0001
Gin Thr Gin Asp Thr Glu Leu Val Glu Thr Arg Pro Ala Gly Asp Gly
Thr Phe Gin Lys Trp Ala Ala Val Val Val Pro Ser Gly Glu Glu Gin
Arg Tyr Thr Cys His Val Gin His Glu Gly Leu Pro Lys Pro Leu Thr
Leu Arg Trp Glu Pro Pro Pro Ser Gly Ser Ser Ala Trp Ser His Pro
Gin Phe Glu Lys Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Gly Ser
Ser Ala Trp Ser His Pro Gin Phe Glu Lys
Met Gly Ser His Ser Met Arg Tyr Phe Tyr Thr Ser Val Ser Arg Pro HLA-B*0702 Gly Arg Gly Glu Pro Arg Phe He Ser Val Gly Tyr Val Asp Asp Thr
Gin Phe Val Arg Phe Asp Ser Asp Ala Ala Ser Pro Arg Glu Glu Pro
Arg Ala Pro Trp He Glu Gin Glu Gly Pro Glu Tyr Trp Asp Arg Asn
Thr Gin He Tyr Lys Ala Gin Ala Gin Thr Asp Arg Glu Ser Leu Arg
Asn Leu Arg Gly Tyr Tyr Asn Gin Ser Glu Ala Gly Ser His Thr Leu
Gin Ser Met Tyr Gly Cys Asp Val Gly Pro Asp Gly Arg Leu Leu Arg
Gly His Asp Gin Tyr Ala Tyr Asp Gly Lys Asp Tyr He Ala Leu Asn
Glu Asp Leu Arg Ser Trp Thr Ala Ala Asp Thr Ala Ala Gin He Thr
Gin Arg Lys Trp Glu Ala Ala Arg Glu Ala Glu Gin Arg Arg Ala Tyr
Leu Glu Gly Glu Cys Val Glu Trp Leu Arg Arg Tyr Leu Glu Asn Gly
Lys Asp Lys Leu Glu Arg Ala Asp Pro Pro Lys Thr His Val Thr His
His Pro He Ser Asp His Glu Ala Thr Leu Arg Cys Trp Ala Leu Gly
Phe Tyr Pro Ala Glu He Thr Leu Thr Trp Gin Arg Asp Gly Glu Asp
Gin Thr Gin Asp Thr Glu Leu Val Glu Thr Arg Pro Ala Gly Asp Arg
Thr Phe Gin Lys Trp Ala Ala Val Val Val Pro Ser Gly Glu Glu Gin
Arg Tyr Thr Cys His Val Gin His Glu Gly Leu Pro Lys Pro Leu Thr
Leu Arg Trp Glu Pro Pro Pro Ser Gly Ser Ser Ala Trp Ser His Pro
Gin Phe Glu Lys Gly Gly Gly Ser Gly Gly Gly Ser Gly Gly Gly Ser
Ser Ala Trp Ser His Pro Gin Phe Glu Lys
Met Ala Leu Thr Glu Thr Trp Ala Cys Ser His Ser Met Arg Tyr Phe HLA-C*0702 Asp Thr Ala Val Ser Arg Pro Gly Arg Gly Glu Pro Arg Phe lie Ser
Val Gly Tyr Val Asp Asp Thr Gin Phe Val Arg Phe Asp Ser Asp Ala
Ala Ser Pro Arg Gly Glu Pro Arg Ala Pro Trp Val Glu Gin Glu Gly
Pro Glu Tyr Trp Asp Arg Glu Thr Gin Lys Tyr Lys Arg Gin Ala Gin
Ala Asp Arg Val Ser Leu Arg Asn Leu Arg Gly Tyr Tyr Asn Gin Ser
Glu Asp Gly Ser His Thr Leu Gin Arg Met Ser Gly Cys Asp Leu Gly
Pro Asp Gly Arg Leu Leu Arg Gly Tyr Asp Gin Ser Ala Tyr Asp Gly
Lys Asp Tyr lie Ala Leu Asn Glu Asp Leu Arg Ser Trp Thr Ala Ala
Asp Thr Ala Ala Gin lie Thr Gin Arg Lys Leu Glu Ala Ala Arg Ala
Ala Glu Gin Leu Arg Ala Tyr Leu Glu Gly Thr Cys Val Glu Trp Leu
Arg Arg Tyr Leu Glu Asn Gly Lys Glu Thr Leu Gin Arg Ala Glu Pro
Pro Lys Thr His Val Thr His His Pro Leu Ser Asp His Glu Ala Thr
Leu Arg Cys Trp Ala Leu Gly Phe Tyr Pro Ala Glu lie Thr Leu Thr
Trp Gin Arg Asp Gly Glu Asp Gin Thr Gin Asp Thr Glu Leu Val Glu
Thr Arg Pro Ala Gly Asp Gly Thr Phe Gin Lys Trp Ala Ala Val Val
Val Pro Ser Gly Gin Glu Gin Arg Tyr Thr Cys His Met Gin His Glu
Gly Leu Gin Glu Pro Leu Thr Leu Ser Trp Glu Pro Ser Ser Gin Pro
Thr lie Gly Ser Ala Trp Ser His Pro Gin Phe Glu Lys Gly Gly Gly
Ser Gly Gly Gly Ser Gly Gly Ser Ala Trp Ser His Pro Gin Phe Glu
Lys
Met lie Gin Arg Thr Pro Lys lie Gin Val Tyr Ser Arg His Pro Ala β2 microglobulin Glu Asn Gly Lys Ser Asn Phe Leu Asn Cys Tyr Val Ser Gly Phe His
Pro Ser Asp He Glu Val Asp Leu Leu Lys Asn Gly Glu Arg He Glu
Lys Val Glu His Ser Asp Leu Ser Phe Ser Lys Asp Trp Ser Phe Tyr
Leu Leu Tyr Tyr Thr Glu Phe Thr Pro Thr Glu Lys Asp Glu Tyr Ala
Cys Arg Val Asn His Val Thr Leu Ser Gin Pro Lys lie Val Lys Trp
Asp Arg Asp Met

