US20070281890A1 - Fibroblast Growth Factor-13 - Google Patents
Fibroblast Growth Factor-13 Download PDFInfo
- Publication number
- US20070281890A1 US20070281890A1 US11/738,563 US73856307A US2007281890A1 US 20070281890 A1 US20070281890 A1 US 20070281890A1 US 73856307 A US73856307 A US 73856307A US 2007281890 A1 US2007281890 A1 US 2007281890A1
- Authority
- US
- United States
- Prior art keywords
- fgf
- polypeptide
- amino acid
- seq
- acid sequence
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Abandoned
Links
- 108090000047 fibroblast growth factor 13 Proteins 0.000 title claims abstract description 322
- 102000003684 fibroblast growth factor 13 Human genes 0.000 title claims abstract description 314
- 210000004027 cell Anatomy 0.000 claims abstract description 166
- 238000000034 method Methods 0.000 claims abstract description 98
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 78
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 65
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 65
- 239000013598 vector Substances 0.000 claims abstract description 59
- 210000005064 dopaminergic neuron Anatomy 0.000 claims abstract description 14
- 238000010188 recombinant method Methods 0.000 claims abstract description 5
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 222
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 214
- 229920001184 polypeptide Polymers 0.000 claims description 201
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 111
- 239000002773 nucleotide Substances 0.000 claims description 107
- 125000003729 nucleotide group Chemical group 0.000 claims description 107
- 239000002299 complementary DNA Substances 0.000 claims description 69
- 108091033319 polynucleotide Proteins 0.000 claims description 67
- 102000040430 polynucleotide Human genes 0.000 claims description 67
- 239000002157 polynucleotide Substances 0.000 claims description 67
- 150000001413 amino acids Chemical class 0.000 claims description 48
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 34
- 238000012217 deletion Methods 0.000 claims description 30
- 230000037430 deletion Effects 0.000 claims description 30
- 230000000295 complement effect Effects 0.000 claims description 18
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 claims description 16
- 238000004519 manufacturing process Methods 0.000 claims description 14
- 238000009396 hybridization Methods 0.000 claims description 10
- 210000004899 c-terminal region Anatomy 0.000 claims description 8
- 230000001965 increasing effect Effects 0.000 claims description 8
- 208000018737 Parkinson disease Diseases 0.000 claims description 7
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 claims description 7
- 230000004083 survival effect Effects 0.000 claims description 6
- 238000012258 culturing Methods 0.000 claims description 2
- 230000000694 effects Effects 0.000 abstract description 43
- 239000005557 antagonist Substances 0.000 abstract description 19
- 239000000556 agonist Substances 0.000 abstract description 11
- 102000018233 Fibroblast Growth Factor Human genes 0.000 abstract description 9
- 108050007372 Fibroblast Growth Factor Proteins 0.000 abstract description 9
- 238000012216 screening Methods 0.000 abstract description 7
- 229940126864 fibroblast growth factor Drugs 0.000 abstract description 5
- 230000032405 negative regulation of neuron apoptotic process Effects 0.000 abstract description 3
- 238000002560 therapeutic procedure Methods 0.000 abstract description 3
- 238000002405 diagnostic procedure Methods 0.000 abstract description 2
- 108090000623 proteins and genes Proteins 0.000 description 136
- 102000004169 proteins and genes Human genes 0.000 description 92
- 235000018102 proteins Nutrition 0.000 description 91
- 108020004414 DNA Proteins 0.000 description 79
- 235000001014 amino acid Nutrition 0.000 description 59
- 239000012634 fragment Substances 0.000 description 57
- 230000014509 gene expression Effects 0.000 description 54
- 229940024606 amino acid Drugs 0.000 description 49
- 210000001519 tissue Anatomy 0.000 description 40
- 241000282414 Homo sapiens Species 0.000 description 39
- 101150021185 FGF gene Proteins 0.000 description 33
- 239000013612 plasmid Substances 0.000 description 33
- 239000013615 primer Substances 0.000 description 32
- 230000027455 binding Effects 0.000 description 31
- 210000002950 fibroblast Anatomy 0.000 description 31
- 238000009739 binding Methods 0.000 description 30
- 238000003556 assay Methods 0.000 description 29
- 102000005962 receptors Human genes 0.000 description 25
- 108020003175 receptors Proteins 0.000 description 25
- 108091026890 Coding region Proteins 0.000 description 23
- 108020004999 messenger RNA Proteins 0.000 description 21
- 238000003752 polymerase chain reaction Methods 0.000 description 21
- 150000001875 compounds Chemical class 0.000 description 20
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 20
- 239000000203 mixture Substances 0.000 description 20
- 108091008146 restriction endonucleases Proteins 0.000 description 20
- 238000001727 in vivo Methods 0.000 description 19
- 238000011282 treatment Methods 0.000 description 19
- 241000588724 Escherichia coli Species 0.000 description 18
- 238000006467 substitution reaction Methods 0.000 description 18
- 239000002609 medium Substances 0.000 description 17
- 125000000539 amino acid group Chemical group 0.000 description 16
- 210000000349 chromosome Anatomy 0.000 description 16
- 238000010367 cloning Methods 0.000 description 16
- 230000001177 retroviral effect Effects 0.000 description 16
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 15
- 108020004705 Codon Proteins 0.000 description 15
- 108090000386 Fibroblast Growth Factor 1 Proteins 0.000 description 15
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 15
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 15
- 238000004458 analytical method Methods 0.000 description 15
- 210000001130 astrocyte Anatomy 0.000 description 15
- 230000001580 bacterial effect Effects 0.000 description 15
- 238000000338 in vitro Methods 0.000 description 15
- 108700026244 Open Reading Frames Proteins 0.000 description 14
- 108091081024 Start codon Proteins 0.000 description 14
- 230000000890 antigenic effect Effects 0.000 description 14
- 230000035772 mutation Effects 0.000 description 14
- 238000000746 purification Methods 0.000 description 14
- 102000003971 Fibroblast Growth Factor 1 Human genes 0.000 description 13
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 13
- 206010028980 Neoplasm Diseases 0.000 description 13
- 230000001054 cortical effect Effects 0.000 description 13
- 102000037865 fusion proteins Human genes 0.000 description 13
- 108020001507 fusion proteins Proteins 0.000 description 13
- 229960002897 heparin Drugs 0.000 description 13
- 229920000669 heparin Polymers 0.000 description 13
- 125000001360 methionine group Chemical group N[C@@H](CCSC)C(=O)* 0.000 description 13
- 230000004071 biological effect Effects 0.000 description 12
- 239000012472 biological sample Substances 0.000 description 12
- 230000000875 corresponding effect Effects 0.000 description 12
- 201000010099 disease Diseases 0.000 description 12
- 230000008569 process Effects 0.000 description 12
- 239000000047 product Substances 0.000 description 12
- 230000035755 proliferation Effects 0.000 description 12
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 11
- 108090000367 Fibroblast growth factor 9 Proteins 0.000 description 11
- 102100037665 Fibroblast growth factor 9 Human genes 0.000 description 11
- 238000003776 cleavage reaction Methods 0.000 description 11
- 238000005516 engineering process Methods 0.000 description 11
- 230000012010 growth Effects 0.000 description 11
- 239000003550 marker Substances 0.000 description 11
- 239000000523 sample Substances 0.000 description 11
- 230000007017 scission Effects 0.000 description 11
- 108091034117 Oligonucleotide Proteins 0.000 description 10
- 241000700605 Viruses Species 0.000 description 10
- 238000007792 addition Methods 0.000 description 10
- 230000004663 cell proliferation Effects 0.000 description 10
- 229930027917 kanamycin Natural products 0.000 description 10
- 229960000318 kanamycin Drugs 0.000 description 10
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 10
- 229930182823 kanamycin A Natural products 0.000 description 10
- 108010082117 matrigel Proteins 0.000 description 10
- 229930182817 methionine Natural products 0.000 description 10
- 230000004044 response Effects 0.000 description 10
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 9
- 230000033115 angiogenesis Effects 0.000 description 9
- 238000004113 cell culture Methods 0.000 description 9
- 230000002759 chromosomal effect Effects 0.000 description 9
- 239000013604 expression vector Substances 0.000 description 9
- 210000004408 hybridoma Anatomy 0.000 description 9
- 210000004072 lung Anatomy 0.000 description 9
- 238000013507 mapping Methods 0.000 description 9
- 229960000485 methotrexate Drugs 0.000 description 9
- 210000002569 neuron Anatomy 0.000 description 9
- 238000013519 translation Methods 0.000 description 9
- 241000701447 unidentified baculovirus Species 0.000 description 9
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 8
- 108090000368 Fibroblast growth factor 8 Proteins 0.000 description 8
- 102000003956 Fibroblast growth factor 8 Human genes 0.000 description 8
- 102000004889 Interleukin-6 Human genes 0.000 description 8
- 108090001005 Interleukin-6 Proteins 0.000 description 8
- 241001465754 Metazoa Species 0.000 description 8
- 230000002378 acidificating effect Effects 0.000 description 8
- 239000000427 antigen Substances 0.000 description 8
- 102000036639 antigens Human genes 0.000 description 8
- 108091007433 antigens Proteins 0.000 description 8
- 230000008859 change Effects 0.000 description 8
- XEYBRNLFEZDVAW-ARSRFYASSA-N dinoprostone Chemical compound CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O XEYBRNLFEZDVAW-ARSRFYASSA-N 0.000 description 8
- 208000035475 disorder Diseases 0.000 description 8
- 210000002889 endothelial cell Anatomy 0.000 description 8
- 230000002068 genetic effect Effects 0.000 description 8
- 230000002163 immunogen Effects 0.000 description 8
- 238000003780 insertion Methods 0.000 description 8
- 230000037431 insertion Effects 0.000 description 8
- 210000004962 mammalian cell Anatomy 0.000 description 8
- 230000001537 neural effect Effects 0.000 description 8
- 238000004806 packaging method and process Methods 0.000 description 8
- 239000011780 sodium chloride Substances 0.000 description 8
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 8
- 108091008794 FGF receptors Proteins 0.000 description 7
- 102000044168 Fibroblast Growth Factor Receptor Human genes 0.000 description 7
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Chemical compound CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 7
- 239000011543 agarose gel Substances 0.000 description 7
- 229960000723 ampicillin Drugs 0.000 description 7
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 7
- 238000013459 approach Methods 0.000 description 7
- 230000015572 biosynthetic process Effects 0.000 description 7
- 238000003745 diagnosis Methods 0.000 description 7
- 239000000499 gel Substances 0.000 description 7
- 239000002245 particle Substances 0.000 description 7
- 230000008488 polyadenylation Effects 0.000 description 7
- 238000002360 preparation method Methods 0.000 description 7
- 230000010076 replication Effects 0.000 description 7
- 238000012163 sequencing technique Methods 0.000 description 7
- 239000007787 solid Substances 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- 238000001890 transfection Methods 0.000 description 7
- 230000003612 virological effect Effects 0.000 description 7
- 241000894006 Bacteria Species 0.000 description 6
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 6
- 241000701022 Cytomegalovirus Species 0.000 description 6
- 239000003155 DNA primer Substances 0.000 description 6
- 102000004190 Enzymes Human genes 0.000 description 6
- 108090000790 Enzymes Proteins 0.000 description 6
- 241000238631 Hexapoda Species 0.000 description 6
- 108010076504 Protein Sorting Signals Proteins 0.000 description 6
- 230000009471 action Effects 0.000 description 6
- 230000000692 anti-sense effect Effects 0.000 description 6
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 6
- 210000001124 body fluid Anatomy 0.000 description 6
- 238000004587 chromatography analysis Methods 0.000 description 6
- 210000002257 embryonic structure Anatomy 0.000 description 6
- 229940088598 enzyme Drugs 0.000 description 6
- 230000006870 function Effects 0.000 description 6
- 238000003384 imaging method Methods 0.000 description 6
- 238000011534 incubation Methods 0.000 description 6
- 230000001939 inductive effect Effects 0.000 description 6
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 6
- 230000014511 neuron projection development Effects 0.000 description 6
- 239000008194 pharmaceutical composition Substances 0.000 description 6
- 230000003248 secreting effect Effects 0.000 description 6
- 230000004936 stimulating effect Effects 0.000 description 6
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 6
- 229940104230 thymidine Drugs 0.000 description 6
- 238000013518 transcription Methods 0.000 description 6
- 230000035897 transcription Effects 0.000 description 6
- PLRACCBDVIHHLZ-UHFFFAOYSA-N 1-methyl-4-phenyl-1,2,3,6-tetrahydropyridine Chemical compound C1N(C)CCC(C=2C=CC=CC=2)=C1 PLRACCBDVIHHLZ-UHFFFAOYSA-N 0.000 description 5
- 102000053602 DNA Human genes 0.000 description 5
- 238000001712 DNA sequencing Methods 0.000 description 5
- 108090000385 Fibroblast growth factor 7 Proteins 0.000 description 5
- 102000003972 Fibroblast growth factor 7 Human genes 0.000 description 5
- ZRALSGWEFCBTJO-UHFFFAOYSA-N Guanidine Chemical compound NC(N)=N ZRALSGWEFCBTJO-UHFFFAOYSA-N 0.000 description 5
- 101100288095 Klebsiella pneumoniae neo gene Proteins 0.000 description 5
- 241000124008 Mammalia Species 0.000 description 5
- 241000699666 Mus <mouse, genus> Species 0.000 description 5
- 108091000117 Tyrosine 3-Monooxygenase Proteins 0.000 description 5
- 102000048218 Tyrosine 3-monooxygenases Human genes 0.000 description 5
- -1 aliphatic amino acid Chemical class 0.000 description 5
- 239000010839 body fluid Substances 0.000 description 5
- 238000005119 centrifugation Methods 0.000 description 5
- 238000001514 detection method Methods 0.000 description 5
- 231100000673 dose–response relationship Toxicity 0.000 description 5
- 230000002500 effect on skin Effects 0.000 description 5
- 210000003527 eukaryotic cell Anatomy 0.000 description 5
- 230000001605 fetal effect Effects 0.000 description 5
- 210000003917 human chromosome Anatomy 0.000 description 5
- 238000007901 in situ hybridization Methods 0.000 description 5
- 238000010348 incorporation Methods 0.000 description 5
- 208000015181 infectious disease Diseases 0.000 description 5
- 239000003446 ligand Substances 0.000 description 5
- 239000000463 material Substances 0.000 description 5
- 230000004048 modification Effects 0.000 description 5
- 238000012986 modification Methods 0.000 description 5
- 239000013600 plasmid vector Substances 0.000 description 5
- 230000001737 promoting effect Effects 0.000 description 5
- 230000004952 protein activity Effects 0.000 description 5
- 230000000638 stimulation Effects 0.000 description 5
- 239000000126 substance Substances 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- 108020005544 Antisense RNA Proteins 0.000 description 4
- 108020004635 Complementary DNA Proteins 0.000 description 4
- 102000012410 DNA Ligases Human genes 0.000 description 4
- 108010061982 DNA Ligases Proteins 0.000 description 4
- ZHNUHDYFZUAESO-UHFFFAOYSA-N Formamide Chemical compound NC=O ZHNUHDYFZUAESO-UHFFFAOYSA-N 0.000 description 4
- HVLSXIKZNLPZJJ-TXZCQADKSA-N HA peptide Chemical compound C([C@@H](C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](C(C)C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](C)C(O)=O)NC(=O)[C@H]1N(CCC1)C(=O)[C@@H](N)CC=1C=CC(O)=CC=1)C1=CC=C(O)C=C1 HVLSXIKZNLPZJJ-TXZCQADKSA-N 0.000 description 4
- 108060003951 Immunoglobulin Proteins 0.000 description 4
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 4
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- 238000005481 NMR spectroscopy Methods 0.000 description 4
- 238000000636 Northern blotting Methods 0.000 description 4
- 108010038807 Oligopeptides Proteins 0.000 description 4
- 102000015636 Oligopeptides Human genes 0.000 description 4
- 101710182846 Polyhedrin Proteins 0.000 description 4
- 241000700159 Rattus Species 0.000 description 4
- 108020004511 Recombinant DNA Proteins 0.000 description 4
- 102000006601 Thymidine Kinase Human genes 0.000 description 4
- 108020004440 Thymidine kinase Proteins 0.000 description 4
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 4
- 230000004075 alteration Effects 0.000 description 4
- 239000007640 basal medium Substances 0.000 description 4
- 239000000872 buffer Substances 0.000 description 4
- 244000309466 calf Species 0.000 description 4
- 230000010261 cell growth Effects 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 239000003184 complementary RNA Substances 0.000 description 4
- 210000003618 cortical neuron Anatomy 0.000 description 4
- 230000004069 differentiation Effects 0.000 description 4
- VYFYYTLLBUKUHU-UHFFFAOYSA-N dopamine Chemical compound NCCC1=CC=C(O)C(O)=C1 VYFYYTLLBUKUHU-UHFFFAOYSA-N 0.000 description 4
- 230000003291 dopaminomimetic effect Effects 0.000 description 4
- 239000012737 fresh medium Substances 0.000 description 4
- RWSXRVCMGQZWBV-WDSKDSINSA-N glutathione Chemical compound OC(=O)[C@@H](N)CCC(=O)N[C@@H](CS)C(=O)NCC(O)=O RWSXRVCMGQZWBV-WDSKDSINSA-N 0.000 description 4
- 239000003102 growth factor Substances 0.000 description 4
- 239000001963 growth medium Substances 0.000 description 4
- 229960004198 guanidine Drugs 0.000 description 4
- 102000018358 immunoglobulin Human genes 0.000 description 4
- 101150109249 lacI gene Proteins 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 239000012528 membrane Substances 0.000 description 4
- 210000004379 membrane Anatomy 0.000 description 4
- 230000002297 mitogenic effect Effects 0.000 description 4
- 238000010369 molecular cloning Methods 0.000 description 4
- 230000002611 ovarian Effects 0.000 description 4
- 230000035935 pregnancy Effects 0.000 description 4
- 230000000717 retained effect Effects 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 230000029663 wound healing Effects 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 229920001817 Agar Polymers 0.000 description 3
- 108020004491 Antisense DNA Proteins 0.000 description 3
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 3
- 241000283690 Bos taurus Species 0.000 description 3
- 101150074155 DHFR gene Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 238000012286 ELISA Assay Methods 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- 108090001047 Fibroblast growth factor 10 Proteins 0.000 description 3
- 102100028412 Fibroblast growth factor 10 Human genes 0.000 description 3
- 102000003974 Fibroblast growth factor 2 Human genes 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 101001027382 Homo sapiens Fibroblast growth factor 8 Proteins 0.000 description 3
- 108090000144 Human Proteins Proteins 0.000 description 3
- 102000003839 Human Proteins Human genes 0.000 description 3
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 3
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 3
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 3
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 3
- 108010054278 Lac Repressors Proteins 0.000 description 3
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 3
- 239000006137 Luria-Bertani broth Substances 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 229930182555 Penicillin Natural products 0.000 description 3
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 3
- 206010035226 Plasma cell myeloma Diseases 0.000 description 3
- 108010039918 Polylysine Proteins 0.000 description 3
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 3
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 3
- 206010039491 Sarcoma Diseases 0.000 description 3
- 238000012300 Sequence Analysis Methods 0.000 description 3
- 239000008272 agar Substances 0.000 description 3
- 230000003321 amplification Effects 0.000 description 3
- 239000003816 antisense DNA Substances 0.000 description 3
- 235000009582 asparagine Nutrition 0.000 description 3
- 229960001230 asparagine Drugs 0.000 description 3
- 230000008901 benefit Effects 0.000 description 3
- 230000003115 biocidal effect Effects 0.000 description 3
- 230000008827 biological function Effects 0.000 description 3
- 238000001574 biopsy Methods 0.000 description 3
- 230000037396 body weight Effects 0.000 description 3
- BQRGNLJZBFXNCZ-UHFFFAOYSA-N calcein am Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC(CN(CC(=O)OCOC(C)=O)CC(=O)OCOC(C)=O)=C(OC(C)=O)C=C1OC1=C2C=C(CN(CC(=O)OCOC(C)=O)CC(=O)OCOC(=O)C)C(OC(C)=O)=C1 BQRGNLJZBFXNCZ-UHFFFAOYSA-N 0.000 description 3
- 201000011510 cancer Diseases 0.000 description 3
- 238000001516 cell proliferation assay Methods 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 239000005547 deoxyribonucleotide Substances 0.000 description 3
- 230000029087 digestion Effects 0.000 description 3
- 238000010790 dilution Methods 0.000 description 3
- 239000012895 dilution Substances 0.000 description 3
- 238000006073 displacement reaction Methods 0.000 description 3
- 239000003814 drug Substances 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 239000013613 expression plasmid Substances 0.000 description 3
- 239000000284 extract Substances 0.000 description 3
- 239000012091 fetal bovine serum Substances 0.000 description 3
- 239000012530 fluid Substances 0.000 description 3
- 238000001415 gene therapy Methods 0.000 description 3
- 239000011521 glass Substances 0.000 description 3
- 210000003958 hematopoietic stem cell Anatomy 0.000 description 3
- 230000000971 hippocampal effect Effects 0.000 description 3
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 3
- 102000057238 human FGF8 Human genes 0.000 description 3
- 230000001900 immune effect Effects 0.000 description 3
- 230000000415 inactivating effect Effects 0.000 description 3
- 230000002458 infectious effect Effects 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 230000000968 intestinal effect Effects 0.000 description 3
- 210000002510 keratinocyte Anatomy 0.000 description 3
- 238000009630 liquid culture Methods 0.000 description 3
- 238000002844 melting Methods 0.000 description 3
- 230000008018 melting Effects 0.000 description 3
- 210000003716 mesoderm Anatomy 0.000 description 3
- 210000004925 microvascular endothelial cell Anatomy 0.000 description 3
- 239000003226 mitogen Substances 0.000 description 3
- 201000000050 myeloid neoplasm Diseases 0.000 description 3
- 238000003199 nucleic acid amplification method Methods 0.000 description 3
- 230000003287 optical effect Effects 0.000 description 3
- 229940049954 penicillin Drugs 0.000 description 3
- 235000021317 phosphate Nutrition 0.000 description 3
- 229920000656 polylysine Polymers 0.000 description 3
- 238000003127 radioimmunoassay Methods 0.000 description 3
- 230000008929 regeneration Effects 0.000 description 3
- 238000011069 regeneration method Methods 0.000 description 3
- 230000001105 regulatory effect Effects 0.000 description 3
- 238000012552 review Methods 0.000 description 3
- 230000028327 secretion Effects 0.000 description 3
- 210000002966 serum Anatomy 0.000 description 3
- 239000012679 serum free medium Substances 0.000 description 3
- 239000001488 sodium phosphate Substances 0.000 description 3
- 229910000162 sodium phosphate Inorganic materials 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 229960005322 streptomycin Drugs 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- RYFMWSXOAZQYPI-UHFFFAOYSA-K trisodium phosphate Chemical compound [Na+].[Na+].[Na+].[O-]P([O-])([O-])=O RYFMWSXOAZQYPI-UHFFFAOYSA-K 0.000 description 3
- 241000701161 unidentified adenovirus Species 0.000 description 3
- 241001430294 unidentified retrovirus Species 0.000 description 3
- 210000002700 urine Anatomy 0.000 description 3
- 210000003556 vascular endothelial cell Anatomy 0.000 description 3
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 2
- NHBKXEKEPDILRR-UHFFFAOYSA-N 2,3-bis(butanoylsulfanyl)propyl butanoate Chemical compound CCCC(=O)OCC(SC(=O)CCC)CSC(=O)CCC NHBKXEKEPDILRR-UHFFFAOYSA-N 0.000 description 2
- NKDFYOWSKOHCCO-YPVLXUMRSA-N 20-hydroxyecdysone Chemical compound C1[C@@H](O)[C@@H](O)C[C@]2(C)[C@@H](CC[C@@]3([C@@H]([C@@](C)(O)[C@H](O)CCC(C)(O)C)CC[C@]33O)C)C3=CC(=O)[C@@H]21 NKDFYOWSKOHCCO-YPVLXUMRSA-N 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 241000201370 Autographa californica nucleopolyhedrovirus Species 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 101000583086 Bunodosoma granuliferum Delta-actitoxin-Bgr2b Proteins 0.000 description 2
- 125000001433 C-terminal amino-acid group Chemical group 0.000 description 2
- 101100230428 Caenorhabditis elegans hil-5 gene Proteins 0.000 description 2
- 201000009030 Carcinoma Diseases 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 108091033380 Coding strand Proteins 0.000 description 2
- FMGYKKMPNATWHP-UHFFFAOYSA-N Cyperquat Chemical compound C1=C[N+](C)=CC=C1C1=CC=CC=C1 FMGYKKMPNATWHP-UHFFFAOYSA-N 0.000 description 2
- 229920002307 Dextran Polymers 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- 241000196324 Embryophyta Species 0.000 description 2
- 108010042407 Endonucleases Proteins 0.000 description 2
- 102000004533 Endonucleases Human genes 0.000 description 2
- 241001596967 Escherichia coli M15 Species 0.000 description 2
- 102100031706 Fibroblast growth factor 1 Human genes 0.000 description 2
- 108050003239 Fibroblast growth factor 12 Proteins 0.000 description 2
- 102100028417 Fibroblast growth factor 12 Human genes 0.000 description 2
- 108090000381 Fibroblast growth factor 4 Proteins 0.000 description 2
- 102100028072 Fibroblast growth factor 4 Human genes 0.000 description 2
- 108090000380 Fibroblast growth factor 5 Proteins 0.000 description 2
- 102100028073 Fibroblast growth factor 5 Human genes 0.000 description 2
- 108090000382 Fibroblast growth factor 6 Proteins 0.000 description 2
- 102100028075 Fibroblast growth factor 6 Human genes 0.000 description 2
- 208000032612 Glial tumor Diseases 0.000 description 2
- 206010018338 Glioma Diseases 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 101710154606 Hemagglutinin Proteins 0.000 description 2
- 102100031000 Hepatoma-derived growth factor Human genes 0.000 description 2
- 108010093488 His-His-His-His-His-His Proteins 0.000 description 2
- 101001052035 Homo sapiens Fibroblast growth factor 2 Proteins 0.000 description 2
- 101001083798 Homo sapiens Hepatoma-derived growth factor Proteins 0.000 description 2
- 101100286713 Homo sapiens IL6 gene Proteins 0.000 description 2
- 108010001336 Horseradish Peroxidase Proteins 0.000 description 2
- 102000002265 Human Growth Hormone Human genes 0.000 description 2
- 108010000521 Human Growth Hormone Proteins 0.000 description 2
- 239000000854 Human Growth Hormone Substances 0.000 description 2
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 2
- 241000725303 Human immunodeficiency virus Species 0.000 description 2
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- 108010085895 Laminin Proteins 0.000 description 2
- 241000713869 Moloney murine leukemia virus Species 0.000 description 2
- 241000713862 Moloney murine sarcoma virus Species 0.000 description 2
- 101100446506 Mus musculus Fgf3 gene Proteins 0.000 description 2
- 125000000729 N-terminal amino-acid group Chemical group 0.000 description 2
- 101710163270 Nuclease Proteins 0.000 description 2
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 2
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 2
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 description 2
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 description 2
- 239000004793 Polystyrene Substances 0.000 description 2
- 239000012518 Poros HS 50 resin Substances 0.000 description 2
- 101710176177 Protein A56 Proteins 0.000 description 2
- 108091034057 RNA (poly(A)) Proteins 0.000 description 2
- 241000700157 Rattus norvegicus Species 0.000 description 2
- 241000725643 Respiratory syncytial virus Species 0.000 description 2
- 102000006382 Ribonucleases Human genes 0.000 description 2
- 108010083644 Ribonucleases Proteins 0.000 description 2
- 108091028664 Ribonucleotide Proteins 0.000 description 2
- MUMGGOZAMZWBJJ-DYKIIFRCSA-N Testostosterone Chemical compound O=C1CC[C@]2(C)[C@H]3CC[C@](C)([C@H](CC4)O)[C@@H]4[C@@H]3CCC2=C1 MUMGGOZAMZWBJJ-DYKIIFRCSA-N 0.000 description 2
- 239000007983 Tris buffer Substances 0.000 description 2
- 102000004142 Trypsin Human genes 0.000 description 2
- 108090000631 Trypsin Proteins 0.000 description 2
- 208000025865 Ulcer Diseases 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- 208000027418 Wounds and injury Diseases 0.000 description 2
- HMNZFMSWFCAGGW-XPWSMXQVSA-N [3-[hydroxy(2-hydroxyethoxy)phosphoryl]oxy-2-[(e)-octadec-9-enoyl]oxypropyl] (e)-octadec-9-enoate Chemical compound CCCCCCCC\C=C\CCCCCCCC(=O)OCC(COP(O)(=O)OCCO)OC(=O)CCCCCCC\C=C\CCCCCCCC HMNZFMSWFCAGGW-XPWSMXQVSA-N 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 238000010521 absorption reaction Methods 0.000 description 2
- 239000002253 acid Substances 0.000 description 2
- 230000002776 aggregation Effects 0.000 description 2
- 238000004220 aggregation Methods 0.000 description 2
- 239000003098 androgen Substances 0.000 description 2
- 150000001450 anions Chemical class 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 210000001367 artery Anatomy 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 125000000613 asparagine group Chemical group N[C@@H](CC(N)=O)C(=O)* 0.000 description 2
- 239000011324 bead Substances 0.000 description 2
- 238000004166 bioassay Methods 0.000 description 2
- 210000000988 bone and bone Anatomy 0.000 description 2
- 239000001506 calcium phosphate Substances 0.000 description 2
- 229910000389 calcium phosphate Inorganic materials 0.000 description 2
- 235000011010 calcium phosphates Nutrition 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 210000004978 chinese hamster ovary cell Anatomy 0.000 description 2
- 210000001612 chondrocyte Anatomy 0.000 description 2
- 238000004590 computer program Methods 0.000 description 2
- 230000002596 correlated effect Effects 0.000 description 2
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 125000002637 deoxyribonucleotide group Chemical group 0.000 description 2
- 238000013461 design Methods 0.000 description 2
- 229960002086 dextran Drugs 0.000 description 2
- 108020001096 dihydrofolate reductase Proteins 0.000 description 2
- 229960003638 dopamine Drugs 0.000 description 2
- 238000004520 electroporation Methods 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 230000007717 exclusion Effects 0.000 description 2
- 230000001747 exhibiting effect Effects 0.000 description 2
- 238000009472 formulation Methods 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 238000001502 gel electrophoresis Methods 0.000 description 2
- 238000007429 general method Methods 0.000 description 2
- 108060003196 globin Proteins 0.000 description 2
- 238000004128 high performance liquid chromatography Methods 0.000 description 2
- 210000004295 hippocampal neuron Anatomy 0.000 description 2
- 210000004754 hybrid cell Anatomy 0.000 description 2
- 230000003053 immunization Effects 0.000 description 2
- 229940072221 immunoglobulins Drugs 0.000 description 2
- 230000001976 improved effect Effects 0.000 description 2
- CGIGDMFJXJATDK-UHFFFAOYSA-N indomethacin Chemical compound CC1=C(CC(O)=O)C2=CC(OC)=CC=C2N1C(=O)C1=CC=C(Cl)C=C1 CGIGDMFJXJATDK-UHFFFAOYSA-N 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 206010022000 influenza Diseases 0.000 description 2
- 230000002401 inhibitory effect Effects 0.000 description 2
- 230000003993 interaction Effects 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 238000002372 labelling Methods 0.000 description 2
- 125000001909 leucine group Chemical group [H]N(*)C(C(*)=O)C([H])([H])C(C([H])([H])[H])C([H])([H])[H] 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 150000002632 lipids Chemical class 0.000 description 2
- 239000002502 liposome Substances 0.000 description 2
- 238000005259 measurement Methods 0.000 description 2
- 210000002752 melanocyte Anatomy 0.000 description 2
- 210000001259 mesencephalon Anatomy 0.000 description 2
- 230000031864 metaphase Effects 0.000 description 2
- 230000037230 mobility Effects 0.000 description 2
- 239000000178 monomer Substances 0.000 description 2
- 210000003098 myoblast Anatomy 0.000 description 2
- 210000001577 neostriatum Anatomy 0.000 description 2
- 210000004498 neuroglial cell Anatomy 0.000 description 2
- 230000000926 neurological effect Effects 0.000 description 2
- 230000007514 neuronal growth Effects 0.000 description 2
- 230000003961 neuronal insult Effects 0.000 description 2
- 230000008906 neuronal response Effects 0.000 description 2
- 230000006576 neuronal survival Effects 0.000 description 2
- 230000007935 neutral effect Effects 0.000 description 2
- 210000004248 oligodendroglia Anatomy 0.000 description 2
- 230000002018 overexpression Effects 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Chemical compound OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 210000002381 plasma Anatomy 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 229920002223 polystyrene Polymers 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 230000003389 potentiating effect Effects 0.000 description 2
- 239000002244 precipitate Substances 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 239000002987 primer (paints) Substances 0.000 description 2
- 230000002062 proliferating effect Effects 0.000 description 2
- 230000004853 protein function Effects 0.000 description 2
- 238000001742 protein purification Methods 0.000 description 2
- 238000002601 radiography Methods 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000007894 restriction fragment length polymorphism technique Methods 0.000 description 2
- 238000010839 reverse transcription Methods 0.000 description 2
- 239000002336 ribonucleotide Substances 0.000 description 2
- 125000002652 ribonucleotide group Chemical group 0.000 description 2
- 238000009738 saturating Methods 0.000 description 2
- 239000002356 single layer Substances 0.000 description 2
- 210000002363 skeletal muscle cell Anatomy 0.000 description 2
- 230000009759 skin aging Effects 0.000 description 2
- 150000003384 small molecules Chemical class 0.000 description 2
- 210000004988 splenocyte Anatomy 0.000 description 2
- 238000010561 standard procedure Methods 0.000 description 2
- 239000007858 starting material Substances 0.000 description 2
- 238000003860 storage Methods 0.000 description 2
- 239000000758 substrate Substances 0.000 description 2
- 239000003104 tissue culture media Substances 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- 230000009466 transformation Effects 0.000 description 2
- 230000001131 transforming effect Effects 0.000 description 2
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 2
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 2
- 230000001228 trophic effect Effects 0.000 description 2
- 239000012588 trypsin Substances 0.000 description 2
- 231100000397 ulcer Toxicity 0.000 description 2
- 208000019553 vascular disease Diseases 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- 238000001086 yeast two-hybrid system Methods 0.000 description 2
- DIGQNXIGRZPYDK-WKSCXVIASA-N (2R)-6-amino-2-[[2-[[(2S)-2-[[2-[[(2R)-2-[[(2S)-2-[[(2R,3S)-2-[[2-[[(2S)-2-[[2-[[(2S)-2-[[(2S)-2-[[(2R)-2-[[(2S,3S)-2-[[(2R)-2-[[(2S)-2-[[(2S)-2-[[(2S)-2-[[2-[[(2S)-2-[[(2R)-2-[[2-[[2-[[2-[(2-amino-1-hydroxyethylidene)amino]-3-carboxy-1-hydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxypropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1,5-dihydroxy-5-iminopentylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxybutylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1,3-dihydroxypropylidene]amino]-1-hydroxyethylidene]amino]-1-hydroxy-3-sulfanylpropylidene]amino]-1-hydroxyethylidene]amino]hexanoic acid Chemical compound C[C@@H]([C@@H](C(=N[C@@H](CS)C(=N[C@@H](C)C(=N[C@@H](CO)C(=NCC(=N[C@@H](CCC(=N)O)C(=NC(CS)C(=N[C@H]([C@H](C)O)C(=N[C@H](CS)C(=N[C@H](CO)C(=NCC(=N[C@H](CS)C(=NCC(=N[C@H](CCCCN)C(=O)O)O)O)O)O)O)O)O)O)O)O)O)O)O)N=C([C@H](CS)N=C([C@H](CO)N=C([C@H](CO)N=C([C@H](C)N=C(CN=C([C@H](CO)N=C([C@H](CS)N=C(CN=C(C(CS)N=C(C(CC(=O)O)N=C(CN)O)O)O)O)O)O)O)O)O)O)O)O DIGQNXIGRZPYDK-WKSCXVIASA-N 0.000 description 1
- KUHSEZKIEJYEHN-BXRBKJIMSA-N (2s)-2-amino-3-hydroxypropanoic acid;(2s)-2-aminopropanoic acid Chemical compound C[C@H](N)C(O)=O.OC[C@H](N)C(O)=O KUHSEZKIEJYEHN-BXRBKJIMSA-N 0.000 description 1
- PSLCKQYQNVNTQI-BHFSHLQUSA-N (2s)-2-aminobutanedioic acid;(2s)-2-aminopentanedioic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O.OC(=O)[C@@H](N)CCC(O)=O PSLCKQYQNVNTQI-BHFSHLQUSA-N 0.000 description 1
- 125000006701 (C1-C7) alkyl group Chemical group 0.000 description 1
- BRAJQLYTRXKQAW-UHFFFAOYSA-N 1-methyl-4-phenyl-2h-pyridine Chemical compound C1=CN(C)CC=C1C1=CC=CC=C1 BRAJQLYTRXKQAW-UHFFFAOYSA-N 0.000 description 1
- FMYBFLOWKQRBST-UHFFFAOYSA-N 2-[bis(carboxymethyl)amino]acetic acid;nickel Chemical compound [Ni].OC(=O)CN(CC(O)=O)CC(O)=O FMYBFLOWKQRBST-UHFFFAOYSA-N 0.000 description 1
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 1
- ZCYVEMRRCGMTRW-UHFFFAOYSA-N 7553-56-2 Chemical compound [I] ZCYVEMRRCGMTRW-UHFFFAOYSA-N 0.000 description 1
- WRDABNWSWOHGMS-UHFFFAOYSA-N AEBSF hydrochloride Chemical compound Cl.NCCC1=CC=C(S(F)(=O)=O)C=C1 WRDABNWSWOHGMS-UHFFFAOYSA-N 0.000 description 1
- 206010001513 AIDS related complex Diseases 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 201000004384 Alopecia Diseases 0.000 description 1
- 208000024827 Alzheimer disease Diseases 0.000 description 1
- 108010032595 Antibody Binding Sites Proteins 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 241000972773 Aulopiformes Species 0.000 description 1
- 238000012935 Averaging Methods 0.000 description 1
- 241000713826 Avian leukosis virus Species 0.000 description 1
- 101001051969 Bos taurus Fibroblast growth factor 2 Proteins 0.000 description 1
- 206010006187 Breast cancer Diseases 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 208000005623 Carcinogenesis Diseases 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 208000002177 Cataract Diseases 0.000 description 1
- 102000000844 Cell Surface Receptors Human genes 0.000 description 1
- 108010001857 Cell Surface Receptors Proteins 0.000 description 1
- ACTIUHUUMQJHFO-UHFFFAOYSA-N Coenzym Q10 Natural products COC1=C(OC)C(=O)C(CC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)C)=C(C)C1=O ACTIUHUUMQJHFO-UHFFFAOYSA-N 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- 241000699802 Cricetulus griseus Species 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 1
- 102100024746 Dihydrofolate reductase Human genes 0.000 description 1
- BWGNESOTFCXPMA-UHFFFAOYSA-N Dihydrogen disulfide Chemical compound SS BWGNESOTFCXPMA-UHFFFAOYSA-N 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 238000011891 EIA kit Methods 0.000 description 1
- 238000008157 ELISA kit Methods 0.000 description 1
- YQYJSBFKSSDGFO-UHFFFAOYSA-N Epihygromycin Natural products OC1C(O)C(C(=O)C)OC1OC(C(=C1)O)=CC=C1C=C(C)C(=O)NC1C(O)C(O)C2OCOC2C1O YQYJSBFKSSDGFO-UHFFFAOYSA-N 0.000 description 1
- 241001131785 Escherichia coli HB101 Species 0.000 description 1
- 101000686777 Escherichia phage T7 T7 RNA polymerase Proteins 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 102100023600 Fibroblast growth factor receptor 2 Human genes 0.000 description 1
- 101710182389 Fibroblast growth factor receptor 2 Proteins 0.000 description 1
- 102100027844 Fibroblast growth factor receptor 4 Human genes 0.000 description 1
- 230000010190 G1 phase Effects 0.000 description 1
- 241000713813 Gibbon ape leukemia virus Species 0.000 description 1
- 102000053171 Glial Fibrillary Acidic Human genes 0.000 description 1
- 101710193519 Glial fibrillary acidic protein Proteins 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004366 Glucose oxidase Substances 0.000 description 1