Claims

CLAIMS WHAT IS CLAIMED:
1. A method for culturing target cells, comprising incubating a composition comprising target cells in the presence of:
a stimulatory agent which is i) reversibly bound to a reagent comprising a plurality of binding sites capable of reversibly binding to the stimulatory agent; and ii) is capable of reversibly binding to the stimulatory agent, under conditions whereby the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells; and
a selection agent that (i) is capable of specifically binding to a selection marker expressed by one or more of the at least a plurality of the target cells and ii) is reversibly bound to the reagent comprising a plurality of binding sites capable of reversibly binding to the selection agent, thereby generating cultured target cells.
2. A method for culturing cells, the method comprising:
(1) combining (a) a composition comprising a plurality of target cells and (b) a selection agent that (i) is capable of specifically binding to a selection marker expressed by one or more of the at least a plurality of the target cells and ii) is reversibly bound to a reagent comprising a plurality of binding sites capable of reversibly binding to the selection agent; and
(2) incubating at least a plurality of the target cells in the presence of a stimulatory agent reversibly bound to the reagent, the reagent comprising a plurality of binding sites each capable of reversibly binding to the stimulatory agent, under conditions whereby the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells,
wherein the contacting in (1) and the incubating in (2) are carried out simultaneously or sequentially, in either order, wherein the method generates cultured target cells.
3. A method for culturing target cells, comprising incubating a composition comprising target cells in the presence of a stimulatory agent and a selection agent each of which is i) reversibly bound to a reagent, which reagent comprises a plurality of binding sites capable of reversibly binding to the stimulatory agent, and one or more binding sites capable of binding to the selection agent,
wherein the selection agent is capable of specifically binding to a selection marker expressed by at least a subpopulation of the target cells,
whereby the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells.
4. The method of any of claims 1-4, wherein a further subpopulation of the target cells do not express the molecule on their surfaces, or express it to a lower degree compared to the subpopulation of target cells expressing the molecule on their surfaces.
5. The method of any of claims 1-4, wherein the method results in the preferential induction or modulation of the signal in preferentially induces or modulates the signal in the subpopulation expressing the molecule on the cell surface or expressing it to a higher degree.
6. The method of any of claims 1-5, wherein:
the reagent is not, and is not bound to or associated with, a solid support, stationary phase, a bead, a microparticle, a magnetic particle, and/or a matrix during said incubation;
and/or
the reagent is flexible, does not contain a metal or magnetic core, is comprised entirely or primarily of organic multimer, is not spherical, is not substantially spherical or uniform in shape and/or is not rigid.
7. The method of any of claims 1-5, wherein the reagent is immobilized, or is capable of being immobilized, on a support, directly or indirectly, whereby the selection agent is immobilized, or is capable of being immobilized on the support.
8. The method of claim 7, wherein:
the support is or comprises a stationary phase; and/or
the support is or comprises a solid support.
9. The method of any of claims 1-8, wherein the reagent comprises a plurality of binding sites, Zl, capable of reversibly binding to the selection agent and the reagent comprise a plurality of binding sites, Zl or Z2, capable of reversibly binding to the stimulatory agent.
10. The method of any of claims 1-9, wherein:
the selection agent comprises a binding partner CI and the plurality of binding sites comprises two or more binding sites, Zl, which each are capable of binding to the binding partner CI to form the reversible bond between the selection agent and the reagent; and
the stimulatory agent comprises a binding partner CI or C2 and the and the plurality of binding sites comprises two or more binding sites, Zl or Z2, which each are capable of binding to the binding partner CI of C2, respectively, to form the reversible bond between the selection agent and the reagent.
11. The method of claim 10, wherein:
CI and C2 are the same or substantially the same, or contain the same or substantially the same moiety; and/or
Zl and Z2 are the same or substantially the same or contain the same or substantially the same moiety.
12. The method of any of claims 1-15, wherein:
the selection agent further comprises a binding site Bl, wherein the specific binding between the selection agent and the selection marker on the target cells comprises interaction between B 1 and the marker; and
the stimulatory agent further comprises a binding site B2, wherein the specific binding between the stimulatory agent and the molecule on the target cells comprises interaction between B2 and the molecule.
13. The method of any of claims 1-12, wherein the selection marker is a first selection marker and the selection agent is further capable of binding to a second selection marker, which is expressed on the surface of at least a plurality of the target cells.
14. The method of any of claims 1-13, wherein the selection agent is a first selection agent, the selection marker is a first selection marker and the incubation is further carried out in the presence of a second selection agent, which is capable of specifically binding to a second selection marker which is expressed on the surface of at least a plurality of the target cells.
15. The method of claim 14, wherein the reagent comprises a plurality of binding sites capable of reversibly binding to the second selection agent, whereby the second selection agent is reversibly bound to the reagent.
16. The method of any of claims 1-15, wherein:
the selection marker, which can be a first selection marker, and/or the second selection marker expressed on the surface of the target cells is a protein or polypeptide; and/or
the selection marker, which can be a first selection marker, and/or the second selection marker is a protein or polypeptide.
17. The method of any of claims 1-16, wherein:
the target cells comprise blood cells;
the target cells comprise leukocytes;
the target cells comprise lymphocytes;
the target cells comprise B cells;
the target cells comprise a B cell population
the target cells comprise T cells;
the target cells comprise a T cell population; and/or
the target cells comprise natural killer (NK) cells;
the target cells comprise dendritic cells;
the target cells comprise macrophages.
18. The method of any of claims 1-17, wherein the target cells comprise antigen- specific T cells or a population thereof, a T helper cell or population thereof, a cytotoxic T cell or population thereof, a memory T cell or population thereof, a regulatory T cell or population thereof, or a NK cell or population thereof, antigen- specific B cells or a population thereof, a memory B cell or population thereof, or a regulatory B cell or population thereof.
19. The method of any of claims 1-18, wherein the target cells comprise T cells.
20. The method of claim 18, wherein the plurality of binding sites capable of reversibly binding to the first selection agent and the plurality of binding sites capable of reversibly binding to the second selection agent can be the same or different.
21. The method of any of claims 1-20, wherein the selection marker, which can be the first selection marker, and/or the second selection marker are selected from among CD25, CD28, CD62L, CCR7, CD27, CD 127, CD3, CD4, CD8, CD45RA, and/or CD45RO.
22. The method of any of claims 1-21, wherein:
the stimulatory agent is capable of initiating a TCR/CD3 complex-associated signal in the T cells; and/or
the stimulatory agent specifically binds to a member of a TCR/CD3 complex; and/or the stimulatory agent specifically binds to CD3.
23. The method of any of claims 20-22, wherein the incubation is further carried out in the presence of a second stimulatory agent, which is capable of specifically binding to a second molecule on the surface of one or more of the T cells, which second molecule is optionally capable of inducing or modulating a signal in target cells in the composition to enhance, dampen or modify a signal delivered through the first molecule.
24. The method of claim 23, wherein:
the second signal is a signal other than a TCR/CD3 complex-associated signal;
the second signal is capable of enhancing or potentiating a TCR/CD3 complex- associated signal; or
the second molecule is a costimulatory molecule, accessory molecule, cytokine receptor, chemokine receptor, immune checkpoint molecule or is a member of the TNF family or the TNF receptor family.
25. The method of any of claims 23 or claim 24, wherein the second molecule is selected from among CD28 and CD 137.
26. The method of any of claims 24-25, wherein the second molecule is CD28.
27. The method of any of claims 1-26, wherein:
the selection agent and/or stimulatory agent comprise an antibody fragment;
the selection agent and/or stimulatory agent comprise a Fab fragment;
the selection agent and/or stimulatory agent are is a divalent antibody fragment selected from among a (Fab)2' -fragment and a divalent single-chain Fv (scFv) fragment;
the selection agent and/or stimulatory agent is a monovalent antibody fragment selected from among a Fab fragment, an Fv fragment and an scFv fragment; and/or
the selection agent and/or stimulatory agent is a proteinaceous binding molecule with antibody-like binding properties selected from among aptamers, muteins based on a polypeptide of the lipocalin family, glubodies, proteins based on the ankyrin scaffold, proteins based on the crystalline scaffold, adnectins and avimers.
28. The method of any of claims 1-27, wherein the reagent is or comprises streptavidin, avidin, an analog or mutein of streptavidin that reversibly binds biotin, a biotin analog or a biologically active fragment thereof; an analog or mutein of avidin or streptavidin that reversibly binds a streptavidin-binding peptide; a reagent that comprises at least two chelating groups K, wherein the at least two chelating groups are capable of binding to a transition metal ion; an agent capable of binding to an oligohistidine affinity tag; an agent capable of binding to a glutathione-S-transferase; calmodulin or an analog thereof; an agent capable of binding to calmodulin binding peptide (CBP); an agent capable of binding to a FLAG-peptide; an agent capable of binding to an HA-tag; an agent capable of binding to maltose binding protein (MBP); an agent capable of binding to an HSV epitope; an agent capable of binding to a myc epitope; or an agent capable of binding to a biotinylated carrier protein.
29. The method of any of claims 1-28, wherein:
the reagent is or comprises a streptavidin analog or mutein or an avidin analog or mutein that reversibly binds to biotin or a biologically active fragment; the reagent is or comprises a streptavidin analog or mutein or an avidin analog or mutein that reversibly binds to a biotin analog or a biologically active fragment; and/or the reagent is or comprises a streptavidin analog or mutein or an avidin analog or mutein that reversibly binds to a strep tavidin-binding peptide.
30. The method of any of claims 1-29, wherein the reagent is an oligomer or polymer of streptavidin, avidin, an analog or mutein of streptavidin that reversibly binds biotin or a biologically active fragment; a streptavidin or avidin analog or mutein that reversibly binds a streptavidin-binding peptide; a reagent that comprises at least two chelating groups K, wherein the at least two chelating groups are capable of binding to a transition metal ion; an agent capable of binding to an oligohistidine affinity tag; an agent capable of binding to a glutathione- S-transferase; calmodulin or an analog thereof; an agent capable of binding to calmodulin binding peptide (CBP); an agent capable of binding to a FLAG-peptide; an agent capable of binding to an HA-tag; an agent capable of binding to maltose binding protein (MBP); an agent capable of binding to an HSV epitope; an agent capable of binding to a myc epitope; or an agent capable of binding to a biotinylated carrier protein.
31. The method of any of claims 1-30, wherein the reagent comprises an oligomer or polymer of streptavidin, avidin, a streptavidin analog or mutein or and an avidin analog or mutein.
32. The method of claim 30 or claim 31, wherein individual molecules of the oligomer or polymer are crosslinked by a polysaccharide or a bifunctional linker.
33. The method of any of claims 1-32, wherein the plurality of binding sites comprises at least 2, 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48, 52, 56, 60, 64, 72 or more binding sites.
34. The method of any of claims 28-33, wherein the streptavidin-binding peptide is selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp- Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)3-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys ((SEQ ID NO: 17), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2-Trp-Ser-His-Pro-Gln-Phe-Glu- Lys (SEQ ID NO: 18) and Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2Gly-Gly-Ser- Ala-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 19).
35. The method of any of claims 1-34, wherein:
the reagent comprises a streptavidin analog or mutein comprising the amino acid sequence Val44-Thr45-Ala46-Arg47 or lle44-Gly45-Ala46-Arg47 at sequence positions
corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO: l;or
the streptavidin analog or mutein comprises the amino acid sequence Val44-Thr45-Ala46- Arg47 at sequence positions corresponding to positions 44 to 47 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO: l.
36. The method of any of claims 1-35, wherein the streptavidin analog or mutein comprises:
a) the sequence of amino acids set forth in any of SEQ ID NOS: 3-6, 27 or 28;
b) a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to any of SEQ ID NOS:3-6, 27 or 28 and contains the amino acid sequence corresponding to Val44-Thr45- Ala46-Arg47 or lle44-Gly45-Ala46-Arg47 and that reversibly binds to biotin or a biologically active form thereof, a biotin analog or mutein or a biologically active fragment thereof or a
strep tavidin-binding peptide; or
c) a functional fragment of a) or b) that reversibly binds to biotin or a biologically active form thereof, a biotin analog or mutein or a biologically active fragment thereof or a
strep tavidin-binding peptide.
37. The method of claim 35 or claim 36, wherein the streptavidin analog or mutein further comprises an amino acid replacement or replacements at a position corresponding to 117, 120 and/or 121 with reference to positions in streptavidin in the sequence of amino acids set forth in SEQ ID NO: 1.
38. The method of claim 37, wherein:
the amino acid replacement or replacements are selected from among Glul 17, Asp 117, Argl l7, Serl20, A 20, Glyl20, Trpl21, Tyrl21 or Phel21; or the amino acid replacement or replacements are selected from one or more of Glul 17, Glyl20 or Tyrl21; or
the amino acid replacements are selected from Glul 17, Glyl20 or Tyrl21.
39. The method of any of claims 1-38, wherein the streptavidin analog or mutein comprises:
a) the sequence of amino acids set forth in SEQ ID NO: 27 or 28;
b) a sequence of amino acids that exhibits at least 85%, 86%, 87%, 88%, 89%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99% or more sequence identity to SEQ ID NOS:28 and contains the amino acid sequence corresponding to Val44, Thr45, Ala46, Arg47,
Glu 117 , Gly 120 and Tyr 121 and reversibly binds to biotin or a biologically active fragment, a biotin analog or mutein or a biologically active fragment thereof or a streptavidin-binding peptide; or c) a functional fragment of a) or b) that reversibly binds to biotin or a biologically active fragment, a biotin analog or mutein or a biologically active fragment thereof or a streptavidin- binding peptide.
40. The method of any of claims 1-39, wherein the binding partner CI and/or the binding partner C2, independently, comprises a streptavidin-binding peptide selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro-Gln- Phe-Glu-Lys-(GlyGlyGlySer)3-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys ((SEQ ID NO: 17), Trp-Ser- His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID
NO: 18) and Trp-Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2Gly-Gly-Ser-Ala-Trp-Ser-His- Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 19).
41. The method of any of claims 1-40, further comprising disrupting the reversible binding between the first and/or second receptor-binding agent and the reagent.
42. The method of claim 41, wherein said disruption comprises introducing to the cells a composition comprising a substance capable of reversing the bond between the receptor- binding agent, which can be the first receptor-binding agent, and/or the second-receptor-binding agent and the reagent.
43. The method of claim 42, wherein the substance is a free binding partner and/or is a competition agent.
44. The method of claim 42 or claim 43, wherein the substance in the composition is not detrimental to the T cells or to the target cells and/or wherein the addition of said substance does not reduce the percentage of surviving T cells or target cells to less than 90 , 80 , 70 , 60 , or 50 , as compared to incubation of the T cells or target cells, respectively, under comparable or the same conditions, without the substance.
45. The method of any of claims 41-44-, wherein said disruption terminates or lessens the signal induced or modulated by one or both of the receptor-binding agent or second receptor-binding agent in the T cells or the target cells.
46. The method of any of claims 41-45, wherein:
the reagent is or comprises a streptavidin, avidin, a streptavidin analog or mutein or and an avidin analog or mutein or biologically active fragments thereof; and
the substance comprises a streptavidin-binding peptide, biotin or a biologically active fragment, optionally a D-biotin, or a biotin analog or biologically active fragment.
47. The method of claim 46, wherein:
the substance is a streptavidin-binding peptide is selected from the group consisting of Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 8), Trp-Ser-His-Pro-Gln-Phe-Glu-Lys- (GlyGlyGlySer)3-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys ((SEQ ID NO: 17), Trp-Ser-His-Pro-Gln- Phe-Glu-Lys-(GlyGlyGlySer)2-Trp-Ser-His-Pro-Gln-Phe-Glu-Lys (SEQ ID NO: 18) and Trp- Ser-His-Pro-Gln-Phe-Glu-Lys-(GlyGlyGlySer)2Gly-Gly-Ser-Ala-Trp-Ser-His-Pro-Gln-Phe-Glu- Lys (SEQ ID NO: 19); and/or
the substance is CI, C2 or C3 or an analog thereof.
48. An article of manufacture, comprising a reagent comprising a plurality of binding sites capable of binding to a stimulatory agent and a plurality of binding sites capable of binding to a selection marker, wherein: wherein the selection agent is capable of specifically binding to a selection marker expressed by at least a subpopulation of the target cells,
whereby the stimulatory agent specifically binds to a molecule expressed on the surface of the target cells, thereby inducing or modulating a signal in the target cells.
PCT/IB2015/002162 2015-04-16 2015-10-22 Methods, kits and apparatus for expanding a population of cells WO2016166568A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EPPCT/EP2015/058339 2015-04-16
PCT/EP2015/058339 WO2015158868A2 (en) 2014-04-16 2015-04-16 Methods, kits and apparatus for expanding a population of cells