- 108010015776 Glucose oxidase Proteins 0.000 description 1
- 108010024636 Glutathione Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 108010078321 Guanylate Cyclase Proteins 0.000 description 1
- 102000014469 Guanylate cyclase Human genes 0.000 description 1
- 101150101014 HST1 gene Proteins 0.000 description 1
- 230000010556 Heparin Binding Activity Effects 0.000 description 1
- 208000009889 Herpes Simplex Diseases 0.000 description 1
- 108010033040 Histones Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101001060261 Homo sapiens Fibroblast growth factor 7 Proteins 0.000 description 1
- 101000917134 Homo sapiens Fibroblast growth factor receptor 4 Proteins 0.000 description 1
- 101001010621 Homo sapiens Interleukin-21 Proteins 0.000 description 1
- 108700002232 Immediate-Early Genes Proteins 0.000 description 1
- 108010054477 Immunoglobulin Fab Fragments Proteins 0.000 description 1
- 102000001706 Immunoglobulin Fab Fragments Human genes 0.000 description 1
- 102000018071 Immunoglobulin Fc Fragments Human genes 0.000 description 1
- 108010091135 Immunoglobulin Fc Fragments Proteins 0.000 description 1
- 102000008070 Interferon-gamma Human genes 0.000 description 1
- 108010074328 Interferon-gamma Proteins 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 102000004310 Ion Channels Human genes 0.000 description 1
- 108010025815 Kanamycin Kinase Proteins 0.000 description 1
- 208000007766 Kaposi sarcoma Diseases 0.000 description 1
- XUJNEKJLAYXESH-REOHCLBHSA-N L-Cysteine Chemical compound SC[C@H](N)C(O)=O XUJNEKJLAYXESH-REOHCLBHSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- 101710090149 Lactose operon repressor Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 102000018697 Membrane Proteins Human genes 0.000 description 1
- 108010052285 Membrane Proteins Proteins 0.000 description 1
- 102000003792 Metallothionein Human genes 0.000 description 1
- 108090000157 Metallothionein Proteins 0.000 description 1
- 102000010909 Monoamine Oxidase Human genes 0.000 description 1
- 108010062431 Monoamine oxidase Proteins 0.000 description 1
- 101100278853 Mus musculus Dhfr gene Proteins 0.000 description 1
- 101001027384 Mus musculus Fibroblast growth factor 8 Proteins 0.000 description 1
- 102000008300 Mutant Proteins Human genes 0.000 description 1
- 108010021466 Mutant Proteins Proteins 0.000 description 1
- 241000713883 Myeloproliferative sarcoma virus Species 0.000 description 1
- CHJJGSNFBQVOTG-UHFFFAOYSA-N N-methyl-guanidine Natural products CNC(N)=N CHJJGSNFBQVOTG-UHFFFAOYSA-N 0.000 description 1
- 125000001429 N-terminal alpha-amino-acid group Chemical group 0.000 description 1
- 241001045988 Neogene Species 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 102000008763 Neurofilament Proteins Human genes 0.000 description 1
- 108010088373 Neurofilament Proteins Proteins 0.000 description 1
- 108020004711 Nucleic Acid Probes Proteins 0.000 description 1
- 108020005187 Oligonucleotide Probes Proteins 0.000 description 1
- 102000043276 Oncogene Human genes 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- 206010033128 Ovarian cancer Diseases 0.000 description 1
- 206010061535 Ovarian neoplasm Diseases 0.000 description 1
- 238000012408 PCR amplification Methods 0.000 description 1
- 108020002230 Pancreatic Ribonuclease Proteins 0.000 description 1
- 102000005891 Pancreatic ribonuclease Human genes 0.000 description 1
- 108090000526 Papain Proteins 0.000 description 1
- 229930040373 Paraformaldehyde Natural products 0.000 description 1
- 102000057297 Pepsin A Human genes 0.000 description 1
- 108090000284 Pepsin A Proteins 0.000 description 1
- 108010033276 Peptide Fragments Proteins 0.000 description 1
- 102000007079 Peptide Fragments Human genes 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 108010001014 Plasminogen Activators Proteins 0.000 description 1
- 102000001938 Plasminogen Activators Human genes 0.000 description 1
- 239000002202 Polyethylene glycol Substances 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 241000125945 Protoparvovirus Species 0.000 description 1
- 101100084022 Pseudomonas aeruginosa (strain ATCC 15692 / DSM 22644 / CIP 104116 / JCM 14847 / LMG 12228 / 1C / PRS 101 / PAO1) lapA gene Proteins 0.000 description 1
- 239000012083 RIPA buffer Substances 0.000 description 1
- 108020005091 Replication Origin Proteins 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- BFDMCHRDSYTOLE-UHFFFAOYSA-N SC#N.NC(N)=N.ClC(Cl)Cl.OC1=CC=CC=C1 Chemical compound SC#N.NC(N)=N.ClC(Cl)Cl.OC1=CC=CC=C1 BFDMCHRDSYTOLE-UHFFFAOYSA-N 0.000 description 1
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 1
- 101100379247 Salmo trutta apoa1 gene Proteins 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 108091081021 Sense strand Proteins 0.000 description 1
- 108020004682 Single-Stranded DNA Proteins 0.000 description 1
- 238000002105 Southern blotting Methods 0.000 description 1
- 241000713896 Spleen necrosis virus Species 0.000 description 1
- 241000256248 Spodoptera Species 0.000 description 1
- 241000187747 Streptomyces Species 0.000 description 1
- NINIDFKCEFEMDL-UHFFFAOYSA-N Sulfur Chemical compound [S] NINIDFKCEFEMDL-UHFFFAOYSA-N 0.000 description 1
- 206010042496 Sunburn Diseases 0.000 description 1
- 210000001744 T-lymphocyte Anatomy 0.000 description 1
- GKLVYJBZJHMRIY-OUBTZVSYSA-N Technetium-99 Chemical compound [99Tc] GKLVYJBZJHMRIY-OUBTZVSYSA-N 0.000 description 1
- 108020005038 Terminator Codon Proteins 0.000 description 1
- 239000004098 Tetracycline Substances 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 108060008683 Tumor Necrosis Factor Receptor Proteins 0.000 description 1
- 102100040247 Tumor necrosis factor Human genes 0.000 description 1
- 206010072810 Vascular wall hypertrophy Diseases 0.000 description 1
- 108020005202 Viral DNA Proteins 0.000 description 1
- 206010052428 Wound Diseases 0.000 description 1
- 210000001015 abdomen Anatomy 0.000 description 1
- 230000001594 aberrant effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 210000001789 adipocyte Anatomy 0.000 description 1
- 230000001919 adrenal effect Effects 0.000 description 1
- 238000001042 affinity chromatography Methods 0.000 description 1
- 238000001261 affinity purification Methods 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 238000012867 alanine scanning Methods 0.000 description 1
- 150000001408 amides Chemical group 0.000 description 1
- 238000003277 amino acid sequence analysis Methods 0.000 description 1
- BFNBIHQBYMNNAN-UHFFFAOYSA-N ammonium sulfate Chemical compound N.N.OS(O)(=O)=O BFNBIHQBYMNNAN-UHFFFAOYSA-N 0.000 description 1
- 229910052921 ammonium sulfate Inorganic materials 0.000 description 1
- 238000012870 ammonium sulfate precipitation Methods 0.000 description 1
- 235000011130 ammonium sulphate Nutrition 0.000 description 1
- 230000002491 angiogenic effect Effects 0.000 description 1
- 238000002399 angioplasty Methods 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 238000005571 anion exchange chromatography Methods 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 230000009830 antibody antigen interaction Effects 0.000 description 1
- 239000002246 antineoplastic agent Substances 0.000 description 1
- 108010062796 arginyllysine Proteins 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 238000011888 autopsy Methods 0.000 description 1
- 238000000376 autoradiography Methods 0.000 description 1
- 229910052788 barium Inorganic materials 0.000 description 1
- DSAJWYNOEDNPEQ-UHFFFAOYSA-N barium atom Chemical compound [Ba] DSAJWYNOEDNPEQ-UHFFFAOYSA-N 0.000 description 1
- 210000002469 basement membrane Anatomy 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 108010005774 beta-Galactosidase Proteins 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- 229960002685 biotin Drugs 0.000 description 1
- 235000020958 biotin Nutrition 0.000 description 1
- 239000011616 biotin Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004204 blood vessel Anatomy 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 239000012888 bovine serum Substances 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 210000005013 brain tissue Anatomy 0.000 description 1
- 201000008275 breast carcinoma Diseases 0.000 description 1
- 210000000424 bronchial epithelial cell Anatomy 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000007975 buffered saline Substances 0.000 description 1
- 229910052792 caesium Inorganic materials 0.000 description 1
- TVFDJXOCXUVLDH-UHFFFAOYSA-N caesium atom Chemical compound [Cs] TVFDJXOCXUVLDH-UHFFFAOYSA-N 0.000 description 1
- 230000036952 cancer formation Effects 0.000 description 1
- 239000002775 capsule Substances 0.000 description 1
- 231100000504 carcinogenesis Toxicity 0.000 description 1
- 230000003197 catalytic effect Effects 0.000 description 1
- 238000005341 cation exchange Methods 0.000 description 1
- 238000005277 cation exchange chromatography Methods 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 239000006143 cell culture medium Substances 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 239000013592 cell lysate Substances 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 230000009087 cell motility Effects 0.000 description 1
- 230000003833 cell viability Effects 0.000 description 1
- 108091092328 cellular RNA Proteins 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 230000003196 chaotropic effect Effects 0.000 description 1
- 239000013522 chelant Substances 0.000 description 1
- 230000003399 chemotactic effect Effects 0.000 description 1
- 238000003200 chromosome mapping Methods 0.000 description 1
- 238000005352 clarification Methods 0.000 description 1
- 235000017471 coenzyme Q10 Nutrition 0.000 description 1
- ACTIUHUUMQJHFO-UPTCCGCDSA-N coenzyme Q10 Chemical compound COC1=C(OC)C(=O)C(C\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CC\C=C(/C)CCC=C(C)C)=C(C)C1=O ACTIUHUUMQJHFO-UPTCCGCDSA-N 0.000 description 1
- 238000012875 competitive assay Methods 0.000 description 1
- 239000003636 conditioned culture medium Substances 0.000 description 1
- 238000010276 construction Methods 0.000 description 1
- 239000000356 contaminant Substances 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 210000000399 corneal endothelial cell Anatomy 0.000 description 1
- 239000011243 crosslinked material Substances 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 229940127089 cytotoxic agent Drugs 0.000 description 1
- 230000007812 deficiency Effects 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000002074 deregulated effect Effects 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 229910052805 deuterium Inorganic materials 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 229960000633 dextran sulfate Drugs 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- 206010012601 diabetes mellitus Diseases 0.000 description 1
- 229910003460 diamond Inorganic materials 0.000 description 1
- 239000010432 diamond Substances 0.000 description 1
- 102000004419 dihydrofolate reductase Human genes 0.000 description 1
- OZRNSSUDZOLUSN-LBPRGKRZSA-N dihydrofolic acid Chemical compound N=1C=2C(=O)NC(N)=NC=2NCC=1CNC1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 OZRNSSUDZOLUSN-LBPRGKRZSA-N 0.000 description 1
- SWSQBOPZIKWTGO-UHFFFAOYSA-N dimethylaminoamidine Natural products CN(C)C(N)=N SWSQBOPZIKWTGO-UHFFFAOYSA-N 0.000 description 1
- 231100000676 disease causative agent Toxicity 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 238000007876 drug discovery Methods 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 210000003981 ectoderm Anatomy 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 238000000804 electron spin resonance spectroscopy Methods 0.000 description 1
- 230000013020 embryo development Effects 0.000 description 1
- 210000001671 embryonic stem cell Anatomy 0.000 description 1
- 210000001900 endoderm Anatomy 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 238000009585 enzyme analysis Methods 0.000 description 1
- 238000012869 ethanol precipitation Methods 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 238000001400 expression cloning Methods 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 238000000605 extraction Methods 0.000 description 1
- 239000012894 fetal calf serum Substances 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 239000006260 foam Substances 0.000 description 1
- 230000037433 frameshift Effects 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 210000001222 gaba-ergic neuron Anatomy 0.000 description 1
- 230000003371 gabaergic effect Effects 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 238000010353 genetic engineering Methods 0.000 description 1
- 230000002518 glial effect Effects 0.000 description 1
- 210000005046 glial fibrillary acidic protein Anatomy 0.000 description 1
- 102000018146 globin Human genes 0.000 description 1
- 229940116332 glucose oxidase Drugs 0.000 description 1
- 235000019420 glucose oxidase Nutrition 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229960003180 glutathione Drugs 0.000 description 1
- 239000006451 grace's insect medium Substances 0.000 description 1
- 239000011544 gradient gel Substances 0.000 description 1
- 210000003714 granulocyte Anatomy 0.000 description 1
- 230000003676 hair loss Effects 0.000 description 1
- 208000024963 hair loss Diseases 0.000 description 1
- 210000003494 hepatocyte Anatomy 0.000 description 1
- 238000012188 high-throughput screening assay Methods 0.000 description 1
- 125000000487 histidyl group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C([H])=N1 0.000 description 1
- 238000010562 histological examination Methods 0.000 description 1
- 238000002744 homologous recombination Methods 0.000 description 1
- 230000006801 homologous recombination Effects 0.000 description 1
- 230000003054 hormonal effect Effects 0.000 description 1
- 102000057239 human FGF7 Human genes 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 230000002209 hydrophobic effect Effects 0.000 description 1
- 238000004191 hydrophobic interaction chromatography Methods 0.000 description 1
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 1
- 238000012872 hydroxylapatite chromatography Methods 0.000 description 1
- 208000026278 immune system disease Diseases 0.000 description 1
- 238000002649 immunization Methods 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000011532 immunohistochemical staining Methods 0.000 description 1
- 238000001114 immunoprecipitation Methods 0.000 description 1
- 238000012744 immunostaining Methods 0.000 description 1
- 239000007943 implant Substances 0.000 description 1
- 238000011503 in vivo imaging Methods 0.000 description 1
- 238000010249 in-situ analysis Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 229910052738 indium Inorganic materials 0.000 description 1
- APFVFJFRJDLVQX-UHFFFAOYSA-N indium atom Chemical compound [In] APFVFJFRJDLVQX-UHFFFAOYSA-N 0.000 description 1
- 229960000905 indomethacin Drugs 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 230000010354 integration Effects 0.000 description 1
- 230000002452 interceptive effect Effects 0.000 description 1
- 229960003130 interferon gamma Drugs 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 230000026045 iodination Effects 0.000 description 1
- 238000006192 iodination reaction Methods 0.000 description 1
- 229910052740 iodine Inorganic materials 0.000 description 1
- 239000011630 iodine Substances 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 210000003644 lens cell Anatomy 0.000 description 1
- 210000001542 lens epithelial cell Anatomy 0.000 description 1
- 231100000225 lethality Toxicity 0.000 description 1
- 238000007834 ligase chain reaction Methods 0.000 description 1
- 238000001638 lipofection Methods 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- WSFSSNUMVMOOMR-NJFSPNSNSA-N methanone Chemical compound O=[14CH2] WSFSSNUMVMOOMR-NJFSPNSNSA-N 0.000 description 1
- 244000005700 microbiome Species 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 239000002808 molecular sieve Substances 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 238000004264 monolayer culture Methods 0.000 description 1
- 230000007659 motor function Effects 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 101150091879 neo gene Proteins 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 210000005170 neoplastic cell Anatomy 0.000 description 1
- 210000001020 neural plate Anatomy 0.000 description 1
- 210000002241 neurite Anatomy 0.000 description 1
- 230000000626 neurodegenerative effect Effects 0.000 description 1
- 210000005044 neurofilament Anatomy 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 239000002853 nucleic acid probe Substances 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 229940046166 oligodeoxynucleotide Drugs 0.000 description 1
- 239000002751 oligonucleotide probe Substances 0.000 description 1
- 231100000590 oncogenic Toxicity 0.000 description 1
- 230000002246 oncogenic effect Effects 0.000 description 1
- 210000000056 organ Anatomy 0.000 description 1
- 210000000963 osteoblast Anatomy 0.000 description 1
- 229910052760 oxygen Inorganic materials 0.000 description 1
- 239000001301 oxygen Substances 0.000 description 1
- 238000004091 panning Methods 0.000 description 1
- 229940055729 papain Drugs 0.000 description 1
- 235000019834 papain Nutrition 0.000 description 1
- 239000012188 paraffin wax Substances 0.000 description 1
- 229920002866 paraformaldehyde Polymers 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 230000036961 partial effect Effects 0.000 description 1
- 239000013610 patient sample Substances 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- 229940111202 pepsin Drugs 0.000 description 1
- 230000007030 peptide scission Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 230000003239 periodontal effect Effects 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 239000012071 phase Substances 0.000 description 1
- 238000002205 phenol-chloroform extraction Methods 0.000 description 1
- 101150009573 phoA gene Proteins 0.000 description 1
- 229940080469 phosphocellulose Drugs 0.000 description 1
- 150000003906 phosphoinositides Chemical class 0.000 description 1
- 150000003013 phosphoric acid derivatives Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 238000005222 photoaffinity labeling Methods 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 229940127126 plasminogen activator Drugs 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 102000054765 polymorphisms of proteins Human genes 0.000 description 1
- 238000011176 pooling Methods 0.000 description 1
- 230000026341 positive regulation of angiogenesis Effects 0.000 description 1
- 230000002980 postoperative effect Effects 0.000 description 1
- 230000003334 potential effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 108010066381 preproinsulin Proteins 0.000 description 1
- 230000003658 preventing hair loss Effects 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 210000001176 projection neuron Anatomy 0.000 description 1
- 238000011321 prophylaxis Methods 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- RYVMUASDIZQXAA-UHFFFAOYSA-N pyranoside Natural products O1C2(OCC(C)C(OC3C(C(O)C(O)C(CO)O3)O)C2)C(C)C(C2(CCC3C4(C)CC5O)C)C1CC2C3CC=C4CC5OC(C(C1O)O)OC(CO)C1OC(C1OC2C(C(OC3C(C(O)C(O)C(CO)O3)O)C(O)C(CO)O2)O)OC(CO)C(O)C1OC1OCC(O)C(O)C1O RYVMUASDIZQXAA-UHFFFAOYSA-N 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 238000000163 radioactive labelling Methods 0.000 description 1
- NPCOQXAVBJJZBQ-UHFFFAOYSA-N reduced coenzyme Q9 Natural products COC1=C(O)C(C)=C(CC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)CCC=C(C)C)C(O)=C1OC NPCOQXAVBJJZBQ-UHFFFAOYSA-N 0.000 description 1
- 230000002829 reductive effect Effects 0.000 description 1
- 210000005227 renal system Anatomy 0.000 description 1
- 210000005084 renal tissue Anatomy 0.000 description 1
- 238000004153 renaturation Methods 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 208000037803 restenosis Diseases 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- PYWVYCXTNDRMGF-UHFFFAOYSA-N rhodamine B Chemical compound [Cl-].C=12C=CC(=[N+](CC)CC)C=C2OC2=CC(N(CC)CC)=CC=C2C=1C1=CC=CC=C1C(O)=O PYWVYCXTNDRMGF-UHFFFAOYSA-N 0.000 description 1
- 210000003935 rough endoplasmic reticulum Anatomy 0.000 description 1
- 210000003296 saliva Anatomy 0.000 description 1
- 235000019515 salmon Nutrition 0.000 description 1
- 231100000241 scar Toxicity 0.000 description 1
- 230000037390 scarring Effects 0.000 description 1
- 239000006152 selective media Substances 0.000 description 1
- 238000000926 separation method Methods 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 238000007390 skin biopsy Methods 0.000 description 1
- URGAHOPLAPQHLN-UHFFFAOYSA-N sodium aluminosilicate Chemical compound [Na+].[Al+3].[O-][Si]([O-])=O.[O-][Si]([O-])=O URGAHOPLAPQHLN-UHFFFAOYSA-N 0.000 description 1
- 239000001509 sodium citrate Substances 0.000 description 1
- 238000010532 solid phase synthesis reaction Methods 0.000 description 1
- 238000001228 spectrum Methods 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 210000000130 stem cell Anatomy 0.000 description 1
- 238000012799 strong cation exchange Methods 0.000 description 1
- 238000012916 structural analysis Methods 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 229910052717 sulfur Inorganic materials 0.000 description 1
- 239000011593 sulfur Substances 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 230000008093 supporting effect Effects 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 208000024891 symptom Diseases 0.000 description 1
- 210000001179 synovial fluid Anatomy 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 230000002123 temporal effect Effects 0.000 description 1
- 229960003604 testosterone Drugs 0.000 description 1
- 229930101283 tetracycline Natural products 0.000 description 1
- 229960002180 tetracycline Drugs 0.000 description 1
- 235000019364 tetracycline Nutrition 0.000 description 1
- 150000003522 tetracyclines Chemical class 0.000 description 1
- 229940126585 therapeutic drug Drugs 0.000 description 1
- 230000036964 tight binding Effects 0.000 description 1
- 230000017423 tissue regeneration Effects 0.000 description 1
- 238000011200 topical administration Methods 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 231100000419 toxicity Toxicity 0.000 description 1
- 230000001988 toxicity Effects 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- HRXKRNGNAMMEHJ-UHFFFAOYSA-K trisodium citrate Chemical compound [Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O HRXKRNGNAMMEHJ-UHFFFAOYSA-K 0.000 description 1
- 229940038773 trisodium citrate Drugs 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- 230000005747 tumor angiogenesis Effects 0.000 description 1
- 210000004881 tumor cell Anatomy 0.000 description 1
- 230000005740 tumor formation Effects 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 102000003298 tumor necrosis factor receptor Human genes 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 229940035936 ubiquinone Drugs 0.000 description 1
- 210000003606 umbilical vein Anatomy 0.000 description 1
- 230000009452 underexpressoin Effects 0.000 description 1
- 238000011144 upstream manufacturing Methods 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 210000004509 vascular smooth muscle cell Anatomy 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 1
- 210000005253 yeast cell Anatomy 0.000 description 1
Images
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/50—Fibroblast growth factor [FGF]
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/14—Drugs for disorders of the nervous system for treating abnormal movements, e.g. chorea, dyskinesia
- A61P25/16—Anti-Parkinson drugs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P25/00—Drugs for disorders of the nervous system
- A61P25/28—Drugs for disorders of the nervous system for treating neurodegenerative disorders of the central nervous system, e.g. nootropic agents, cognition enhancers, drugs for treating Alzheimer's disease or other forms of dementia
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K48/00—Medicinal preparations containing genetic material which is inserted into cells of the living body to treat genetic diseases; Gene therapy
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12N—MICROORGANISMS OR ENZYMES; COMPOSITIONS THEREOF; PROPAGATING, PRESERVING, OR MAINTAINING MICROORGANISMS; MUTATION OR GENETIC ENGINEERING; CULTURE MEDIA
- C12N2799/00—Uses of viruses
- C12N2799/02—Uses of viruses as vector
- C12N2799/021—Uses of viruses as vector for the expression of a heterologous nucleic acid
- C12N2799/026—Uses of viruses as vector for the expression of a heterologous nucleic acid where the vector is derived from a baculovirus
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10—TECHNICAL SUBJECTS COVERED BY FORMER USPC
- Y10S—TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y10S530/00—Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof
- Y10S530/866—Chemistry: natural resins or derivatives; peptides or proteins; lignins or reaction products thereof involving immunoglobulin or antibody fragment, e.g. fab', fab, fv, fc, heavy chain or light chain
Definitions
- This invention relates to newly identified polynucleotides, polypeptides encoded by such polynucleotides, the use of such polynucleotides and polypeptides, as well as the production of such polynucleotides and polypeptides. More particularly, the polypeptide of the present invention have been putatively identified as fibroblast growth factor/heparin binding growth factor, hereinafter referred to as Fibroblast Growth Factor-13 (hereafter, “FGF-13”). The invention also relates to inhibiting the action of such polypeptides.
- FGF-13 Fibroblast Growth Factor-13
- Fibroblast growth factors are a family of proteins characteristic of binding to heparin and are, therefore, also called heparin binding growth factors (HBGF). Expression of different members of these proteins are found in various tissues and are under particular temporal and spatial control. These proteins are potent mitogens for a variety of—cells of mesodermal, ectodermal, and endodennal origin, including fibroblasts, corneal and vascular endothelial cells, granulocytes, adrenal cortical cells, chondrocytes, myoblasts, vascular smooth muscle cells, lens epithelial cells, melanocytes, keratinocytes, oligodendrocytes, astrocytes, osteoblasts, and hematopoietic cells.
- HBGF heparin binding growth factors
- FGF-1 and 2 are chemotactic for endothelial cells and FGF-2 has been shown to enable endothelial cells to penetrate the basement membrane. Consistent with these properties, both FGF-1 and 2 have the capacity to stimulate angiogene'sis. Another important feature of these growth factors is their ability to promote wound healing. Many other members of the FGF family share similar activities with FGF-1 and 2 such as promoting angiogenesis and wound healing. Several members of the FGF family have been shown to induce mesoderm formation and to modulate differentiation of neuronal cells, adipocytes and skeletal muscle cells.
- FGF proteins have been implicated in promoting tumorigenesis in carcinomas and sarcomas by promoting tumor vascularization and as transforming proteins when their expression is deregulated.
- the FGF family presently consists of eight structurally-related polypeptides: basic FGF, acidic FGF, int 2, hst 1/k-FGF, FGF-5, FGF-6, keratinocyte growth factor, AIGF (FGF-8); and recently a glia-activating factor has been shown to be a novel heparin-binding growth factor which was purified from the culture supernatant of a human glioma cell line (Miyamoto, M. et al., Mol. and Cell. Biol., 13(7):4251-4259 (1993). The genes for each have been cloned and sequenced.
- FGF-1 and FGF-2 Two of the members, FGF-1 and FGF-2, have been characterized under many names, but most often as acidic and basic fibroblast growth factor, respectively.
- the normal gene products influence the general proliferation capacity of the majority of mesoderm and neuroectoderm-derived cells. They are capable of inducing angiogenesis in vivo and may play important roles in early development (Burgess, W. H. and Maciag, T., Ann. Rev. Biochem., 58:575-606 (1989)).
- a eukaryotic expression vector encoding a secreted form of FGF-1 has been introduced by gene transfer into porcine arteries. This model defines gene function in the arterial wall in vivo. FGF-1 expression induced intimal thickening in porcine arteries 21 days after gene transfer (Nabel, E. G., et al., Nature, 362:844-6 (1993)). It has further been demonstrated that basic fibroblast growth factor may regulate glioma growth and progression independent of its role in tumor angiogenesis and that basic fibroblast growth factor release or secretion may be required for these actions (Morrison, R. S., et al., J. Neurosci. Res. 34:502-509 (1993)).
- Fibroblast growth factors such as basic FGF
- basic FGF have further been implicated in the growth of Kaposi's sarcoma cells in vitro (Huang, Y. Q., et al., J. Clin. Invest 91:1191-1197 (1993)).
- the cDNA sequence encoding human basic fibroblast growth factor has been cloned downstream of a transcription promoter recognized by the bacteriophage T7 RNA polymerase.
- Basic fibroblast growth factors so obtained have been shown to have biological activity indistinguishable from human placental fibroblast growth factor in mitogenicity, synthesis of plasminogen activator and angiogenesis assays (Squires, C. H., et al., J. Biol. Chem. 263:16297-16302 (1988)).
- U.S. Pat. No. 5,155,214 discloses substantially pure mammalian basic fibroblast growth factors and their production.
- the amino acid sequences of bovine and human basic fibroblast growth factor are disclosed, as well as the DNA sequence encoding the polypeptide of the bovine species.
- FGF-9 has around 30% sequence similarity to other members of the FGF family. Two cysteine residues and other consensus sequences in family members were also well conserved in the FGF-9 sequence. FGF-9 was found to have no typical signal sequence in its N terminus like those in acidic and basic FGF. However, FGF-9 was found to be secreted from cells after synthesis despite its lack of a typical signal sequence FGF (Miyamoto, M. et al., Mol. and Cell. Biol. 13(7):4251-4259 (1993).
- FGF-9 was found to stimulate the cell growth of oligodendrocyte type 2 astrocyte progenitor cells, BALB/c 3T3, and PC-12 cells but not that of human umbilical vein endothelial cells (Naruo, K., et al., J. Biol. Chem. 268:2857-2864 (1993).
- Basic FGF and acidic FGF are potent modulators of cell proliferation, cell motility, differentiation, and survival and act on cell types from ectoderm, mesoderm and endoderm. These two FGFs, along with KGF and AIGF, were identified by protein purification. However, the other four members were isolated as oncogenes, expression of which was restricted to embryogenesis and certain types of cancers. FGF-9 was demonstrated to be a mitogen against glial cells. Members of the FGF family are reported to have oncogenic potency. FGF-9 has shown transforming potency when transformed into BALB/c 3T3 cells (Miyamoto, M., et al., Mol. Cell. Biol. 13(7):4251-4259 (1993).
- AIGF Androgen induced growth factor
- SC-3 mouse mammary carcinoma cells
- AIGF is a distinctive FGF-like growth factor, having a putative signal peptide and sharing 30-40% homology with known members of the FGF family.
- Mammalian cells transformed with AIGF shows a remarkable stimulatory effect on the growth of SC-3 cells in the absence of androgen. Therefore, AIGF mediates androgen-induced growth of SC-3 cells, and perhaps other cells, since it is secreted by the tumor cells themselves.
- polypeptide of the present invention has been putatively identified as a member of the FGF family as a result of amino acid sequence homology with other members of the FGF family.
- novel mature polypeptides as well as biologically active and diagnostically or therapeutically useful fragments, analogs and derivatives thereof.
- the polypeptides of the present invention are of human origin.
- nucleic acid molecules encoding the polypeptides of the present invention, including mRNAs, DNAs, cDNAs, genomic DNA, as well as antisense analogs thereof and biologically active and diagnostically or therapeutically useful fragments thereof.
- the present invention provides isolated nucleic acid molecules comprising a polynucleotide encoding at least a portion of the FGF-13 polypeptide having the complete amino acid sequence shown in SEQ ID NO:2 or the complete amino acid sequence encoded by the cDNA clone deposited as plasmid DNA in a bacterial host as ATCCTM Deposit Number 97148 on May 12, 1995.
- the nucleotide sequence determined by sequencing the deposited FGF-13 clone which is shown in FIGS. 1 A-D (SEQ ID NO:1), contains an open reading frame encoding a complete polypeptide of 216 amino acid residues, including an initiation codon encoding an N-terminal methionine at nucleotide positions 1 to 3.
- Nucleic acid molecules of the invention include those encoding the complete amino acid sequence excepting the N-terminal methionine shown in SEQ ID NO:2, or the complete amino acid sequence excepting the N-terminal methionine encoded by the cDNA clone in ATCCTM Deposit Number 97148, which molecules also can encode additional amino acids fused to the N-terminus of the FGF-13 amino acid sequence.
- one aspect of the invention provides an isolated nucleic acid molecule comprising a polynucleotide comprising a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding the FGF-13 polypeptide having the complete amino acid sequence in SEQ ID NO:2 excepting the N-terminal methionine (i.e., positions ⁇ 22 to 193 of SEQ ID NO:2); (b) a nucleotide sequence encoding the predicted mature FGF-13 polypeptide having the amino acid sequence from about position 1 to about position 193 in SEQ ID NO:2; (c) a nucleotide sequence encoding the FGF-13 polypeptide having the complete amino acid sequence encoded by the cDNA clone contained in ATCCTM Deposit No.
- nucleic acid molecules that comprise a polynucleotide having a nucleotide sequence at least 90% identical, and more preferably at least 95%, 96%, 97%, 98% or 99% identical, to any of the nucleotide sequences in (a), (b), (c), (d) or (e), above, or a polynucleotide which hybridizes under stringent hybridization conditions to a polynucleotide in (a), (b), (c), (d) or (e), above.
- This polynucleotide which hybridizes does not hybridize under stringent hybridization conditions to a polynucleotide having a nucleotide sequence consisting of only A residues or of only T residues.
- An additional nucleic acid embodiment of the invention relates to an isolated nucleic acid molecule comprising a polynucleotide which encodes the amino acid sequence of an epitope-bearing portion of an FGF-13 polypeptide having an amino acid sequence in (a), (b), (c) or (d), above.
- processes for producing such polypeptides by recombinant techniques through the use of recombinant vectors, such as cloning and expression plasmids useful as reagents in the recombinant production of the polypeptides of the present invention, as well as recombinant prokaryotic and/or eukaryotic host cells comprising a nucleic acid sequence encoding a polypeptide of the present invention.
- recombinant vectors such as cloning and expression plasmids useful as reagents in the recombinant production of the polypeptides of the present invention, as well as recombinant prokaryotic and/or eukaryotic host cells comprising a nucleic acid sequence encoding a polypeptide of the present invention.
- antagonists against such polypeptides and processes for their use to inhibit the action of such polypeptides, for example, in the treatment of cellular transformation, for example, tumors, to reduce scarring and treat hyper-vascular diseases.
- nucleic acid probes comprising nucleic acid molecules of sufficient length to specifically hybridize to a polynucleotide encoding a polypeptide of the present invention.
- the invention provides an isolated antibody that binds specifically to an FGF-13 polypeptide having an amino acid sequence described in (a), (b), (c) or (d) above.
- the invention further provides methods for isolating antibodies that bind specifically to an FGF-13 polypeptide having an amino acid sequence as described herein. Such antibodies are useful diagnostically or therapeutically as described below.
- diagnostic assays for detecting diseases or susceptibility to diseases related to mutations in a nucleic acid sequence of the present invention and for detecting over-expression or under-expression of the polypeptides encoded by such sequences.
- the invention also provides pharmaceutical compositions comprising FGF-13 polypeptides, particularly human FGF-13 polypeptides. Methods of treating individuals in need of FGF-13 polypeptides are also provided.
- the invention further provides compositions comprising an FGF-13 polynucleotide or an FGF-13 polypeptide for administration to cells in vitro, to cells ex vivo and to cells in vivo, or to a multicellular organism.
- compositions comprise an FGF-13 polynucleotide for expression of an FGF-13 polypeptide in a host organism for treatment of disease.
- FGF-13 polynucleotide for expression of an FGF-13 polypeptide in a host organism for treatment of disease.
- expression in a human patient for treatment of a dysfunction associated with aberrant endogenous activity of an FGF-13 gene is particularly preferred.
- FIGS. 1 A-D depicts the nucleotide sequence (SEQ ID NO:1) of the human mRNA encoding FGF-13 and the deduced amino acid sequence (SEQ ID NO:2) of the FGF-13 polypeptide.
- the putative leader sequence of about 23 amino acids is underlined. Note that the methionine residue at the beginning of the leader sequence in FIGS. 1 A-D is shown in position number (positive) 1, whereas the leader positions in the corresponding sequence of SEQ ID NO:2 are designated with negative position numbers.
- the leader sequence positions 1 to 23 in FIGS. 1 A-D correspond to positions ⁇ 23 to ⁇ 1 in SEQ ID NO:2.
- FIG. 2 shows an alignment of the regions of identity among the amino acid sequences of the human FGF-13 protein and the amino acid sequences of the following human proteins: acidic FGF (SEQ ID NO:3), basic FGF (SEQ ID NO:4), Int-2 (SEQ ID NO:5), FGF-4 (SEQ ID NO:6), FGF-5 (SEQ ID NO:7), FGF-6 (SEQ ID NO:8), Keratinocyte Growth Factor (KGF) (SEQ ID NO:9), and AIGF (FGF-8) (SEQ ID NO:10), as determined by the “Megalign” routine of the DNAStar program.
- acidic FGF SEQ ID NO:3
- basic FGF SEQ ID NO:4
- Int-2 SEQ ID NO:5
- FGF-4 SEQ ID NO:6
- FGF-5 SEQ ID NO:7
- FGF-6 SEQ ID NO:8
- Keratinocyte Growth Factor Keratinocyte Growth Factor
- AIGF FGF-8
- FIG. 3 shows an analysis of the FGF-13 amino acid sequence.
- Alpha, beta, turn and coil regions; hydrophilicity and hydrophobicity; amphipathic regions; flexible regions; antigenic index and surface probability are shown.
- “Antigenic Index—Jameson-Wolf” graph the indicate location of the highly antigenic regions of the FGF-13 protein, i.e., regions from which epitope-bearing peptides of the invention may be obtained.
- FIG. 4 FGF-13 treatment increases the number of cells in embryonic cortical cultures.
- the cells derived from gestation day 17 embryos, were plated in polylysine/laminin coated wells at a density of 354 cells/mm 2 .
- the cultures were maintained in serum-free medium and treated every other day with the indicated concentrations of FGFs.
- the cell number was estimated by labeling the cultures with Calcein AM and monitoring the level of fluorescence emission at 530 nm.
- FIG. 5 The increase in high-affinity neuronal specific GABA-uptake induced by FGF-13 is enhanced by heparin.
- the heparin and FGF-13 were pre-incubated for approximately 30 min prior to addition to the cultures.
- FIG. 6 FGF-13 treatment enhances neurite outgrowth of cortical neurons.
- FIG. 7 FGF-13 induces the proliferation of rat hippocampal astrocytes.
- FIG. 11 Effect of FGF-2 and FGF-13 on release of PGE 2 from human lung fibroblasts.
- FGF-2 and FGF-13 are the bars that represent: medium alone; bFGF (FGF-2) (100 ng/ml); indomethicin (100 ng/ml); FGF-13 (100 ng/ml); FGF-13 (1000 ng/ml); FGF-12 (2500 ng/ml)).
- FIG. 12 Effects of FGF-2 and FGF-13 on release of IL-6 from human lung fibroblasts.
- FGF-2 and FGF-13 are the bars that represent: medium alone; bFGF (FGF-2) (100 ng/ml); indomethicin (100 ng/ml); FGF-13 (100 ng/ml); FGF-13 (1000 ng/ml); FGF-12 (2500 ng/ml)).