Publications (1)

Publication Number Publication Date
WO2016166568A1 true WO2016166568A1 (en) 2016-10-20

Family

ID=55069910

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/IB2015/002162 WO2016166568A1 (en) 2015-04-16 2015-10-22 Methods, kits and apparatus for expanding a population of cells

Country Status (1)

Country Link
WO (1) WO2016166568A1 (en)

Cited By (9)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2017068419A3 (en) * 2015-10-22 2017-05-26 Juno Therapeutics Gmbh Methods, kits, agents and apparatuses for transduction
CN107389420A (en) * 2017-08-04 2017-11-24 武汉格蓝丽富科技有限公司 A kind of cell enrichment separation method
WO2018197949A1 (en) * 2017-04-27 2018-11-01 Juno Therapeutics Gmbh Oligomeric particle reagents and methods of use thereof
CN111107871A (en) * 2017-07-21 2020-05-05 伯克利之光生命科技公司 Antigen presenting synthetic surface, covalently functionalized surface, activated T cells and uses thereof
WO2020089343A1 (en) * 2018-10-31 2020-05-07 Juno Therapeutics Gmbh Methods for selection and stimulation of cells and apparatus for same
US11274278B2 (en) 2014-04-16 2022-03-15 Juno Therapeutics Gmbh Methods, kits and apparatus for expanding a population of cells
RU2777989C2 (en) * 2017-04-27 2022-08-12 Джуно Терапьютикс Гмбх Oligomeric reagents in form of particles and their application methods
US11466253B2 (en) 2015-10-22 2022-10-11 Juno Therapeutics Gmbh Methods for culturing cells and kits and apparatus for same
US11913024B2 (en) 2015-10-22 2024-02-27 Juno Therapeutics Gmbh Methods for culturing cells and kits and apparatus for same

Citations (63)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4361549A (en) 1979-04-26 1982-11-30 Ortho Pharmaceutical Corporation Complement-fixing monoclonal antibody to human T cells, and methods of preparing same
US4452773A (en) 1982-04-05 1984-06-05 Canadian Patents And Development Limited Magnetic iron-dextran microspheres
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
WO1986002077A1 (en) 1984-10-02 1986-04-10 Meade Harry M Production of streptavidin-like polypeptides
US4690915A (en) 1985-08-08 1987-09-01 The United States Of America As Represented By The Department Of Health And Human Services Adoptive immunotherapy as a treatment modality in humans
US4795698A (en) 1985-10-04 1989-01-03 Immunicon Corporation Magnetic-polymer particles
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US4851341A (en) 1986-12-19 1989-07-25 Immunex Corporation Immunoaffinity purification system
US5019369A (en) 1984-10-22 1991-05-28 Vestar, Inc. Method of targeting tumors in humans
US5087616A (en) 1986-08-07 1992-02-11 Battelle Memorial Institute Cytotoxic drug conjugates and their delivery to tumor cells
US5200084A (en) 1990-09-26 1993-04-06 Immunicon Corporation Apparatus and methods for magnetic separation
US5219740A (en) 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
EP0452342B1 (en) 1988-12-28 1994-11-30 MILTENYI, Stefan Methods and materials for high gradient magnetic separation of biological materials
US5506121A (en) 1992-11-03 1996-04-09 Institut Fur Bioanalytik Gemeinnutzige Gesellschaft MBH Fusion peptides with binding activity for streptavidin
WO1996023879A1 (en) 1995-01-30 1996-08-08 Terrapin Technologies, Inc. Glubodies - multiplicities of proteins capable of binding a variety of small molecules
WO1996024606A1 (en) 1995-02-09 1996-08-15 University Of Washington Modified-affinity streptavidin
DE19641876A1 (en) 1996-10-10 1998-04-16 Inst Bioanalytik Gmbh Streptavidin muteins
WO1998040396A1 (en) 1997-03-14 1998-09-17 Trustees Of Boston University Multiflavor streptavidin
US5985658A (en) 1997-11-14 1999-11-16 Health Research Incorporated Calmodulin-based cell separation technique
WO1999061065A1 (en) 1998-05-23 1999-12-02 Leiden University Medical Center Cd40 binding molecules and ctl peptides for treating tumors
US6022951A (en) 1995-04-11 2000-02-08 Univ Boston Streptavidin mutants
WO2000014257A1 (en) 1998-09-04 2000-03-16 Sloan-Kettering Institute For Cancer Research Fusion receptors specific for prostate-specific membrane antigen and uses thereof
US6040177A (en) 1994-08-31 2000-03-21 Fred Hutchinson Cancer Research Center High efficiency transduction of T lymphocytes using rapid expansion methods ("REM")
WO2001004144A2 (en) 1999-07-13 2001-01-18 Scil Proteins Gmbh Fabrication of beta-pleated sheet proteins with specific binding properties
US6207453B1 (en) 1996-03-06 2001-03-27 Medigene Ag Recombinant AAV vector-based transduction system and use of same
WO2001056603A1 (en) 2000-02-01 2001-08-09 Tanox, Inc. Cd40-binding apc-activating molecules
US6303121B1 (en) 1992-07-30 2001-10-16 Advanced Research And Technology Method of using human receptor protein 4-1BB
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6410319B1 (en) 1998-10-20 2002-06-25 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
WO2002054065A2 (en) 2000-12-28 2002-07-11 Iba Gmbh Reversible mhc multimer staining for functional purification of antigen-specific t cells
US6451995B1 (en) 1996-03-20 2002-09-17 Sloan-Kettering Institute For Cancer Research Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods
US20020131960A1 (en) 2000-06-02 2002-09-19 Michel Sadelain Artificial antigen presenting cells and methods of use thereof
WO2002077018A1 (en) 2001-03-21 2002-10-03 Iba Gmbh Sequentially arranged streptavidin-binding modules as affinity tags
WO2003029462A1 (en) 2001-09-27 2003-04-10 Pieris Proteolab Ag Muteins of human neutrophil gelatinase-associated lipocalin and related proteins
US20030170238A1 (en) 2002-03-07 2003-09-11 Gruenberg Micheal L. Re-activated T-cells for adoptive immunotherapy
EP0700430B1 (en) 1993-06-04 2005-04-20 The United States of America as Represented by the Secretary of the Navy Methods for selectively stimulating proliferation of t cells
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US7446179B2 (en) 2000-11-07 2008-11-04 City Of Hope CD19-specific chimeric T cell receptor
US7482000B2 (en) 2002-07-05 2009-01-27 Centre National De La Recherche Scientifique - Cnrs Mutant Fab fragments of the chimeric 13B8.2 anti-CD4 antibody and their applications
WO2009072003A2 (en) 2007-12-07 2009-06-11 Miltenyi Biotec Gmbh Sample processing system and methods
WO2010033140A2 (en) 2008-05-06 2010-03-25 Innovative Micro Technology Removable/disposable apparatus for mems particle sorting device
WO2012129514A1 (en) 2011-03-23 2012-09-27 Fred Hutchinson Cancer Research Center Method and compositions for cellular immunotherapy
US8324353B2 (en) 2001-04-30 2012-12-04 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
US8339645B2 (en) 2008-05-27 2012-12-25 Canon Kabushiki Kaisha Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match
EP2537416A1 (en) 2007-03-30 2012-12-26 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
WO2013011011A2 (en) 2011-07-18 2013-01-24 Iba Gmbh Method of reversibly staining a target cell
US8398282B2 (en) 2011-05-12 2013-03-19 Delphi Technologies, Inc. Vehicle front lighting assembly and systems having a variable tint electrowetting element
WO2013071154A1 (en) 2011-11-11 2013-05-16 Fred Hutchinson Cancer Research Center Cyclin a1-targeted t-cell immunotherapy for cancer
US20130149337A1 (en) 2003-03-11 2013-06-13 City Of Hope Method of controlling administration of cancer antigen
US8479118B2 (en) 2007-12-10 2013-07-02 Microsoft Corporation Switching search providers within a browser search box
WO2013123061A1 (en) 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2013126726A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Double transgenic t cells comprising a car and a tcr and their methods of use
WO2013124474A2 (en) 2012-02-23 2013-08-29 Stage Cell Therapeutics Gmbh Chromatographic isolation of cells and other complex biological materials
US20130287748A1 (en) 2010-12-09 2013-10-31 The Trustees Of The University Of Pennsylvania Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer
WO2013166321A1 (en) 2012-05-03 2013-11-07 Fred Hutchinson Cancer Research Center Enhanced affinity t cell receptors and methods for making the same
WO2014031687A1 (en) 2012-08-20 2014-02-27 Jensen, Michael Method and compositions for cellular immunotherapy
WO2014039044A1 (en) 2012-09-06 2014-03-13 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods of producing t memory stem cell populations
WO2014055668A1 (en) 2012-10-02 2014-04-10 Memorial Sloan-Kettering Cancer Center Compositions and methods for immunotherapy
WO2014076277A1 (en) 2012-11-16 2014-05-22 Iba Gmbh Streptavidin muteins and methods of using them
US9108442B2 (en) 2013-08-20 2015-08-18 Ricoh Company, Ltd. Image forming apparatus
US9405601B2 (en) 2012-12-20 2016-08-02 Mitsubishi Electric Corporation In-vehicle apparatus and program