- FIG. 13 shows mitogenic activity of FGF13 on BaF3 cells expressing FGF receptors (FGFR) 1c, 2c, 3c, and 4 measured by thymidine incorporation.
- BaF3 cells expressing FGF receptors were incubated with FGF-13 up to concentration of 62.5 nM (X axis). aFGF at the same concentration range was used as a positive control.
- the Y axis represents the amount of 3 H thymidine incorporated into DNA of BaF3 cells as a percentage of the maximum cpm incorporated following FGF1 stimulation.
- FIG. 14 shows the tyrosine hydroxylase stimulatory activity of FGF13 on cultured dopaminergic neurons from the midbrain floor dissected from E14 Wistar rat embryos, dissociated with trypsin and seeded at a density of 200,000 cells per square centimeter. Tyrosine hydroxylase positive neurons increased after FGF-13 administration.
- the control was basic FGF, other fibroblase growth factors include FGR-2, FGF-9, and FGF-10.
- the present invention provides isolated nucleic acid molecules comprising a polynucleotide encoding an FGF-13 polypeptide having the amino acid sequence shown in SEQ ID NO:2, which was determined by sequencing cloned cDNAs.
- the nucleotide sequence shown in positions 11-1212 of SEQ ID NO:1 was obtained by sequencing the HODAH63 clone, which was deposited on May 12, 1995 at the American Type Culture Collection, 10801 University Boulevard, Manassas, Va. 20110-2209, and given accession number ATCCTM 97148.
- the deposited clone is contained in the pBluescript SK( ⁇ ) plasmid (Stratagene, La Jolla, Calif.).
- the nucleotide sequence shown in positions 1-10 of SEQ ID NO:1 was obtained by sequencing the product of a PCR amplification of a cDNA library containing a mixture of human cDNAs.
- the FGF-13 polypeptide is structurally related to all members of the fibroblast growth. factor family and contains an open reading frame encoding a ‘polypeptide of 216 amino acids (SEQ ID NO:2) of which the first 25 amino acids represent a putative leader sequence such that the mature polypeptide comprises 193 amino acids.
- SEQ ID NO:2 a polypeptide of 216 amino acids
- GXLX(S, T, A, G)X6(D, E)CKFXE is conserved in the polypeptide of the present invention (X means any amino acid residue; (D, E) means either D or E residue; X6 means any 6 amino acid residues).
- nucleotide sequences determined by sequencing a DNA molecule herein were determined using an automated DNA sequencer (such as the Model 373 from Applied Biosystems, Inc., Foster City, Calif.), and all amino acid sequences of polypeptides encoded by DNA molecules determined herein were predicted by translation of a DNA sequence determined as above. Therefore, as is known in the art for any DNA sequence determined by this automated approach, any nucleotide sequence determined herein may contain some errors. Nucleotide sequences determined by automation are typically at least about 90% identical, more typically at least about 95% to at least about 99.9% identical to the actual nucleotide sequence of the sequenced DNA molecule. The actual sequence can be more precisely determined by other approaches including manual DNA sequencing methods well known in the art.
- a single insertion or deletion in a determined nucleotide sequence compared to the actual sequence will cause a frame shift in translation of the nucleotide sequence such that the predicted amino acid sequence encoded by a determined nucleotide sequence will be completely different from the amino acid sequence actually encoded by the sequenced DNA molecule, beginning at the point of such an insertion or deletion.
- nucleotide sequence of a nucleic acid molecule or polynucleotide is intended, for a DNA molecule or polynucleotide, a sequence of deoxyribonucleotides, and for an RNA molecule or polynucleotide, the corresponding sequence of ribonucleotides (A, G, C and U), where each thymidine deoxyribonucleotide (T) in the specified deoxyribonucleotide sequence is replaced by the ribonucleotide uridine (U).
- a nucleic acid molecule of the present invention encoding an FGF-13 polypeptide may be obtained using standard cloning and screening procedures, such as those for cloning cDNAs using mRNA as starting material.
- standard cloning and screening procedures such as those for cloning cDNAs using mRNA as starting material.
- the nucleic acid molecule described in FIGS. 1 A-D was discovered in a cDNA library derived from human ovarian cancer tissue.
- nucleic acids of the invention are useful as hybridization probes for differential identification of the tissue(s) or cell type(s) present in a biological sample.
- polypeptides and antibodies directed to those polypeptides are useful to provide immunological probes for differential identification of tissue(s) or cell type(s).
- the determined nucleotide sequence of the FGF-13 cDNA of FIGS. 1 A-D contains an open reading frame encoding a protein of 216 amino acid residues, with an initiation codon at nucleotide positions 1 to 3 of the nucleotide sequence in FIGS. 1 A-D (SEQ ID NO:1).
- the FGF-13 polypeptide encoded by the deposited cDNA actually comprises about the 212 amino acids at the C-terminal end of the sequence in SEQ ID NO:2, with the remaining N-terminal sequences in FIGS.
- the actual FGF-13 polypeptide encoded by the deposited cDNA which comprises about 212 amino acids at the C-terminal end of the sequence in SEQ ID NO:2, may be somewhat longer or shorter than the determined sequence. More generally, the actual open reading frame may be anywhere in the range of ⁇ 20 amino acids, more likely in the range of ⁇ 10 amino acids, of that predicted from the N-terminus shown in FIGS. 1 A-D (SEQ ID NO:1).
- the amino acid sequence of the complete FGF-13 protein includes a leader sequence and a mature protein; as shown in SEQ ID NO:2. More in particular, the present invention provides nucleic acid molecules encoding a mature form of the FGF-13 protein.
- proteins secreted by mammalian cells have a signal or secretory leader sequence which is cleaved from the complete polypeptide to produce a secreted “mature” form of the protein. Most mammalian cells and even insect cells cleave secreted proteins with the same specificity.
- cleavage of a secreted protein is not entirely uniform, which results in two or more mature species of the protein. Further, it has long been known that the cleavage specificity of a secreted protein is ultimately determined by the primary structure of the complete protein, that is, it is inherent in the amino acid sequence of the polypeptide.
- the present invention provides a nucleotide sequence encoding the mature FGF-13 polypeptide having the amino acid sequence encoded by the cDNA clone contained in the host identified as ATCCTM Deposit No. 97148.
- 97148 is meant the mature form(s) of the FGF-13 protein produced by expression in a mammalian cell (e.g., COS cells, as described below) by a DNA encoding the complete FGF-13 coding sequence encoded by the human DNA sequence of the clone contained in the vector in the deposited host, when that human DNA sequence is operably linked to appropriate regulatory sequences for translation of the FGF-13 coding sequence including an initiation codon.
- a mammalian cell e.g., COS cells, as described below
- the deduced amino acid sequence of the complete FGF-13 polypeptide was analyzed by alignment with the known amino acid sequence of human FGF-8 (see FIG. 2 ), thereby predicting a secretory leader cleavage site at the homologous location within the complete amino acid sequence shown in SEQ ID NO:2, between residues ⁇ 1 and +1.
- nucleic acid molecules of the present invention may be in the form of RNA, such as mRNA, or in the form of DNA, including, for instance, cDNA and genomic DNA obtained by cloning or produced synthetically.
- the DNA may be double-stranded or single-stranded.
- Single-stranded DNA or RNA may be the coding strand, also known as the sense strand, or it may be the non-coding strand, also referred to as the anti-sense strand.
- isolated nucleic acid molecule(s) is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment
- recombinant DNA molecules contained in a vector are considered isolated for the purposes of the present invention.
- Further examples of isolated DNA molecules include recombinant DNA molecules maintained in heterologous host cells or purified (partially or substantially) DNA molecules in solution.
- Isolated RNA molecules include in vivo or in vitro RNA transcripts of the DNA molecules of the present invention. Isolated nucleic acid molecules according to the present invention further include such molecules produced synthetically.
- Isolated nucleic acid molecules of the present invention include DNA molecules comprising an open reading frame (ORF) with or without an initiation codon at positions 1 to 3 of the nucleotide sequence shown in FIGS. 1 A-D (SEQ ID NO:1). Also included are DNA molecules comprising the coding sequence for the predicted mature FGF-13 protein shown at positions 1 to 193 of SEQ ID NO:2.
- isolated nucleic acid molecules of the invention include DNA molecules which comprise a sequence substantially different from those described above but which, due to the degeneracy of the genetic code, still encode an FGF-13 protein.
- the genetic code and species-specific codon preferences are well known in the art.
- the invention provides isolated nucleic acid molecules encoding the FGF-13 polypeptide having an amino acid sequence encoded by the cDNA clone contained in the plasmid deposited as ATCCTM Deposit No. 97148 on May 12, 1995.
- this nucleic acid molecule will encode the mature polypeptide encoded by the above-described deposited cDNA clone.
- the invention further provides an isolated nucleic acid molecule having the nucleotide sequence shown in FIGS. 1 A-D (SEQ ID NO:1) or the nucleotide sequence of the FGF-13 cDNA contained in the above-described deposited clone, or a nucleic acid molecule having a sequence complementary to one of the above sequences.
- isolated molecules particularly DNA molecules, are useful as probes for gene mapping, by in situ hybridization with chromosomes, and for detecting expression of the FGF-13 gene in human tissue, for instance, by Northern blot analysis.
- the present invention is further directed to nucleic acid molecules encoding portions of the nucleotide sequences described herein as well as to fragments of the isolated nucleic acid molecules described herein.
- the invention provides a polynucleotide having a nucleotide sequence representing the portion of SEQ ID NO: 1 which consists of positions 1 to 648 of SEQ ID NO:1.
- the invention includes a polynucleotide comprising any portion of at least about 30 nucleotides, preferably at least about 50 nucleotides, of SEQ ID NO:1 from residue 1 to 648. More generally, by a fragment of an isolated nucleic acid molecule having the nucleotide sequence of the deposited cDNA or the nucleotide sequence shown in FIGS. 1 A-D (SEQ ID NO:1) is intended fragments at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt in length which are useful as diagnostic probes and primers as discussed herein.
- fragments 50-300 nt in length are also useful according to the present invention as are fragments corresponding to most, if not all, of the nucleotide sequence of the deposited cDNA or as shown in FIGS. 1 A-D (SEQ ID NO:1).
- a fragment at least 20 nt in length for example, is intended fragments which include 20 or more contiguous bases from the nucleotide sequence of the deposited cDNA or the nucleotide sequence as shown in FIGS. 1 A-D (SEQ ID NO:1).
- Preferred nucleic acid fragments of the present invention include nucleic acid molecules encoding epitope-bearing portions of the FGF-13 polypeptide as identified in FIG. 3 and described in more detail below.
- the invention provides an isolated nucleic acid molecule comprising a polynucleotide which hybridizes under stringent hybridization conditions to a portion of the polynucleotide in a nucleic acid molecule of the invention described above, for instance, the cDNA clone contained in ATCCTM Deposit No. 97148.
- stringent hybridization conditions is intended overnight incubation at 42° C.
- a polynucleotide which hybridizes to a “portion” of a polynucleotide is intended a polynucleotide (either DNA or RNA) hybridizing to at least about 15 nucleotides (nt), and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably about 30-70 (e.g., 50) nt of the reference polynucleotide. These are useful as diagnostic probes and primers as discussed above and in more detail below.
- a portion of a polynucleotide of “at least 20 nt in length,” for example, is intended 20 or more contiguous nucleotides from the nucleotide sequence of the reference polynucleotide (e.g., the deposited cDNA or the nucleotide sequence as shown in FIGS. 1 A-D (SEQ ID NO:1)).
- a polynucleotide which hybridizes only to a poly A sequence such as the 3′ terminal poly(A) tract of the FGF-13 cDNA shown in FIGS.
- nucleic acid molecules of the present invention which encode an FGF-13 polypeptide may include, but are not limited to those encoding the amino acid sequence of the mature polypeptide, by itself; and the coding sequence for the mature polypeptide and additional sequences, such as those encoding the about 25 amino acid leader or secretory sequence, such as a pre-, or pro- or prepro-protein sequence; the coding sequence of the mature polypeptide, with or without the aforementioned additional coding sequences.
- nucleic acids of the invention are the above protein sequences together with additional, non-coding sequences, including for example, but not limited to introns and non-coding 5′ and 3′ sequences, such as the transcribed, non-translated sequences that play a role.
- additional, non-coding sequences including for example, but not limited to introns and non-coding 5′ and 3′ sequences, such as the transcribed, non-translated sequences that play a role.
- additional coding sequence which codes for additional amino acids, such as those which provide additional functionalities.
- the sequence encoding the polypeptide may be fused to a marker sequence, such as a sequence encoding a peptide which facilitates purification of the fused polypeptide.
- the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311), among others, many of which are commercially available.
- hexa-histidine provides for convenient purification of the fusion protein.
- the “HA” tag is another peptide useful for purification which corresponds to an epitope derived from the influenza hemagglutinin protein, which has been described by Wilson et al., Cell 37: 767 (1984).
- other such fusion proteins include the FGF-13 fused to Fc at the N- or C-terminus.
- the present invention further relates to variants of the nucleic acid molecules of the present invention, which encode portions, analogs or derivatives of the FGF-13 protein.
- Variants may occur naturally, such as a natural allelic variant.
- allelic variant is intended one of several alternate forms of a gene occupying a given locus on a chromosome of an organism. Genes II, Lewin, B.; ed., John Wiley & Sons, New York (1985). Non-naturally occurring variants may be produced using art-known mutagenesis techniques.
- variants include those produced by nucleotide substitutions, deletions or additions.
- the substitutions, deletions or additions may involve one or more nucleotides.
- the variants may be altered in coding regions, non-coding regions, or both. Alterations in the coding regions may produce conservative or non-conservative amino acid substitutions, deletions or additions. Especially preferred among these are silent substitutions, additions and deletions, which do not alter the properties and activities of the FGF-13 protein or portions thereof. Also especially preferred in this regard are conservative substitutions.
- nucleic acid molecules encoding the mature protein having the amino acid sequence shown in SEQ ID NO:2 or the mature FGF-13 amino acid sequence encoded by the deposited cDNA clone.
- inventions include an isolated nucleic acid molecule comprising a polynucleotide having a nucleotide sequence at least 90% identical, and more preferably at least 95%, 96%, 97%, 98% or 99% identical to a polynucleotide selected from the group consisting of: (a) a nucleotide sequence encoding the FGF-13 polypeptide having the complete.
- polynucleotide having a nucleotide sequence at least, for example, 95% “identical” to a reference nucleotide sequence encoding an FGF-13 polypeptide is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence encoding the FGF-13 polypeptide.
- a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence.
- These mutations of the reference sequence may occur at the 5′ or 3′ terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.
- nucleic acid molecule is at least 90%, 95%, 96%, 97%, 98% or 99% identical to, for instance, the nucleotide sequence shown in FIGS. 1 A-D or to the nucleotides sequence of the deposited cDNA clone can be determined conventionally using known computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711).
- Bestfit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981), to find the best segment of homology between two sequences.
- the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
- the present application is directed to nucleic acid molecules at least 90%, 95%, 96%, 97%, 98% or 99% identical to the nucleic acid sequence shown in FIGS. 1 A-D (SEQ ID NO:1) or to the nucleic acid sequence of the deposited cDNA, irrespective of whether they encode a polypeptide having FGF-13 activity. This is because even where a particular nucleic acid molecule does not encode a polypeptide having FGF-13 activity, one of skill in the art would still know how to use the nucleic acid molecule, for instance, as a hybridization probe or a polymerase chain reaction (PCR) primer.
- PCR polymerase chain reaction
- nucleic acid molecules of the present invention that do not encode a polypeptide having FGF-13 activity include, inter alia, (1) isolating the FGF-13 gene or allelic variants thereof in a cDNA library; (2) in situ hybridization (e.g., “FISH”) to metaphase chromosomal spreads to provide precise chromosomal location of the FGF-13 gene, as described in Verma et al., Human Chromosomes: A Manual of Basic Techniques , Pergamon Press, New York (1988); and Northern blot analysis for detecting FGF-13 mRNA expression in specific tissues.
- FISH in situ hybridization
- nucleic acid molecules having sequences at least 90%, 95%, 96%, 97%, 98% or 99% identical to the nucleic acid sequence shown in FIGS. 1 A-D (SEQ ID NO:1) or to the nucleic acid sequence of the deposited cDNA which do, in fact, encode a polypeptide having FGF-13 protein activity.
- a polypeptide having FGF-13 activity is intended polypeptides exhibiting activity similar, but not necessarily identical, to an activity of the mature FGF-13 protein of the invention, as measured in a particular biological assay.
- the FGF-13 protein of the present invention stimulates proliferations of various mammalian cells, particularly fibroblasts, as described further below.
- a polypeptide having FGF-13 protein activity includes polypeptides that also exhibit any of the same activities in the below-described assays in a dose-dependent manner.
- the degree of dose-dependent activity need not be identical to that of the FGF-13 protein, preferably, “a polypeptide having FGF-13 protein activity” will exhibit substantially similar dose-dependence in a given activity as compared to the FGF-13 protein (i.e., the candidate polypeptide will exhibit greater activity or not more than about 25-fold less and, preferably, not more than about tenfold less activity relative to the reference FGF-13 protein).
- nucleic acid molecules having a sequence at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence of the deposited cDNA or the nucleic acid sequence shown in FIGS. 1 A-D will encode a polypeptide “having FGF-13 protein activity.”
- degenerate variants of these nucleotide sequences all encode the same polypeptide, this will be clear to the skilled artisan even without performing the above-described comparison assay.
- nucleic acid molecules that are not degenerate variants, a reasonable number will also encode a polypeptide having FGF-13 protein activity. This is because the skilled artisan is fully aware of amino acid substitutions that are either less likely or not likely to significantly effect protein function (e.g., replacing one aliphatic amino acid with a second aliphatic amino acid), as further described below.
- the present invention also relates to vectors which include the isolated DNA molecules of the present invention, host cells which are genetically engineered with the recombinant vectors, and the production of FGF-13 polypeptides or fragments thereof by recombinant techniques.
- the vector may be, for example, a phage, plasmid, viral or retroviral vector.
- Retroviral vectors may be replication competent or replication defective. In the latter case, viral propagation generally will occur only in complementing host cells.
- the polynucleotides may be joined to a vector containing a selectable marker for propagation in a host.
- a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. If the vector is a virus, it may be packaged in vitro using an appropriate packaging cell line and then transduced into host cells.
- the DNA insert should be operatively linked to an appropriate promoter, such as the phage lambda PL promoter, the E. coli lac, trp, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few. Other suitable promoters will be known to the skilled artisan.
- the expression constructs will further contain sites for transcription initiation, termination and, in the transcribed region, a ribosome binding site for translation.
- the coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated.
- the expression vectors will preferably include at least one selectable marker.
- markers include dihydrofolate reductase, G418 or neomycin resistance for eukaryotic cell culture and tetracycline, kanamycin or ampicillin resistance genes for culturing in E. coli and other bacteria.
- Representative examples of appropriate hosts include, but are not limited to, bacterial cells, such as E. coli, Streptomyces and Salmonella typhimurium cells; fungal cells, such as yeast cells; insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, 293 and Bowes melanoma cells; and plant cells. Appropriate culture mediums and conditions for the above-described host cells are known in the art.
- vectors preferred for use in bacteria include pQE70, pQE60 and pQE-9, available from QIAGEN, Inc., supra; pBS vectors, Phagescript vectors, Bluescript vectors, pNH8A, pNH16a, pNH18A, pNH46A, available from Stratagene; and ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 available from Pharmacia.
- preferred eukaryotic vectors are pWLNEO, pSV2CAT, pOG44, pXT1 and pSG available from Stratagene; and pSVK3, pBPV, pMSG and pSVL available from Pharmacia.
- Other suitable vectors will be readily apparent to the skilled artisan.
- Introduction of the construct into the host cell can be effected by calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection or other methods. Such methods are described in many standard laboratory manuals, such as Davis et al., Basic Methods In Molecular Biology (1986).
- the polypeptide may be expressed in a modified form, such as a fusion protein, and may include not only secretion signals, but also additional heterologous functional regions. For instance, a region of additional amino acids, particularly charged amino acids, may be added to the N-terminus of the polypeptide to improve stability and persistence in the host cell, during purification, or during subsequent handling and storage. Also, peptide moieties may be added to the polypeptide to facilitate purification. Such regions may be removed prior to final preparation of the polypeptide. The addition of peptide moieties to polypeptides to engender secretion or excretion, to improve stability and to facilitate purification, among others, are familiar and routine techniques in the art.
- a preferred fusion protein comprises a heterologous region from immunoglobulin that is useful to stabilize and purify proteins.
- BP-A-0 464 533 (Canadian counterpart 2045869) discloses fusion proteins comprising various portions of constant region of immunoglobulin molecules together with another human protein or part thereof.
- the Fc part in a fusion protein is thoroughly advantageous for use in therapy and diagnosis and thus results, for example, in improved pharmacokinetic properties (EP-A 0232 262).
- Fc portion proves to be a hindrance to use in therapy and diagnosis, for example when the fusion protein is to be used as antigen for immunizations.
- human proteins such as hIL-5
- Fc portions have been fused with Fc portions for the purpose of high-throughput screening assays to identify antagonists of hIL-5. See, D. Bennett et al., J. Molecular Recognition 8:52-58 (1995) and K. Johanson et al., J. Biol. Chem. 270:9459-9471 (1995).
- the FGF-13 protein can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, high performance liquid chromatography (“HPLC”) is employed for purification.
- HPLC high performance liquid chromatography
- Polypeptides of the present invention include: products purified from natural sources, including bodily fluids, tissues and cells, whether directly isolated or cultured; products of chemical synthetic procedures; and products produced by recombinant techniques from a prokaryotic or eukaryotic host, including, for example, bacterial, yeast, higher plant, insect and mammalian cells. Depending upon the host employed in a recombinant production procedure, the polypeptides of the present invention may be glycosylated or may be non-glycosylated. In addition, polypeptides of the invention may also include an initial modified methionine residue, in some cases as a result of host-mediated processes.
- N-terminal methionine encoded by the translation initiation codon generally is removed with high efficiency from any protein after translation in all eukaryotic cells. While the N-terminal methionine on most proteins also is efficiently removed in most prokaryotes, for some proteins this prokaryotic removal process is inefficient, depending on the nature of the amino acid to which the N-terminal methionine is covalently linked.
- the invention further provides an isolated FGF-13 polypeptide comprising the amino acid sequence encoded by the deposited cDNA, or the amino acid sequence in SEQ ID NO:2, or a peptide or polypeptide comprising a portion of the above polypeptides.
- FGF-13 polypeptides protein engineering may be employed.
- Recombinant DNA technology known to those skilled in the art can be used to create novel mutant proteins or “muteins including single or multiple amino acid substitutions, deletions, additions or fusion proteins.
- Such modified polypeptides can show, e.g., enhanced activity or increased stability.
- they may be purified in higher yields and show better solubility than the corresponding natural polypeptide, at least under certain purification and storage conditions.
- polypeptides having deletions of up to about 10 additional N-terminal residues beyond the predicted leader cleavage point can retain some biological activity such as cell proliferation stimulating or receptor binding activity.
- the present invention further provides polypeptides having one or more residues deleted from the amino terminus of the amino acid sequence of the FGF-13 shown in SEQ ID NO:2, up to the Asparagine at position 10.
- the present invention provides polypeptides comprising the amino acid sequence of residues n-193 of SEQ ID NO:2, where n is an integer other than zero in the range of ⁇ 23 to +10 (excepting zero).
- the invention provides polynucleotides encoding polypeptides having the amino acid sequence of residues of ⁇ 23 to 193, ⁇ 22 to 193, ⁇ 21 to 193, ⁇ 20 to 193, ⁇ 19 to 193, ⁇ 18 to 193, ⁇ 17 to 193, ⁇ 16 to 193, ⁇ 15 to 193, ⁇ 14 to 193, ⁇ 13 to 193, ⁇ 12 to 193, ⁇ 11 to 193, ⁇ 10 to 193, ⁇ 9 to 193, ⁇ 8 to 193, ⁇ 7 to 193, ⁇ 6 to 193, ⁇ 5 to 193, ⁇ 4 to 193, ⁇ 3 to 193, ⁇ 2 to 193, ⁇ 1 to
- interferon gamma shows up to ten times higher activities by deleting 8-10 amino acid residues from the carboxy terminus of the protein (Dobeli et al., J. Biotechnology 7:199-216 (1988).
- deletions of C-terminal amino acids up to the conserved region beginning with the Leucine at position 154 in SEQ ID NO:2 can retain some biological activity such as stimulation of cellular proliferation or receptor binding.
- the present invention further provides polypeptides having one or more residues from the carboxy terminus of the amino acid sequence of the FGF-13 shown in SEQ ID NO:2, up to the Leucine at position 154 of SEQ ID NO:2, and polynucleotides encoding such polypeptides.
- the present invention provides polypeptides having the amino acid sequence of residues ⁇ 22 to m of the amino acid sequence in SEQ ID NO:2, where m is any integer in the range of 154 to 192, and residue 154 is the position of the first residue from the C-terminus of. the complete FGF-13 polypeptide (shown in SEQ ID NO:2) which begins the region highly conserved between FGF-13 and human FGF-8.
- the invention provides polynucleotides encoding polypeptides having the amino acid sequence of residues ⁇ 22 to 154, ⁇ 22 to 155, ⁇ 22 to 156, ⁇ 22 to 157, ⁇ 22 to 158, ⁇ 22 to 159, ⁇ 22 to 160, ⁇ 22 to 161, ⁇ 22 to 162, ⁇ 22 to 163, ⁇ 22 to 164, ⁇ 22 to 165, ⁇ 22 to 166, ⁇ 22 to 167, ⁇ 22 to 168, ⁇ 22 to 169, ⁇ 22 to 170, ⁇ 22 to 171, ⁇ 22 to 172, ⁇ 22 to 173, ⁇ 22 to 174, ⁇ 22 to 175, ⁇ 22 to 176, ⁇ 22 to 177, ⁇ 22 to 178, ⁇ 22 to 179, ⁇ 22 to 180, ⁇ 22 to 181, ⁇ 22 to 182, ⁇ 22 to 183, ⁇ 22 to 184, ⁇ 22 to 185, ⁇ 22 to 186, ⁇ 22 to 180, ⁇
- the invention also provides polypeptides having one or more amino acids deleted from both the amino and the carboxyl termini, which may be described generally as having residues n-m of SEQ ID NO:2, where n and m are integers as described above.
- nucleotide sequence encoding a polypeptide consisting of a portion of the complete FGF-13 amino acid sequence encoded by the cDNA clone contained in ATCCTM Deposit No. 97148, where this. portion excludes from 1 to about 33 amino acids from the amino terminus of the complete amino acid sequence encoded by the cDNA clone contained in ATCCTM Deposit No. 97148, or from 1 to about 39 amino acids from the carboxy terminus, or any combination of the above amino terminal and carboxy terminal deletions, of the complete amino acid sequence encoded by the cDNA clone contained in ATCCTM Deposit No. 97148
- the invention further includes variations of the FGF-13 polypeptide which show substantial FGF-13 polypeptide activity or which include regions of FGF-13 protein such as the protein portions discussed below.
- Such mutants include deletions, insertions, inversions, repeats, and type substitutions selected according to general rules known in the art so as have little effect on activity.
- guidance concerning how to make phenotypically silent amino acid substitutions is provided in Bowie, J. U. et al., “Deciphering the Message in Protein Sequences: Tolerance to Amino Acid Substitutions,” Science 247:1306-1310 (1990), wherein the authors indicate that there are two main approaches for studying the tolerance of an amino acid sequence to change.
- the first method relies on the process of evolution, in which mutations are either accepted or rejected by natural selection.
- the second approach uses genetic engineering to introduce amino acid changes at specific positions of a cloned gene and selections or screens to identify sequences that maintain functionality.
- conservative substitutions are the replacements, one for another, among the aliphatic amino acids Ala, Val, Leu and Ile; interchange of the hydroxyl residues Ser and Thr, exchange of the acidic residues Asp and Glu, substitution between the amide residues Asn and Gln, exchange of the basic residues Lys and Arg and replacements among the aromatic residues Phe, Tyr.
- the fragment, derivative or analog of the polypeptide of SEQ ID NO:2, or that encoded by the deposited cDNA may be (i) one in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code, or (ii) one in which one or more of the amino acid residues includes a substituent group, or (iii) one in which the mature polypeptide is fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol), or (iv) one in which the additional amino acids are fused to the above form of the polypeptide, such as an IgG Fc fusion region peptide or leader or secretory sequence or a sequence which is employed for purification of the above form of the polypeptide or a proprotein sequence.
- a conserved or non-conserved amino acid residue preferably
- the FGF-13 of the present invention may include one or more amino acid substitutions, deletions or additions, either from natural mutations or human manipulation.
- changes are preferably of a minor nature, such as conservative amino acid substitutions that do not significantly affect the folding or activity of the protein (see Table 1).
- TABLE 1 Conservative Amino Acid Substitutions Aromatic Phenylalanin Tryptophan Tyrosine Hydrophobic Leucine Isoleucine Valine Polar Glutamine Asparagine Basic Arginine Lysine Histidine Acidic Aspartic Acid Glutamic Acid Small Alanine Serine Threnine Methionine Glycine
- Amino acids in the FGF-13 protein of the present invention that are essential for function can be identified by methods known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, Science 244:1081-1085 (1989)). The latter procedure introduces single alanine mutations at every residue in the molecule. The resulting mutant molecules are then tested for biological activity such as receptor binding or in vitro or in vitro proliferative activity.
- Replacement of amino acids can also change the selectivity of the binding of a ligand to cell surface receptors.
- Ostade et al. Nature 361:266-268 (1993) describes certain mutations resulting in selective binding of TNF-a to only one of the two known types of TNF receptors.
- Sites that are critical for ligand-receptor binding can also be determined by structural analysis such as crystallization, nuclear magnetic resonance or photoaffinity labeling (Smith et al., J. Mol. Biol. 224:899-904 (1992) and de Vos et al. Science 255:306-312 (1992)).
- polypeptides of the present invention are preferably provided in an isolated form, and preferably are substantially purified.
- a recombinantly produced version of the FGF-13 polypeptide can be substantially purified by the one-step method described in Smith and Johnson, Gene 67:31-40 (1988).
- Polypeptides of the invention also can be purified from natural or recombinant sources using anti-FGF-13 antibodies of the invention in methods which are well known in the art of protein purification.
- the invention farther provides an isolated FGF-13 polypeptide comprising an amino acid sequence selected from the group consisting of: (a) the amino acid sequence of the complete FGF-13 polypeptide shown in SEQ ID NO:2 excepting the N-terminal methionine (i.e., positions ⁇ 22 to 193 of SEQ ID NO:2); (b) the amino acid sequence of the predicted mature FGF-13 polypeptide from about position 1 to about position 193 in SEQ ID NO:2; (c) the amino acid sequence of the FGF-13 polypeptide having the complete amino acid sequence encoded by the cDNA clone contained in ATCCTM Deposit No. 97148; and (d) the amino acid sequence of the mature FGF-13 polypeptide having the amino acid sequence encoded by the cDNA clone contained in ATCCTM Deposit No. 97148.
- polypeptides of the present invention include polypeptides which have at least 90% similarity, more preferably at least 95% similarity, and still more preferably at least 96%, 97%, 98% or 99% similarity to those described above.
- the polypeptides of the invention also comprise those which are at least 80% identical, more preferably at least 90% or 95% identical, still more preferably at least 96%, 97%, 98% or 99% identical to the polypeptide encoded by the deposited cDNA or to the polypeptide of SEQ ID NO:2, and also include portions of such polypeptides with at least 30 amino acids and more preferably at least 50 amino acids.
- % similarity for two polypeptides is intended a similarity score produced by comparing the amino acid sequences of the two polypeptides using the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711) and the default settings for determining similarity. Bestfit uses the local homology algorithm of Smith and Waterman (Advances in Applied Mathematics 2:482-489, 1981) to find the best segment of similarity between two sequences.
- polypeptide having an amino acid sequence at least, for example, 95% “identical” to a reference amino acid sequence of an FGF-13 polypeptide is intended that the amino acid sequence of the polypeptide is identical to the reference sequence except that the polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the reference amino acid of the FGF-13 polypeptide.
- up to 5% of the amino acid residues in the reference sequence may be deleted or substituted with another amino acid, or a number of amino acids up to 5% of the total amino acid residues in the reference sequence may be inserted into the reference sequence.
- These alterations of the reference sequence may occur at the amino or carboxy terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
- any particular polypeptide is at least 90%, 95%, 96%, 97%, 98% or 99% identical to, for instance, the amino acid sequence shown in SEQ ID‘NO:2 or to the amino acid sequence encoded by deposited cDNA clone can be determined conventionally using known computer programs such the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711).
- the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference amino acid sequence and that gaps in homology of up to 5% of the total number of amino acid residues in the reference sequence are allowed.
- polypeptide of the present invention could be used as a molecular weight marker on SDS-PAGE gels or on molecular sieve gel filtration columns using methods well known to those of skill in the art.
- polypeptides of the present invention can also be used to raise polyclonal and monoclonal antibodies, which are useful in assays for detecting FGF-13 protein expression as described below or as agonists and antagonists capable of enhancing or inhibiting FGF-13 protein function.
- polypeptides can be used in the yeast two-hybrid system to “capture” FGF-13 protein binding proteins which are also candidate agonists and antagonists according to the present invention.
- the yeast two hybrid system is described in Fields and Song, Nature 340:245-246 (1989).
- the invention provides a peptide or polypeptide comprising an epitope-bearing portion of a polypeptide of the invention.
- the epitope of this polypeptide portion is an immunogenic or antigenic epitope of a polypeptide of the invention.
- An “immunogenic epitope” is defined as a part of a protein that elicits an antibody response when the whole protein is the immunogen.
- a region of a protein molecule to which an antibody can bind is defined as an “antigenic epitope.”
- the number of immunogenic epitopes of a protein generally is less than the number of antigenic epitopes. See, for instance, Geysen et al., Proc. Natl. Acad. Sci. USA 81:3998-4002 (1983).
- peptides or polypeptides bearing an antigenic epitope i.e., that contain a region of a protein molecule to which an antibody can bind
- relatively short synthetic peptides that mimic part of a protein sequence are routinely capable of eliciting an antiserum that reacts with the partially mimicked protein. See, for instance, Sutcliffe, J. G., Shinnick, T. M., Green, N. and Learner, R. A. (1983) “Antibodies that react with predetermined sites on proteins,” Science, 219:660-666.
- Peptides capable of eliciting protein-reactive sera are frequently represented in the primary sequence of a protein, can be characterized by a set of simple chemical rules, and are confined neither to immunodominant regions of intact proteins (i.e., immunogenic epitopes) nor to the amino or carboxyl terminals.
- Antigenic epitope-bearing peptides and polypeptides of the invention are therefore useful to raise antibodies, including monoclonal antibodies, that bind specifically to a polypeptide of the invention. See, for instance, Wilson et al., Cell 37:767-778 (1984) at 777.
- Antigenic epitope-bearing peptides and polypeptides of the invention preferably contain a sequence of at least seven, more preferably at least nine and most preferably between about 15 to about 30 amino acids contained within the amino acid sequence of a polypeptide of the invention.
- Non-limiting examples of antigenic polypeptides or peptides that can be used to generate FGF-13-specific antibodies include: a polypeptide comprising amino acid residues in SEQ ID NO:2 from about Gln 22 to about Asn 32, about Asn 34 to about Met 43, about Gln 46 to about Tyr 55, about Ser 59 to about Val 66, about Val 68 to about Phe 83, about Val 88 to about Glu 105, about Met 110 to about Val 128, about Phe 153 to about His 173, about Leu 178 to about Gin 182, about Phe 185 to about Gin 194, and about Val 198 to about Gin 213.
- These polypeptide fragments have been determined to bear antigenic epitopes of the FGF-13 protein by the analysis of the Jameson-Wolf antigenic index, as shown in FIG. 3 , above.
- the epitope-bearing peptides and polypeptides of the invention may be produced by any conventional means. See, e.g., Houghten, R. A. (1985) “General method for the rapid solid-phase synthesis of large numbers of peptides: specificity of antigen-antibody interaction at the level of individual amino acids.” Proc. Natl. Acad. Sci. USA 82:5131-5135; this “Simultaneous Multiple Peptide Synthesis (SMPS)” process is further described in U.S. Pat. No. 4,631,211 to Houghten et al. (1986).
- SMPS Simultaneous Multiple Peptide Synthesis
- Epitope-bearing peptides and polypeptides of the invention are used to induce antibodies according to methods well known in the art. See, for instance, Sutcliffe et al., supra; Wilson et al., supra; Chow, M. et al., Proc. Natl. Acad. Sci. USA, 82:910-914; and Bittle, F. J. et al., J. Gen. Tirol. 66:2347-2354 (1985).
- Immunogenic epitope-bearing peptides of the invention i.e., those parts of a protein that elicit an antibody response when the whole protein is the immunogen, are identified according to methods known in the art.
- U.S. Pat. No. 5,194,392 to Geysen (1990) describes a general method of detecting or determining the sequence of monomers (amino acids or other compounds) which is a topological equivalent of the epitope (i.e., a “mimotope”) which is complementary to a particular paratope (antigen binding site) of an antibody of interest. More generally, U.S. Pat. No. 4,433,092 to Geysen (1989) describes a method of detecting or determining a sequence of monomers which is a topographical equivalent of a ligand which is complementary to the ligand binding site of a particular receptor of interest.
- FGF-13 polypeptides of the present invention and the epitope-bearing fragments thereof described above can be combined with parts of the constant domain of immunoglobulins (IgG), resulting in chimeric polypeptides.
- IgG immunoglobulins
- These fusion proteins facilitate purification and show an increased half-life in vivo. This has been shown, e.g., for chimeric proteins consisting of the first two domains of the human CD4-polypeptide and various domains of the constant regions of the heavy or light chains of mammalian immunoglobulins (EP A 394,827; Traunecker et al., Nature 331:84-86 (1988)).
- Fusion proteins that have a disulfide-linked dimeric structure due to the IgG part can also be more efficient in binding and neutralizing other molecules than the monomeric FGF-13 protein or protein fragment alone (Fountoulakis et al., J. Biochem. 270:3958-3964 (1995)).
- FGF-13-protein specific antibodies for use in the present invention can be raised against the intact FGF-13 protein or an antigenic polypeptide fragment thereof, which may be presented together with a carrier protein, such as an albumin, to an animal system (such as rabbit or mouse) or, if it is long enough (at least about 25 amino acids), without a carrier.
- a carrier protein such as an albumin
- antibody or “monoclonal antibody” (Mab) is meant to include intact molecules as well as antibody fragments (such as, for example, Fab and F(ab′)2 fragments) which are capable of specifically binding to FGF-13 protein.
- Fab and F(ab′)2 fragments lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983)). Thus, these fragments are preferred.
- the antibodies of the present invention may be prepared by any of a variety of methods.
- cells expressing the FGF-13 protein or an antigenic fragment thereof can be administered to an animal in order to induce the production of sera containing polyclonal antibodies.
- a preparation of FGF-13 protein is prepared and purified to render it substantially free of natural contaminants. Such a preparation is then introduced into an animal in order to produce polyclonal antisera of greater specific activity.
- the antibodies of the present invention are monoclonal antibodies (or FGF-13 protein binding fragments thereof).
- monoclonal antibodies can be prepared using hybridoma technology (Kohler et al., Nature 256:495 (1975); Kohler et al., Eur. J. Immunol. 6:511 (1976); Kohler et al., Eur. J. Immunol. 6:292 (1976); Hammering et al., in: Monoclonal Antibodies and T - Cell Hybridomas , Elsevier, N.Y., (1981) pp. 563-681).
- such procedures involve immunizing an animal (preferably a mouse) with an FGF-13 protein antigen or, more preferably, with an FGF-13 protein-expressing cell.
- Suitable cells can be recognized by their capacity to bind anti-FGF-13 protein antibody.
- Such cells may be cultured in any suitable tissue culture medium; however, it is preferable to culture cells in Earle's modified Eagle's medium supplemented with 10% fetal bovine serum (inactivated at about 56° C.), and supplemented with about 10 g/l of nonessential amino acids, about 1,000 U/ml of penicillin, and about 100 ⁇ g/ml of streptomycin.
- the splenocytes of such mice are extracted and fused with a suitable myeloma cell line.
- any suitable myeloma cell line may be employed in accordance with the present invention; however, it is preferable to employ the parent myeloma cell line (SP20), available from the American Type Culture Collection, Rockville, Md.
- SP20 myeloma cell line
- the resulting hybridoma cells are selectively maintained in HAT medium, and then cloned by limiting dilution as described by Wands et al. ( Gastroenterology, 80:225-232 (1981)).
- the hybridoma cells obtained through such a selection are then assayed to identify clones which secrete antibodies capable of binding the FGF-13 protein antigen.
- additional antibodies capable of binding to the FGF-13 protein antigen may be produced in a two-step procedure through the use of anti-idiotypic antibodies.
- FGF-13-protein specific antibodies are used to immunize an animal, preferably a mouse.
- the splenocytes of such an animal are then used to produce hybridoma cells, and the hybridoma cells are screened to identify clones which produce an antibody whose ability to bind to the FGF-13 protein-specific antibody can be blocked by the FGF-13 protein antigen.
- Such antibodies comp i se anti-idiotypic antibodies to the FGF-13 protein-specific antibody and can be used to immunize an animal to induce formation of further FGF-13 protein-specific antibodies.
- Fab and F(ab′)2 and other fragments of the antibodies of the present invention may be used according to the methods disclosed herein.
- Such fragments are typically produced by proteolytic cleavage, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab′)2 fragments).
- enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab′)2 fragments).
- FGF-13 protein-binding fragments can be produced through the application of recombinant DNA technology or through synthetic chemistry.
- chimeric monoclonal antibodies For in vivo use of anti-FGF-13 in humans, it may be preferable to use “humanized” chimeric monoclonal antibodies. Such antibodies can be produced using genetic constructs derived from hybridoma cells producing the monoclonal antibodies described above. Methods for producing chimeric antibodies are known in the art. See, for review, Morrison, Science 229:1202 (1985); 0i et al., BioTechniques 4:214 (1986); Cabilly et al., U.S. Pat. No. 4,816,567; Taniguchi et al., EP 171496; Morrison et al., EP 173494; Neuberger et al., WO 8601533; Robinson. et al., WO 8702671; Boulianne et al., Nature 312:643 (1984); Neuberger et al., Nature, 314:268 (1985).
- This invention is also related to the use of the genes of the present invention as part of a diagnostic assay for detecting diseases or susceptibility to diseases related to the presence of mutations in the nucleic acid sequences encoding the polypeptide of the present invention.
- Nucleic acids for diagnosis may be obtained from a patient's cells, such as from blood, urine, saliva, tissue biopsy and autopsy material.
- the genomic DNA may be used directly for detection or may be amplified enzymatically by using PCR (Saiki et al., Nature, 324:163-166 (1986)) prior to analysis.
- RNA or cDNA may also be used for the same purpose.
- PCR primers complementary to the nucleic acid encoding a polypeptide of the present invention can be used to identify and analyze mutations.
- deletions and insertions can be detected by a change in size of the amplified product in comparison to the normal genotype.
- Point mutations can be identified by hybridizing amplified DNA to radiolabeled RNA or alternatively, radiolabeled antisense DNA sequences. Perfectly matched sequences can be distinguished from mismatched duplexes by RNase A digestion or by differences in melting temperatures.
- DNA sequence differences may be achieved by detection of alteration in electrophoretic mobility of DNA fragments in gels with or without denaturing agents. Small sequence deletions and insertions can be visualized by high resolution gel electrophoresis. DNA fragments of different sequences may be distinguished on denaturing formamide gradient gels in which the mobilities of different DNA fragments are retarded in the gel at different positions according to their specific melting or partial melting temperatures (see, e.g., Myers et al., Science, 230:1242 (1985)).
- Sequence changes at specific locations may also be revealed by nuclease protection assays, such as RNase and S1 protection or the chemical cleavage method (e.g., Cotton et al., PNAS, USA, 85:4397-4401 (1985)).
- nuclease protection assays such as RNase and S1 protection or the chemical cleavage method (e.g., Cotton et al., PNAS, USA, 85:4397-4401 (1985)).
- the detection of a specific DNA sequence may be achieved by methods such as hybridization, RNase protection, chemical cleavage, direct DNA sequencing or the use of restriction enzymes, (e.g., Restriction Fragment Length Polymorphisms (RFLP)) and Southern blotting of genomic DNA.
- restriction enzymes e.g., Restriction Fragment Length Polymorphisms (RFLP)
- mutations can also be detected by in situ analysis.
- the present invention also relates to a diagnostic assay for detecting altered levels of FGF-13 proteins in various tissues since an over-expression of the proteins compared to normal control tissue samples may detect the presence of abnormal cellular proliferation, for example, a tumor.
- Assays used to detect levels of protein in a sample derived from a host are well-known to those of skill in the art and include radioimmunoassays, competitive-binding assays, Western Blot analysis, ELISA assays and “sandwich” assay.
- An ELISA assay (Coligan, et al., Current Protocols in Immunology, 1(2), Chapter 6, (1991)) initially comprises preparing an antibody specific to an antigen to the polypeptides of the present invention, preferably a monoclonal antibody.
- a reporter antibody is prepared against the monoclonal antibody.
- a detectable reagent such as radioactivity, fluorescence or, in this example, a horseradish peroxidase enzyme.
- a sample is removed from a host and incubated on a solid support, e.g. a polystyrene dish, that binds the proteins in the sample. Any free protein binding sites on the dish are then covered by incubating with a non-specific protein like bovine serum albumen.
- the monoclonal antibody is incubated in the dish during which time the monoclonal antibodies attach to any polypeptides of the present invention attached to the polystyrene dish. All unbound monoclonal antibody is washed out with buffer.
- the reporter antibody linked to horseradish peroxidase is now placed in the dish resulting in binding of the reporter antibody to any monoclonal antibody bound to the protein of interest.
- Unattached reporter antibody is then washed out.
- Peroxidase substrates are then added to the dish and the amount of color developed in a given time period is a measurement of the amount of a polypeptide of the present invention present in a given volume of patient sample when compared against a standard curve.
- a competition assay may be employed wherein antibodies specific to a polypeptide of the present invention are attached to a solid support and labeled FGF-13 and a sample derived from the host are passed over the solid support and the amount of label detected, for example by liquid scintillation chromatography, can be correlated to a quantity of a polypeptide of the present invention in the sample.
- a “sandwich” assay is similar to an ELISA assay.
- a polypeptide of the present invention is passed over a solid support and binds to antibody attached to a solid support.
- a second antibody is then bound to the polypeptide of interest.
- a third antibody which is labeled and specific to the second antibody is then passed over the solid support and binds to the second antibody and an amount can then be quantified.
- FGF-13 is expressed in cancerous ovarian tissue as well as fetal kidney and fetal brain tissue.
- cancers of these tissues as well as other cancerous tissues in mammals can express significantly enhanced levels of the FGF-13 protein and mRNA encoding the FGF-13 protein when compared to a corresponding “standard” level.
- enhanced levels of the FGF-13 protein can be detected in certain body fluids (e.g., sera, plasma, urine, and spinal fluid) from mammals with such a cancer when compared to sera from mammals of the same species not having the cancer.
- the invention provides a diagnostic method useful during diagnosis of a disorder involving FGF-13 expression, including cancers, which involves measuring the expression level of the gene encoding the FGF-13 protein in ovarian, renal or neurological system tissue or other cells or body fluid from an individual and comparing the measured gene expression level with a standard FGF-13 gene expression level in that tissue, cell or fluid, whereby an increase or decrease in the gene expression level compared to the standard is indicative of a disorder related to FGF-13 expression.
- the present invention is useful as a prognostic indicator, whereby patients exhibiting enhanced or reduced FGF-13 gene expression will experience a worse clinical outcome relative to patients expressing the gene at a level nearer the standard level.
- saying the expression level of the gene encoding the FGF-13 protein is intended qualitatively or quantitatively measuring or estimating the level of the FGF-13 protein or the level of the mRNA encoding the FGF-13 protein in a first biological sample either directly (e.g., by determining or estimating absolute protein level or mRNA level) or relatively (e.g., by comparing to the FGF-13 protein level or mRNA level in a second biological sample).
- the FGF-13 protein level or mRNA level in the first biological sample is measured or estimated and compared to a standard FGF-13 protein level or mRNA level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of individuals not having a disorder related to FGF-13 expression.
- a standard FGF-13 protein level or mRNA level it can be used repeatedly as a standard for comparison.
- biological sample any biological sample obtained from an individual, body fluid, cell line, tissue culture, or other source which contains FGF-13 protein or mRNA.
- biological samples include body fluids (such as sera, plasma, urine, synovial fluid and spinal fluid) which contain free FGF-13 protein, ovarian or renal system tissue, and other tissue sources found to express complete or mature FGF-13 polypeptide or an FGF-13 receptor. Methods for obtaining tissue biopsies and body fluids from mammals are well known in the art. Where the biological sample is to include mRNA, a tissue biopsy is the preferred source.
- Total cellular RNA can be isolated from a biological sample using any suitable technique such as the single-step guanidinium-thiocyanate-phenol-chloroform method described in Chomczynski and Sacchi, Anal. Biochem. 162:156-159(1987). Levels of mRNA encoding the FGF-13 protein are then assayed using any appropriate method. These include Northern blot analysis, S1 nuclease mapping, the polymerase chain reaction (PCR), reverse transcription in combination with the polymerase chain reaction (RT-PCR), and reverse transcription in combination with the ligase chain reaction (RT-LCR).
- PCR polymerase chain reaction
- RT-PCR reverse transcription in combination with the polymerase chain reaction
- RT-LCR reverse transcription in combination with the ligase chain reaction
- Assaying FGF-13 protein levels in a biological sample can occur using antibody-based techniques.
- FGF-13 protein expression in tissues can be studied with classical immunohistological methods (Jalkanen, M., et al., J. Cell. Biol. 101:976-985 (1985); Jalkanen, M., et al., J. Cell. Biol. 105:3087-3096 (1987)).
- Other antibody-based methods useful for detecting FGF-13 protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA).
- ELISA enzyme linked immunosorbent assay
- RIA radioimmunoassay
- Suitable antibody assay labels include enzyme labels, such as, glucose oxidase, and radioisotopes, such as iodine ( 125 I, 121 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 1n), and technetium ( 99m Tc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
- enzyme labels such as, glucose oxidase, and radioisotopes, such as iodine ( 125 I, 121 I), carbon ( 14 C), sulfur ( 35 S), tritium ( 3 H), indium ( 112 1n), and technetium ( 99m Tc)
- fluorescent labels such as fluorescein and rhodamine, and biotin.
- FGF-13 protein can also be detected in vivo by imaging.
- Antibody labels or markers for in vivo imaging of FGF-13 protein include those detectable by X-radiography, NMR or ESR.
- suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject.
- Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which may be incorporated into the antibody by labeling of nutrients for the relevant hybridoma.
- a FGF-13 protein-specific antibody or antibody fragment which has been labeled with an appropriate detectable imaging moiety such as a radioisotope (for example, 131 I, 112 In, 99m Tc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance, is introduced (for example, parenterally, subcutaneously or intraperitoneally) into the mammal to be examined for immune system disorder.
- a radioisotope for example, 131 I, 112 In, 99m Tc
- a radio-opaque substance for example, parenterally, subcutaneously or intraperitoneally
- the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of 99m Tc.
- the labeled antibody or antibody fragment will then preferentially accumulate at the location of cells which contain FGF-13 protein.
- In vivo tumor imaging is described in S. W. Burchiel et al., “Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments” (Chapter 13 in Tumor Imaging: The Radiochemical Detection of Cancer , S. W. Burchiel and B. A. Rhodes, eds., Masson Publishing Inc. (1982)).
- polypeptide of the present invention may be employed in treatment for stimulating re-vascularization ischemic tissues due to various disease conditions such as thrombosis, arteriosclerosis, and other cardiovascular conditions. These polypeptide may also be employed to stimulate angiogenesis and limb regeneration.
- the polypeptide may also be employed for treating wounds due to injuries, burns, post-operative tissue repair, and ulcers since they are mitogenic to various cells of different origins, such as fibroblast cells and skeletal muscle cells, and therefore, facilitate the repair or replacement of damaged or diseased tissue.
- the polypeptide of the present invention may also be employed stimulate neuronal growth and to treat and prevent neuronal damage associated with stroke and which occurs in certain neuronal disorders or neuro-degenerative conditions such as Alzheimer's disease, Parkinson's disease, and AIDS related complex.
- FGF-13 increases the number of dopaminergic neurons surviving in vitro indicating that it may benefit the Parkinson's disease patient.
- FGF-13 has the ability to stimulate chondrocyte growth, therefore, they may be employed to enhance bone and periodontal regeneration and aid in tissue transplants or bone grafts.
- the polypeptide of the present invention may be also be employed to prevent skin aging due to sunburn by stimulating keratinocyte growth.
- the FGF-13 polypeptide may also be employed for preventing hair loss, since FGF family members activate hair-forming cells and promotes melanocyte growth.
- the polypeptides of the present invention may be employed to stimulate growth and differentiation of hematopoietic cells and bone marrow cells when used in combination with other cytokines.
- the FGF-13 polypeptide may also be employed to maintain organs before transplantation or for supporting cell culture of primary tissues.
- polypeptide of the present invention may also be employed for inducing tissue of mesodermal origin to differentiate in early embryos.
- This invention provides a method for identification of the receptors for the polypeptides of the present invention.
- the genes encoding the receptor can be identified by numerous methods known to those of skill in the art, for example, ligand, panning and FACS sorting (Coligan, et al., Current Protocols in Immun., 1(2), Chapter 5, (1991)).
- expression cloning is employed wherein polyadenylated RNA is prepared from a cell responsive to the polypeptides, for example, NIH3T3 cells which are known to contain multiple receptors for the FGF family proteins, and SC-3 cells, and a cDNA library created from this RNA is divided into pools and used to transfect COS cells or other cells that are not responsive to the polypeptides.
- Transfected cells which are grown on glass slides are exposed to the polypeptide of the present invention, after they have been labeled.
- the polypeptides can be labeled by a variety of means including iodination or inclusion of a recognition site for a site-specific protein kinase.
- the labeled polypeptides can be photoaffinity linked with cell membrane or extract preparations that express the receptor molecule. Cross-linked material is resolved by PAGE analysis and exposed to X-ray film. The labeled complex containing the receptors of the polypeptides can be excised, resolved into peptide fragments, and subjected to protein microsequencing. The amino acid sequence obtained from microsequencing would be used to design a set of degenerate oligonucleotide probes to screen a cDNA library to identify the genes encoding the putative receptors.
- the FGF-13 polypeptide composition will be formulated and dosed in a fashion consistent with good medical practice, taking into account the clinical condition of the individual patient (especially the side effects of treatment with FGF-13 polypeptide alone), the site of delivery of the FGF-13 polypeptide composition, the method of administration, the scheduling of administration, and other factors known to practitioners.
- the “effective amount” of FGF-13 polypeptide for purposes herein is thus determined by such considerations.
- polypeptides, agonists and antagonists of the present invention may be employed in combination with a suitable pharmaceutical carrier to comprise a pharmaceutical composition for parenteral administration.
- a suitable pharmaceutical carrier includes but is not limited to saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof.
- the formulation should suit the mode of administration.
- the invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention.
- Associated with such containers can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration.
- the polypeptides, agonists and antagonists of the present invention may be employed in conjunction with other therapeutic compounds.
- the pharmaceutical compositions may be administered in a convenient manner such as by the oral, topical, intravenous, intraperitoneal, intramuscular, subcutaneous, intranasal or intradermal routes.
- the pharmaceutical compositions are administered in an amount which is effective for treating and/or prophylaxis of the specific indication. In general, they are administered in an amount of at least about 10 ⁇ g/kg body weight and in most cases they will be administered in an amount not in excess of about 8 mg/Kg body weight per day. In most cases, the dosage is from about 10 ⁇ g/kg to about 1 mg/kg body weight daily, taking into account the routes of administration, symptoms, etc.
- dosages are preferably administered from about 0.1 ⁇ g to 9 mg per cm 2 .
- polypeptide of the invention and agonist and antagonist compounds which are polypeptides may also be employed in accordance with the present invention by expression of such polypeptide in vivo, which is often referred to as “gene therapy.”
- cells may be engineered with a polynucleotide (DNA or RNA) encoding for the polypeptide ex vivo, the engineered cells are then provided to a patient to be treated with the polypeptide.
- a polynucleotide DNA or RNA
- Such methods are well-known in the art.
- cells may be engineered by procedures known in the art by use of a retroviral particle containing RNA encoding for the polypeptide of the present invention.
- cells may be engineered in vivo for expression of the polypeptide in vivo, for example, by procedures known in the art.
- a producer cell for producing a retroviral particle containing RNA encoding the polypeptide of the present invention may be administered to a patient for engineering cells in vivo and expression of the polypeptide in vivo.
- the expression vehicle for engineering cells may be other than a retroviral particle, for example, an adenovirus, which may be used to engineer cells in vivo after combination with a suitable delivery vehicle.
- Retroviruses from which the retroviral plasmid vectors hereinabove mentioned may be derived include, but are not limited to, Moloney Murine Leukemia Virus, spleen necrosis virus, retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, gibbon ape leukemia virus, human immunodeficiency virus, adenovirus, Myeloproliferative Sarcoma Virus, and mammary tumor virus.
- the retroviral plasmid vector is derived from Moloney Murine Leukemia Virus.
- the vector includes one or more promoters.
- Suitable promoters which may be employed include, but are not limited to, the retroviral LTR; the SV40 promoter; and the human cytomegalovirus (CMV) promoter described in Miller, et al., Biotechniques, Vol. 7, No. 9, 980-990 (1989), or any other promoter (e.g., cellular promoters such as eukaryotic cellular promoters including, but not limited to, the histone, pol III, and 13-actin promoters).
- Other viral promoters which may be employed include, but are not limited to, adenovirus promoters, thymidine kinase (TK) promoters, and B19 parvovirus promoters. The selection of a suitable promoter will be apparent to those skilled in the art from the teachings contained herein.
- the nucleic acid sequence encoding the polypeptide of the present invention is under the control of a suitable promoter.
- suitable promoters which may be employed include, but are not limited to, adenoviral promoters, such as the adenoviral major late promoter; or hetorologous promoters, such as the cytomegalovirus (CMV) promoter; the respiratory syncytial virus (RSV) promoter; inducible promoters, such as the MMT promoter, the metallothionein promoter; heat shock promoters; the albumin promoter; the ApoAI promoter; human globin promoters; viral thymidine kinase promoters, such as the Herpes Simplex thymidine kinase promoter; retroviral LTRs (including the modified retroviral LTRs hereinabove described); the 13-actin promoter; and human growth hormone promoters.
- the promoter also may be the native promoter which controls the gene
- the retroviral plasmid vector is employed to transduce packaging cell lines to form producer cell lines.
- packaging cells which may be transfected include, but are not limited to, the PE501, PA317, -2, -AM, PA12, T19-14 ⁇ , VT-19-17-H2, CRE, CRIP, GP+E-86, GP+envAm12, and DAN cell lines as described in Miller, Human Gene Therapy, Vol. 1, pgs. 5-14 (1990), which is incorporated herein by reference in its entirety.
- the vector may transducer the packaging cells through any means known in the art. Such means include, but are not limited to, electroporation, the use of liposomes, and CaPO 4 precipitation.
- the retroviral. plasmid vector may be encapsulated into a liposome, or coupled to a lipid, and then administered to a host.
- the producer cell line generates infectious retroviral vector particles which include the nucleic acid sequence(s) encoding the polypeptides.
- retroviral vector particles then may be employed, to transduce eukaryotic cells, either in vitro or in vivo.
- the transduced eukaryotic cells will express the nucleic acid sequence(s) encoding the polypeptide.
- Eukaryotic cells which may be transduced include, but are not limited to, embryonic stem cells, embryonic carcinoma cells, as well as hematopoietic stem cells, hepatocytes, fibroblasts, myoblasts, keratinocytes, endothelial cells, and bronchial epithelial cells.
- This invention provides a method of screening compounds to identify those which modulate the action of the polypeptide of the present invention.
- An example of such an assay comprises combining a mammalian fibroblast ‘cell, a the polypeptide of the present invention, the compound to be screened and 3 [H] thymidine under cell culture conditions where the fibroblast cell would normally proliferate.
- a control assay may be performed in the absence of the compound to be screened and compared to the amount of fibroblast proliferation in the presence of the compound to determine if the compound stimulates proliferation by determining the uptake of 3 [H] thymidine in each case.
- the amount of fibroblast cell proliferation is measured by liquid scintillation chromatography which measures the incorporation of 3 [H] thymidine. Both agonist and antagonist compounds may be identified by this procedure.
- a mammalian cell or membrane preparation expressing a receptor for a polypeptide of the present invention is incubated with a labeled polypeptide of the present invention in the presence of the compound.
- the ability of the compound to enhance or block this interaction could then be measured.
- the response of a known second messenger system following interaction of a compound to be screened and the FGF-13 receptor is measured and the ability of the compound to bind to the receptor and elicit a second messenger response is measured to determine if the compound is a potential agonist or antagonist.
- second messenger systems include but are not limited to, cAMP guanylate cyclase, ion channels or phosphoinositide hydrolysis.
- antagonist compounds include antibodies, or in some cases, oligonucleotides, which bind to the receptor for the polypeptide of the present invention but elicit no second messenger response or bind to the FGF-13 polypeptide itself.
- a potential antagonist may be a mutant form of the polypeptide which binds to the receptors, however, no second messenger response is elicited and, therefore, the action of the polypeptide is effectively blocked.
- Another antagonist compound to the FGF-13 gene and gene product is an antisense construct prepared using antisense technology.
- Antisense technology can be used to control gene expression through triple-helix formation or antisense DNA or RNA, both of which methods are based on binding of a polynucleotide to DNA or RNA.
- the 5′ coding portion of the polynucleotide sequence which encodes for the mature polypeptides of the present invention, is used to design an antisense RNA oligonucleotide of from about 10 to 40 base pairs in length.
- a DNA oligonucleotide is designed to be complementary to a region of the gene involved in transcription (triple helix—see Lee et al., Nucl.
- the antisense RNA oligonucleotide hybridizes to the mRNA in vivo and blocks translation of the mRNA molecule into the polypeptide (Antisense—Okano, J., Neurochem., 56:560 (1991); Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988)).
- the oligonucleotides described above can also be delivered to cells such that the antisense RNA or DNA may be expressed in vivo to inhibit production of the polypeptide.
- Potential antagonist compounds also include small molecules which bind to and occupy the binding site of the receptors thereby making the receptor inaccessible to its polypeptide such that normal biological activity is prevented.
- small molecules include, but are not limited to, small peptides or peptide-like molecules.
- Antagonist compounds may be employed to inhibit the cell growth and proliferation effects of the polypeptides of the present invention on neoplastic cells and tissues, i.e. stimulation of angiogenesis of tumors, and, therefore, retard or prevent abnormal cellular growth and proliferation, for example, in tumor formation or growth.
- the antagonists may also be employed to prevent hyper-vascular diseases, and prevent the proliferation of epithelial lens cells after extracapsular cataract surgery. Prevention of the mitogenic activity of the polypeptides of the present invention may also be desirous in cases such as restenosis after balloon angioplasty.
- the antagonists may also be employed to prevent the growth of scar tissue during wound healing.
- the cDNA herein disclosed is used to clone genomic DNA of an FGF-13 gene. This, can be accomplished using a variety of well known techniques and libraries, which generally are available commercially. The genomic DNA then. is used for in situ chromosome mapping using well known techniques for this purpose. Therefore, the nucleic acid molecules of the present invention are also valuable for chromosome identification. The sequence is specifically targeted to and can hybridize with a particular location on an individual human chromosome. Moreover, there is a current need for identifying 25 particular sites on the chromosome. Few chromosome marking reagents based on actual sequence data (repeat polymorphisms) are presently available for marking chromosomal location. The mapping of DNAs to chromosomes according to the present invention is an important first step in correlating those sequences with genes associated with disease.
- sequences can be mapped to chromosomes by preparing PCR primers (preferably 15-25 bp) from the cDNA. Computer analysis of the 3′ untranslated region is used to rapidly select primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers are then used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the primer will yield an amplified fragment.
- PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular DNA to a particular chromosome.
- sublocalization can be achieved with panels of fragments from specific chromosomes or pools of large genomic clones in an analogous manner.
- Other mapping strategies that can similarly be used to map to its chromosome include in situ hybridization, prescreening with labeled flow-sorted chromosomes and preselection by hybridization to construct chromosome specificcDNA libraries.
- Fluorescence in situ hybridization of a cDNA clone to a metaphase chromosomal spread can be used to provide a precise chromosomal location in one step.
- This technique can be used with cDNA as short as 50 or 60 bases.
- Verma et al. Human Chromosomes: a Manual of Basic Techniques, Pergamon Press, New York (1988).
- a cDNA precisely localized to a chromosomal region associated with the disease could be one of between 50 and 500 potential causative genes. (This assumes 1 megabase mapping resolution and one gene per 20 kb).
- the FGF-13 gene of the invention has been mapped by florescent in situ hybridization to human chromosome 8p21.
- the corresponding map position in the mouse includes several disease loci including ds (disorganization-developmental disruption) and wc (waved coat-homozygous lethality).
- Plasmids are designated by a lower case p. preceded and/or followed by capital letters and/or numbers.
- the starting plasmids herein are either commercially available, publicly available on an unrestricted basis, or can be constructed from available plasmids in accord with published procedures.
- equivalent plasmids to those described are known in the art and will be apparent to the ordinarily skilled artisan.
- “Digestion” of DNA refers to catalytic cleavage of the DNA with a restriction enzyme that acts only at certain sequences in the DNA.
- the various restriction enzymes used herein are commercially available and their reaction conditions, cofactors and other requirements were used as would be known to the ordinarily skilled artisan.
- For analytical purposes typically 1 ⁇ g of plasmid or DNA fragment is used with about 2 units of enzyme in about 20 ⁇ l of buffer solution.
- Size separation of the cleaved fragments is performed using 8 percent polyacrylamide gel described by Goeddel, D. et al., Nucleic Acids Res., 8:4057 (1980).
- Oligonucleotides refers to either a single stranded polydeoxynucleotide or two complementary polydeoxynucleotide strands which may be chemically synthesized. Such synthetic oligonucleotides have no 5′ phosphate and thus will not ligate to another oligonucleotide without adding a phosphate with an ATP in the presence of a kinase. A synthetic oligonucleotide will ligate to a fragment that has not been dephosphorylated.
- Ligase refers to the process of forming phosphodiester bonds between two double stranded nucleic acid fragments (Maniatis, T., et al., Id., p. 146). Unless otherwise provided, ligation may be accomplished using known buffers and conditions with 10 units of T4 DNA ligase (“ligase”) per 0.5 ⁇ g of approximately equimolar amounts of the DNA fragments to be ligated.
- ligase T4 DNA ligase
- the DNA sequence encoding FGF-13 ATCCTM No. 97148 was initially amplified using PCR oligonucleotide primers corresponding to the 5′ sequences of the polypeptide having the amino acid sequence from position 2 to position 193 of SEQ ID NO:2 and to the vector sequences 3′ to the gene. Additional nucleotides corresponding to the gene were added to the 5′ and 3′ sequences respectively.
- the 5′ oligonucleotide primer 5′ GCCAGACCATGGAGAATCACCCGTCTCCTAAT 3′ (SEQ ID NO:11) contains a Nco restriction enzyme site.
- the 3′ sequence 5′ GATTTAAGATCTCGTGAGGGGCTGGGGCCG 3′ contains complementary sequences to a BgIII site and is followed by 18 nucleotides of FGF-13 coding sequence.
- the restriction enzyme sites correspond to the restriction enzyme sites on the bacterial expression vector pQE-60 (Qiagen, Inc. Chatsworth, Calif. 91311).
- pQE-60 encodes antibiotic resistance (Ampr), a bacterial origin of replication (ori), an IPTG-regulatable promoter operator (P/O), a ribosome binding site (RBS), a 6-His tag and restriction enzyme sites.
- pQE-60 was then digested with NcoI and BgIII. The amplified sequences were ligated into pQE-60 and were inserted in frame with the sequence encoding for the histidine tag and the ribosome binding site (RBS). The ligation mixture was then used to transform E.
- M15/rep4 coli strain M15/rep4 (Qiagen, Inc.) by the procedure described in Sambrook, J. et al., Molecular Cloning: A Laboratory Manual, Cold Spring Laboratory Press, (1989). M15/rep4 contains multiple copies of the plasmid pREP4, which expresses the lacI repressor and also confers kanamycin resistance (Kan r ). Transformants were identified by their ability to grow on LB plates and ampicillin/kanamycin resistant colonies were selected. Plasmid DNA was isolated and confirmed by restriction analysis.
- Clones containing the desired constructs are grown overnight (O/N) in liquid culture in LB media supplemented with both Amp (100 ⁇ g/ml) and Kan r (25 ⁇ g/ml).
- the O/N culture is used to inoculate a large culture at a ratio of 1:100 to 1:250.
- the cells are grown to an optical density 600 (O.D. 600 ) of between 0.4 and 0.6.
- IPTG Isopropyl-B-D-thiogalacto pyranoside
- IPTG induces by inactivating the lacI repressor, clearing the P/0 leading to increased gene expression.
- Cells are grown an extra 3 to 4 hours. Cells are then harvested by centrifugation.
- the cell pellet is solubilized in the chaotropic agent 6 Molar Guanidine HCl.
- solubilized FGF-13 is purified from this solution by chromatography on a Nickel-Chelate column under conditions that allow for tight binding by proteins containing the 6-His tag (Hochuli, E. et al., J. Chromatography 411:177-184 (1984)).
- the proteins are eluted from the column in 6 molar guanidine HC1 pH 5.0 and for the purpose of renaturation adjusted to 3 molar guanidine HCl, 100 mM sodium phosphate, 10 mmolar glutathione (reduced) and 2 mmolar glutathione (oxidized). After incubation in this solution for 12 hours the proteins are dialyzed to 10 mmolar sodium phosphate.
- the bacterial expression vector pQE70 is used for bacterial expression in this example (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311).
- pQE70 encodes ampicillin antibiotic resistance (“Ampr) and contains a bacterial origin of replication (“ori”), an IPTG inducible promoter, a ribosome binding site (“RBS”), six codons encoding histidine residues that allow affinity purification using nickel-nitrilotri-acetic acid (“Ni-NTA”) affinity resin sold by QIAGEN, Inc., supra, and suitable single restriction enzyme cleavage sites.
- a DNA fragment encoding a polypeptide may be inserted in such as way as to produce that polypeptide with the six His residues (i.e., a “6 ⁇ His tag”) covalently linked to the carboxyl terminus of that polypeptide.
- the polypeptide coding sequence is inserted such that translation of the six His codons is prevented and, therefore, the polypeptide is produced with no 6 ⁇ His tag.
- the DNA sequence encoding the desired portion of the FGF-13 protein comprising the predicted mature form of the FGF-13 amino acid sequence (i.e., amino acids 1-193 of SEQ ID NO:2) was amplified from the deposited cDNA clone using PCR oligonucleotide primers which anneal to the amino terminal sequences encoding the desired portion of the FGF-13 protein and to sequences in the deposited construct 3′ to the cDNA coding sequence. Additional nucleotides containing restriction sites to facilitate cloning in the pQE70 vector were added to the 5′ and 3′ sequences, respectively.
- the 5′ primer had the sequence 5′ CTAGTC GCATGC AGGGGGAGAATCACCCGTCT 3′ (SEQ ID NO:13) containing the underlined SphI restriction site, which includes an initiation codon and following the initiation codon, 21 nucleotides of the amino terminal coding sequence of the mature FGF-13 sequence in SEQ ID NO:2.
- the point in the protein coding sequence where the 5′ primer begins may be varied to amplify a desired portion of the complete protein shorter or longer than the mature form.
- the 3′ primer had the sequence 5′ GCTTGA AAGCTT CTACGTGAGGGGCTGGGGCCG 3′ (SEQ ID NO:14) containing the underlined HindIII restriction site followed by a stop codon and 18 nucleotides complementary to the 3′ end of the coding sequence in the FGF-13 DNA sequence in SEQ ID NO:1.
- the amplified FGF-13 DNA fragments and the vector pQE70 were digested with SphI and HindIII and the digested DNAs were then ligated together. Insertion of the FGF-13 DNA into the restricted pQE70 vector places the FGF-13 protein coding region including its associated stop codon downstream from the IPTG-inducible promoter and in-frame with the initiating AUG in the 5′ primer. The associated stop codon prevents translation of the six histidine codons downstream of the insertion point.
- E. coli strain M15/rep4 containing multiple copies of the plasmid pREP4, which expresses the lac repressor and confers kanamycin resistance (“Kan r ”), was used in carrying out the illustrative example described herein.
- This strain which is only one of many that are suitable for expressing FGF-13 protein, is available commercially from QIAGEN, Inc., supra. Transformants were identified by their ability to grow on LB plates in the presence of ampicillin and kanamycin. Plasmid DNA was isolated from resistant colonies and the identity of the cloned DNA confirmed by restriction analysis, PCR and DNA sequencing.
- Clones containing the desired constructs were grown overnight (“O/N”) in liquid culture in LB media supplemented with both ampicillin (100 ⁇ g/ml) and kanamycin (25 ⁇ g/ml).
- O/N culture was used to inoculate a large culture, at a dilution of approximately 1:25 to 1:250.
- the cells are grown to an optical density at 600 nm (“OD 600 ”) of between 0.4 and 0.6.
- Isopropyl-b-D-thiogalactopyranoside (“IPTG”) is then added to a final concentration of 1 mM to induce transcription from the lac repressor sensitive promoter, by inactivating the lacI repressor. Cells subsequently were incubated further for 3 to 4 hours and were then harvested by centrifugation.
- the cells were lysed in a microfluidizer and then stirred for 3-4 hours at 4° C. in 2M and then 6M guanidine-HCl, 50 mM tris-HCl, pH 7.5, 2 mM EDTA.
- FGF-13 protein was present in both the 2M and 6M GuHCl extracts.
- the combined GuHCLl extract was quickly diluted into a buffer containing 30 mM Tris pH7.5, 5 mM EDTA, 200 mM NaCl, 20 ug/ml Pefabloc SC, 2 ug/ml E-64 (Boeringer Mannhein).
- the refolded FGF-13 was purified through poros 50 HS (PerSeptive Biosystem) cation exchange column at pH7.
- the HS purified protein was applied to a set of poros HQ 50/poros CM 20 (PerSeptive Biosystem) anion/cation columns in a tandem chromatographic mode.
- FGF-13 was eluted from the CM column with 20 column volumes of 0.2 to 1.25M NaCl linear gradient in 24 mM NaCl, and purification was finished with a S200 sepharcryl HR (Pharmacia) size exclusion column.
- the GuHCl extracted protein appeared to be the same size as the starting material on SDS-PAGE and was greater than 60% pure. However, after refolding the protein showed three bands which appeared to be about 2 kD smaller on SDS-PAGE, suggesting that proteolytic degradation may have occurred during refolding.
- Refolded FGF-13 captured by a strong cation exchange on the poros HS 50 column eluted at 80% purity with 1M NaCl.
- the CM purified FGF-13 was put through a S200 sepharcryl HR size exclusion column. A fraction containing mainly the upper bands was isolated. The upper bands and the lower band were analyzed by N-terminus microsequencing.
- the purified FGF-13 was slot blotted onto a ProBlott membrane (Applied Biosystems, Inc. (ABI) and stained with Ponceau S (0.2% in 3% acetic acid).
- the band of interest was then excised, placed in a “Blot Cartridge” and subjected to N-terminal amino acid sequence analysis using a model ABI-494 sequencer (Perkin-Elmer-Applied Biosystems, Inc.) and the Gas-phase Blot cycles.
- the results showed that the N-terminal sequence of the upper doublet bands was as predicted for the QE70 expression construct including the N-terminal Met (i.e., MQGEN . . .
- Fibroblast proliferation assays showed that the upper and lower fractions exhibited comparable, and both fractions were more active than the His-tagged FGF-13 made using the vector of Example 1(a). These assays also showed that FGF-13 can be frozen at ⁇ 80° C. and thawed later without losing its activity.
- the upper and lower FGF-13 fractions were then combined for all further biological activity tests described herein, producing a mixture consisting of three bands with nearly equal intensity on SDS-PAGE, greater than 95% purity and a low endotoxin level of 2 EU/mg.
- the DNA sequence encoding the full length FGF-13 protein, ATCCTM No. 97148 is amplified using PCR oligonucleotide primers corresponding to the 5′ and 3′ sequences of the gene:
- the FGF-13 5′ primer has the sequence 5′ CTAGTGGATCCCGA GAATCACCCGTCTCCT 3′ (SEQ ID NO:15) and contains a BamHI restriction enzyme site (in bold) such that cloning at this site will put the baculovirus signal sequence in frame with 18 nucleotides of the FGF-13 gene downstream of the putative FGF-13 signal peptide cleavage site.
- the 3′ primer has the sequence 5′ CGACTTCTAGAACCT CGGGGATCTGGCTCC 3′ (SEQ ID NO:16) and contains the cleavage site for the restriction endonuclease XbaI and 18 nucleotides complementary to the 3′ non-translated sequence of the gene.
- the amplified sequences are isolated from a 1% agarose gel using a commercially available kit (“Geneclean,” BIO 101 Inc., La Jolla, Calif.). The fragment is then digested with the respective endonucleases and purified again on a 1% agarose gel. This fragment is designated F2.
- the vector pA2gp (modification of pVL941 vector, discussed below) is used for the expression of the proteins using the baculovirus expression system (for review see: Summers, M. D. and Smith, G. E. 1987, A manual of methods for baculovirus vectors and insect cell culture procedures, Texas Agricultural Experimental Station Bulletin No. 1555).
- This expression vector contains the strong polyhedrin promoter of the Autographa californica nuclear polyhedrosis virus (AcMNPV) followed by the recognition sites for the restriction endonucleases BamHI and XbaI.
- the polyadenylation site of the simian virus (SV)40 is used for efficient polyadenylation.
- the beta-galactosidase gene from E. coli is inserted in the same orientation as the polyhedrin promoter followed by the polyadenylation signal of the polyhedrin gene.