Patent Citations (83)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US4235871A (en) 1978-02-24 1980-11-25 Papahadjopoulos Demetrios P Method of encapsulating biologically active materials in lipid vesicles
US4361549A (en) 1979-04-26 1982-11-30 Ortho Pharmaceutical Corporation Complement-fixing monoclonal antibody to human T cells, and methods of preparing same
US4452773A (en) 1982-04-05 1984-06-05 Canadian Patents And Development Limited Magnetic iron-dextran microspheres
US4501728A (en) 1983-01-06 1985-02-26 Technology Unlimited, Inc. Masking of liposomes from RES recognition
WO1986002077A1 (en) 1984-10-02 1986-04-10 Meade Harry M Production of streptavidin-like polypeptides
US5168049A (en) 1984-10-02 1992-12-01 Biogen, Inc. Production of streptavidin-like polypeptides
US5019369A (en) 1984-10-22 1991-05-28 Vestar, Inc. Method of targeting tumors in humans
US4690915A (en) 1985-08-08 1987-09-01 The United States Of America As Represented By The Department Of Health And Human Services Adoptive immunotherapy as a treatment modality in humans
US4795698A (en) 1985-10-04 1989-01-03 Immunicon Corporation Magnetic-polymer particles
US5087616A (en) 1986-08-07 1992-02-11 Battelle Memorial Institute Cytotoxic drug conjugates and their delivery to tumor cells
US4851341A (en) 1986-12-19 1989-07-25 Immunex Corporation Immunoaffinity purification system
US4837028A (en) 1986-12-24 1989-06-06 Liposome Technology, Inc. Liposomes with enhanced circulation time
US5219740A (en) 1987-02-13 1993-06-15 Fred Hutchinson Cancer Research Center Retroviral gene transfer into diploid fibroblasts for gene therapy
EP0452342B1 (en) 1988-12-28 1994-11-30 MILTENYI, Stefan Methods and materials for high gradient magnetic separation of biological materials
US5200084A (en) 1990-09-26 1993-04-06 Immunicon Corporation Apparatus and methods for magnetic separation
US6303121B1 (en) 1992-07-30 2001-10-16 Advanced Research And Technology Method of using human receptor protein 4-1BB
US5506121A (en) 1992-11-03 1996-04-09 Institut Fur Bioanalytik Gemeinnutzige Gesellschaft MBH Fusion peptides with binding activity for streptavidin
EP0700430B1 (en) 1993-06-04 2005-04-20 The United States of America as Represented by the Secretary of the Navy Methods for selectively stimulating proliferation of t cells
US6352694B1 (en) 1994-06-03 2002-03-05 Genetics Institute, Inc. Methods for inducing a population of T cells to proliferate using agents which recognize TCR/CD3 and ligands which stimulate an accessory molecule on the surface of the T cells
US6040177A (en) 1994-08-31 2000-03-21 Fred Hutchinson Cancer Research Center High efficiency transduction of T lymphocytes using rapid expansion methods ("REM")
WO1996023879A1 (en) 1995-01-30 1996-08-08 Terrapin Technologies, Inc. Glubodies - multiplicities of proteins capable of binding a variety of small molecules
WO1996024606A1 (en) 1995-02-09 1996-08-15 University Of Washington Modified-affinity streptavidin
US6156493A (en) 1995-02-09 2000-12-05 University Of Washington Modified-affinity streptavidin
US6165750A (en) 1995-02-09 2000-12-26 University Of Washington Modified-affinity streptavidin
US6569997B1 (en) 1995-03-23 2003-05-27 Advanced Research And Technology Institute, Inc. Antibody specific for H4-1BB
US6022951A (en) 1995-04-11 2000-02-08 Univ Boston Streptavidin mutants
US6207453B1 (en) 1996-03-06 2001-03-27 Medigene Ag Recombinant AAV vector-based transduction system and use of same
US6451995B1 (en) 1996-03-20 2002-09-17 Sloan-Kettering Institute For Cancer Research Single chain FV polynucleotide or peptide constructs of anti-ganglioside GD2 antibodies, cells expressing same and related methods
US6103493A (en) 1996-10-10 2000-08-15 Institut Fur Bioanalytic Streptavidin muteins
DE19641876A1 (en) 1996-10-10 1998-04-16 Inst Bioanalytik Gmbh Streptavidin muteins
US6368813B1 (en) 1997-03-14 2002-04-09 The Trustees Of Boston University Multiflavor streptavidin
WO1998040396A1 (en) 1997-03-14 1998-09-17 Trustees Of Boston University Multiflavor streptavidin
US5985658A (en) 1997-11-14 1999-11-16 Health Research Incorporated Calmodulin-based cell separation technique
WO1999061065A1 (en) 1998-05-23 1999-12-02 Leiden University Medical Center Cd40 binding molecules and ctl peptides for treating tumors
WO2000014257A1 (en) 1998-09-04 2000-03-16 Sloan-Kettering Institute For Cancer Research Fusion receptors specific for prostate-specific membrane antigen and uses thereof
US6410319B1 (en) 1998-10-20 2002-06-25 City Of Hope CD20-specific redirected T cells and their use in cellular immunotherapy of CD20+ malignancies
WO2001004144A2 (en) 1999-07-13 2001-01-18 Scil Proteins Gmbh Fabrication of beta-pleated sheet proteins with specific binding properties
US20010026932A1 (en) 2000-02-01 2001-10-04 David Thomas CD40-binding APC-activating molecules
WO2001056603A1 (en) 2000-02-01 2001-08-09 Tanox, Inc. Cd40-binding apc-activating molecules
US7547438B2 (en) 2000-02-01 2009-06-16 Pangenetics Bv CD40-binding activating antibodies
US20020131960A1 (en) 2000-06-02 2002-09-19 Michel Sadelain Artificial antigen presenting cells and methods of use thereof
US7446179B2 (en) 2000-11-07 2008-11-04 City Of Hope CD19-specific chimeric T cell receptor
WO2002054065A2 (en) 2000-12-28 2002-07-11 Iba Gmbh Reversible mhc multimer staining for functional purification of antigen-specific t cells
US8298782B2 (en) 2000-12-28 2012-10-30 Iba Gmbh Reversible MHC multimer staining for functional purification of antigen-specific T cells
US7776562B2 (en) 2000-12-28 2010-08-17 Iba Gmbh Reversible MHC multimer staining for functional purification of antigen-specific T cells
US20040082012A1 (en) 2000-12-28 2004-04-29 Busch Dirk H. Reversible mhc multimer staining for functional purification of antigen-specific t cells
WO2002077018A1 (en) 2001-03-21 2002-10-03 Iba Gmbh Sequentially arranged streptavidin-binding modules as affinity tags
US8735540B2 (en) 2001-03-21 2014-05-27 Iba Gmbh Peptides with sequentially arranged streptavidin binding modules
US7981632B2 (en) 2001-03-21 2011-07-19 Iba Gmbh Sequentially arranged streptavidin-binding modules as affinity tags
US7446191B2 (en) 2001-04-11 2008-11-04 City Of Hope DNA construct encoding CE7-specific chimeric T cell receptor
US7265209B2 (en) 2001-04-11 2007-09-04 City Of Hope CE7-specific chimeric T cell receptor
US7070995B2 (en) 2001-04-11 2006-07-04 City Of Hope CE7-specific redirected immune cells
US7354762B2 (en) 2001-04-11 2008-04-08 City Of Hope Method for producing CE7-specific redirected immune cells
US8324353B2 (en) 2001-04-30 2012-12-04 City Of Hope Chimeric immunoreceptor useful in treating human gliomas
WO2003029462A1 (en) 2001-09-27 2003-04-10 Pieris Proteolab Ag Muteins of human neutrophil gelatinase-associated lipocalin and related proteins
US20030170238A1 (en) 2002-03-07 2003-09-11 Gruenberg Micheal L. Re-activated T-cells for adoptive immunotherapy
US7446190B2 (en) 2002-05-28 2008-11-04 Sloan-Kettering Institute For Cancer Research Nucleic acids encoding chimeric T cell receptors
US7482000B2 (en) 2002-07-05 2009-01-27 Centre National De La Recherche Scientifique - Cnrs Mutant Fab fragments of the chimeric 13B8.2 anti-CD4 antibody and their applications
US20130149337A1 (en) 2003-03-11 2013-06-13 City Of Hope Method of controlling administration of cancer antigen
EP2537416A1 (en) 2007-03-30 2012-12-26 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
US8389282B2 (en) 2007-03-30 2013-03-05 Memorial Sloan-Kettering Cancer Center Constitutive expression of costimulatory ligands on adoptively transferred T lymphocytes
US20110003380A1 (en) 2007-12-07 2011-01-06 Stefan Miltenyi Sample Processing System and Methods
WO2009072003A2 (en) 2007-12-07 2009-06-11 Miltenyi Biotec Gmbh Sample processing system and methods
US8479118B2 (en) 2007-12-10 2013-07-02 Microsoft Corporation Switching search providers within a browser search box
WO2010033140A2 (en) 2008-05-06 2010-03-25 Innovative Micro Technology Removable/disposable apparatus for mems particle sorting device
US8339645B2 (en) 2008-05-27 2012-12-25 Canon Kabushiki Kaisha Managing apparatus, image processing apparatus, and processing method for the same, wherein a first user stores a temporary object having attribute information specified but not partial-area data, at a later time an object is received from a second user that includes both partial-area data and attribute information, the storage unit is searched for the temporary object that matches attribute information of the received object, and the first user is notified in response to a match
US20130287748A1 (en) 2010-12-09 2013-10-31 The Trustees Of The University Of Pennsylvania Use of Chimeric Antigen Receptor-Modified T-Cells to Treat Cancer
WO2012129514A1 (en) 2011-03-23 2012-09-27 Fred Hutchinson Cancer Research Center Method and compositions for cellular immunotherapy
US8398282B2 (en) 2011-05-12 2013-03-19 Delphi Technologies, Inc. Vehicle front lighting assembly and systems having a variable tint electrowetting element
WO2013011011A2 (en) 2011-07-18 2013-01-24 Iba Gmbh Method of reversibly staining a target cell
US9023604B2 (en) 2011-07-18 2015-05-05 Iba Gmbh Method of reversibly staining a target cell
US20140295458A1 (en) 2011-07-18 2014-10-02 Iba Gmbh Method of reversibly staining a target cell
WO2013071154A1 (en) 2011-11-11 2013-05-16 Fred Hutchinson Cancer Research Center Cyclin a1-targeted t-cell immunotherapy for cancer
WO2013123061A1 (en) 2012-02-13 2013-08-22 Seattle Children's Hospital D/B/A Seattle Children's Research Institute Bispecific chimeric antigen receptors and therapeutic uses thereof
WO2013126726A1 (en) 2012-02-22 2013-08-29 The Trustees Of The University Of Pennsylvania Double transgenic t cells comprising a car and a tcr and their methods of use
WO2013124474A2 (en) 2012-02-23 2013-08-29 Stage Cell Therapeutics Gmbh Chromatographic isolation of cells and other complex biological materials
WO2013166321A1 (en) 2012-05-03 2013-11-07 Fred Hutchinson Cancer Research Center Enhanced affinity t cell receptors and methods for making the same
WO2014031687A1 (en) 2012-08-20 2014-02-27 Jensen, Michael Method and compositions for cellular immunotherapy
WO2014039044A1 (en) 2012-09-06 2014-03-13 The United States Of America, As Represented By The Secretary, Department Of Health And Human Services Methods of producing t memory stem cell populations
WO2014055668A1 (en) 2012-10-02 2014-04-10 Memorial Sloan-Kettering Cancer Center Compositions and methods for immunotherapy
WO2014076277A1 (en) 2012-11-16 2014-05-22 Iba Gmbh Streptavidin muteins and methods of using them
US9405601B2 (en) 2012-12-20 2016-08-02 Mitsubishi Electric Corporation In-vehicle apparatus and program
US9108442B2 (en) 2013-08-20 2015-08-18 Ricoh Company, Ltd. Image forming apparatus