- the polyhedrin sequences are flanked at both sides by viral sequences for the cell-mediated homologous recombination of co-transfected wild-type viral DNA.
- Many other baculovirus vectors could be used in place of pA2 such as pRG1, pAc373, pVL941 and pAcIM1 (Luckow, V. A. and Summers, M. D., Virology, 170:31-39).
- the plasmid is digested with the restriction enzymes and dephosphorylated using calf intestinal phosphatase by procedures known in the art.
- the DNA is then isolated from a 1% agarose gel using the commercially available kit (“Geneclean” BIO 101 Inc., La Jolla, Calif.). This vector DNA is designated V2.
- Fragment F2 and the dephosphorylated plasmid V2 are ligated with T4 DNA ligase.
- E. coli DH5 cells are then transformed and bacteria identified that contained the plasmid (pBacFGF-13) using the respective restriction enzymes. The sequence of the cloned fragment are confirmed by DNA sequencing.
- 5 ⁇ g of the plasmid pBacFGF-13 are co-transfected with 1.0 ⁇ g of a commercially available linearized baculovirus (“BACULOGOLDTM baculovirus DNA”, Pharmingen, San Diego, Calif.) using the lipofection method (Feigner et al. Proc. Natl. Acad. Sci. USA, 84:7413-7417 (1987)).
- BACULOGOLDTM baculovirus DNA baculovirus DNA
- plaque assays performed similar as described by Summers and Smith (supra). As a modification an agarose gel with “Blue Gal” (Life Technologies Inc., Gaithersburg) is used which allows an easy isolation of blue stained plaques. (A detailed description of a “plaque assay” can also be found in the user's guide for insect cell culture and baculovirology distributed by Life Technologies Inc., Gaithersburg, page 9-10).
- the virus is added to the cells and blue stained plaques are picked with the tip of an Eppendorf pipette.
- the agar containing the recombinant viruses is then resuspended in an Eppendorf tube containing 20011 of Grace's medium.
- the agar is removed by a brief centrifugation and the supernatant containing the recombinant baculovirus is used to infect Sf9 cells seeded in 35 mm dishes.
- the supernatants of these culture dishes are harvested and then stored at 4° C.
- Sf9 cells are grown in Grace's medium supplemented with 10% heat-inactivated FBS.
- the cells are infected with the recombinant baculovirus V-FGF-13 at a multiplicity of infection (MOI) of 2.
- MOI multiplicity of infection
- the medium is removed and replaced with SF900 II medium minus methionine and cysteine (Life Technologies Inc., Gaithersburg).
- 5 ⁇ Ci of 35S-methionine and 5 ⁇ Ci 35S cysteine (Amersham) are added.
- the cells are further incubated for 16 hours before they are harvested by centrifugation and the labelled proteins visualized by SDS-PAGE and autoradiography.
- the expression of the predicted mature FGF-13 polypeptide uses a plasmid, FGF-13-HA derived from a vector pcDNA3/Amp (Invitrogen) containing: 1) SV40 origin of replication, 2) ampicillin resistance gene, 3) E. coli replication origin, 4) CMV promoter followed by a polylinker region, an SV40 intron and polyadenylation site.
- DNA fragments encoding the entire FGF-13 precursor and an HA tag fused in frame to the 3′ end is cloned into the polylinker region of the vector, therefore, the recombinant protein expression is directed under the CMV promoter.
- the HA tag corresponds to an epitope derived from the influenza hemagglutinin protein as previously described (I.
- HA tag to the target protein allows easy detection of the recombinant protein with an antibody that recognizes the HA epitope.
- the PCR amplified DNA fragments and the vector, pcDNA3/Amp, are digested with the respective restriction enzymes and ligated.
- the ligation mixture is transformed into E. coli strain SURE (Stratagene Cloning Systems, La Jolla, Calif.) the transformed culture is plated on ampicillin media plates and resistant colonies are selected. Plasmid DNA is isolated from transformants and examined by restriction analysis for the presence of the correct fragment.
- FGF-13 COS cells are transfected with the expression vector by DEAE-DEXTRAN method (J. Sambrook, E. Fritsch, T. Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Laboratory Press, (1989)).
- FGF-13-HA protein The expression of the FGF-13-HA protein is detected by radiolabelling and immunoprecipitation method (E. Harlow, D. Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, (1988)). Cells are labelled for 8 hours with 35S-cysteine two days post transfection. Culture media is then collected and cells are lysed with detergent (RIPA buffer (150 mM NaCl, 1% NP-40, 0.1% SDS, 1% NP-40, 0.5% DOC, 50 mM Tris, pH 7.5) (Wilson, I. et al., Id. 37:767 (1984)). Both cell lysate and culture media are precipitated with an HA specific monoclonal antibody. Proteins precipitated are analyzed on 15% SDS-PAGE gels.
- RIPA buffer 150 mM NaCl, 1% NP-40, 0.1% SDS, 1% NP-40, 0.5% DOC, 50 mM Tris, pH 7.5
- Plasmid pC4 is used for the expression of FGF-13 polypeptide.
- Plasmid pC4 is a derivative of the plasmid pSV2-dhfr (ATCCTM Accession No. 37146). To produce a soluble, secreted form of the polypeptide, the predicted mature is fused to the secretory leader sequence of the human IL-6 gene.
- the plasmid contains the mouse DHFR gene under control of the SV40 early promoter. Chinese hamster ovary- or other cells lacking dihydrofolate activity that are transfected with these plasmids can be selected by growing the cells in a selective medium (alpha minus MEM, Life Technologies) supplemented with the chemotherapeutic agent methotrexate.
- MTX methotrexate
- DHFR target enzyme
- a second gene is linked to the DHFR gene, it is usually co-amplified and over-expressed. It is known in the art that this approach may be used to develop cell lines carrying more than 1,000 copies of the amplified gene(s). Subsequently, when the methotrexate is withdrawn, cell lines are obtained which contain the amplified gene integrated into one or more chromosome(s) of the host cell.
- Plasmid pC4 contains for expressing the gene of interest the strong promoter of the long terminal repeat (LTR) of the Rouse Sarcoma Virus (Cullen, et al., Molecular and Cellular Biology , March 1985:438-447) plus a fragment isolated from the enhancer of the immediate early gene of human cytomegalovirus (CMV) (Boshart et al., Cell 41:521-530 (1985)). Downstream of the promoter are the following single restriction enzyme cleavage sites that allow the integration of the genes: BamHI, XbaI, and Asp718. Behind these cloning sites the plasmid contains the 3′ intron and polyadenylation site of the rat preproinsulin gene.
- LTR long terminal repeat
- CMV cytomegalovirus
- high efficiency promoters can also be used for the expression, e.g., the human B-actin promoter, the SV40 early or late promoters or the long terminal repeats from other retroviruses, e.g., HIV and HTLVI.
- Clontech's Tet-Off and Tet-On gene expression systems and similar systems can be used to express the FGF-13 polypeptide in a regulated way in mammalian cells (Gossen, M., & Bujard, H. 1992 , Proc. Natl. Acad. Sci. USA 89:5547-5551).
- Other signals e.g., from the human growth hormone or globin genes can be used as well.
- Stable cell lines carrying a gene of interest integrated into the chromosomes can also be selected upon cotransfection with a selectable marker such as gpt, G418 or hygromycin. It is advantageous to use more than one selectable marker in the beginning, e.g., G418 plus methotrexate.
- the plasmid pC4 is digested with the restriction enzymes BamHI and XbaI and then dephosphorylated using calf intestinal phosphates by procedures known in the art.
- the vector is then isolated from a 1% agarose gel.
- the DNA sequence encoding the mature FGF-13 polypeptide is amplified using PCR oligonucleotide primers corresponding to the 5′ and 3′ sequences of the desired portion of the gene.
- the 5′ primer containing the underlined BamHI site which overlaps with a Kozak sequence, an AUG start codon, a sequence encoding the secretory leader peptide from the human IL-6 gene, and 21 nucleotides of the 5′ coding region of the mature FGF-13 polypeptide has the following sequence: 5′ CTAGCC GGATCC GCCACCATGAACTCCTTCTCCACAAGCGCCTTCGGT CCAGTTGCCTTCTCCCTGGGGCTGCTCCTGGTGTTGCCTGCTGCOTTCCC TGCCCCAGTTGTGAGACCAGGGGGAGAATCACCCGTCT 3′ (SEQ ID NO:17).
- the 3′ primer containing the underlined XbaI and 18 of nucleotides complementary to the 3′ coding sequence immediately before the stop codon as shown in FIGS. 1 A-D (SEQ ID NO:1), has the following sequence: 5′ GCTTGATCTAGACGTGAGGGGCTGGGGCCG 3′ (SEQ ID NO:18).
- the amplified fragment is digested with the endonucleases BamHI and XbaI and then purified again on a 1% agarose gel.
- the isolated fragment and the dephosphorylated vector are then ligated with T4 DNA ligase.
- E. coli HB101 or XL-1 Blue cells are then transformed and bacteria are identified that contain the fragment inserted into plasmid pC4 using, for instance, restriction enzyme analysis.
- Chinese hamster ovary cells lacking an active DHFR gene are used for transfection.
- Five gg of the expression plasmid pC4 is cotransfected with 0.5 ⁇ g of the plasmid pSVneo using lipofectin (Feigner et al., supra).
- the plasmid pSV2-neo contains a dominant selectable marker, the neo gene from Tn5 encoding an enzyme that confers resistance to a group of antibiotics including G418.
- the cells are seeded in alpha minus MEM supplemented with 1 mg/ml G418.
- the cells are trypsinized and seeded in hybridoma cloning plates (Greiner, Germany) in alpha minus MEM supplemented with 10, 25, or 50 ng/ml of metothrexate plus 1 mg/ml G418. After about 10-14 days single clones are trypsinized and then seeded in 6-well petri dishes or 10 ml flasks using different concentrations of methotrexate (50 nM, 100 nM, 200 nM, 400 nM, 800 nM).
- methotrexate 50 nM, 100 nM, 200 nM, 400 nM, 800 nM.
- Clones growing at the highest concentrations of methotrexate are then transferred to new 6-well plates containing even higher concentrations of methotrexate (1 ⁇ M, 2 ⁇ M, 5 ⁇ M, 10 mM, 20 mM). The same procedure is repeated until clones are obtained which grow at a concentration of 100-200 ⁇ M. Expression of the desired gene product is analyzed, for instance, by SDS-PAGE and Western blot or by reversed phase HPLC analysis.
- Fibroblasts are obtained from a subject by skin biopsy.
- the resulting tissue is placed in tissue-culture medium and separated into small pieces. Small chunks of the tissue are placed on a wet surface of a tissue culture flask, approximately ten pieces are placed in each flask.
- the flask is turned upside down, closed tight and left at room temperature over night. After 24 hours at room temperature, the flask is inverted and the chunks of tissue remain fixed to the bottom of the flask and fresh media (e.g., Ham's F12 media, with 10% FBS, penicillin and streptomycin, is added. This is then incubated at 37° C. for approximately one week. At this time, fresh media is added and subsequently changed every several days. After an additional two weeks in culture, a monolayer of fibroblasts emerge. The monolayer is trypsinized and scaled into larger flasks.
- fresh media e.g., Ham's F12 media, with 10% FBS, penicillin and streptomycin
- pMV-7 (Kirschmeier, P. T. et al, DNA, 7:219-25 (1988) flanked by the long terminal repeats of the Moloney murine sarcoma virus, is digested with EcoRI and HindIII and subsequently treated with calf intestinal phosphatase.
- the linear vector is fractionated on agarose gel and purified, using glass beads.
- the cDNA encoding a polypeptide of the present invention is amplified using PCR primers which correspond to the 5′ and 3′ end sequences respectively.
- Equal quantities of the Moloney murine sarcoma virus linear backbone and the EcoRI and HindIII fragment are added together, in the presence of T4 DNA ligase.
- the resulting mixture is maintained under conditions appropriate for ligation of the two fragments.
- the ligation mixture is used to transform bacteria HB101, which are then plated onto agar-containing kanamycin for the purpose of confirming that the vector had the gene of interest properly inserted.
- the amphotropic pA317 or GP+am12 packaging cells are grown in tissue culture to confluent density in Dulbecco's Modified Eagles Medium (DMEM) with 10% calf serum (CS), penicillin and streptomycin.
- DMEM Dulbecco's Modified Eagles Medium
- CS calf serum
- penicillin and streptomycin The MSV vector containing the gene is then added to the media and the packaging cells are transduced with the vector.
- the packaging cells now produce infectious viral particles containing the gene (the packaging cells are now referred to as producer cells).
- Fresh media is added to the transduced producer cells, and subsequently, the media is harvested from a 10 cm plate of confluent producer cells.
- the spent media containing the infectious viral particles, is filtered through a millipore filter to remove detached producer cells and this media is then used to infect fibroblast cells.
- Media is removed from a sub-confluent plate of fibroblasts and quickly replaced with the media from the producer cells. This media is removed and replaced with fresh media. If the titer of virus is high, then virtually all fibroblasts will be infected and no selection is required. If the titer is very low, then it is necessary to use a retroviral vector that has a selectable marker, such as neo or his.
- the engineered fibroblasts are then injected into the host, either alone or after having been grown to confluence on cytodex 3 microcarrier beads.
- the fibroblasts now produce the protein product.
- Astrocyte and Neuronal Assays Recombinant FGF-13, expressed in Escherichia coli and purified as described above, was tested for activity in promoting the survival, neurite outgrowth, or phenotypic differentiation of cortical neuronal cells and for inducing the proliferation of glial fibrillary acidic protein immunopositive cells, astrocytes.
- the selection of cortical cells for the bioassay is based on the prevalent expression of FGF-1 and FGF-2 in cortical structures and on the previously reported enhancement of cortical neuronal survival resulting from FGF-2 treatment.
- FGF-13 was tested to see whether it would induce a change in the level of phenotypic differentiation of one of the neuronal populations, the GABAergic neurons, present in the cortical cultures. After a 7 day treatment period, the level of high-affinity GABA-uptake increased as a function of the concentration of FGF-13 ( FIG. 5 ). The GABAergic neuronal response appeared to be more sensitive to FGF-13 than the general cell survival response since the maximal induction of GABA-uptake occurred with 10 as opposed to 50 ng/ml of FGF-13.
- Astrocytes are the major non-neuronal cell type present in the cortical cultures.
- FGF-1 acidic FGF
- FGF-2 and FGF-9 are mitogens for astrocytes.
- FGF-1, FGF-2, or FGF-9 produced a 5- to 10-fold increase in the level of [ 3 H]-thymidine incorporation.
- maximal responses were achieved in the range of 10 to 50 ng/ml.
- treatment with FGF-13 in the presence of 100 ng/ml heparin, produced a concentration dependent increase in [ 3 H]-thymidine incorporation up to 150 ng/ml. The addition of heparin caused an apparent shift to the left in the dose response curve.
- FIG. 8 summarizes the displacement curves for FGF-2, FGF-10, and FGF-13.
- concentration of FGF-2 or FGF-13 required to achieve 50% displacement was 200 and 1000 pM, respectively.
- Fibroblast and endothelial cell assays Human lung fibroblasts were obtained from Clonetics (San Diego, Calif.) and maintained in growth media from Clonetics. Dermal microvascular endothelial cells were obtained from Cell Applications (San Diego, Calif.). For proliferation assays, the human lung fibroblasts and dermal microvascular endothelial cells were cultured at 5,000 cells/well in a 96-well plate for one day in growth medium. The cells were then incubated for one day in 0.1% BSA basal medium. After replacing the medium with fresh 0.1% BSA medium, the cells were incubated with the test proteins for 3 days.
- ALAMAR BLUETM (Alamar Biosciences, Sacramento, Calif.) was added to each well to a final concentration of 10%. The cells were incubated for 4 hr. Cell viability was measured by reading in a CytoFluor fluorescence reader.
- the human lung fibroblasts were cultured at 5,000 cells/well in a 96-well plate for one day. After a medium change to 0.1% BSA basal medium, the cells were incubated with FGF-2 or FGF-13 with or without IL-l ⁇ for 24 hours. The supernatants were collected and assayed for PGE 2 by EIA kit (Cayman, Ann Arbor, Mich.).
- the human lung fibroblasts were cultured at 5,000 cells/well in a 96-well plate for one day. After a medium change to .0.1% BSA basal medium, the cells were incubated with FGF-2 or FGF-13 with or without IL-la for 24 hours. The supernatants were collected and assayed for IL-6 by ELISA kit (Endogen, Cambridge, Mass.).
- FGF-2 Human lung fibroblasts were cultured with FGF-2 or FGF-13 for 3 days in basal medium before the addition of ALAMAR BLUETM to assess effects on growth of the fibroblasts.
- FGF-2 showed stimulation at 10-2500 ng/ml while FGF-13 showed stimulation at 1000-2500 ng/ml ( FIG. 9 ). However, the maximal effect was similar. In contrast to FGF-2, FGF-13 did not have any stimulatory effect on dermal endothelial cells ( FIG. 10 ).
- FGF-2 and FGF-13 did not have any effect on PGE 2 and IL-6 release, from the fibroblasts.
- IL-la showed stimulation of PGE 2 and IL-6.
- Both FGF-2 and FGF-13 acted synergistically with IL-la to release PGE 2 ( FIG. 11 ) and IL-6 ( FIG. 12 ).
- FGF-13 at 2,500 ng/ml gave a similar effects as 100 ng/ml FGF-2.
- Indomethacin at 100 ng/ml inhibited PGE 2 release but not IL-6 release from the fibroblasts.
- Angiogenesis assays In vivo angiogenesis assay of FGF-13 measures the ability of an existing capillary network to form new vessels in an implanted capsule of marine extracellular matrix material (Matrigel).
- the protein is mixed with the liquid Matrigel at 4° C. and the mixture is then injected subcutaneously in mice where it solidifies. After 7 days, the solid “plug” of Matrigel is removed and examined for the presence of new blood vessels.
- Matrigel was purchased. from Becton Dickinson Labware/Collaborative Biomedical Products.
- the Matrigel material When thawed at 4° C. the Matrigel material is a liquid.
- the Matrigel was mixed with FGF-13 at 150 ng/ml at 4° C. and drawn into cold 3 ml syringes.
- Female C57B1/6 mice approximately 8 weeks old were injected with the mixture of Matrigel and experimental protein at 2 sites at the midventral aspect of the abdomen (0.5 ml/site). After 7 days, the mice were sacrificed by cervical dislocation, the Matrigel plugs were removed and cleaned (i.e., all clinging membranes and fibrous tissue is removed).
- Replicate whole plugs were fixed in neutral buffered 10% formaldehyde, embedded in paraffin and used to produce sections for histological examination after staining with Masson's Trichrome. Cross sections from 3 different regions of each plug were processed. Selected sections were stained for the presence of vWF.
- the positive control for this assay was bovine basic FGF (150 ng/ml). Matri
- FGF-13 was weakly positive in that a small number of infiltrating of cells were observed at the peripheral edge of the Matrigel plug. Immunostaining with antibody to vWF did not reveal vWF-positive endothelial cells. Protocols such as the above which are known in the art generally quantify angiogenesis only by determining the total cellularity of the plug, a procedure which may not give a complete assessment of angiogenic activity of the protein.
- Parkinson's disease The observed loss of motor function in Parkinson's disease is attributed to a deficiency of striatal dopamine resulting from the degeneration of the nigrostriatal dopaminergic projection neurons.
- An animal model for Parkinson's that has been extensively characterized involves the systemic administration of 1-methyl-4 phenyl 1,2,3,6-tetrahydropyridine (MPTP).
- MPTP is taken-up by astrocytes and catabolized by monoamine oxidase B to 1-methyl-4-phenyl pyridine (MPP + ) and released.
- MPP + is actively accumulated in dopaminergic neurons by the high-affinity reuptake transporter for dopamine.
- MMP is then concentrated in mitochondria by the electrochemical gradient and selectively inhibits nicotidamide adenine disphosphate: ubiquinone oxidoreductionase (complex thereby interfering with electron transport and eventually generating oxygen radicals.
- FGF-2 basic FGF
- Dr. Unsicker's group has demonstrated that administering FGF-2 in gel foam implants in the striatum results in the near complete protection of nigral dopaminergic neurons from the toxicity associated with MPTP exposure (Otto and Unsicker, J. Neuroscience, 1990).
- FGF-13 was evaluated to determine whether it has an action similar to that of FGF-2 in enhancing dopaminergic neuronal survival in vitro and it was then be tested in vivo for protection of dopaminergic neurons in the striatum from the damage associated with MPTP treatment.
- the potential effect of FGF-13 was first examined in vitro in a dopaminergic neuronal cell culture paradigm. The cultures were prepared by dissecting the midbrain floor plate from gestation day 14 Wistar rat embryos. The tissue was dissociated with trypsin and seeded at a density of 200,000 cells/cm 2 on polyorthinine-laminin coated glass coverslips.
- the cells were maintained in Dulbecco's Modified Eagle's medium and F12 medium containing hormonal supplements (N1). The cultures were fixed with paraformaldehyde after 8 days in vitro and were processed for tyrosine hydroxylase, a specific marker for dopminergic neurons, immunohistochemical staining.
- FIG. 14 FGF-13 Increases the Number of Tyrosine Hydroxylase immunopositive Neurons. Dissociated cell cultures were prepared from embryonic rats. The culture medium was changed every third day and the factors were also added at that time.
- Parkinson's Conclusion Since the dopaminergic neurons were isolated from animals at gestation day 14, a developmental time which is past the stage when the dopaminergic precursor cells are proliferating, the increase in the number of tyrosine hydroxylase immunopositive neurons represents an increase in the number of dopaminergic neurons surviving in vitro. Therefore, FGF-13 acts to prolong the survival of dopaminergic neurons which is needed in Parkinson's Disease.
- FGF-13 Biological Activity Conclusions. FGF-13 increases the number of cells, neurite outgrowth, and the level of neuronal specific high-affinity GABA-uptake in cortical cultures derived from embryos at gestation day 16. The results from proliferation assays using purified hippocampal astrocytes demonstrate that FGF-13 increases the amount of [ 3 H]-thymidine incorporation in astrocyte cultures. Although the cortical cell cultures are maintained in serum-free medium in order to inhibit non-neuronal cell proliferation, increases in the number of astrocytes were noted following FGF-2 and FGF-13 treatments. Thus, a portion of the increase in the number of cells observed following FGF-13 treatment is due to the proliferation of astrocytes. However, the robust increase in the neuronal marker (GABA-uptake) suggests that a direct neuronal response is also occurring.
- FGF-13 acted similarly to FGF-2 in human lung fibroblasts to stimulate proliferation. Neither had any—effect on IL-6 and PGE 2 release from fibroblasts but both acted synergisticly with IL-l ⁇ . In contrast to FGF-2, however, FGF-13 did not stimulate proliferation in the dermal microvascular endothelial cells. Dopaminergic neuron survival was increased by FGF-13 administration indicating it may have therapeutic benefits in Parkinson's Disease.
- the bacterial expression vector pHE-4 or pHE-4-5 is used for bacterial expression in this example.
- pHE-4 encodes kanamycin antibiotic resistance (“Kan”) and contains a bacterial origin of replication (“ori”), an IPTG inducible promoter, a ribosome binding site (“RBS”), and suitable single restriction enzyme cleavage sites. These elements are arranged such that a DNA fragment encoding a polypeptide may be inserted in such a way as to produce that polypeptide corresponding to the DNA fragment.
- the novel pHE4 series of bacterial expression vectors in particular, the pHE4-5 vector may be used for bacterial expression in this example.
- the expression plasmid pHE4-5/MPIF ⁇ 23 vector plasmid DNA contains an insert which encodes another ORF.
- the construct was deposited with the American Type Culture Collection, 12301 Park Lawn Drive, Rockville, Md. 20852, on Sep. 30, 1997 and given Accession No. 209311.
- the pHE4-5 bacterial expression vector includes a neomycin phosphotransferase gene for selection, an E. coli origin of replication, a T5 phage promoter sequence, two lac operator sequences, a Shine-Delgarno sequence, and the lactose operon repressor gene (lacIq). These elements are arranged such that an inserted DNA fragment encoding a polypeptide expresses that polypeptide with the six His residues (i.e., a “6 ⁇ His tag”) covalently linked to the amino terminus of that polypeptide.
- the promoter and operator sequences of the pHE4-5 vector were made synthetically. Synthetic production of nucleic acid sequences is well known in the art (CLONETECH 95/96 Catalog, pages 215-216, CLONETECH, 1020 East Meadow Circle, Palo Alto, Calif. 94303).
- the DNA sequence encoding the desired portion of the mature FGF-13 protein (i.e., amino acids 20-193 of SEQ ID NO:2) was amplified from the deposited cDNA clone using PCR oligonucleotide primers which anneal to the amino terminal sequences encoding the desired portion of the FGF-13 protein and to sequences in the deposited construct 3′ to the cDNA coding sequence. Additional nucleotides containing restrictions sites to facilitate cloning in the pHE-4 vector were added to the 5′ and 3′ sequences respectively.
- the 5′ primer had the sequence 5′ GGG AAT TC C ATA TG A CCG ACC AGC TGA GCA GG (SEQ ID NO:19) containing the underlined Nde I restriction site, which includes an initiation codon and following the initiation codon, 19 nucleotides of the amino terminal coding sequence of the FGF-13 sequence in SEQ ID NO:2.
- the point in the protein coding sequence where the 5′ primer begins may be varied to amplify a desired portion of the complete protein shorter or longer than the mature form.
- the 3′ primer had the sequence GCCCGG GGTACC TTACGTGAGGGGCTUGGGCCG (SEQ ID NO:20 containing the underlined ASP 718 restriction site followed by a stop codon and 18 nucleotides complementary to the 3′ end of the coding sequence in the FGF-13 DNA sequence in SEQ ID NO:1.
- the 5′ primer had the sequence 5′ GGGAATTC CATATG CAGGGGGAGAATCACCCGTCT 3′ (SEQ ID NO:21 containing the underlined Nde I restriction site, which includes an initiation codon and following the initiation codon, 18 nucleotides of the amino terminal coding sequence of the FGF-13 sequence in SEQ ID NO:2.
- SEQ ID NO:21 containing the underlined Nde I restriction site, which includes an initiation codon and following the initiation codon, 18 nucleotides of the amino terminal coding sequence of the FGF-13 sequence in SEQ ID NO:2.
- the point in the protein coding sequence where the 5′ primer begins may be varied to amplify a desired portion of the complete protein shorter or longer than the mature form.
- the 3′ primer had the sequence GCCCGG GGTACC TTACTTGGTCCGACGGGTGGG (SEQ ID NO:22) containing the underlined ASP 718 restriction site followed by a stop codon and 18 nucleotides complementary to the 3′ end of the coding sequence in the FGF-13 DNA sequence in SEQ ID NO:1.
- this sequence was mutated using a 5′ primer of the sequence GGGAATTC CATATG CAGGGGGAGAATCACCCGTCTCCTAATT TTAACCAGTAGGTGCGTGACCAGGGCCATG (SEQ ID NO 23) containing the underlined Nde I restriction site which includes an initiation codon and following the initiation codon 60 nucleotides of the amino terminal coding sequence of the FGF-13 sequence is SEQ ID NO:2.
- the 3′ primer has the sequence of either SEQ ID NO:20 or SEQ ID NO:22.
- the amplified FGF-13 DNA fragments and the vector pHE-4 were digested with Nde I and ASP 718 and the digested DNAs were then ligated together. Insertion of the FGF-13 DNA into the restricted pHE-4 vector places the FGF-13 protein coding region including its associated stop codon downstream from the IPTG-inducible promoter and in-frame with the initiating AUG in the 5′ primer.
- E. coli strain DH5 ⁇ was used in carrying out the illustrative example described herein. This strain, which is only one of many that are suitable for expressing FGF-13 protein, is available commercially from Life Technologies, Inc., Rockville, Md. Transformants were identified by their ability to grow on LB plates in the presence of kanamycin. Plasmid DNA was isolated from resistant colonies and the identity of the cloned DNA confirmed by restriction analysis, PCR and DNA screening.
- Clones containing the desired constructs were grown overnight (“O/N”) in liquid culture in LB media supplemented with kanamycin (25 ⁇ g/ml).
- O/N culture was used to inoculate a large culture, at a dilution of approximately 1:25 to 1:250.
- the cells are grown to an optical density at 600 nm (“OD 600 ”) of between 0.4 and 0.6.
- Isopropyl-b-d-thiogalactopyranoside (“IPTG”) is then added to a final concentration of 1 mM to induce transcription from the lac repressor sensitive promoter, by inactivating the lacI repressor.
- IPTG Isopropyl-b-d-thiogalactopyranoside
- Amino and/or Carboxy terminal deletion variants of FGF-13 may be prepared using the primers disclosed in A-D to produce the variants described below. The restriction enzyme sites created are indicated. These variants may be produced using the expression systems disclosed in Example 6.
- A. Deletion Variant 1 (FGF13 Primers & Construct Seqs) 5′ Delta 42/3′ Delta 9 (SEQ ID NO 24) 5′ Nde I delta 42 ggg aat tcc ata tga ccg acc agc tga gca gg (SEQ ID NO 25) 3′ delta 9 Asp 718 (6335) gcc cgg ggt acc tta ctt ggt ccg acg ggt ggg (SEQ ID NO 26) ATGACCGACCAGCTGAGCAGGCGGCAGATCCGCGAGTACCAACTCTACAG CAGGACCAGTGGCAAGCACGTGCAGGTCACCGGGCGTCGCATCTCCGCCA CCGCCGAGGACGGCAACAAGTTTGCCAAGCTCATAGTGGAGACGGACACG TTTGGCAGCCGGGTTCGCATCAAAGGGGCTGAGAGTGAAGTACATCTG TATGAACAAGAGGGGCAAGCTCATCGGGAA
- Deletion Variant 4 (5′ Delta 23 SDG Deletion/3′ Full) (SEQ ID NO 36) 5′ NdeI Delta 23 SDG (6881) deletion GGG AAT TCC ATA TGC AGG GGG AGA ATC ACC CGT CTC CTA ATT TTA ACC AGT ACG TGC GTG ACC AGG GCG CCA TG (SEQ ID NO 37) 3′ FULL ASP 718 (6638) GCC CGG GGT ACC TTA CGT GAG GGG CTG GGG CCG
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- Environmental Sciences (AREA)
- Neurosurgery (AREA)
- Neurology (AREA)
- Biomedical Technology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Zoology (AREA)
- Medicinal Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Toxicology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Public Health (AREA)
- Veterinary Medicine (AREA)
- General Chemical & Material Sciences (AREA)
- Animal Husbandry (AREA)
- Biodiversity & Conservation Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Molecular Biology (AREA)
- Genetics & Genomics (AREA)
- Pharmacology & Pharmacy (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Psychiatry (AREA)
- Hospice & Palliative Care (AREA)
- Psychology (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
The present invention relates to a novel FGF-13 protein which is a member of the fibroblast growth factor (FGF) family. In particular, isolated nucleic acid molecules are provided encoding the human FGF-13 protein. FGF-13 polypeptides are also provided as are vectors, host cells and recombinant methods for producing the same. The invention further relates to screening methods for identifying agonists and antagonists of FGF-13 activity. Also provided are diagnostic methods for detecting FGF-13-related disorders and therapeutic methods for treating FGF-13-related disorders. Disclosed is a method of prolonging dopaminergic neuron survival.
Description
- This application is a continuation of U.S. application Ser. No. 10/123,481, filed Apr. 17, 2002, which is a divisional of U.S. application Ser. No. 08/976,315, filed Nov. 21, 1997 (now U.S. Pat. No. 6,403,557), which is a continuation-in-part of U.S. application Ser. No. 08/462,965, filed Jun. 5, 1995 (now U.S. Pat. No. 5,728,546), said No. 08/976,315 is also a continuation-in-part of PCT Application No. PCT/US095/07108, filed Jun. 5, 1995, which published in English under PCT Art. 21(2); said No. 08/976,315 also claims the benefit of U.S. Provisional Application Nos. 60/031,969, filed Nov. 27, 1996, and 60/031,575, filed Dec. 4, 1996. The disclosure of each of these applications is incorporated herein by reference.
- This application refers to a “Sequence Listing” listed below, which is provided as a text document. The document is entitled “PF171P1D1C1_SeqListing.txt” (40,948 bytes, created Mar. 13, 2007), and is hereby incorporated by reference in its entirety herein.
- This invention relates to newly identified polynucleotides, polypeptides encoded by such polynucleotides, the use of such polynucleotides and polypeptides, as well as the production of such polynucleotides and polypeptides. More particularly, the polypeptide of the present invention have been putatively identified as fibroblast growth factor/heparin binding growth factor, hereinafter referred to as Fibroblast Growth Factor-13 (hereafter, “FGF-13”). The invention also relates to inhibiting the action of such polypeptides.
- Fibroblast growth factors are a family of proteins characteristic of binding to heparin and are, therefore, also called heparin binding growth factors (HBGF). Expression of different members of these proteins are found in various tissues and are under particular temporal and spatial control. These proteins are potent mitogens for a variety of—cells of mesodermal, ectodermal, and endodennal origin, including fibroblasts, corneal and vascular endothelial cells, granulocytes, adrenal cortical cells, chondrocytes, myoblasts, vascular smooth muscle cells, lens epithelial cells, melanocytes, keratinocytes, oligodendrocytes, astrocytes, osteoblasts, and hematopoietic cells.
- Each member has functions overlapping with others and also has its unique spectrum of functions. In addition to the ability to stimulate proliferation of vascular endothelial cells, both FGF-1 and 2 are chemotactic for endothelial cells and FGF-2 has been shown to enable endothelial cells to penetrate the basement membrane. Consistent with these properties, both FGF-1 and 2 have the capacity to stimulate angiogene'sis. Another important feature of these growth factors is their ability to promote wound healing. Many other members of the FGF family share similar activities with FGF-1 and 2 such as promoting angiogenesis and wound healing. Several members of the FGF family have been shown to induce mesoderm formation and to modulate differentiation of neuronal cells, adipocytes and skeletal muscle cells.
- Other than these biological activities in normal tissues, FGF proteins have been implicated in promoting tumorigenesis in carcinomas and sarcomas by promoting tumor vascularization and as transforming proteins when their expression is deregulated.
- The FGF family presently consists of eight structurally-related polypeptides: basic FGF, acidic FGF,
int 2,hst 1/k-FGF, FGF-5, FGF-6, keratinocyte growth factor, AIGF (FGF-8); and recently a glia-activating factor has been shown to be a novel heparin-binding growth factor which was purified from the culture supernatant of a human glioma cell line (Miyamoto, M. et al., Mol. and Cell. Biol., 13(7):4251-4259 (1993). The genes for each have been cloned and sequenced. Two of the members, FGF-1 and FGF-2, have been characterized under many names, but most often as acidic and basic fibroblast growth factor, respectively. The normal gene products influence the general proliferation capacity of the majority of mesoderm and neuroectoderm-derived cells. They are capable of inducing angiogenesis in vivo and may play important roles in early development (Burgess, W. H. and Maciag, T., Ann. Rev. Biochem., 58:575-606 (1989)). - Many of the above-identified members of the FGF family also bind to the same receptors and elicit a second message through binding to these receptors.
- A eukaryotic expression vector encoding a secreted form of FGF-1 has been introduced by gene transfer into porcine arteries. This model defines gene function in the arterial wall in vivo. FGF-1 expression induced intimal thickening in
porcine arteries 21 days after gene transfer (Nabel, E. G., et al., Nature, 362:844-6 (1993)). It has further been demonstrated that basic fibroblast growth factor may regulate glioma growth and progression independent of its role in tumor angiogenesis and that basic fibroblast growth factor release or secretion may be required for these actions (Morrison, R. S., et al., J. Neurosci. Res. 34:502-509 (1993)). - Fibroblast growth factors, such as basic FGF, have further been implicated in the growth of Kaposi's sarcoma cells in vitro (Huang, Y. Q., et al., J. Clin. Invest 91:1191-1197 (1993)). Also, the cDNA sequence encoding human basic fibroblast growth factor has been cloned downstream of a transcription promoter recognized by the bacteriophage T7 RNA polymerase. Basic fibroblast growth factors so obtained have been shown to have biological activity indistinguishable from human placental fibroblast growth factor in mitogenicity, synthesis of plasminogen activator and angiogenesis assays (Squires, C. H., et al., J. Biol. Chem. 263:16297-16302 (1988)).
- U.S. Pat. No. 5,155,214 discloses substantially pure mammalian basic fibroblast growth factors and their production. The amino acid sequences of bovine and human basic fibroblast growth factor are disclosed, as well as the DNA sequence encoding the polypeptide of the bovine species.
- Newly discovered FGF-9 has around 30% sequence similarity to other members of the FGF family. Two cysteine residues and other consensus sequences in family members were also well conserved in the FGF-9 sequence. FGF-9 was found to have no typical signal sequence in its N terminus like those in acidic and basic FGF. However, FGF-9 was found to be secreted from cells after synthesis despite its lack of a typical signal sequence FGF (Miyamoto, M. et al., Mol. and Cell. Biol. 13(7):4251-4259 (1993). Further, FGF-9 was found to stimulate the cell growth of
oligodendrocyte type 2 astrocyte progenitor cells, BALB/c 3T3, and PC-12 cells but not that of human umbilical vein endothelial cells (Naruo, K., et al., J. Biol. Chem. 268:2857-2864 (1993). - Basic FGF and acidic FGF are potent modulators of cell proliferation, cell motility, differentiation, and survival and act on cell types from ectoderm, mesoderm and endoderm. These two FGFs, along with KGF and AIGF, were identified by protein purification. However, the other four members were isolated as oncogenes, expression of which was restricted to embryogenesis and certain types of cancers. FGF-9 was demonstrated to be a mitogen against glial cells. Members of the FGF family are reported to have oncogenic potency. FGF-9 has shown transforming potency when transformed into BALB/c 3T3 cells (Miyamoto, M., et al., Mol. Cell. Biol. 13(7):4251-4259 (1993).
- Androgen induced growth factor (AIGF), also known as FGF-8, was purified from a conditioned medium of mouse mammary carcinoma cells (SC-3) simulated with testosterone. AIGF is a distinctive FGF-like growth factor, having a putative signal peptide and sharing 30-40% homology with known members of the FGF family. Mammalian cells transformed with AIGF shows a remarkable stimulatory effect on the growth of SC-3 cells in the absence of androgen. Therefore, AIGF mediates androgen-induced growth of SC-3 cells, and perhaps other cells, since it is secreted by the tumor cells themselves.
- The polypeptide of the present invention has been putatively identified as a member of the FGF family as a result of amino acid sequence homology with other members of the FGF family.
- In accordance with one aspect of the present invention, there are provided novel mature polypeptides as well as biologically active and diagnostically or therapeutically useful fragments, analogs and derivatives thereof. The polypeptides of the present invention are of human origin.
- In accordance with another aspect of the present invention, there are provided isolated nucleic acid molecules encoding the polypeptides of the present invention, including mRNAs, DNAs, cDNAs, genomic DNA, as well as antisense analogs thereof and biologically active and diagnostically or therapeutically useful fragments thereof.
- Thus, the present invention provides isolated nucleic acid molecules comprising a polynucleotide encoding at least a portion of the FGF-13 polypeptide having the complete amino acid sequence shown in SEQ ID NO:2 or the complete amino acid sequence encoded by the cDNA clone deposited as plasmid DNA in a bacterial host as ATCC™ Deposit Number 97148 on May 12, 1995. The nucleotide sequence determined by sequencing the deposited FGF-13 clone, which is shown in FIGS. 1A-D (SEQ ID NO:1), contains an open reading frame encoding a complete polypeptide of 216 amino acid residues, including an initiation codon encoding an N-terminal methionine at
nucleotide positions 1 to 3. Nucleic acid molecules of the invention include those encoding the complete amino acid sequence excepting the N-terminal methionine shown in SEQ ID NO:2, or the complete amino acid sequence excepting the N-terminal methionine encoded by the cDNA clone in ATCC™ Deposit Number 97148, which molecules also can encode additional amino acids fused to the N-terminus of the FGF-13 amino acid sequence. - Accordingly, one aspect of the invention provides an isolated nucleic acid molecule comprising a polynucleotide comprising a nucleotide sequence selected from the group consisting of: (a) a nucleotide sequence encoding the FGF-13 polypeptide having the complete amino acid sequence in SEQ ID NO:2 excepting the N-terminal methionine (i.e., positions −22 to 193 of SEQ ID NO:2); (b) a nucleotide sequence encoding the predicted mature FGF-13 polypeptide having the amino acid sequence from about
position 1 to about position 193 in SEQ ID NO:2; (c) a nucleotide sequence encoding the FGF-13 polypeptide having the complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97148; and (d) a nucleotide sequence encoding the mature FGF-13 polypeptide having the amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97148; and (e) a nucleotide sequence complementary to any of the nucleotide sequences in (a), (b), (c), or (d) above. - Further embodiments of the invention include isolated nucleic acid molecules that comprise a polynucleotide having a nucleotide sequence at least 90% identical, and more preferably at least 95%, 96%, 97%, 98% or 99% identical, to any of the nucleotide sequences in (a), (b), (c), (d) or (e), above, or a polynucleotide which hybridizes under stringent hybridization conditions to a polynucleotide in (a), (b), (c), (d) or (e), above. This polynucleotide which hybridizes does not hybridize under stringent hybridization conditions to a polynucleotide having a nucleotide sequence consisting of only A residues or of only T residues. An additional nucleic acid embodiment of the invention relates to an isolated nucleic acid molecule comprising a polynucleotide which encodes the amino acid sequence of an epitope-bearing portion of an FGF-13 polypeptide having an amino acid sequence in (a), (b), (c) or (d), above.
- In accordance with still another aspect of the present invention, there are provided processes for producing such polypeptides by recombinant techniques through the use of recombinant vectors, such as cloning and expression plasmids useful as reagents in the recombinant production of the polypeptides of the present invention, as well as recombinant prokaryotic and/or eukaryotic host cells comprising a nucleic acid sequence encoding a polypeptide of the present invention.
- In accordance with a further aspect of the present invention, there is provided a process for utilizing such polypeptides, or polynucleotides encoding such polypeptides, for screening for agonists and antagonists thereto and for therapeutic purposes, for example, promoting wound healing for example as a result of burns and ulcers, to prevent neuronal damage associated with stroke and due to neuronal disorders and promote neuronal growth for example Parkinson's disease, and to prevent skin aging and hair loss, to stimulate angiogenesis, mesodermal induction in early embryos and limb regeneration.
- In accordance with yet a further aspect of the present invention, there are provided antibodies against such polypeptides.
- In accordance with yet another aspect of the present invention, there are provided antagonists against such polypeptides and processes for their use to inhibit the action of such polypeptides, for example, in the treatment of cellular transformation, for example, tumors, to reduce scarring and treat hyper-vascular diseases.
- In accordance with another aspect of the present invention, there are provided nucleic acid probes comprising nucleic acid molecules of sufficient length to specifically hybridize to a polynucleotide encoding a polypeptide of the present invention.
- In another embodiment, the invention provides an isolated antibody that binds specifically to an FGF-13 polypeptide having an amino acid sequence described in (a), (b), (c) or (d) above. The invention further provides methods for isolating antibodies that bind specifically to an FGF-13 polypeptide having an amino acid sequence as described herein. Such antibodies are useful diagnostically or therapeutically as described below.
- In accordance with yet another aspect of the present invention, there are provided diagnostic assays for detecting diseases or susceptibility to diseases related to mutations in a nucleic acid sequence of the present invention and for detecting over-expression or under-expression of the polypeptides encoded by such sequences.
- In accordance with another aspect of the present invention, there is provided a process for utilizing such polypeptides, or polynucleotides encoding such polypeptides, for in vitro purposes related to scientific research, synthesis of DNA and manufacture of DNA vectors. Thus, the invention also provides pharmaceutical compositions comprising FGF-13 polypeptides, particularly human FGF-13 polypeptides. Methods of treating individuals in need of FGF-13 polypeptides are also provided. The invention further provides compositions comprising an FGF-13 polynucleotide or an FGF-13 polypeptide for administration to cells in vitro, to cells ex vivo and to cells in vivo, or to a multicellular organism. In certain particularly preferred embodiments of this aspect of the invention, the compositions comprise an FGF-13 polynucleotide for expression of an FGF-13 polypeptide in a host organism for treatment of disease. Particularly preferred in this regard is expression in a human patient for treatment of a dysfunction associated with aberrant endogenous activity of an FGF-13 gene.
- The following drawings are meant only as illustrations of specific embodiments of the present invention and are not meant as limitations in any manner.
- FIGS. 1A-D depicts the nucleotide sequence (SEQ ID NO:1) of the human mRNA encoding FGF-13 and the deduced amino acid sequence (SEQ ID NO:2) of the FGF-13 polypeptide. The putative leader sequence of about 23 amino acids is underlined. Note that the methionine residue at the beginning of the leader sequence in FIGS. 1A-D is shown in position number (positive) 1, whereas the leader positions in the corresponding sequence of SEQ ID NO:2 are designated with negative position numbers. Thus, the
leader sequence positions 1 to 23 in FIGS. 1A-D correspond to positions −23 to −1 in SEQ ID NO:2. -
FIG. 2 shows an alignment of the regions of identity among the amino acid sequences of the human FGF-13 protein and the amino acid sequences of the following human proteins: acidic FGF (SEQ ID NO:3), basic FGF (SEQ ID NO:4), Int-2 (SEQ ID NO:5), FGF-4 (SEQ ID NO:6), FGF-5 (SEQ ID NO:7), FGF-6 (SEQ ID NO:8), Keratinocyte Growth Factor (KGF) (SEQ ID NO:9), and AIGF (FGF-8) (SEQ ID NO:10), as determined by the “Megalign” routine of the DNAStar program. -
FIG. 3 shows an analysis of the FGF-13 amino acid sequence. Alpha, beta, turn and coil regions; hydrophilicity and hydrophobicity; amphipathic regions; flexible regions; antigenic index and surface probability are shown. In the “Antigenic Index—Jameson-Wolf” graph, the indicate location of the highly antigenic regions of the FGF-13 protein, i.e., regions from which epitope-bearing peptides of the invention may be obtained. -
FIG. 4 . FGF-13 treatment increases the number of cells in embryonic cortical cultures. The cells, derived from gestation day 17 embryos, were plated in polylysine/laminin coated wells at a density of 354 cells/mm2. The cultures were maintained in serum-free medium and treated every other day with the indicated concentrations of FGFs. After treatment for 7-8 days, the cell number was estimated by labeling the cultures with Calcein AM and monitoring the level of fluorescence emission at 530 nm. The data points represent the mean of 5-6 determinations ± the standard error. (Key: ∘=FGF-13; •=bFGF(rh)). -
FIG. 5 . The increase in high-affinity neuronal specific GABA-uptake induced by FGF-13 is enhanced by heparin. The cortical cultures, plated at a density of 1770 cells/mM2 in polylysine/laminin coated wells, were treated for 7-8 days with FGF-13 in the presence or absence of heparin. The heparin and FGF-13 were pre-incubated for approximately 30 min prior to addition to the cultures. The data points represent the means of 4 determinations ± the standard error. (Key: ▪=FGF-13; =FGF-13+10 ng/ml heparin; ▴=FGF-13+100 ng/ml heparin). -
FIG. 6 . FGF-13 treatment enhances neurite outgrowth of cortical neurons. For the neurite outgrowth experiments, the cultures were plated at a density of 212 cell/mm2 on poly-lysine coated wells. The cultures were then fixed and the amount of the 68 kDa neurofilament subunit was determined by ELISA. The data points are the means of 5-6 determinations ± the standard error. (Key: ∘=FGF-13; •=bFGF(rh)). -
FIG. 7 . FGF-13 induces the proliferation of rat hippocampal astrocytes. The astrocytes were sub-cultured at a density of 15,000 cells/well in 96 well plates. The cells were arrested in G1 phase by an 18 hr incubation in serum-free medium and then treated with FGF-13 in the absence or presence of heparin for 24 hours. During the last 4 hr of the incubation period, the cultures were labeled with [3H]-thymidine. The data points represent the mean of 4-6 determinations ± the standard error. (Key: ∘=FGF-13; •=FGF-13+10 ng/ml heparin; =FGF-13+100 ng/ml heparin; ▪=FGF-13+1000 ng/ml heparin). -
FIG. 8 . FGF-13 displaces the binding of [125I]FGF-1 from monolayer cultures of hippocampal astrocytes. Astrocytes were subcultured and grown to confluence in 24 well plates. The cultures were incubated at 4° C. with 50 p M [125I]FGF-1 in the absence or presence of the indicated concentration of unlabeled FGFs. The data points are the means of 4 determinations ±the standard error. (Key: •=FGF-10; =bFGF; ▪=FGF-13). -
FIG. 9 . Effect of FGF-13 treatment on human lung fibroblast proliferation. (Key: ▪=bFGF; ♦=FGF-13). -
FIG. 10 . Effect of FGF-13 treatment on human dermal endothelial cell proliferation. (Key: ▪=bFGF; ♦=FGF-13). -
FIG. 11 . Effect of FGF-2 and FGF-13 on release of PGE2 from human lung fibroblasts. (Key: in each group of six bars, from left to right the bars represent: medium alone; bFGF (FGF-2) (100 ng/ml); indomethicin (100 ng/ml); FGF-13 (100 ng/ml); FGF-13 (1000 ng/ml); FGF-12 (2500 ng/ml)). -
FIG. 12 . Effects of FGF-2 and FGF-13 on release of IL-6 from human lung fibroblasts. (Key: in each group of six bars, from left to right the bars represent: medium alone; bFGF (FGF-2) (100 ng/ml); indomethicin (100 ng/ml); FGF-13 (100 ng/ml); FGF-13 (1000 ng/ml); FGF-12 (2500 ng/ml)). -
FIG. 13 shows mitogenic activity of FGF13 on BaF3 cells expressing FGF receptors (FGFR) 1c, 2c, 3c, and 4 measured by thymidine incorporation. BaF3 cells expressing FGF receptors were incubated with FGF-13 up to concentration of 62.5 nM (X axis). aFGF at the same concentration range was used as a positive control. The Y axis represents the amount of 3H thymidine incorporated into DNA of BaF3 cells as a percentage of the maximum cpm incorporated following FGF1 stimulation. Circle: FGFR1c; Square: FGFR2c; Diamond: FGFR3c; Triangle: FGFR4. -
FIG. 14 shows the tyrosine hydroxylase stimulatory activity of FGF13 on cultured dopaminergic neurons from the midbrain floor dissected from E14 Wistar rat embryos, dissociated with trypsin and seeded at a density of 200,000 cells per square centimeter. Tyrosine hydroxylase positive neurons increased after FGF-13 administration. The control was basic FGF, other fibroblase growth factors include FGR-2, FGF-9, and FGF-10. - The present invention provides isolated nucleic acid molecules comprising a polynucleotide encoding an FGF-13 polypeptide having the amino acid sequence shown in SEQ ID NO:2, which was determined by sequencing cloned cDNAs. The nucleotide sequence shown in positions 11-1212 of SEQ ID NO:1 was obtained by sequencing the HODAH63 clone, which was deposited on May 12, 1995 at the American Type Culture Collection, 10801 University Boulevard, Manassas, Va. 20110-2209, and given accession number ATCC™ 97148. The deposited clone is contained in the pBluescript SK(−) plasmid (Stratagene, La Jolla, Calif.). The nucleotide sequence shown in positions 1-10 of SEQ ID NO:1 was obtained by sequencing the product of a PCR amplification of a cDNA library containing a mixture of human cDNAs.
- The deposit referred to herein will be maintained under the Budapest Treaty on the International Recognition of the Deposit of Microorganisms for the purposes of Patent Procedure. This deposit is provided merely as a convenience and is not an admission that a deposit is required under 35 U.S.C. § 112. The sequence of the polynucleotides contained in the deposited materials, as well as the amino acid sequence of the polypeptides encoded thereby, are incorporated herein by reference and are controlling in the event of any conflict with the description of sequences herein. A license may be required to make, use or sell the deposited materials, and no such license is hereby granted.
- The FGF-13 polypeptide is structurally related to all members of the fibroblast growth. factor family and contains an open reading frame encoding a ‘polypeptide of 216 amino acids (SEQ ID NO:2) of which the first 25 amino acids represent a putative leader sequence such that the mature polypeptide comprises 193 amino acids. Among the top matches are:
- 1) 69% identity and 81% similarity to mouse AIGF over a stretch of 185 amino acids; 2) 30% identity and 56% similarity with FGF-4 from in a region of 82 amino acids; 3) 41% identity and 64% similarity with human KGF (SEQ ID NO:9) over a stretch of 78 amino acids. Among human homologs compared to FGF-13, FGF-8 (bFGF) and aFGF show the greatest similarities (56.7% and 51.0%, respectively). An alignment of the FGF-13 amino acid sequence with the amino acids sequences of various human polypeptides is shown in
FIG. 2 . - The FGF/HBGF family signature, GXLX(S, T, A, G)X6(D, E)CKFXE is conserved in the polypeptide of the present invention (X means any amino acid residue; (D, E) means either D or E residue; X6 means any 6 amino acid residues).
- Nucleic Acid Molecules
- Unless otherwise indicated, all nucleotide sequences determined by sequencing a DNA molecule herein were determined using an automated DNA sequencer (such as the Model 373 from Applied Biosystems, Inc., Foster City, Calif.), and all amino acid sequences of polypeptides encoded by DNA molecules determined herein were predicted by translation of a DNA sequence determined as above. Therefore, as is known in the art for any DNA sequence determined by this automated approach, any nucleotide sequence determined herein may contain some errors. Nucleotide sequences determined by automation are typically at least about 90% identical, more typically at least about 95% to at least about 99.9% identical to the actual nucleotide sequence of the sequenced DNA molecule. The actual sequence can be more precisely determined by other approaches including manual DNA sequencing methods well known in the art. As is also known in the art, a single insertion or deletion in a determined nucleotide sequence compared to the actual sequence will cause a frame shift in translation of the nucleotide sequence such that the predicted amino acid sequence encoded by a determined nucleotide sequence will be completely different from the amino acid sequence actually encoded by the sequenced DNA molecule, beginning at the point of such an insertion or deletion.
- By “nucleotide sequence” of a nucleic acid molecule or polynucleotide is intended, for a DNA molecule or polynucleotide, a sequence of deoxyribonucleotides, and for an RNA molecule or polynucleotide, the corresponding sequence of ribonucleotides (A, G, C and U), where each thymidine deoxyribonucleotide (T) in the specified deoxyribonucleotide sequence is replaced by the ribonucleotide uridine (U).
- Using the information provided herein, such as the nucleotide sequence in FIGS. 1A-D (SEQ ID NO:1), a nucleic acid molecule of the present invention encoding an FGF-13 polypeptide may be obtained using standard cloning and screening procedures, such as those for cloning cDNAs using mRNA as starting material. Illustrative of the invention, the nucleic acid molecule described in FIGS. 1A-D (SEQ ID NO:1) was discovered in a cDNA library derived from human ovarian cancer tissue. Additional clones of the same gene were also identified in cDNA libraries from human fetal kidney tissue, and Northern blotting of human tissues detected a weak signal (1.6 kb) only in human fetal kidney and human fetal brain. Therefore, nucleic acids of the invention are useful as hybridization probes for differential identification of the tissue(s) or cell type(s) present in a biological sample. Similarly, polypeptides and antibodies directed to those polypeptides are useful to provide immunological probes for differential identification of tissue(s) or cell type(s).
- The determined nucleotide sequence of the FGF-13 cDNA of FIGS. 1A-D (SEQ ID NO:1) contains an open reading frame encoding a protein of 216 amino acid residues, with an initiation codon at
nucleotide positions 1 to 3 of the nucleotide sequence in FIGS. 1A-D (SEQ ID NO:1). The FGF-13 polypeptide encoded by the deposited cDNA actually comprises about the 212 amino acids at the C-terminal end of the sequence in SEQ ID NO:2, with the remaining N-terminal sequences in FIGS. 1A-D and SEQ ID NO:2 having been determined by sequencing a product of a polymerase chain reaction (PCR) mixture using DNA from a human cDNA library in a phage vector for the template, primed by vector-specific primers 5′ and 3′ to the cDNA insert site. As one of ordinary skill would appreciate, due to the possibilities of sequencing errors discussed above, the actual FGF-13 polypeptide encoded by the deposited cDNA, which comprises about 212 amino acids at the C-terminal end of the sequence in SEQ ID NO:2, may be somewhat longer or shorter than the determined sequence. More generally, the actual open reading frame may be anywhere in the range of ±20 amino acids, more likely in the range of ±10 amino acids, of that predicted from the N-terminus shown in FIGS. 1A-D (SEQ ID NO:1). - Leader and Mature Sequences
- The amino acid sequence of the complete FGF-13 protein includes a leader sequence and a mature protein; as shown in SEQ ID NO:2. More in particular, the present invention provides nucleic acid molecules encoding a mature form of the FGF-13 protein. Thus, according to the signal hypothesis, once export of the growing protein chain across the rough endoplasmic reticulum has, been initiated, proteins secreted by mammalian cells have a signal or secretory leader sequence which is cleaved from the complete polypeptide to produce a secreted “mature” form of the protein. Most mammalian cells and even insect cells cleave secreted proteins with the same specificity. However, in some cases, cleavage of a secreted protein is not entirely uniform, which results in two or more mature species of the protein. Further, it has long been known that the cleavage specificity of a secreted protein is ultimately determined by the primary structure of the complete protein, that is, it is inherent in the amino acid sequence of the polypeptide.
- Therefore, the present invention provides a nucleotide sequence encoding the mature FGF-13 polypeptide having the amino acid sequence encoded by the cDNA clone contained in the host identified as ATCC™ Deposit No. 97148. By the “mature FGF-13 polypeptide having the amino acid sequence encoded by the cDNA clone in ATCC™ Deposit No. 97148” is meant the mature form(s) of the FGF-13 protein produced by expression in a mammalian cell (e.g., COS cells, as described below) by a DNA encoding the complete FGF-13 coding sequence encoded by the human DNA sequence of the clone contained in the vector in the deposited host, when that human DNA sequence is operably linked to appropriate regulatory sequences for translation of the FGF-13 coding sequence including an initiation codon.
- In the present case, the deduced amino acid sequence of the complete FGF-13 polypeptide was analyzed by alignment with the known amino acid sequence of human FGF-8 (see
FIG. 2 ), thereby predicting a secretory leader cleavage site at the homologous location within the complete amino acid sequence shown in SEQ ID NO:2, between residues −1 and +1. - As indicated, nucleic acid molecules of the present invention may be in the form of RNA, such as mRNA, or in the form of DNA, including, for instance, cDNA and genomic DNA obtained by cloning or produced synthetically. The DNA may be double-stranded or single-stranded. Single-stranded DNA or RNA may be the coding strand, also known as the sense strand, or it may be the non-coding strand, also referred to as the anti-sense strand.
- By “isolated” nucleic acid molecule(s) is intended a nucleic acid molecule, DNA or RNA, which has been removed from its native environment For example, recombinant DNA molecules contained in a vector are considered isolated for the purposes of the present invention. Further examples of isolated DNA molecules include recombinant DNA molecules maintained in heterologous host cells or purified (partially or substantially) DNA molecules in solution. Isolated RNA molecules include in vivo or in vitro RNA transcripts of the DNA molecules of the present invention. Isolated nucleic acid molecules according to the present invention further include such molecules produced synthetically.
- Isolated nucleic acid molecules of the present invention include DNA molecules comprising an open reading frame (ORF) with or without an initiation codon at
positions 1 to 3 of the nucleotide sequence shown in FIGS. 1A-D (SEQ ID NO:1). Also included are DNA molecules comprising the coding sequence for the predicted mature FGF-13 protein shown atpositions 1 to 193 of SEQ ID NO:2. - In addition, isolated nucleic acid molecules of the invention include DNA molecules which comprise a sequence substantially different from those described above but which, due to the degeneracy of the genetic code, still encode an FGF-13 protein. Of course, the genetic code and species-specific codon preferences are well known in the art. Thus, it would be routine for one skilled in the art to generate the degenerate variants described above, for instance, to optimize codon expression for a particular host (e.g., change codons in the human mRNA to those preferred by a bacterial host such as E. coli).
- In another aspect, the invention provides isolated nucleic acid molecules encoding the FGF-13 polypeptide having an amino acid sequence encoded by the cDNA clone contained in the plasmid deposited as ATCC™ Deposit No. 97148 on May 12, 1995. Preferably, this nucleic acid molecule will encode the mature polypeptide encoded by the above-described deposited cDNA clone.
- The invention further provides an isolated nucleic acid molecule having the nucleotide sequence shown in FIGS. 1A-D (SEQ ID NO:1) or the nucleotide sequence of the FGF-13 cDNA contained in the above-described deposited clone, or a nucleic acid molecule having a sequence complementary to one of the above sequences. Such isolated molecules, particularly DNA molecules, are useful as probes for gene mapping, by in situ hybridization with chromosomes, and for detecting expression of the FGF-13 gene in human tissue, for instance, by Northern blot analysis.
- The present invention is further directed to nucleic acid molecules encoding portions of the nucleotide sequences described herein as well as to fragments of the isolated nucleic acid molecules described herein. In particular, the invention provides a polynucleotide having a nucleotide sequence representing the portion of SEQ ID NO: 1 which consists of
positions 1 to 648 of SEQ ID NO:1. - Thus, the invention includes a polynucleotide comprising any portion of at least about 30 nucleotides, preferably at least about 50 nucleotides, of SEQ ID NO:1 from
residue 1 to 648. More generally, by a fragment of an isolated nucleic acid molecule having the nucleotide sequence of the deposited cDNA or the nucleotide sequence shown in FIGS. 1A-D (SEQ ID NO:1) is intended fragments at least about 15 nt, and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably, at least about 40 nt in length which are useful as diagnostic probes and primers as discussed herein. Of course, larger fragments 50-300 nt in length are also useful according to the present invention as are fragments corresponding to most, if not all, of the nucleotide sequence of the deposited cDNA or as shown in FIGS. 1A-D (SEQ ID NO:1). By a fragment at least 20 nt in length, for example, is intended fragments which include 20 or more contiguous bases from the nucleotide sequence of the deposited cDNA or the nucleotide sequence as shown in FIGS. 1A-D (SEQ ID NO:1). Preferred nucleic acid fragments of the present invention include nucleic acid molecules encoding epitope-bearing portions of the FGF-13 polypeptide as identified inFIG. 3 and described in more detail below. - In another aspect, the invention provides an isolated nucleic acid molecule comprising a polynucleotide which hybridizes under stringent hybridization conditions to a portion of the polynucleotide in a nucleic acid molecule of the invention described above, for instance, the cDNA clone contained in ATCC™ Deposit No. 97148. By “stringent hybridization conditions” is intended overnight incubation at 42° C. in a solution comprising: 50% formamide, 5×SSC (150 mM NaCl, 15 mM trisodium citrate), 50 mM sodium phosphate (pH 7.6), 5×Denhardt's solution, 10% dextran sulfate, and 20 μg/ml denatured, sheared salmon sperm DNA, followed by washing the filters in 0.1×SSC at about 65° C.
- By a polynucleotide which hybridizes to a “portion” of a polynucleotide is intended a polynucleotide (either DNA or RNA) hybridizing to at least about 15 nucleotides (nt), and more preferably at least about 20 nt, still more preferably at least about 30 nt, and even more preferably about 30-70 (e.g., 50) nt of the reference polynucleotide. These are useful as diagnostic probes and primers as discussed above and in more detail below.
- By a portion of a polynucleotide of “at least 20 nt in length,” for example, is intended 20 or more contiguous nucleotides from the nucleotide sequence of the reference polynucleotide (e.g., the deposited cDNA or the nucleotide sequence as shown in FIGS. 1A-D (SEQ ID NO:1)). Of course, a polynucleotide which hybridizes only to a poly A sequence (such as the 3′ terminal poly(A) tract of the FGF-13 cDNA shown in FIGS. 1A-D (SEQ ID NO:1)), or to a complementary stretch of T (or U) residues, would not be included in a polynucleotide of the invention used to hybridize to a portion of a nucleic acid of the invention, since such a polynucleotide would hybridize to any nucleic acid molecule containing a poly (A) stretch or the complement thereof (e.g., practically any double-stranded cDNA clone).
- As indicated, nucleic acid molecules of the present invention which encode an FGF-13 polypeptide may include, but are not limited to those encoding the amino acid sequence of the mature polypeptide, by itself; and the coding sequence for the mature polypeptide and additional sequences, such as those encoding the about 25 amino acid leader or secretory sequence, such as a pre-, or pro- or prepro-protein sequence; the coding sequence of the mature polypeptide, with or without the aforementioned additional coding sequences.
- Also encoded by nucleic acids of the invention are the above protein sequences together with additional, non-coding sequences, including for example, but not limited to introns and non-coding 5′ and 3′ sequences, such as the transcribed, non-translated sequences that play a role. in transcription, mRNA processing, including splicing and polyadenylation signals, for example—ribosome binding and stability of mRNA; an additional coding sequence which codes for additional amino acids, such as those which provide additional functionalities.
- Thus, the sequence encoding the polypeptide may be fused to a marker sequence, such as a sequence encoding a peptide which facilitates purification of the fused polypeptide. In certain preferred embodiments of this aspect of the invention, the marker amino acid sequence is a hexa-histidine peptide, such as the tag provided in a pQE vector (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311), among others, many of which are commercially available. As described in Gentz et al., Proc. Natl. Acad. Sci. USA 86:821-824 (1989), for instance, hexa-histidine provides for convenient purification of the fusion protein. The “HA” tag is another peptide useful for purification which corresponds to an epitope derived from the influenza hemagglutinin protein, which has been described by Wilson et al., Cell 37: 767 (1984). As discussed below, other such fusion proteins include the FGF-13 fused to Fc at the N- or C-terminus.
- Variant and Mutant Polynucleotides
- The present invention further relates to variants of the nucleic acid molecules of the present invention, which encode portions, analogs or derivatives of the FGF-13 protein. Variants may occur naturally, such as a natural allelic variant. By an “allelic variant” is intended one of several alternate forms of a gene occupying a given locus on a chromosome of an organism. Genes II, Lewin, B.; ed., John Wiley & Sons, New York (1985). Non-naturally occurring variants may be produced using art-known mutagenesis techniques.
- Such variants include those produced by nucleotide substitutions, deletions or additions. The substitutions, deletions or additions may involve one or more nucleotides. The variants may be altered in coding regions, non-coding regions, or both. Alterations in the coding regions may produce conservative or non-conservative amino acid substitutions, deletions or additions. Especially preferred among these are silent substitutions, additions and deletions, which do not alter the properties and activities of the FGF-13 protein or portions thereof. Also especially preferred in this regard are conservative substitutions.
- Most highly preferred are nucleic acid molecules encoding the mature protein having the amino acid sequence shown in SEQ ID NO:2 or the mature FGF-13 amino acid sequence encoded by the deposited cDNA clone.
- Further embodiments include an isolated nucleic acid molecule comprising a polynucleotide having a nucleotide sequence at least 90% identical, and more preferably at least 95%, 96%, 97%, 98% or 99% identical to a polynucleotide selected from the group consisting of: (a) a nucleotide sequence encoding the FGF-13 polypeptide having the complete. amino acid sequence in SEQ ID NO:2; (b) a nucleotide sequence encoding the predicted mature FGF-13 polypeptide having the amino acid sequence at
positions 1 to 193 of SEQUENCE ID NO:2; (c) a nucleotide sequence encoding the FGF-13 polypeptide having the complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97148; (d) a nucleotide sequence encoding the mature FGF-13 polypeptide having the amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97148; and (e) a nucleotide sequence complementary to any of the nucleotide sequences in (a), (b), (c) or (d) above. - By a polynucleotide having a nucleotide sequence at least, for example, 95% “identical” to a reference nucleotide sequence encoding an FGF-13 polypeptide is intended that the nucleotide sequence of the polynucleotide is identical to the reference sequence except that the polynucleotide sequence may include up to five point mutations per each 100 nucleotides of the reference nucleotide sequence encoding the FGF-13 polypeptide. In other words, to obtain a polynucleotide having a nucleotide sequence at least 95% identical to a reference nucleotide sequence, up to 5% of the nucleotides in the reference sequence may be deleted or substituted with another nucleotide, or a number of nucleotides up to 5% of the total nucleotides in the reference sequence may be inserted into the reference sequence. These mutations of the reference sequence may occur at the 5′ or 3′ terminal positions of the reference nucleotide sequence or anywhere between those terminal positions, interspersed either individually among nucleotides in the reference sequence or in one or more contiguous groups within the reference sequence.
- As a practical matter, whether any particular nucleic acid molecule is at least 90%, 95%, 96%, 97%, 98% or 99% identical to, for instance, the nucleotide sequence shown in FIGS. 1A-D or to the nucleotides sequence of the deposited cDNA clone can be determined conventionally using known computer programs such as the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711).
- Bestfit uses the local homology algorithm of Smith and Waterman, Advances in Applied Mathematics 2:482-489 (1981), to find the best segment of homology between two sequences. When using Bestfit or any other sequence alignment program to determine whether a particular sequence is, for instance, 95% identical to a reference sequence according to the present invention, the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference nucleotide sequence and that gaps in homology of up to 5% of the total number of nucleotides in the reference sequence are allowed.
- The present application is directed to nucleic acid molecules at least 90%, 95%, 96%, 97%, 98% or 99% identical to the nucleic acid sequence shown in FIGS. 1A-D (SEQ ID NO:1) or to the nucleic acid sequence of the deposited cDNA, irrespective of whether they encode a polypeptide having FGF-13 activity. This is because even where a particular nucleic acid molecule does not encode a polypeptide having FGF-13 activity, one of skill in the art would still know how to use the nucleic acid molecule, for instance, as a hybridization probe or a polymerase chain reaction (PCR) primer. Uses of the nucleic acid molecules of the present invention that do not encode a polypeptide having FGF-13 activity include, inter alia, (1) isolating the FGF-13 gene or allelic variants thereof in a cDNA library; (2) in situ hybridization (e.g., “FISH”) to metaphase chromosomal spreads to provide precise chromosomal location of the FGF-13 gene, as described in Verma et al., Human Chromosomes: A Manual of Basic Techniques, Pergamon Press, New York (1988); and Northern blot analysis for detecting FGF-13 mRNA expression in specific tissues.
- Preferred, however, are nucleic acid molecules having sequences at least 90%, 95%, 96%, 97%, 98% or 99% identical to the nucleic acid sequence shown in FIGS. 1A-D (SEQ ID NO:1) or to the nucleic acid sequence of the deposited cDNA which do, in fact, encode a polypeptide having FGF-13 protein activity. By “a polypeptide having FGF-13 activity” is intended polypeptides exhibiting activity similar, but not necessarily identical, to an activity of the mature FGF-13 protein of the invention, as measured in a particular biological assay. For example, the FGF-13 protein of the present invention stimulates proliferations of various mammalian cells, particularly fibroblasts, as described further below.
- FGF-13 protein stimulates cellular proliferation in a dose-dependent manner in the various activity assays described hereinbelow. Thus, “a polypeptide having FGF-13 protein activity” includes polypeptides that also exhibit any of the same activities in the below-described assays in a dose-dependent manner. Although the degree of dose-dependent activity need not be identical to that of the FGF-13 protein, preferably, “a polypeptide having FGF-13 protein activity” will exhibit substantially similar dose-dependence in a given activity as compared to the FGF-13 protein (i.e., the candidate polypeptide will exhibit greater activity or not more than about 25-fold less and, preferably, not more than about tenfold less activity relative to the reference FGF-13 protein).
- Of course, due to the degeneracy of the genetic code, one of ordinary skill in the art will immediately recognize that a large number of the nucleic acid molecules having a sequence at least 90%, 95%, 96%, 97%, 98%, or 99% identical to the nucleic acid sequence of the deposited cDNA or the nucleic acid sequence shown in FIGS. 1A-D (SEQ ID NO:1) will encode a polypeptide “having FGF-13 protein activity.” In fact, since degenerate variants of these nucleotide sequences all encode the same polypeptide, this will be clear to the skilled artisan even without performing the above-described comparison assay. It will be further recognized in the art that, for such nucleic acid molecules that are not degenerate variants, a reasonable number will also encode a polypeptide having FGF-13 protein activity. This is because the skilled artisan is fully aware of amino acid substitutions that are either less likely or not likely to significantly effect protein function (e.g., replacing one aliphatic amino acid with a second aliphatic amino acid), as further described below.
- Vectors and Host Cells
- The present invention also relates to vectors which include the isolated DNA molecules of the present invention, host cells which are genetically engineered with the recombinant vectors, and the production of FGF-13 polypeptides or fragments thereof by recombinant techniques. The vector may be, for example, a phage, plasmid, viral or retroviral vector. Retroviral vectors may be replication competent or replication defective. In the latter case, viral propagation generally will occur only in complementing host cells.
- The polynucleotides may be joined to a vector containing a selectable marker for propagation in a host. Generally, a plasmid vector is introduced in a precipitate, such as a calcium phosphate precipitate, or in a complex with a charged lipid. If the vector is a virus, it may be packaged in vitro using an appropriate packaging cell line and then transduced into host cells.
- The DNA insert should be operatively linked to an appropriate promoter, such as the phage lambda PL promoter, the E. coli lac, trp, phoA and tac promoters, the SV40 early and late promoters and promoters of retroviral LTRs, to name a few. Other suitable promoters will be known to the skilled artisan. The expression constructs will further contain sites for transcription initiation, termination and, in the transcribed region, a ribosome binding site for translation. The coding portion of the transcripts expressed by the constructs will preferably include a translation initiating codon at the beginning and a termination codon (UAA, UGA or UAG) appropriately positioned at the end of the polypeptide to be translated. As indicated, the expression vectors will preferably include at least one selectable marker. Such markers include dihydrofolate reductase, G418 or neomycin resistance for eukaryotic cell culture and tetracycline, kanamycin or ampicillin resistance genes for culturing in E. coli and other bacteria. Representative examples of appropriate hosts include, but are not limited to, bacterial cells, such as E. coli, Streptomyces and Salmonella typhimurium cells; fungal cells, such as yeast cells; insect cells such as Drosophila S2 and Spodoptera Sf9 cells; animal cells such as CHO, COS, 293 and Bowes melanoma cells; and plant cells. Appropriate culture mediums and conditions for the above-described host cells are known in the art.
- Among vectors preferred for use in bacteria include pQE70, pQE60 and pQE-9, available from QIAGEN, Inc., supra; pBS vectors, Phagescript vectors, Bluescript vectors, pNH8A, pNH16a, pNH18A, pNH46A, available from Stratagene; and ptrc99a, pKK223-3, pKK233-3, pDR540, pRIT5 available from Pharmacia. Among preferred eukaryotic vectors are pWLNEO, pSV2CAT, pOG44, pXT1 and pSG available from Stratagene; and pSVK3, pBPV, pMSG and pSVL available from Pharmacia. Other suitable vectors will be readily apparent to the skilled artisan.
- Introduction of the construct into the host cell can be effected by calcium phosphate transfection, DEAE-dextran mediated transfection, cationic lipid-mediated transfection, electroporation, transduction, infection or other methods. Such methods are described in many standard laboratory manuals, such as Davis et al., Basic Methods In Molecular Biology (1986).
- The polypeptide may be expressed in a modified form, such as a fusion protein, and may include not only secretion signals, but also additional heterologous functional regions. For instance, a region of additional amino acids, particularly charged amino acids, may be added to the N-terminus of the polypeptide to improve stability and persistence in the host cell, during purification, or during subsequent handling and storage. Also, peptide moieties may be added to the polypeptide to facilitate purification. Such regions may be removed prior to final preparation of the polypeptide. The addition of peptide moieties to polypeptides to engender secretion or excretion, to improve stability and to facilitate purification, among others, are familiar and routine techniques in the art. A preferred fusion protein comprises a heterologous region from immunoglobulin that is useful to stabilize and purify proteins. For example, BP-A-0 464 533 (Canadian counterpart 2045869) discloses fusion proteins comprising various portions of constant region of immunoglobulin molecules together with another human protein or part thereof. In many cases, the Fc part in a fusion protein is thoroughly advantageous for use in therapy and diagnosis and thus results, for example, in improved pharmacokinetic properties (EP-A 0232 262). On the other hand, for some uses it would be desirable to be able to delete the Fc part after the fusion protein has been expressed, detected and purified in the advantageous manner described. This is the case when Fc portion proves to be a hindrance to use in therapy and diagnosis, for example when the fusion protein is to be used as antigen for immunizations. In drug discovery, for example, human proteins, such as hIL-5, have been fused with Fc portions for the purpose of high-throughput screening assays to identify antagonists of hIL-5. See, D. Bennett et al., J. Molecular Recognition 8:52-58 (1995) and K. Johanson et al., J. Biol. Chem. 270:9459-9471 (1995).
- The FGF-13 protein can be recovered and purified from recombinant cell cultures by well-known methods including ammonium sulfate or ethanol precipitation, acid extraction, anion or cation exchange chromatography, phosphocellulose chromatography, hydrophobic interaction chromatography, affinity chromatography, hydroxylapatite chromatography and lectin chromatography. Most preferably, high performance liquid chromatography (“HPLC”) is employed for purification. Polypeptides of the present invention include: products purified from natural sources, including bodily fluids, tissues and cells, whether directly isolated or cultured; products of chemical synthetic procedures; and products produced by recombinant techniques from a prokaryotic or eukaryotic host, including, for example, bacterial, yeast, higher plant, insect and mammalian cells. Depending upon the host employed in a recombinant production procedure, the polypeptides of the present invention may be glycosylated or may be non-glycosylated. In addition, polypeptides of the invention may also include an initial modified methionine residue, in some cases as a result of host-mediated processes. Thus, it is well known in the art that the N-terminal methionine encoded by the translation initiation codon generally is removed with high efficiency from any protein after translation in all eukaryotic cells. While the N-terminal methionine on most proteins also is efficiently removed in most prokaryotes, for some proteins this prokaryotic removal process is inefficient, depending on the nature of the amino acid to which the N-terminal methionine is covalently linked.
- Polypeptides and Fragments
- The invention further provides an isolated FGF-13 polypeptide comprising the amino acid sequence encoded by the deposited cDNA, or the amino acid sequence in SEQ ID NO:2, or a peptide or polypeptide comprising a portion of the above polypeptides.