Non-Patent Citations (112)

* Cited by examiner, † Cited by third party
Title
"Remington: The Science and Practice of Pharmacy; 21st ed.", 1 May 2005, LIPPINCOTT WILLIAMS & WILKINS
.: "Current Protocols in Molecular Biology", JOHN WILEY & SONS
AHLERS; BELYAKOV, BLOOD, vol. 115, 2010, pages 1678
ALONSO-CAMINO ET AL., MOL THER NUCL ACIDS, vol. 2, 2013, pages E93
AMERES ET AL., PLOS PATHOGENS, vol. 9, no. 5, May 2013 (2013-05-01), pages EL003383
AMSTUTZ, P. ET AL., CURR. OPIN. BIOTECHNOL, vol. 12, 2001, pages 400 - 405
AN HACKETT ET AL., MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 18, 2010, pages 674 - 683
ANITA SCHMITT ET AL: "Adoptive transfer and selective reconstitution of streptamer-selected cytomegalovirus-specific CD8+ T?cells leads to virus clearance in patients after allogeneic peripheral blood stem cell transplantation", TRANSFUSION, vol. 51, no. 3, 6 December 2010 (2010-12-06), pages 591 - 599, XP055043927, ISSN: 0041-1132, DOI: 10.1111/j.1537-2995.2010.02940.x *
ARAKAWA ET AL., J. BIOCHEM., vol. 120, 1996, pages 657 - 662
ARGARANA ET AL., NUCLEIC ACIDS RES., vol. 14, 1986, pages 1871 - 1882
BARRETT ET AL., CHIMERIC ANTIGEN RECEPTOR THERAPY FOR CANCER ANNUAL REVIEW OF MEDICINE, vol. 65, 2014, pages 333 - 347
BATTALIA ET AL., IMMUNOLOGY, vol. 139, no. 1, 2013, pages 109 - 120
BAUM ET AL., MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY, vol. 13, 2006, pages 1050 - 1063
BAZDAR; SIEG, JOURNAL OF VIROLOGY, vol. 81, no. 22, 2007, pages 12670 - 12674
BES, C ET AL., J BIOL CHEM, vol. 278, 2003, pages 14265 - 14273
BESTE ET AL., PROC. NATL. ACAD. SCI. U.S.A., vol. 96, 1999, pages 1898 - 1903
BLAIR ET AL., JEM, vol. 191, no. 4, pages 651 - 660
BORIS-LAWRIE; TEMIN, CUR. OPIN. GENET. DEVELOP, vol. 3, 1993, pages 102 - 109
BRASH ET AL., MOL. CELL BIOL, vol. 7, 1987, pages 2031 - 2034
BRENTJENS ET AL., SCI TRANSL MED., vol. 5, no. 177, 2013
BURNS ET AL., PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 8033 - 8037
CARLENS ET AL., EXP HEMATOL, vol. 28, no. 10, 2000, pages 1137 - 46
CAVALIERI ET AL., BLOOD, vol. 102, no. 2, 2003, pages 497 - 505
CHEADLE ET AL.: "Chimeric antigen receptors for T-cell based therapy", METHODS MOL BIOL, vol. 907, 2012, pages 645 - 66, XP009179541, DOI: doi:10.1007/978-1-61779-974-7_36
CHICAYBAM ET AL., PLOS ONE, vol. 8, no. 3, 2013, pages E60298
CHO ET AL., LAB CHIP, vol. 10, 2010, pages 1567 - 1573
CHRISTIAN STEMBERGER ET AL: "Novel Serial Positive Enrichment Technology Enables Clinical Multiparameter Cell Sorting", PLOS ONE, vol. 7, no. 4, 24 April 2012 (2012-04-24), pages e35798, XP055043969, DOI: 10.1371/journal.pone.0035798 *
CIERI ET AL., BLOOD, vol. 125, 2015, pages 2865
COHEN ET AL., J IMMUNOL., vol. 175, 2005, pages 5799 - 5808
COOPER ET AL., BLOOD, vol. 101, 2003, pages 1637 - 1644
CORNISH ET AL., BLOOD, vol. 108, no. 2, 2006, pages 600 - 8
DAVILA ET AL., PLOS ONE, vol. 8, no. 4, 2013, pages E61338
DIENZ O ET AL., J. EXP. MED., vol. 206, 2009, pages 69
FAIRHEAD ET AL., J. MOL. BIOL., vol. 426, 2013, pages 199 - 214
FEDOROV ET AL., SCI. TRANSL. MEDICINE, vol. 5, no. 215, December 2013 (2013-12-01)
FLYNN ET AL., CLINICAL & TRANSLATIONAL IMMUNOLOGY, vol. 3, 2014, pages E20
FRECHA ET AL., MOLECULAR THERAPY: THE JOURNAL OF THE AMERICAN SOCIETY OF GENE THERAPY., vol. 18, 2010, pages 1748 - 1757
GATTINONI ET AL., NAT. MED., vol. 17, 2012, pages 1290 - 1297
GATTINONI ET AL., NAT. REVIEWS, vol. 12, 2012, pages 671
GILL, D.S.; DAMLE, N.K., CURRENT OPINION IN BIOTECHNOLOGY, vol. 17, 2006, pages 653 - 658
GODIN ET AL., J BIOPHOTON., vol. 1, no. 5, 2008, pages 355 - 376
HERMAN ET AL., J. IMMUNOLOGICAL METHODS, vol. 285, no. 1, 2004, pages 25 - 40
HOLLIGER ET AL., PNAS USA, vol. 90, 1993, pages 6444 - 6448
HOLT, L.J. ET AL., TRENDS BIOTECHNOL., vol. 21, no. 11, 2003, pages 484 - 490
HOSHINO ET AL., BLOOD, vol. 78, no. 12, 15 December 1991 (1991-12-15), pages 3232 - 40
HOWARTH ET AL., NAT. METHODS, vol. 3, 2006, pages 267 - 73
HUANG ET AL., METHODS MOL BIOL, vol. 506, 2009, pages 115 - 126
HUDECEK ET AL., CLIN CANCER RES., vol. 19, no. 12, 15 June 2013 (2013-06-15), pages 3153 - 3164
HUTTEN, A. ET AL., J. BIOTECH., vol. 112, 2004, pages 47 - 63
ILIADES, P. ET AL., FEB S LETT, vol. 409, 1997, pages 437 - 441
ILL ET AL., PROTEIN ENG, vol. 10, 1997, pages 949 - 57
JOHNSTON, NATURE, vol. 346, 1990, pages 776 - 777
KAY, B.K. ET AL.: "Phage Display of Peptides and Proteins -A Laboratory Manual", 1996, ACADEMIC PRESS