- Variant and Mutant Polypeptides
- To improve or alter the characteristics of FGF-13 polypeptides, protein engineering may be employed. Recombinant DNA technology known to those skilled in the art can be used to create novel mutant proteins or “muteins including single or multiple amino acid substitutions, deletions, additions or fusion proteins. Such modified polypeptides can show, e.g., enhanced activity or increased stability. In addition, they may be purified in higher yields and show better solubility than the corresponding natural polypeptide, at least under certain purification and storage conditions.
- N-Terminal and C-Terminal Deletion Mutants
- For instance, for many proteins, including the extracellular domain of a membrane associated protein or the mature forms of a secreted protein, it is known in the art that one or more amino acids may be deleted from the N-terminus or C-terminus without substantial loss of biological function. For instance, Ron et al., J. Biol.: Chem., 268:2984-2988 (1993) reported modified KGF proteins that had heparin binding activity even if 3, 8, or 27 amino-terminal amino acid residues were missing. In the present case, polypeptides having deletions of up to about 10 additional N-terminal residues beyond the predicted leader cleavage point (i.e., up to the Asparagine at
position 10 in SEQ ID NO:2) can retain some biological activity such as cell proliferation stimulating or receptor binding activity. - However, even if deletion of one or more amino acids from the N-terminus of a protein results in modification of loss of one or more biological functions of the protein, other biological activities may still be retained. Thus, the ability of the shortened protein to induce and/or bind to antibodies which recognize the complete or mature from of the protein generally will be retained when less than the majority of the residues of the complete or mature protein are removed from the N-terminus. Whether a particular polypeptide lacking N-terminal residues of a complete protein retains such immunologic activities can readily be determined by routine methods described herein and otherwise known in the art.
- Accordingly, the present invention further provides polypeptides having one or more residues deleted from the amino terminus of the amino acid sequence of the FGF-13 shown in SEQ ID NO:2, up to the Asparagine at
position 10. In particular, the present invention provides polypeptides comprising the amino acid sequence of residues n-193 of SEQ ID NO:2, where n is an integer other than zero in the range of −23 to +10 (excepting zero). More in particular, the invention provides polynucleotides encoding polypeptides having the amino acid sequence of residues of −23 to 193, −22 to 193, −21 to 193, −20 to 193, −19 to 193, −18 to 193, −17 to 193, −16 to 193, −15 to 193, −14 to 193, −13 to 193, −12 to 193, −11 to 193, −10 to 193, −9 to 193, −8 to 193, −7 to 193, −6 to 193, −5 to 193, −4 to 193, −3 to 193, −2 to 193, −1 to - 193, 1 to 193, 2 to 193, 3 to 193, 4 to 193, 5 to 193, 6 to 193, 7 to 193, 8 to 193, 9 to 193, and 10 to 193 of SEQ ID NO:2. Polynucleotides encoding these polypeptides also are provided.
- Similarly, many examples of biologically functional C-terminal deletion muteins are known. For instance, interferon gamma shows up to ten times higher activities by deleting 8-10 amino acid residues from the carboxy terminus of the protein (Dobeli et al., J. Biotechnology 7:199-216 (1988). In the present case, since the protein of the invention is homologous to human FGF-8, deletions of C-terminal amino acids up to the conserved region beginning with the Leucine at position 154 in SEQ ID NO:2 can retain some biological activity such as stimulation of cellular proliferation or receptor binding.
- However, even if deletion of one or more amino acids from the C-terminus of a protein results in modification of loss of one or more biological functions of the protein, other biological activities may still be retained. Thus, the ability of the shortened protein to induce and/or bind to antibodies which recognize the complete or mature form of the protein generally will be retained when less than the majority of the residues of the complete or mature protein are removed from the C-terminus. Whether a particular polypeptide lacking C-terminal residues of a complete protein retains such immunologic activities can readily be determined by routine methods described herein and otherwise known in the art.
- Accordingly, the present invention further provides polypeptides having one or more residues from the carboxy terminus of the amino acid sequence of the FGF-13 shown in SEQ ID NO:2, up to the Leucine at position 154 of SEQ ID NO:2, and polynucleotides encoding such polypeptides. In particular, the present invention provides polypeptides having the amino acid sequence of residues −22 to m of the amino acid sequence in SEQ ID NO:2, where m is any integer in the range of 154 to 192, and residue 154 is the position of the first residue from the C-terminus of. the complete FGF-13 polypeptide (shown in SEQ ID NO:2) which begins the region highly conserved between FGF-13 and human FGF-8.
- More in particular, the invention provides polynucleotides encoding polypeptides having the amino acid sequence of residues −22 to 154, −22 to 155, −22 to 156, −22 to 157, −22 to 158, −22 to 159, −22 to 160, −22 to 161, −22 to 162, −22 to 163, −22 to 164, −22 to 165, −22 to 166, −22 to 167, −22 to 168, −22 to 169, −22 to 170, −22 to 171, −22 to 172, −22 to 173, −22 to 174, −22 to 175, −22 to 176, −22 to 177, −22 to 178, −22 to 179, −22 to 180, −22 to 181, −22 to 182, −22 to 183, −22 to 184, −22 to 185, −22 to 186, −22 to 187, −22 to 188, −22 to 189, −22 to 190, and −22 to 192 of SEQ ID NO:2. Polynucleotides encoding these polypeptides also are provided.
- The invention also provides polypeptides having one or more amino acids deleted from both the amino and the carboxyl termini, which may be described generally as having residues n-m of SEQ ID NO:2, where n and m are integers as described above.
- Also included are a nucleotide sequence encoding a polypeptide consisting of a portion of the complete FGF-13 amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97148, where this. portion excludes from 1 to about 33 amino acids from the amino terminus of the complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97148, or from 1 to about 39 amino acids from the carboxy terminus, or any combination of the above amino terminal and carboxy terminal deletions, of the complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97148
- Polynucleotides encoding all of the above deletion mutant polypeptide forms also are provided.
- Other Mutants
- In addition to terminal deletion forms of the protein discussed above, it also will be recognized by one of ordinary skill in the art that some amino acid sequences of the FGF-13 polypeptide can be varied without significant effect of the structure or function of the protein. If such differences in sequence are contemplated, it should be remembered that there will be critical areas on the protein which determine activity.
- Thus, the invention further includes variations of the FGF-13 polypeptide which show substantial FGF-13 polypeptide activity or which include regions of FGF-13 protein such as the protein portions discussed below. Such mutants include deletions, insertions, inversions, repeats, and type substitutions selected according to general rules known in the art so as have little effect on activity. For example, guidance concerning how to make phenotypically silent amino acid substitutions is provided in Bowie, J. U. et al., “Deciphering the Message in Protein Sequences: Tolerance to Amino Acid Substitutions,” Science 247:1306-1310 (1990), wherein the authors indicate that there are two main approaches for studying the tolerance of an amino acid sequence to change. The first method relies on the process of evolution, in which mutations are either accepted or rejected by natural selection. The second approach uses genetic engineering to introduce amino acid changes at specific positions of a cloned gene and selections or screens to identify sequences that maintain functionality.
- As the authors state, these studies have revealed that proteins are surprisingly tolerant of amino acid substitutions. The authors further indicate which amino acid changes are likely to be permissive at a certain position of the protein. For example, most buried amino acid residues require nonpolar side chains, whereas few features of surface side chains are generally conserved. Other such phenotypically silent substitutions are described in Bowie, J. U. et al., supra, and the references cited therein. Typically seen as conservative substitutions are the replacements, one for another, among the aliphatic amino acids Ala, Val, Leu and Ile; interchange of the hydroxyl residues Ser and Thr, exchange of the acidic residues Asp and Glu, substitution between the amide residues Asn and Gln, exchange of the basic residues Lys and Arg and replacements among the aromatic residues Phe, Tyr.
- Thus, the fragment, derivative or analog of the polypeptide of SEQ ID NO:2, or that encoded by the deposited cDNA, may be (i) one in which one or more of the amino acid residues are substituted with a conserved or non-conserved amino acid residue (preferably a conserved amino acid residue) and such substituted amino acid residue may or may not be one encoded by the genetic code, or (ii) one in which one or more of the amino acid residues includes a substituent group, or (iii) one in which the mature polypeptide is fused with another compound, such as a compound to increase the half-life of the polypeptide (for example, polyethylene glycol), or (iv) one in which the additional amino acids are fused to the above form of the polypeptide, such as an IgG Fc fusion region peptide or leader or secretory sequence or a sequence which is employed for purification of the above form of the polypeptide or a proprotein sequence. Such fragments, derivatives and analogs are deemed to be within the scope of those skilled in the art from the teachings herein
- Thus, the FGF-13 of the present invention may include one or more amino acid substitutions, deletions or additions, either from natural mutations or human manipulation. As indicated, changes are preferably of a minor nature, such as conservative amino acid substitutions that do not significantly affect the folding or activity of the protein (see Table 1).
TABLE 1 Conservative Amino Acid Substitutions Aromatic Phenylalanin Tryptophan Tyrosine Hydrophobic Leucine Isoleucine Valine Polar Glutamine Asparagine Basic Arginine Lysine Histidine Acidic Aspartic Acid Glutamic Acid Small Alanine Serine Threnine Methionine Glycine - Amino acids in the FGF-13 protein of the present invention that are essential for function can be identified by methods known in the art, such as site-directed mutagenesis or alanine-scanning mutagenesis (Cunningham and Wells, Science 244:1081-1085 (1989)). The latter procedure introduces single alanine mutations at every residue in the molecule. The resulting mutant molecules are then tested for biological activity such as receptor binding or in vitro or in vitro proliferative activity.
- Of special interest are substitutions of charged amino acids with other charged or neutral amino acids which may produce proteins with highly desirable improved characteristics, such as less aggregation. Aggregation may not only reduce activity but also be problematic when preparing pharmaceutical formulations, because aggregates can be immunogenic (Pinckard et al., Clin. Exp. Immunol. 2:331-340 (1967); Robbins et al., Diabetes 36:838-845 (1987); Cleland et al., Crit. Rev. Therapeutic Drug Carrier Systems 10:307-377 (1993).
- Replacement of amino acids can also change the selectivity of the binding of a ligand to cell surface receptors. For example, Ostade et al., Nature 361:266-268 (1993) describes certain mutations resulting in selective binding of TNF-a to only one of the two known types of TNF receptors. Sites that are critical for ligand-receptor binding can also be determined by structural analysis such as crystallization, nuclear magnetic resonance or photoaffinity labeling (Smith et al., J. Mol. Biol. 224:899-904 (1992) and de Vos et al. Science 255:306-312 (1992)).
- The polypeptides of the present invention are preferably provided in an isolated form, and preferably are substantially purified. A recombinantly produced version of the FGF-13 polypeptide can be substantially purified by the one-step method described in Smith and Johnson, Gene 67:31-40 (1988). Polypeptides of the invention also can be purified from natural or recombinant sources using anti-FGF-13 antibodies of the invention in methods which are well known in the art of protein purification.
- The invention farther provides an isolated FGF-13 polypeptide comprising an amino acid sequence selected from the group consisting of: (a) the amino acid sequence of the complete FGF-13 polypeptide shown in SEQ ID NO:2 excepting the N-terminal methionine (i.e., positions −22 to 193 of SEQ ID NO:2); (b) the amino acid sequence of the predicted mature FGF-13 polypeptide from about
position 1 to about position 193 in SEQ ID NO:2; (c) the amino acid sequence of the FGF-13 polypeptide having the complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97148; and (d) the amino acid sequence of the mature FGF-13 polypeptide having the amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97148. - Further polypeptides of the present invention include polypeptides which have at least 90% similarity, more preferably at least 95% similarity, and still more preferably at least 96%, 97%, 98% or 99% similarity to those described above. The polypeptides of the invention also comprise those which are at least 80% identical, more preferably at least 90% or 95% identical, still more preferably at least 96%, 97%, 98% or 99% identical to the polypeptide encoded by the deposited cDNA or to the polypeptide of SEQ ID NO:2, and also include portions of such polypeptides with at least 30 amino acids and more preferably at least 50 amino acids.
- By “% similarity” for two polypeptides is intended a similarity score produced by comparing the amino acid sequences of the two polypeptides using the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711) and the default settings for determining similarity. Bestfit uses the local homology algorithm of Smith and Waterman (Advances in Applied Mathematics 2:482-489, 1981) to find the best segment of similarity between two sequences.
- By a polypeptide having an amino acid sequence at least, for example, 95% “identical” to a reference amino acid sequence of an FGF-13 polypeptide is intended that the amino acid sequence of the polypeptide is identical to the reference sequence except that the polypeptide sequence may include up to five amino acid alterations per each 100 amino acids of the reference amino acid of the FGF-13 polypeptide. In other words, to obtain a polypeptide having an amino acid sequence at least 95% identical to a reference amino acid sequence, up to 5% of the amino acid residues in the reference sequence may be deleted or substituted with another amino acid, or a number of amino acids up to 5% of the total amino acid residues in the reference sequence may be inserted into the reference sequence. These alterations of the reference sequence may occur at the amino or carboxy terminal positions of the reference amino acid sequence or anywhere between those terminal positions, interspersed either individually among residues in the reference sequence or in one or more contiguous groups within the reference sequence.
- As a practical matter, whether any particular polypeptide is at least 90%, 95%, 96%, 97%, 98% or 99% identical to, for instance, the amino acid sequence shown in SEQ ID‘NO:2 or to the amino acid sequence encoded by deposited cDNA clone can be determined conventionally using known computer programs such the Bestfit program (Wisconsin Sequence Analysis Package, Version 8 for Unix, Genetics Computer Group, University Research Park, 575 Science Drive, Madison, Wis. 53711). When using Bestfit or any other sequence alignment program to determine whether a particular sequence is, for instance, 95% identical to a reference sequence according to the present invention, the parameters are set, of course, such that the percentage of identity is calculated over the full length of the reference amino acid sequence and that gaps in homology of up to 5% of the total number of amino acid residues in the reference sequence are allowed.
- The polypeptide of the present invention could be used as a molecular weight marker on SDS-PAGE gels or on molecular sieve gel filtration columns using methods well known to those of skill in the art.
- As described in detail below, the polypeptides of the present invention can also be used to raise polyclonal and monoclonal antibodies, which are useful in assays for detecting FGF-13 protein expression as described below or as agonists and antagonists capable of enhancing or inhibiting FGF-13 protein function. Further, such polypeptides can be used in the yeast two-hybrid system to “capture” FGF-13 protein binding proteins which are also candidate agonists and antagonists according to the present invention. The yeast two hybrid system is described in Fields and Song, Nature 340:245-246 (1989).
- Epitope-Bearing Portions
- In another aspect, the invention provides a peptide or polypeptide comprising an epitope-bearing portion of a polypeptide of the invention. The epitope of this polypeptide portion is an immunogenic or antigenic epitope of a polypeptide of the invention. An “immunogenic epitope” is defined as a part of a protein that elicits an antibody response when the whole protein is the immunogen. On the other hand, a region of a protein molecule to which an antibody can bind is defined as an “antigenic epitope.” The number of immunogenic epitopes of a protein generally is less than the number of antigenic epitopes. See, for instance, Geysen et al., Proc. Natl. Acad. Sci. USA 81:3998-4002 (1983).
- As to the selection of peptides or polypeptides bearing an antigenic epitope (i.e., that contain a region of a protein molecule to which an antibody can bind), it is well known in that art that relatively short synthetic peptides that mimic part of a protein sequence are routinely capable of eliciting an antiserum that reacts with the partially mimicked protein. See, for instance, Sutcliffe, J. G., Shinnick, T. M., Green, N. and Learner, R. A. (1983) “Antibodies that react with predetermined sites on proteins,” Science, 219:660-666. Peptides capable of eliciting protein-reactive sera are frequently represented in the primary sequence of a protein, can be characterized by a set of simple chemical rules, and are confined neither to immunodominant regions of intact proteins (i.e., immunogenic epitopes) nor to the amino or carboxyl terminals. Antigenic epitope-bearing peptides and polypeptides of the invention are therefore useful to raise antibodies, including monoclonal antibodies, that bind specifically to a polypeptide of the invention. See, for instance, Wilson et al., Cell 37:767-778 (1984) at 777.
- Antigenic epitope-bearing peptides and polypeptides of the invention preferably contain a sequence of at least seven, more preferably at least nine and most preferably between about 15 to about 30 amino acids contained within the amino acid sequence of a polypeptide of the invention. Non-limiting examples of antigenic polypeptides or peptides that can be used to generate FGF-13-specific antibodies include: a polypeptide comprising amino acid residues in SEQ ID NO:2 from about Gln 22 to about Asn 32, about Asn 34 to about Met 43, about Gln 46 to about Tyr 55, about Ser 59 to about Val 66, about Val 68 to about Phe 83, about Val 88 to about Glu 105, about Met 110 to about Val 128, about Phe 153 to about His 173, about Leu 178 to about Gin 182, about Phe 185 to about Gin 194, and about Val 198 to about Gin 213. These polypeptide fragments have been determined to bear antigenic epitopes of the FGF-13 protein by the analysis of the Jameson-Wolf antigenic index, as shown in
FIG. 3 , above. - The epitope-bearing peptides and polypeptides of the invention may be produced by any conventional means. See, e.g., Houghten, R. A. (1985) “General method for the rapid solid-phase synthesis of large numbers of peptides: specificity of antigen-antibody interaction at the level of individual amino acids.” Proc. Natl. Acad. Sci. USA 82:5131-5135; this “Simultaneous Multiple Peptide Synthesis (SMPS)” process is further described in U.S. Pat. No. 4,631,211 to Houghten et al. (1986).
- Epitope-bearing peptides and polypeptides of the invention are used to induce antibodies according to methods well known in the art. See, for instance, Sutcliffe et al., supra; Wilson et al., supra; Chow, M. et al., Proc. Natl. Acad. Sci. USA, 82:910-914; and Bittle, F. J. et al., J. Gen. Tirol. 66:2347-2354 (1985). Immunogenic epitope-bearing peptides of the invention, i.e., those parts of a protein that elicit an antibody response when the whole protein is the immunogen, are identified according to methods known in the art. See, for instance, Geysen et al., supra. Further still, U.S. Pat. No. 5,194,392 to Geysen (1990) describes a general method of detecting or determining the sequence of monomers (amino acids or other compounds) which is a topological equivalent of the epitope (i.e., a “mimotope”) which is complementary to a particular paratope (antigen binding site) of an antibody of interest. More generally, U.S. Pat. No. 4,433,092 to Geysen (1989) describes a method of detecting or determining a sequence of monomers which is a topographical equivalent of a ligand which is complementary to the ligand binding site of a particular receptor of interest. Similarly, U.S. Pat. No. 5,480,971 to Houghten, R. A. et al. (1996) on Peralkylated Oligopeptide Mixtures discloses linear C1-C7-alkyl perallylated oligopeptides and sets and libraries of such peptides, as well as methods for using such oligopeptide sets and libraries for determining the sequence of a peralkylated oligopeptide that preferentially binds to an acceptor molecule of interest. Thus, non-peptide analogs of the epitope-bearing peptides of the invention also can be made routinely by these methods.
- Fusion Proteins
- As one of skill in the art will appreciate, FGF-13 polypeptides of the present invention and the epitope-bearing fragments thereof described above can be combined with parts of the constant domain of immunoglobulins (IgG), resulting in chimeric polypeptides. These fusion proteins facilitate purification and show an increased half-life in vivo. This has been shown, e.g., for chimeric proteins consisting of the first two domains of the human CD4-polypeptide and various domains of the constant regions of the heavy or light chains of mammalian immunoglobulins (EP A 394,827; Traunecker et al., Nature 331:84-86 (1988)). Fusion proteins that have a disulfide-linked dimeric structure due to the IgG part can also be more efficient in binding and neutralizing other molecules than the monomeric FGF-13 protein or protein fragment alone (Fountoulakis et al., J. Biochem. 270:3958-3964 (1995)).
- Antibodies
- FGF-13-protein specific antibodies for use in the present invention can be raised against the intact FGF-13 protein or an antigenic polypeptide fragment thereof, which may be presented together with a carrier protein, such as an albumin, to an animal system (such as rabbit or mouse) or, if it is long enough (at least about 25 amino acids), without a carrier.
- As used herein, the term “antibody” (Ab) or “monoclonal antibody” (Mab) is meant to include intact molecules as well as antibody fragments (such as, for example, Fab and F(ab′)2 fragments) which are capable of specifically binding to FGF-13 protein. Fab and F(ab′)2 fragments lack the Fc fragment of intact antibody, clear more rapidly from the circulation, and may have less non-specific tissue binding of an intact antibody (Wahl et al., J. Nucl. Med. 24:316-325 (1983)). Thus, these fragments are preferred.
- The antibodies of the present invention may be prepared by any of a variety of methods. For example, cells expressing the FGF-13 protein or an antigenic fragment thereof can be administered to an animal in order to induce the production of sera containing polyclonal antibodies. In a preferred method, a preparation of FGF-13 protein is prepared and purified to render it substantially free of natural contaminants. Such a preparation is then introduced into an animal in order to produce polyclonal antisera of greater specific activity.
- In the most preferred method, the antibodies of the present invention are monoclonal antibodies (or FGF-13 protein binding fragments thereof). Such monoclonal antibodies can be prepared using hybridoma technology (Kohler et al., Nature 256:495 (1975); Kohler et al., Eur. J. Immunol. 6:511 (1976); Kohler et al., Eur. J. Immunol. 6:292 (1976); Hammering et al., in: Monoclonal Antibodies and T-Cell Hybridomas, Elsevier, N.Y., (1981) pp. 563-681). In general, such procedures involve immunizing an animal (preferably a mouse) with an FGF-13 protein antigen or, more preferably, with an FGF-13 protein-expressing cell. Suitable cells can be recognized by their capacity to bind anti-FGF-13 protein antibody. Such cells may be cultured in any suitable tissue culture medium; however, it is preferable to culture cells in Earle's modified Eagle's medium supplemented with 10% fetal bovine serum (inactivated at about 56° C.), and supplemented with about 10 g/l of nonessential amino acids, about 1,000 U/ml of penicillin, and about 100 μg/ml of streptomycin. The splenocytes of such mice are extracted and fused with a suitable myeloma cell line. Any suitable myeloma cell line may be employed in accordance with the present invention; however, it is preferable to employ the parent myeloma cell line (SP20), available from the American Type Culture Collection, Rockville, Md. After fusion, the resulting hybridoma cells are selectively maintained in HAT medium, and then cloned by limiting dilution as described by Wands et al. (Gastroenterology, 80:225-232 (1981)). The hybridoma cells obtained through such a selection are then assayed to identify clones which secrete antibodies capable of binding the FGF-13 protein antigen.
- Alternatively, additional antibodies capable of binding to the FGF-13 protein antigen may be produced in a two-step procedure through the use of anti-idiotypic antibodies. Such a method makes use of the fact that antibodies are themselves antigens, and that, therefore, it is possible to obtain an antibody which binds to a second antibody. In accordance with this method, FGF-13-protein specific antibodies are used to immunize an animal, preferably a mouse. The splenocytes of such an animal are then used to produce hybridoma cells, and the hybridoma cells are screened to identify clones which produce an antibody whose ability to bind to the FGF-13 protein-specific antibody can be blocked by the FGF-13 protein antigen. Such antibodies comp i se anti-idiotypic antibodies to the FGF-13 protein-specific antibody and can be used to immunize an animal to induce formation of further FGF-13 protein-specific antibodies.
- It will be appreciated that Fab and F(ab′)2 and other fragments of the antibodies of the present invention may be used according to the methods disclosed herein. Such fragments are typically produced by proteolytic cleavage, using enzymes such as papain (to produce Fab fragments) or pepsin (to produce F(ab′)2 fragments). Alternatively, FGF-13 protein-binding fragments can be produced through the application of recombinant DNA technology or through synthetic chemistry.
- For in vivo use of anti-FGF-13 in humans, it may be preferable to use “humanized” chimeric monoclonal antibodies. Such antibodies can be produced using genetic constructs derived from hybridoma cells producing the monoclonal antibodies described above. Methods for producing chimeric antibodies are known in the art. See, for review, Morrison, Science 229:1202 (1985); 0i et al., BioTechniques 4:214 (1986); Cabilly et al., U.S. Pat. No. 4,816,567; Taniguchi et al., EP 171496; Morrison et al., EP 173494; Neuberger et al., WO 8601533; Robinson. et al., WO 8702671; Boulianne et al., Nature 312:643 (1984); Neuberger et al., Nature, 314:268 (1985).
- FGF-13 Related Disorders
- Diagnosis
- This invention is also related to the use of the genes of the present invention as part of a diagnostic assay for detecting diseases or susceptibility to diseases related to the presence of mutations in the nucleic acid sequences encoding the polypeptide of the present invention.
- Individuals carrying mutations in a gene of the present invention may be detected at the DNA level by a variety of techniques. Nucleic acids for diagnosis may be obtained from a patient's cells, such as from blood, urine, saliva, tissue biopsy and autopsy material. The genomic DNA may be used directly for detection or may be amplified enzymatically by using PCR (Saiki et al., Nature, 324:163-166 (1986)) prior to analysis. RNA or cDNA may also be used for the same purpose. As an example, PCR primers complementary to the nucleic acid encoding a polypeptide of the present invention can be used to identify and analyze mutations. For example, deletions and insertions can be detected by a change in size of the amplified product in comparison to the normal genotype. Point mutations can be identified by hybridizing amplified DNA to radiolabeled RNA or alternatively, radiolabeled antisense DNA sequences. Perfectly matched sequences can be distinguished from mismatched duplexes by RNase A digestion or by differences in melting temperatures.
- Genetic testing based on DNA sequence differences may be achieved by detection of alteration in electrophoretic mobility of DNA fragments in gels with or without denaturing agents. Small sequence deletions and insertions can be visualized by high resolution gel electrophoresis. DNA fragments of different sequences may be distinguished on denaturing formamide gradient gels in which the mobilities of different DNA fragments are retarded in the gel at different positions according to their specific melting or partial melting temperatures (see, e.g., Myers et al., Science, 230:1242 (1985)).
- Sequence changes at specific locations may also be revealed by nuclease protection assays, such as RNase and S1 protection or the chemical cleavage method (e.g., Cotton et al., PNAS, USA, 85:4397-4401 (1985)).
- Thus, the detection of a specific DNA sequence may be achieved by methods such as hybridization, RNase protection, chemical cleavage, direct DNA sequencing or the use of restriction enzymes, (e.g., Restriction Fragment Length Polymorphisms (RFLP)) and Southern blotting of genomic DNA.
- In addition to more conventional gel-electrophoresis and DNA sequencing, mutations can also be detected by in situ analysis.
- The present invention also relates to a diagnostic assay for detecting altered levels of FGF-13 proteins in various tissues since an over-expression of the proteins compared to normal control tissue samples may detect the presence of abnormal cellular proliferation, for example, a tumor. Assays used to detect levels of protein in a sample derived from a host are well-known to those of skill in the art and include radioimmunoassays, competitive-binding assays, Western Blot analysis, ELISA assays and “sandwich” assay. An ELISA assay (Coligan, et al., Current Protocols in Immunology, 1(2),
Chapter 6, (1991)) initially comprises preparing an antibody specific to an antigen to the polypeptides of the present invention, preferably a monoclonal antibody. In addition a reporter antibody is prepared against the monoclonal antibody. To the reporter antibody is attached a detectable reagent such as radioactivity, fluorescence or, in this example, a horseradish peroxidase enzyme. A sample is removed from a host and incubated on a solid support, e.g. a polystyrene dish, that binds the proteins in the sample. Any free protein binding sites on the dish are then covered by incubating with a non-specific protein like bovine serum albumen. Next, the monoclonal antibody is incubated in the dish during which time the monoclonal antibodies attach to any polypeptides of the present invention attached to the polystyrene dish. All unbound monoclonal antibody is washed out with buffer. The reporter antibody linked to horseradish peroxidase is now placed in the dish resulting in binding of the reporter antibody to any monoclonal antibody bound to the protein of interest. - Unattached reporter antibody is then washed out. Peroxidase substrates are then added to the dish and the amount of color developed in a given time period is a measurement of the amount of a polypeptide of the present invention present in a given volume of patient sample when compared against a standard curve.
- A competition assay may be employed wherein antibodies specific to a polypeptide of the present invention are attached to a solid support and labeled FGF-13 and a sample derived from the host are passed over the solid support and the amount of label detected, for example by liquid scintillation chromatography, can be correlated to a quantity of a polypeptide of the present invention in the sample.
- A “sandwich” assay is similar to an ELISA assay. In a “sandwich” assay a polypeptide of the present invention is passed over a solid support and binds to antibody attached to a solid support. A second antibody is then bound to the polypeptide of interest. A third antibody which is labeled and specific to the second antibody is then passed over the solid support and binds to the second antibody and an amount can then be quantified.
- The present inventors have discovered that FGF-13 is expressed in cancerous ovarian tissue as well as fetal kidney and fetal brain tissue. Thus, cancers of these tissues as well as other cancerous tissues in mammals can express significantly enhanced levels of the FGF-13 protein and mRNA encoding the FGF-13 protein when compared to a corresponding “standard” level. Further, it is believed that enhanced levels of the FGF-13 protein can be detected in certain body fluids (e.g., sera, plasma, urine, and spinal fluid) from mammals with such a cancer when compared to sera from mammals of the same species not having the cancer. Thus, the invention provides a diagnostic method useful during diagnosis of a disorder involving FGF-13 expression, including cancers, which involves measuring the expression level of the gene encoding the FGF-13 protein in ovarian, renal or neurological system tissue or other cells or body fluid from an individual and comparing the measured gene expression level with a standard FGF-13 gene expression level in that tissue, cell or fluid, whereby an increase or decrease in the gene expression level compared to the standard is indicative of a disorder related to FGF-13 expression.
- Where a diagnosis of a disorder in the ovarian, renal or neurological system, including diagnosis of a tumor, has already been made according to conventional methods, the present invention is useful as a prognostic indicator, whereby patients exhibiting enhanced or reduced FGF-13 gene expression will experience a worse clinical outcome relative to patients expressing the gene at a level nearer the standard level.
- By “assaying the expression level of the gene encoding the FGF-13 protein” is intended qualitatively or quantitatively measuring or estimating the level of the FGF-13 protein or the level of the mRNA encoding the FGF-13 protein in a first biological sample either directly (e.g., by determining or estimating absolute protein level or mRNA level) or relatively (e.g., by comparing to the FGF-13 protein level or mRNA level in a second biological sample). Preferably, the FGF-13 protein level or mRNA level in the first biological sample is measured or estimated and compared to a standard FGF-13 protein level or mRNA level, the standard being taken from a second biological sample obtained from an individual not having the disorder or being determined by averaging levels from a population of individuals not having a disorder related to FGF-13 expression. As will be appreciated in the art, once a standard FGF-13 protein level or mRNA level is known, it can be used repeatedly as a standard for comparison.
- By “biological sample” is intended any biological sample obtained from an individual, body fluid, cell line, tissue culture, or other source which contains FGF-13 protein or mRNA. As indicated, biological samples include body fluids (such as sera, plasma, urine, synovial fluid and spinal fluid) which contain free FGF-13 protein, ovarian or renal system tissue, and other tissue sources found to express complete or mature FGF-13 polypeptide or an FGF-13 receptor. Methods for obtaining tissue biopsies and body fluids from mammals are well known in the art. Where the biological sample is to include mRNA, a tissue biopsy is the preferred source.
- Total cellular RNA can be isolated from a biological sample using any suitable technique such as the single-step guanidinium-thiocyanate-phenol-chloroform method described in Chomczynski and Sacchi, Anal. Biochem. 162:156-159(1987). Levels of mRNA encoding the FGF-13 protein are then assayed using any appropriate method. These include Northern blot analysis, S1 nuclease mapping, the polymerase chain reaction (PCR), reverse transcription in combination with the polymerase chain reaction (RT-PCR), and reverse transcription in combination with the ligase chain reaction (RT-LCR).
- Assaying FGF-13 protein levels in a biological sample can occur using antibody-based techniques. For example, FGF-13 protein expression in tissues can be studied with classical immunohistological methods (Jalkanen, M., et al., J. Cell. Biol. 101:976-985 (1985); Jalkanen, M., et al., J. Cell. Biol. 105:3087-3096 (1987)). Other antibody-based methods useful for detecting FGF-13 protein gene expression include immunoassays, such as the enzyme linked immunosorbent assay (ELISA) and the radioimmunoassay (RIA). Suitable antibody assay labels are known in the art and include enzyme labels, such as, glucose oxidase, and radioisotopes, such as iodine (125I, 121I), carbon (14C), sulfur (35S), tritium (3H), indium (1121n), and technetium (99mTc), and fluorescent labels, such as fluorescein and rhodamine, and biotin.
- In addition to assaying FGF-13 protein levels in a biological sample obtained from an individual, FGF-13 protein can also be detected in vivo by imaging. Antibody labels or markers for in vivo imaging of FGF-13 protein include those detectable by X-radiography, NMR or ESR. For X-radiography, suitable labels include radioisotopes such as barium or cesium, which emit detectable radiation but are not overtly harmful to the subject. Suitable markers for NMR and ESR include those with a detectable characteristic spin, such as deuterium, which may be incorporated into the antibody by labeling of nutrients for the relevant hybridoma.
- A FGF-13 protein-specific antibody or antibody fragment which has been labeled with an appropriate detectable imaging moiety, such as a radioisotope (for example, 131I, 112In, 99mTc), a radio-opaque substance, or a material detectable by nuclear magnetic resonance, is introduced (for example, parenterally, subcutaneously or intraperitoneally) into the mammal to be examined for immune system disorder. It will be understood in the art that the size of the subject and the imaging system used will determine the quantity of imaging moiety needed to produce diagnostic images. In the case of a radioisotope moiety, for a human subject, the quantity of radioactivity injected will normally range from about 5 to 20 millicuries of 99mTc. The labeled antibody or antibody fragment will then preferentially accumulate at the location of cells which contain FGF-13 protein. In vivo tumor imaging is described in S. W. Burchiel et al., “Immunopharmacokinetics of Radiolabeled Antibodies and Their Fragments” (
Chapter 13 in Tumor Imaging: The Radiochemical Detection of Cancer, S. W. Burchiel and B. A. Rhodes, eds., Masson Publishing Inc. (1982)). - Treatment
- The polypeptide of the present invention, as a result of the ability to stimulate vascular endothelial cell growth, may be employed in treatment for stimulating re-vascularization ischemic tissues due to various disease conditions such as thrombosis, arteriosclerosis, and other cardiovascular conditions. These polypeptide may also be employed to stimulate angiogenesis and limb regeneration.
- The polypeptide may also be employed for treating wounds due to injuries, burns, post-operative tissue repair, and ulcers since they are mitogenic to various cells of different origins, such as fibroblast cells and skeletal muscle cells, and therefore, facilitate the repair or replacement of damaged or diseased tissue.
- The polypeptide of the present invention may also be employed stimulate neuronal growth and to treat and prevent neuronal damage associated with stroke and which occurs in certain neuronal disorders or neuro-degenerative conditions such as Alzheimer's disease, Parkinson's disease, and AIDS related complex. FGF-13 increases the number of dopaminergic neurons surviving in vitro indicating that it may benefit the Parkinson's disease patient. FGF-13 has the ability to stimulate chondrocyte growth, therefore, they may be employed to enhance bone and periodontal regeneration and aid in tissue transplants or bone grafts.
- The polypeptide of the present invention may be also be employed to prevent skin aging due to sunburn by stimulating keratinocyte growth.
- The FGF-13 polypeptide may also be employed for preventing hair loss, since FGF family members activate hair-forming cells and promotes melanocyte growth. Along the same lines, the polypeptides of the present invention may be employed to stimulate growth and differentiation of hematopoietic cells and bone marrow cells when used in combination with other cytokines.
- The FGF-13 polypeptide may also be employed to maintain organs before transplantation or for supporting cell culture of primary tissues.
- The polypeptide of the present invention may also be employed for inducing tissue of mesodermal origin to differentiate in early embryos.
- In accordance with yet a further aspect of the present invention, there is provided a process for utilizing such polypeptides, or polynucleotides encoding such polypeptides, for in vitro purposes related to scientific research, synthesis of DNA, manufacture of DNA vectors and for the purpose of providing diagnostics and therapeutics for the treatment of human disease.
- This invention provides a method for identification of the receptors for the polypeptides of the present invention. The genes encoding the receptor can be identified by numerous methods known to those of skill in the art, for example, ligand, panning and FACS sorting (Coligan, et al., Current Protocols in Immun., 1(2), Chapter 5, (1991)). Preferably, expression cloning is employed wherein polyadenylated RNA is prepared from a cell responsive to the polypeptides, for example, NIH3T3 cells which are known to contain multiple receptors for the FGF family proteins, and SC-3 cells, and a cDNA library created from this RNA is divided into pools and used to transfect COS cells or other cells that are not responsive to the polypeptides. Transfected cells which are grown on glass slides are exposed to the polypeptide of the present invention, after they have been labeled. The polypeptides can be labeled by a variety of means including iodination or inclusion of a recognition site for a site-specific protein kinase.
- Following fixation and incubation, the slides are subjected to auto-radiographic analysis. Positive pools are identified and sub-pools are prepared and re-transfected using an iterative sub-pooling and re-screening process, eventually yielding a single clones that encodes the putative receptor.
- As an alternative approach for receptor identification, the labeled polypeptides can be photoaffinity linked with cell membrane or extract preparations that express the receptor molecule. Cross-linked material is resolved by PAGE analysis and exposed to X-ray film. The labeled complex containing the receptors of the polypeptides can be excised, resolved into peptide fragments, and subjected to protein microsequencing. The amino acid sequence obtained from microsequencing would be used to design a set of degenerate oligonucleotide probes to screen a cDNA library to identify the genes encoding the putative receptors.
- As a further approach to identifying the specific classes of known FGF-specific receptors which bind FGF-13, recombinant human FGF-13 protein was assayed for mitogenic activity on BaF3 cell lines engineered to express individual FGF receptors (Ornitz et al., J. Biol. Chem., 271:15292-15297 (1996)). These experiments demonstrate that FGF-13 preferentially activates
FGF receptors 3c and 4 and has some activity toward FGF receptors 1c and 2c. SeeFIG. 13 . No activity was detected toward the “b” splice variants of any FGF receptor. Overall, this is a similar receptor specificity pattern to that of FGF-8. However, the overall activity of recombinant FGF-13 is considerably lower than that of other FGFs, suggesting that the particular preparation of this recombinant protein which was tested was not fully active. - Formulations
- The FGF-13 polypeptide composition will be formulated and dosed in a fashion consistent with good medical practice, taking into account the clinical condition of the individual patient (especially the side effects of treatment with FGF-13 polypeptide alone), the site of delivery of the FGF-13 polypeptide composition, the method of administration, the scheduling of administration, and other factors known to practitioners. The “effective amount” of FGF-13 polypeptide for purposes herein is thus determined by such considerations.
- The polypeptides, agonists and antagonists of the present invention may be employed in combination with a suitable pharmaceutical carrier to comprise a pharmaceutical composition for parenteral administration. Such compositions comprise a therapeutically effective amount of the polypeptide, agonist or antagonist and a pharmaceutically acceptable carrier or excipient. Such a carrier includes but is not limited to saline, buffered saline, dextrose, water, glycerol, ethanol, and combinations thereof. The formulation should suit the mode of administration.