KLEBANOFF ET AL., J IMMUNOTHER, vol. 35, no. 9, 2012, pages 651 - 660
KNABEL MICHAEL ET AL: "Reversible MHC multimer staining for functional isolation of T-cell populations and effective adoptive transfer", NATURE MEDICINE, NATURE PUBLISHING GROUP, NEW YORK, NY, US, vol. 8, no. 6, 1 June 2002 (2002-06-01), pages 631 - 637, XP002460640, ISSN: 1078-8956, DOI: 10.1038/NM0602-631 *
KOCHENDERFER ET AL., J. IMMUNOTHERAPY, vol. 32, no. 7, 2009, pages 689 - 702
KOCHENDERFER ET AL., NATURE REVIEWS CLINICAL ONCOLOGY, vol. 10, 2013, pages 267 - 276
KOSTE ET AL., GENE THERAPY, 3 April 2014 (2014-04-03)
KWON, Y.-U.; KODADEK, T., J. AM. CHEM. SOC., vol. 129, 2007, pages 1508 - 1509
LI ET AL., PLOS ONE, vol. 8, 2013, pages E67401
LI, NAT BIOTECHNOL., vol. 23, 2005, pages 349 - 354
LIM ET AL., BIOCHEMISTRY, vol. 50, 2010, pages 8682 - 91
LOWMAN, H.B., ANNU. REV. BIOPHYS. BIOMOL. STRUCT, vol. 26, 1997, pages 401 - 424
LUPTON S. D. ET AL., MOL. AND CELL BIOL., vol. 11, 1991, pages 6
MANURI ET AL., HUM GENE THER, vol. 21, no. 4, 2010, pages 427 - 437
MARTIN ET AL., EMBO J, vol. 13, 1994, pages 5303 - 5309
MILLER, A. D., HUMAN GENE THERAPY, vol. 1, 1990, pages 5 - 14
MILLER; ROSMAN, BIOTECHNIQUES, vol. 7, 1989, pages 980 - 990
MITTLER ET AL., IMMUNOL RES., vol. 29, no. 1-3, 2004, pages 197 - 208
MOSAVI, L.K. ET AL., PROTEIN SCIENCE, vol. 13, no. 6, 2004, pages 1435 - 1448
MULLEN ET AL., PROC. NATL. ACAD. SCI. USA., vol. 89, 1992, pages 33
NOGUCHI, A ET AL., BIOCONJUGATE CHEMISTRY, vol. 3, 1992, pages 132 - 137
OSOL, A.: "Remington's Pharmaceutical Sciences 16th edition,", 1980
PARK ET AL., TRENDS BIOTECHNOL., vol. 29, no. 11, November 2011 (2011-11-01), pages 550 - 557
PARKHURST ET AL., CLIN CANCER RES., vol. 15, 2009, pages 169 - 180
PAULSEN ET AL., CELL DEATH & DIFFERENTIATION, vol. 18.4, 2011, pages 619 - 631
RIDDELL ET AL., HUMAN GENE THERAPY, vol. 3, 1992, pages 319 - 338
RODI, D.J.; MAKOWSKI, L., CURR. OPIN. BIOTECHNOL, vol. 10, 1999, pages 87 - 93
ROSENBERG, NAT REV CLIN ONCOL., vol. 8, no. 10, 2011, pages 577 - 85
S. A. BROOKS AND U. SCHUMACHER: "Methods in Molecular Medicine", vol. 58, 2, HUMANA PRESS INC., pages: 17 - 25
SADELAIN ET AL., CANCER DISCOV., vol. 3, no. 4, April 2013 (2013-04-01), pages 388 - 398
SCARPA ET AL., VIROLOGY, vol. 180, 1991, pages 849 - 852
SHARMA ET AL., MOLEC THER NUCL ACIDS, vol. 2, 2013, pages E74
SILVERMAN, J. ET AL., NATURE BIOTECHNOLOGY, vol. 23, 2005, pages 1556 - 1561
SKERRA, J. MOL. RECOGNIT, vol. 13, 2000, pages 167 - 187
STEMBERGER ET AL., PLOS ONE., vol. 7, no. 4, 2012, pages E35798
STONE, E. ET AL., JOURNAL OF IMMUNOLOGICAL METHODS, vol. 318, 2007, pages 88 - 94
SZOKA ET AL., ANN. REV. BIOPHYS. BIOENG., vol. 9, 1980, pages 467
TARABAN ET AL., EUR J IMMUNOL., vol. 32, no. 12, December 2002 (2002-12-01), pages 3617 - 27
TERAKURA ET AL., BLOOD, vol. 1, 2012, pages 72 - 82
THEMELI ET AL., NAT BIOTECHNOL., vol. 31, no. 10, 2013, pages 928 - 933
TRAUNECKER ET AL., EMBO J, vol. 10, 1991, pages 3655 - 3659
TRAUNECKER ET AL., INT J CANCER, vol. 7, 1992, pages 51 - 52
TSUKAHARA ET AL., BIOCHEM BIOPHYS RES COMMUN, vol. 438, no. 1, 2013, pages 84 - 9
TURTLE ET AL., CURR. OPIN. IMMUNOL., vol. 24, no. 5, October 2012 (2012-10-01), pages 633 - 39
VAN TEDELOO ET AL., GENE THERAPY, vol. 7, no. 16, 2000, pages 1431 - 1437
VANHOVE ET AL., BLOOD, vol. 102, no. 2, 15 July 2003 (2003-07-15), pages 564 - 570
VARELA-ROHENA ET AL., NAT MED, vol. 14, 2008, pages 1390 - 1395
VERHOEYEN ET AL., METHODS MOL BIOL., vol. 506, 2009, pages 97 - 114
VITALE ET AL., THE ANATOMICAL RECORD., vol. 266, 2002, pages 87 - 92
VOSS; SKERRA, PROTEIN ENG., vol. 1, 1997, pages 975 - 982
WADWA ET AL., J. DRUG TARGETING, vol. 3, 1995, pages 1 1 1
WANG ET AL., J IMMUNOTHER, vol. 35, no. 9, 2012, pages 689 - 701
WANG ET AL., J IMMUNOTHER., vol. 35, no. 9, 2012, pages 689 - 701
WANG ET AL., J. IMMUNOTHER, vol. 35, no. 9, 2012, pages 689 - 701
WANG ET AL., J. IMMUNOTHER., vol. 35, no. 9, 2012, pages 689 - 701
WIGLER ET AL., CELL, vol. II, 1977, pages 223
WILSON, D.S. ET AL., PROC. NATL. ACAD. SCI. USA, vol. 98, 2001, pages 3750 - 3755
WU ET AL., CANCER, vol. 18, no. 2, March 2012 (2012-03-01), pages 160 - 75
WU ET AL., J. BIOL. CHEM., vol. 280, 2005, pages 23225 - 31
ZHANG ET AL., BIOCHEM. BIOPHYS. RES. COMMUN., vol. 463, 2015, pages 1059 - 63
ZHANG ET AL., J IMMUNOL, vol. 184, 2010, pages 787 - 795

Cited By (16)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US11274278B2 (en) 2014-04-16 2022-03-15 Juno Therapeutics Gmbh Methods, kits and apparatus for expanding a population of cells
WO2017068419A3 (en) * 2015-10-22 2017-05-26 Juno Therapeutics Gmbh Methods, kits, agents and apparatuses for transduction
US11913024B2 (en) 2015-10-22 2024-02-27 Juno Therapeutics Gmbh Methods for culturing cells and kits and apparatus for same
US11466253B2 (en) 2015-10-22 2022-10-11 Juno Therapeutics Gmbh Methods for culturing cells and kits and apparatus for same
US11248238B2 (en) 2015-10-22 2022-02-15 Juno Therapeutics Gmbh Methods, kits, agents and apparatuses for transduction
US20210032297A1 (en) * 2017-04-27 2021-02-04 Juno Therapeutics Gmbh Oligomeric particle reagents and methods of use thereof
JP2020517705A (en) * 2017-04-27 2020-06-18 ジュノ セラピューティクス ゲーエムベーハー Oligomer particle reagent and method of using the same
CN111032850A (en) * 2017-04-27 2020-04-17 朱诺治疗学有限公司 Oligomeric particle reagents and methods of use thereof
RU2777989C2 (en) * 2017-04-27 2022-08-12 Джуно Терапьютикс Гмбх Oligomeric reagents in form of particles and their application methods
WO2018197949A1 (en) * 2017-04-27 2018-11-01 Juno Therapeutics Gmbh Oligomeric particle reagents and methods of use thereof
JP7339160B2 (en) 2017-04-27 2023-09-05 ジュノ セラピューティクス ゲーエムベーハー Oligomeric particle reagents and methods of use thereof
US11866465B2 (en) 2017-04-27 2024-01-09 Juno Therapeutics Gmbh Oligomeric particle reagents and methods of use thereof
CN111107871A (en) * 2017-07-21 2020-05-05 伯克利之光生命科技公司 Antigen presenting synthetic surface, covalently functionalized surface, activated T cells and uses thereof
CN107389420B (en) * 2017-08-04 2020-10-16 武汉格蓝丽富科技有限公司 Cell enrichment and separation method
CN107389420A (en) * 2017-08-04 2017-11-24 武汉格蓝丽富科技有限公司 A kind of cell enrichment separation method
WO2020089343A1 (en) * 2018-10-31 2020-05-07 Juno Therapeutics Gmbh Methods for selection and stimulation of cells and apparatus for same

Similar Documents

Publication Publication Date Title
US20230295567A1 (en) Methods for culturing cells and kits and apparatus for same
US11913024B2 (en) Methods for culturing cells and kits and apparatus for same
US20240101613A1 (en) Oligomeric particle reagents and methods of use thereof
JP2018531035A6 (en) Method for culturing cells and kit and apparatus therefor
CA2946312A1 (en) Methods for isolating, culturing, and genetically engineering immune cell populations for adoptive therapy
WO2016166568A1 (en) Methods, kits and apparatus for expanding a population of cells
RU2777989C2 (en) Oligomeric reagents in form of particles and their application methods
RU2778411C2 (en) Methods for cultivation of cells and sets and device for them

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 15820251

Country of ref document: EP

Kind code of ref document: A1

DPE1 Request for preliminary examination filed after expiration of 19th month from priority date (pct application filed from 20040101)
NENP Non-entry into the national phase

Ref country code: DE

122 Ep: pct application non-entry in european phase

Ref document number: 15820251

Country of ref document: EP

Kind code of ref document: A1