- The invention also provides a pharmaceutical pack or kit comprising one or more containers filled with one or more of the ingredients of the pharmaceutical compositions of the invention. Associated with such containers can be a notice in the form prescribed by a governmental agency regulating the manufacture, use or sale of pharmaceuticals or biological products, which notice reflects approval by the agency of manufacture, use or sale for human administration. In addition, the polypeptides, agonists and antagonists of the present invention may be employed in conjunction with other therapeutic compounds.
- The pharmaceutical compositions may be administered in a convenient manner such as by the oral, topical, intravenous, intraperitoneal, intramuscular, subcutaneous, intranasal or intradermal routes. The pharmaceutical compositions are administered in an amount which is effective for treating and/or prophylaxis of the specific indication. In general, they are administered in an amount of at least about 10 μg/kg body weight and in most cases they will be administered in an amount not in excess of about 8 mg/Kg body weight per day. In most cases, the dosage is from about 10 μg/kg to about 1 mg/kg body weight daily, taking into account the routes of administration, symptoms, etc. In the specific case of topical administration, dosages are preferably administered from about 0.1 μg to 9 mg per cm2.
- The polypeptide of the invention and agonist and antagonist compounds which are polypeptides, may also be employed in accordance with the present invention by expression of such polypeptide in vivo, which is often referred to as “gene therapy.”
- Thus, for example, cells may be engineered with a polynucleotide (DNA or RNA) encoding for the polypeptide ex vivo, the engineered cells are then provided to a patient to be treated with the polypeptide. Such methods are well-known in the art. For example, cells may be engineered by procedures known in the art by use of a retroviral particle containing RNA encoding for the polypeptide of the present invention.
- Similarly, cells may be engineered in vivo for expression of the polypeptide in vivo, for example, by procedures known in the art. As known in the art, a producer cell for producing a retroviral particle containing RNA encoding the polypeptide of the present invention may be administered to a patient for engineering cells in vivo and expression of the polypeptide in vivo. These and other methods for administering a polypeptide of the present invention by such methods should be apparent to those skilled in the art from the teachings of the present invention. For example, the expression vehicle for engineering cells may be other than a retroviral particle, for example, an adenovirus, which may be used to engineer cells in vivo after combination with a suitable delivery vehicle.
- Retroviruses from which the retroviral plasmid vectors hereinabove mentioned may be derived include, but are not limited to, Moloney Murine Leukemia Virus, spleen necrosis virus, retroviruses such as Rous Sarcoma Virus, Harvey Sarcoma Virus, avian leukosis virus, gibbon ape leukemia virus, human immunodeficiency virus, adenovirus, Myeloproliferative Sarcoma Virus, and mammary tumor virus. In one embodiment, the retroviral plasmid vector is derived from Moloney Murine Leukemia Virus.
- The vector includes one or more promoters. Suitable promoters which may be employed include, but are not limited to, the retroviral LTR; the SV40 promoter; and the human cytomegalovirus (CMV) promoter described in Miller, et al., Biotechniques, Vol. 7, No. 9, 980-990 (1989), or any other promoter (e.g., cellular promoters such as eukaryotic cellular promoters including, but not limited to, the histone, pol III, and 13-actin promoters). Other viral promoters which may be employed include, but are not limited to, adenovirus promoters, thymidine kinase (TK) promoters, and B19 parvovirus promoters. The selection of a suitable promoter will be apparent to those skilled in the art from the teachings contained herein.
- The nucleic acid sequence encoding the polypeptide of the present invention is under the control of a suitable promoter. Suitable promoters which may be employed include, but are not limited to, adenoviral promoters, such as the adenoviral major late promoter; or hetorologous promoters, such as the cytomegalovirus (CMV) promoter; the respiratory syncytial virus (RSV) promoter; inducible promoters, such as the MMT promoter, the metallothionein promoter; heat shock promoters; the albumin promoter; the ApoAI promoter; human globin promoters; viral thymidine kinase promoters, such as the Herpes Simplex thymidine kinase promoter; retroviral LTRs (including the modified retroviral LTRs hereinabove described); the 13-actin promoter; and human growth hormone promoters. The promoter also may be the native promoter which controls the gene encoding the polypeptide.
- The retroviral plasmid vector is employed to transduce packaging cell lines to form producer cell lines. Examples of packaging cells which may be transfected include, but are not limited to, the PE501, PA317, -2, -AM, PA12, T19-14×, VT-19-17-H2, CRE, CRIP, GP+E-86, GP+envAm12, and DAN cell lines as described in Miller, Human Gene Therapy, Vol. 1, pgs. 5-14 (1990), which is incorporated herein by reference in its entirety. The vector may transducer the packaging cells through any means known in the art. Such means include, but are not limited to, electroporation, the use of liposomes, and CaPO4 precipitation. In one alternative, the retroviral. plasmid vector may be encapsulated into a liposome, or coupled to a lipid, and then administered to a host.
- The producer cell line generates infectious retroviral vector particles which include the nucleic acid sequence(s) encoding the polypeptides. Such retroviral vector particles then may be employed, to transduce eukaryotic cells, either in vitro or in vivo. The transduced eukaryotic cells will express the nucleic acid sequence(s) encoding the polypeptide. Eukaryotic cells which may be transduced include, but are not limited to, embryonic stem cells, embryonic carcinoma cells, as well as hematopoietic stem cells, hepatocytes, fibroblasts, myoblasts, keratinocytes, endothelial cells, and bronchial epithelial cells.
- Agonists and Antagonists—Assays and Molecules
- This invention provides a method of screening compounds to identify those which modulate the action of the polypeptide of the present invention. An example of such an assay comprises combining a mammalian fibroblast ‘cell, a the polypeptide of the present invention, the compound to be screened and 3[H] thymidine under cell culture conditions where the fibroblast cell would normally proliferate. A control assay may be performed in the absence of the compound to be screened and compared to the amount of fibroblast proliferation in the presence of the compound to determine if the compound stimulates proliferation by determining the uptake of 3[H] thymidine in each case. The amount of fibroblast cell proliferation is measured by liquid scintillation chromatography which measures the incorporation of 3[H] thymidine. Both agonist and antagonist compounds may be identified by this procedure.
- In another method, a mammalian cell or membrane preparation expressing a receptor for a polypeptide of the present invention (as described above and in (Ornitz et al., supra) is incubated with a labeled polypeptide of the present invention in the presence of the compound. The ability of the compound to enhance or block this interaction could then be measured. Alternatively, the response of a known second messenger system following interaction of a compound to be screened and the FGF-13 receptor is measured and the ability of the compound to bind to the receptor and elicit a second messenger response is measured to determine if the compound is a potential agonist or antagonist. Such second messenger systems include but are not limited to, cAMP guanylate cyclase, ion channels or phosphoinositide hydrolysis.
- Examples of antagonist compounds include antibodies, or in some cases, oligonucleotides, which bind to the receptor for the polypeptide of the present invention but elicit no second messenger response or bind to the FGF-13 polypeptide itself. Alternatively, a potential antagonist may be a mutant form of the polypeptide which binds to the receptors, however, no second messenger response is elicited and, therefore, the action of the polypeptide is effectively blocked.
- Another antagonist compound to the FGF-13 gene and gene product is an antisense construct prepared using antisense technology. Antisense technology can be used to control gene expression through triple-helix formation or antisense DNA or RNA, both of which methods are based on binding of a polynucleotide to DNA or RNA. For example, the 5′ coding portion of the polynucleotide sequence, which encodes for the mature polypeptides of the present invention, is used to design an antisense RNA oligonucleotide of from about 10 to 40 base pairs in length. A DNA oligonucleotide is designed to be complementary to a region of the gene involved in transcription (triple helix—see Lee et al., Nucl. Acids Res., 6:3073 (1979); Cooney et al, Science, 241:456 (1988); and Dervan et al., Science, 251: 1360 (1991)), thereby preventing transcription and the production of the polypeptides of the present invention. The antisense RNA oligonucleotide hybridizes to the mRNA in vivo and blocks translation of the mRNA molecule into the polypeptide (Antisense—Okano, J., Neurochem., 56:560 (1991); Oligodeoxynucleotides as Antisense Inhibitors of Gene Expression, CRC Press, Boca Raton, Fla. (1988)). The oligonucleotides described above can also be delivered to cells such that the antisense RNA or DNA may be expressed in vivo to inhibit production of the polypeptide.
- Potential antagonist compounds also include small molecules which bind to and occupy the binding site of the receptors thereby making the receptor inaccessible to its polypeptide such that normal biological activity is prevented. Examples of small molecules include, but are not limited to, small peptides or peptide-like molecules.
- Antagonist compounds may be employed to inhibit the cell growth and proliferation effects of the polypeptides of the present invention on neoplastic cells and tissues, i.e. stimulation of angiogenesis of tumors, and, therefore, retard or prevent abnormal cellular growth and proliferation, for example, in tumor formation or growth.
- The antagonists may also be employed to prevent hyper-vascular diseases, and prevent the proliferation of epithelial lens cells after extracapsular cataract surgery. Prevention of the mitogenic activity of the polypeptides of the present invention may also be desirous in cases such as restenosis after balloon angioplasty.
- The antagonists may also be employed to prevent the growth of scar tissue during wound healing.
- Chromosome Assays
- In certain preferred embodiments relating to chromosomal mapping, the cDNA herein disclosed is used to clone genomic DNA of an FGF-13 gene. This, can be accomplished using a variety of well known techniques and libraries, which generally are available commercially. The genomic DNA then. is used for in situ chromosome mapping using well known techniques for this purpose. Therefore, the nucleic acid molecules of the present invention are also valuable for chromosome identification. The sequence is specifically targeted to and can hybridize with a particular location on an individual human chromosome. Moreover, there is a current need for identifying 25 particular sites on the chromosome. Few chromosome marking reagents based on actual sequence data (repeat polymorphisms) are presently available for marking chromosomal location. The mapping of DNAs to chromosomes according to the present invention is an important first step in correlating those sequences with genes associated with disease.
- Briefly, sequences can be mapped to chromosomes by preparing PCR primers (preferably 15-25 bp) from the cDNA. Computer analysis of the 3′ untranslated region is used to rapidly select primers that do not span more than one exon in the genomic DNA, thus complicating the amplification process. These primers are then used for PCR screening of somatic cell hybrids containing individual human chromosomes. Only those hybrids containing the human gene corresponding to the primer will yield an amplified fragment.
- PCR mapping of somatic cell hybrids is a rapid procedure for assigning a particular DNA to a particular chromosome. Using the present invention with the same oligonucleotide primers, sublocalization can be achieved with panels of fragments from specific chromosomes or pools of large genomic clones in an analogous manner. Other mapping strategies that can similarly be used to map to its chromosome include in situ hybridization, prescreening with labeled flow-sorted chromosomes and preselection by hybridization to construct chromosome specificcDNA libraries.
- Fluorescence in situ hybridization (FISH) of a cDNA clone to a metaphase chromosomal spread can be used to provide a precise chromosomal location in one step. This technique can be used with cDNA as short as 50 or 60 bases. For a review of this technique, see Verma et al., Human Chromosomes: a Manual of Basic Techniques, Pergamon Press, New York (1988).
- Once a sequence has been mapped to a precise chromosomal location, the physical position of the sequence on the chromosome can be correlated with genetic map data. (Such data are found, for example, in V. McKusick, Mendelian Inheritance in Man (available on line through Johns Hopkins University Welch Medical Library). The relationship between genes and diseases that have been mapped to the same chromosomal region are then identified through linkage analysis (coinheritance of physically adjacent genes).
- Next, it is necessary to determine the differences in the cDNA or genomic sequence between affected and unaffected individuals. If a mutation is observed in some or all of the affected individuals but not in any normal individuals, then the mutation is likely to be the causative agent of the disease.
- With current resolution of physical mapping and genetic mapping techniques, a cDNA precisely localized to a chromosomal region associated with the disease could be one of between 50 and 500 potential causative genes. (This assumes 1 megabase mapping resolution and one gene per 20 kb).
- Using methods described above, the FGF-13 gene of the invention has been mapped by florescent in situ hybridization to human chromosome 8p21. The corresponding map position in the mouse includes several disease loci including ds (disorganization-developmental disruption) and wc (waved coat-homozygous lethality).
- Having generally described the invention, the same will be more readily understood by reference to the following examples, which are provided by way of illustration and are not intended as limiting.
- The present invention will be further described with reference to the following examples; however, it is to be understood that the present invention is not limited to such examples. All parts or amounts, unless otherwise specified, are by weight.
- In order to facilitate understanding of the following examples, certain frequently occurring methods and/or terms will be described.
- “Plasmids” are designated by a lower case p. preceded and/or followed by capital letters and/or numbers. The starting plasmids herein are either commercially available, publicly available on an unrestricted basis, or can be constructed from available plasmids in accord with published procedures. In addition, equivalent plasmids to those described are known in the art and will be apparent to the ordinarily skilled artisan.
- “Digestion” of DNA refers to catalytic cleavage of the DNA with a restriction enzyme that acts only at certain sequences in the DNA. The various restriction enzymes used herein are commercially available and their reaction conditions, cofactors and other requirements were used as would be known to the ordinarily skilled artisan. For analytical purposes, typically 1 μg of plasmid or DNA fragment is used with about 2 units of enzyme in about 20 μl of buffer solution. For the purpose of isolating DNA fragments for plasmid construction, typically 5 to 50 μg of DNA are digested with 20 to 250 units of enzyme in a larger volume. Appropriate buffers and substrate amounts for particular restriction enzymes are specified by the manufacturer. Incubation times of about 1 hour at 37° C. are ordinarily used, but may vary in accordance with the supplier's instructions. After digestion the reaction is electrophoresed directly on a polyacrylamide gel to isolate the desired fragment.
- Size separation of the cleaved fragments is performed using 8 percent polyacrylamide gel described by Goeddel, D. et al., Nucleic Acids Res., 8:4057 (1980).
- Oligonucleotides” refers to either a single stranded polydeoxynucleotide or two complementary polydeoxynucleotide strands which may be chemically synthesized. Such synthetic oligonucleotides have no 5′ phosphate and thus will not ligate to another oligonucleotide without adding a phosphate with an ATP in the presence of a kinase. A synthetic oligonucleotide will ligate to a fragment that has not been dephosphorylated.
- “Ligation” refers to the process of forming phosphodiester bonds between two double stranded nucleic acid fragments (Maniatis, T., et al., Id., p. 146). Unless otherwise provided, ligation may be accomplished using known buffers and conditions with 10 units of T4 DNA ligase (“ligase”) per 0.5 μg of approximately equimolar amounts of the DNA fragments to be ligated.
- Unless otherwise stated, transformation was performed as described by the method of Graham, F. and Van der Eb, A., Virology, 52:456-457 (1973).
- The DNA sequence encoding FGF-13 ATCC™ No. 97148, was initially amplified using PCR oligonucleotide primers corresponding to the 5′ sequences of the polypeptide having the amino acid sequence from
position 2 to position 193 of SEQ ID NO:2 and to the vector sequences 3′ to the gene. Additional nucleotides corresponding to the gene were added to the 5′ and 3′ sequences respectively. The 5′ oligonucleotide primer 5′ GCCAGACCATGGAGAATCACCCGTCTCCTAAT 3′ (SEQ ID NO:11) contains a Nco restriction enzyme site. The 3′ sequence 5′ GATTTAAGATCTCGTGAGGGGCTGGGGCCG 3′ (SEQ ID NO:12) contains complementary sequences to a BgIII site and is followed by 18 nucleotides of FGF-13 coding sequence. - The restriction enzyme sites correspond to the restriction enzyme sites on the bacterial expression vector pQE-60 (Qiagen, Inc. Chatsworth, Calif. 91311). pQE-60 encodes antibiotic resistance (Ampr), a bacterial origin of replication (ori), an IPTG-regulatable promoter operator (P/O), a ribosome binding site (RBS), a 6-His tag and restriction enzyme sites. pQE-60 was then digested with NcoI and BgIII. The amplified sequences were ligated into pQE-60 and were inserted in frame with the sequence encoding for the histidine tag and the ribosome binding site (RBS). The ligation mixture was then used to transform E. coli strain M15/rep4 (Qiagen, Inc.) by the procedure described in Sambrook, J. et al., Molecular Cloning: A Laboratory Manual, Cold Spring Laboratory Press, (1989). M15/rep4 contains multiple copies of the plasmid pREP4, which expresses the lacI repressor and also confers kanamycin resistance (Kanr). Transformants were identified by their ability to grow on LB plates and ampicillin/kanamycin resistant colonies were selected. Plasmid DNA was isolated and confirmed by restriction analysis.
- Clones containing the desired constructs are grown overnight (O/N) in liquid culture in LB media supplemented with both Amp (100 μg/ml) and Kanr (25 μg/ml). The O/N culture is used to inoculate a large culture at a ratio of 1:100 to 1:250. The cells are grown to an optical density 600 (O.D.600) of between 0.4 and 0.6. IPTG (“Isopropyl-B-D-thiogalacto pyranoside”) is then added to a final concentration of 1 mM. IPTG induces by inactivating the lacI repressor, clearing the P/0 leading to increased gene expression. Cells are grown an extra 3 to 4 hours. Cells are then harvested by centrifugation. The cell pellet is solubilized in the
chaotropic agent 6 Molar Guanidine HCl. After clarification, solubilized FGF-13 is purified from this solution by chromatography on a Nickel-Chelate column under conditions that allow for tight binding by proteins containing the 6-His tag (Hochuli, E. et al., J. Chromatography 411:177-184 (1984)). The proteins are eluted from the column in 6 molar guanidine HC1 pH 5.0 and for the purpose of renaturation adjusted to 3 molar guanidine HCl, 100 mM sodium phosphate, 10 mmolar glutathione (reduced) and 2 mmolar glutathione (oxidized). After incubation in this solution for 12 hours the proteins are dialyzed to 10 mmolar sodium phosphate. - The bacterial expression vector pQE70 is used for bacterial expression in this example (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311). pQE70 encodes ampicillin antibiotic resistance (“Ampr) and contains a bacterial origin of replication (“ori”), an IPTG inducible promoter, a ribosome binding site (“RBS”), six codons encoding histidine residues that allow affinity purification using nickel-nitrilotri-acetic acid (“Ni-NTA”) affinity resin sold by QIAGEN, Inc., supra, and suitable single restriction enzyme cleavage sites. These elements are arranged such that a DNA fragment encoding a polypeptide may be inserted in such as way as to produce that polypeptide with the six His residues (i.e., a “6×His tag”) covalently linked to the carboxyl terminus of that polypeptide. However, in this example, the polypeptide coding sequence is inserted such that translation of the six His codons is prevented and, therefore, the polypeptide is produced with no 6×His tag.
- The DNA sequence encoding the desired portion of the FGF-13 protein comprising the predicted mature form of the FGF-13 amino acid sequence (i.e., amino acids 1-193 of SEQ ID NO:2) was amplified from the deposited cDNA clone using PCR oligonucleotide primers which anneal to the amino terminal sequences encoding the desired portion of the FGF-13 protein and to sequences in the deposited construct 3′ to the cDNA coding sequence. Additional nucleotides containing restriction sites to facilitate cloning in the pQE70 vector were added to the 5′ and 3′ sequences, respectively.
- For cloning mature form of the FGF-13 protein, the 5′ primer had the sequence 5′ CTAGTCGCATGCAGGGGGAGAATCACCCGTCT 3′ (SEQ ID NO:13) containing the underlined SphI restriction site, which includes an initiation codon and following the initiation codon, 21 nucleotides of the amino terminal coding sequence of the mature FGF-13 sequence in SEQ ID NO:2. One of ordinary skill in the art would appreciate, of course, that the point in the protein coding sequence where the 5′ primer begins may be varied to amplify a desired portion of the complete protein shorter or longer than the mature form. The 3′ primer had the sequence 5′ GCTTGAAAGCTTCTACGTGAGGGGCTGGGGCCG 3′ (SEQ ID NO:14) containing the underlined HindIII restriction site followed by a stop codon and 18 nucleotides complementary to the 3′ end of the coding sequence in the FGF-13 DNA sequence in SEQ ID NO:1.
- The amplified FGF-13 DNA fragments and the vector pQE70 were digested with SphI and HindIII and the digested DNAs were then ligated together. Insertion of the FGF-13 DNA into the restricted pQE70 vector places the FGF-13 protein coding region including its associated stop codon downstream from the IPTG-inducible promoter and in-frame with the initiating AUG in the 5′ primer. The associated stop codon prevents translation of the six histidine codons downstream of the insertion point.
- The ligation mixture was transformed into competent E. coli cells ‘using standard procedures such as those described in Sambrook et al., Molecular Cloning: a Laboratory Manual, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989). E. coli strain M15/rep4, containing multiple copies of the plasmid pREP4, which expresses the lac repressor and confers kanamycin resistance (“Kanr”), was used in carrying out the illustrative example described herein. This strain, which is only one of many that are suitable for expressing FGF-13 protein, is available commercially from QIAGEN, Inc., supra. Transformants were identified by their ability to grow on LB plates in the presence of ampicillin and kanamycin. Plasmid DNA was isolated from resistant colonies and the identity of the cloned DNA confirmed by restriction analysis, PCR and DNA sequencing.
- Clones containing the desired constructs were grown overnight (“O/N”) in liquid culture in LB media supplemented with both ampicillin (100 μg/ml) and kanamycin (25 μg/ml). The O/N culture was used to inoculate a large culture, at a dilution of approximately 1:25 to 1:250. The cells are grown to an optical density at 600 nm (“OD600”) of between 0.4 and 0.6. Isopropyl-b-D-thiogalactopyranoside (“IPTG”) is then added to a final concentration of 1 mM to induce transcription from the lac repressor sensitive promoter, by inactivating the lacI repressor. Cells subsequently were incubated further for 3 to 4 hours and were then harvested by centrifugation.
- To purify the FGF-13 polypeptide, the cells were lysed in a microfluidizer and then stirred for 3-4 hours at 4° C. in 2M and then 6M guanidine-HCl, 50 mM tris-HCl, pH 7.5, 2 mM EDTA. FGF-13 protein was present in both the 2M and 6M GuHCl extracts. The combined GuHCLl extract was quickly diluted into a buffer containing 30 mM Tris pH7.5, 5 mM EDTA, 200 mM NaCl, 20 ug/ml Pefabloc SC, 2 ug/ml E-64 (Boeringer Mannhein). The refolded FGF-13 was purified through
poros 50 HS (PerSeptive Biosystem) cation exchange column at pH7. The HS purified protein was applied to a set ofporos HQ 50/poros CM 20 (PerSeptive Biosystem) anion/cation columns in a tandem chromatographic mode. FGF-13 was eluted from the CM column with 20 column volumes of 0.2 to 1.25M NaCl linear gradient in 24 mM NaCl, and purification was finished with a S200 sepharcryl HR (Pharmacia) size exclusion column. - The GuHCl extracted protein appeared to be the same size as the starting material on SDS-PAGE and was greater than 60% pure. However, after refolding the protein showed three bands which appeared to be about 2 kD smaller on SDS-PAGE, suggesting that proteolytic degradation may have occurred during refolding. Refolded FGF-13 captured by a strong cation exchange on the
poros HS 50 column eluted at 80% purity with 1M NaCl. The protein resulting from the set of tandem columns, which was eluted from the CM column with 600 mM NaCl, showed at least three different bands on SDS-PAGE: two upper bands at about 22 kD and one lower band at about 19 kD. In an attempt to separate the upper and lower bands, the CM purified FGF-13 was put through a S200 sepharcryl HR size exclusion column. A fraction containing mainly the upper bands was isolated. The upper bands and the lower band were analyzed by N-terminus microsequencing. - The purified FGF-13 was slot blotted onto a ProBlott membrane (Applied Biosystems, Inc. (ABI) and stained with Ponceau S (0.2% in 3% acetic acid). The band of interest was then excised, placed in a “Blot Cartridge” and subjected to N-terminal amino acid sequence analysis using a model ABI-494 sequencer (Perkin-Elmer-Applied Biosystems, Inc.) and the Gas-phase Blot cycles. The results showed that the N-terminal sequence of the upper doublet bands was as predicted for the QE70 expression construct including the N-terminal Met (i.e., MQGEN . . . ) while the lower MW band had an N-
terminal sequence 21 amino acids shorter (i.e., TDQLS). These terminal sequences represented, respectively, 40% and 50% of all N-termini in the original unfractionated preparation. Fibroblast proliferation assays showed that the upper and lower fractions exhibited comparable, and both fractions were more active than the His-tagged FGF-13 made using the vector of Example 1(a). These assays also showed that FGF-13 can be frozen at −80° C. and thawed later without losing its activity. The upper and lower FGF-13 fractions were then combined for all further biological activity tests described herein, producing a mixture consisting of three bands with nearly equal intensity on SDS-PAGE, greater than 95% purity and a low endotoxin level of 2 EU/mg. - The DNA sequence encoding the full length FGF-13 protein, ATCC™ No. 97148 is amplified using PCR oligonucleotide primers corresponding to the 5′ and 3′ sequences of the gene:
- The FGF-13 5′ primer has the sequence 5′ CTAGTGGATCCCGA GAATCACCCGTCTCCT 3′ (SEQ ID NO:15) and contains a BamHI restriction enzyme site (in bold) such that cloning at this site will put the baculovirus signal sequence in frame with 18 nucleotides of the FGF-13 gene downstream of the putative FGF-13 signal peptide cleavage site.
- The 3′ primer has the sequence 5′ CGACTTCTAGAACCT CGGGGATCTGGCTCC 3′ (SEQ ID NO:16) and contains the cleavage site for the restriction endonuclease XbaI and 18 nucleotides complementary to the 3′ non-translated sequence of the gene. The amplified sequences are isolated from a 1% agarose gel using a commercially available kit (“Geneclean,”
BIO 101 Inc., La Jolla, Calif.). The fragment is then digested with the respective endonucleases and purified again on a 1% agarose gel. This fragment is designated F2. - The vector pA2gp (modification of pVL941 vector, discussed below) is used for the expression of the proteins using the baculovirus expression system (for review see: Summers, M. D. and Smith, G. E. 1987, A manual of methods for baculovirus vectors and insect cell culture procedures, Texas Agricultural Experimental Station Bulletin No. 1555). This expression vector contains the strong polyhedrin promoter of the Autographa californica nuclear polyhedrosis virus (AcMNPV) followed by the recognition sites for the restriction endonucleases BamHI and XbaI. The polyadenylation site of the simian virus (SV)40 is used for efficient polyadenylation. For an easy selection of recombinant virus the beta-galactosidase gene from E. coli is inserted in the same orientation as the polyhedrin promoter followed by the polyadenylation signal of the polyhedrin gene. The polyhedrin sequences are flanked at both sides by viral sequences for the cell-mediated homologous recombination of co-transfected wild-type viral DNA. Many other baculovirus vectors could be used in place of pA2 such as pRG1, pAc373, pVL941 and pAcIM1 (Luckow, V. A. and Summers, M. D., Virology, 170:31-39).
- The plasmid is digested with the restriction enzymes and dephosphorylated using calf intestinal phosphatase by procedures known in the art. The DNA is then isolated from a 1% agarose gel using the commercially available kit (“Geneclean”
BIO 101 Inc., La Jolla, Calif.). This vector DNA is designated V2. - Fragment F2 and the dephosphorylated plasmid V2 are ligated with T4 DNA ligase. E. coli DH5 cells are then transformed and bacteria identified that contained the plasmid (pBacFGF-13) using the respective restriction enzymes. The sequence of the cloned fragment are confirmed by DNA sequencing.
- 5 μg of the plasmid pBacFGF-13 are co-transfected with 1.0 μg of a commercially available linearized baculovirus (“BACULOGOLD™ baculovirus DNA”, Pharmingen, San Diego, Calif.) using the lipofection method (Feigner et al. Proc. Natl. Acad. Sci. USA, 84:7413-7417 (1987)).
- 1 μg of BACULOGOLD™ virus DNA and 5 μg of the plasmids, in each case, are mixed in a sterile well of microtiter plates containing 50 μg of serum free Grace's medium (Life Technologies Inc., Gaithersburg, Md.). Afterwards 10 μl Lipofectin plus 90 μl Grace's medium are added, mixed and incubated for 15 minutes at room temperature. Then the transfection mixture is added drop-wise to the Sf9 insect cells (ATCC™ CRL 1711) seeded in 35 mm tissue culture plates with 1 ml Grace's medium without serum. The plates are rocked back and forth to mix the newly added solution. The plates are then incubated for 5 hours at 27° C. After 5 hours the transfection solution is removed from the plate and 1 ml of Grace's insect medium supplemented with 10% fetal calf serum is added. The plates are put back into an incubator and cultivation continued at 27° C. for four days.
- After four days the supernatant is collected and plaque assays performed similar as described by Summers and Smith (supra). As a modification an agarose gel with “Blue Gal” (Life Technologies Inc., Gaithersburg) is used which allows an easy isolation of blue stained plaques. (A detailed description of a “plaque assay” can also be found in the user's guide for insect cell culture and baculovirology distributed by Life Technologies Inc., Gaithersburg, page 9-10).
- Four days after the serial dilution the virus is added to the cells and blue stained plaques are picked with the tip of an Eppendorf pipette. The agar containing the recombinant viruses is then resuspended in an Eppendorf tube containing 20011 of Grace's medium. The agar is removed by a brief centrifugation and the supernatant containing the recombinant baculovirus is used to infect Sf9 cells seeded in 35 mm dishes. Four days later the supernatants of these culture dishes are harvested and then stored at 4° C.
- Sf9 cells are grown in Grace's medium supplemented with 10% heat-inactivated FBS. The cells are infected with the recombinant baculovirus V-FGF-13 at a multiplicity of infection (MOI) of 2. Six hours later the medium is removed and replaced with SF900 II medium minus methionine and cysteine (Life Technologies Inc., Gaithersburg). 42 hours later 5 μCi of 35S-methionine and 5 μCi 35S cysteine (Amersham) are added. The cells are further incubated for 16 hours before they are harvested by centrifugation and the labelled proteins visualized by SDS-PAGE and autoradiography.
- The expression of the predicted mature FGF-13 polypeptide uses a plasmid, FGF-13-HA derived from a vector pcDNA3/Amp (Invitrogen) containing: 1) SV40 origin of replication, 2) ampicillin resistance gene, 3) E. coli replication origin, 4) CMV promoter followed by a polylinker region, an SV40 intron and polyadenylation site. DNA fragments encoding the entire FGF-13 precursor and an HA tag fused in frame to the 3′ end is cloned into the polylinker region of the vector, therefore, the recombinant protein expression is directed under the CMV promoter. The HA tag corresponds to an epitope derived from the influenza hemagglutinin protein as previously described (I. Wilson, H. Niman, R. Heighten, A Cherenson, M. Connolly, and R. Lerner, 1984, Cell 37:767, (1984)). The infusion of HA tag to the target protein allows easy detection of the recombinant protein with an antibody that recognizes the HA epitope.
- The PCR amplified DNA fragments and the vector, pcDNA3/Amp, are digested with the respective restriction enzymes and ligated. The ligation mixture is transformed into E. coli strain SURE (Stratagene Cloning Systems, La Jolla, Calif.) the transformed culture is plated on ampicillin media plates and resistant colonies are selected. Plasmid DNA is isolated from transformants and examined by restriction analysis for the presence of the correct fragment. For expression of the recombinant FGF-13 COS cells are transfected with the expression vector by DEAE-DEXTRAN method (J. Sambrook, E. Fritsch, T. Maniatis, Molecular Cloning: A Laboratory Manual, Cold Spring Laboratory Press, (1989)). The expression of the FGF-13-HA protein is detected by radiolabelling and immunoprecipitation method (E. Harlow, D. Lane, Antibodies: A Laboratory Manual, Cold Spring Harbor Laboratory Press, (1988)). Cells are labelled for 8 hours with 35S-cysteine two days post transfection. Culture media is then collected and cells are lysed with detergent (RIPA buffer (150 mM NaCl, 1% NP-40, 0.1% SDS, 1% NP-40, 0.5% DOC, 50 mM Tris, pH 7.5) (Wilson, I. et al., Id. 37:767 (1984)). Both cell lysate and culture media are precipitated with an HA specific monoclonal antibody. Proteins precipitated are analyzed on 15% SDS-PAGE gels.
- The vector pC4 is used for the expression of FGF-13 polypeptide. Plasmid pC4 is a derivative of the plasmid pSV2-dhfr (ATCC™ Accession No. 37146). To produce a soluble, secreted form of the polypeptide, the predicted mature is fused to the secretory leader sequence of the human IL-6 gene. The plasmid contains the mouse DHFR gene under control of the SV40 early promoter. Chinese hamster ovary- or other cells lacking dihydrofolate activity that are transfected with these plasmids can be selected by growing the cells in a selective medium (alpha minus MEM, Life Technologies) supplemented with the chemotherapeutic agent methotrexate. The amplification of the DHFR genes in cells resistant to methotrexate (MTX) has been well documented (see, e.g., Alt, F. W., Kellems, R. M., Bertino, J. R., and Schimke, R. T., 1978, J. Biol. Chem. 253:1357-1370, Hamlin, J. L. and Ma, C. 1990, Biochem. et Biophys. Acta, 1097:107-143, Page, M. J. and Sydenham, M. A. 1991, Biotechnology 9:64-68). Cells grown in increasing concentrations of MTX develop resistance to the drug by overproducing the target enzyme, DHFR, as a result of amplification of the DHFR gene. If a second gene is linked to the DHFR gene, it is usually co-amplified and over-expressed. It is known in the art that this approach may be used to develop cell lines carrying more than 1,000 copies of the amplified gene(s). Subsequently, when the methotrexate is withdrawn, cell lines are obtained which contain the amplified gene integrated into one or more chromosome(s) of the host cell.
- Plasmid pC4 contains for expressing the gene of interest the strong promoter of the long terminal repeat (LTR) of the Rouse Sarcoma Virus (Cullen, et al., Molecular and Cellular Biology, March 1985:438-447) plus a fragment isolated from the enhancer of the immediate early gene of human cytomegalovirus (CMV) (Boshart et al., Cell 41:521-530 (1985)). Downstream of the promoter are the following single restriction enzyme cleavage sites that allow the integration of the genes: BamHI, XbaI, and Asp718. Behind these cloning sites the plasmid contains the 3′ intron and polyadenylation site of the rat preproinsulin gene. Other high efficiency promoters can also be used for the expression, e.g., the human B-actin promoter, the SV40 early or late promoters or the long terminal repeats from other retroviruses, e.g., HIV and HTLVI. Clontech's Tet-Off and Tet-On gene expression systems and similar systems can be used to express the FGF-13 polypeptide in a regulated way in mammalian cells (Gossen, M., & Bujard, H. 1992, Proc. Natl. Acad. Sci. USA 89:5547-5551). For the polyadenylation of the mRNA other signals, e.g., from the human growth hormone or globin genes can be used as well. Stable cell lines carrying a gene of interest integrated into the chromosomes can also be selected upon cotransfection with a selectable marker such as gpt, G418 or hygromycin. It is advantageous to use more than one selectable marker in the beginning, e.g., G418 plus methotrexate.
- The plasmid pC4 is digested with the restriction enzymes BamHI and XbaI and then dephosphorylated using calf intestinal phosphates by procedures known in the art. The vector is then isolated from a 1% agarose gel.
- The DNA sequence encoding the mature FGF-13 polypeptide is amplified using PCR oligonucleotide primers corresponding to the 5′ and 3′ sequences of the desired portion of the gene. The 5′ primer containing the underlined BamHI site which overlaps with a Kozak sequence, an AUG start codon, a sequence encoding the secretory leader peptide from the human IL-6 gene, and 21 nucleotides of the 5′ coding region of the mature FGF-13 polypeptide, has the following sequence: 5′ CTAGCCGGATCCGCCACCATGAACTCCTTCTCCACAAGCGCCTTCGGT CCAGTTGCCTTCTCCCTGGGGCTGCTCCTGGTGTTGCCTGCTGCOTTCCC TGCCCCAGTTGTGAGACCAGGGGGAGAATCACCCGTCT 3′ (SEQ ID NO:17). The 3′ primer, containing the underlined XbaI and 18 of nucleotides complementary to the 3′ coding sequence immediately before the stop codon as shown in FIGS. 1A-D (SEQ ID NO:1), has the following sequence: 5′ GCTTGATCTAGACGTGAGGGGCTGGGGCCG 3′ (SEQ ID NO:18).
- The amplified fragment is digested with the endonucleases BamHI and XbaI and then purified again on a 1% agarose gel. The isolated fragment and the dephosphorylated vector are then ligated with T4 DNA ligase. E. coli HB101 or XL-1 Blue cells are then transformed and bacteria are identified that contain the fragment inserted into plasmid pC4 using, for instance, restriction enzyme analysis.
- Chinese hamster ovary cells lacking an active DHFR gene are used for transfection. Five gg of the expression plasmid pC4 is cotransfected with 0.5 μg of the plasmid pSVneo using lipofectin (Feigner et al., supra). The plasmid pSV2-neo contains a dominant selectable marker, the neo gene from Tn5 encoding an enzyme that confers resistance to a group of antibiotics including G418. The cells are seeded in alpha minus MEM supplemented with 1 mg/ml G418. After 2 days, the cells are trypsinized and seeded in hybridoma cloning plates (Greiner, Germany) in alpha minus MEM supplemented with 10, 25, or 50 ng/ml of metothrexate plus 1 mg/ml G418. After about 10-14 days single clones are trypsinized and then seeded in 6-well petri dishes or 10 ml flasks using different concentrations of methotrexate (50 nM, 100 nM, 200 nM, 400 nM, 800 nM). Clones growing at the highest concentrations of methotrexate are then transferred to new 6-well plates containing even higher concentrations of methotrexate (1 μM, 2 μM, 5 μM, 10 mM, 20 mM). The same procedure is repeated until clones are obtained which grow at a concentration of 100-200 μM. Expression of the desired gene product is analyzed, for instance, by SDS-PAGE and Western blot or by reversed phase HPLC analysis.
- Fibroblasts are obtained from a subject by skin biopsy. The resulting tissue is placed in tissue-culture medium and separated into small pieces. Small chunks of the tissue are placed on a wet surface of a tissue culture flask, approximately ten pieces are placed in each flask. The flask is turned upside down, closed tight and left at room temperature over night. After 24 hours at room temperature, the flask is inverted and the chunks of tissue remain fixed to the bottom of the flask and fresh media (e.g., Ham's F12 media, with 10% FBS, penicillin and streptomycin, is added. This is then incubated at 37° C. for approximately one week. At this time, fresh media is added and subsequently changed every several days. After an additional two weeks in culture, a monolayer of fibroblasts emerge. The monolayer is trypsinized and scaled into larger flasks.
- pMV-7 (Kirschmeier, P. T. et al, DNA, 7:219-25 (1988) flanked by the long terminal repeats of the Moloney murine sarcoma virus, is digested with EcoRI and HindIII and subsequently treated with calf intestinal phosphatase. The linear vector is fractionated on agarose gel and purified, using glass beads.
- The cDNA encoding a polypeptide of the present invention is amplified using PCR primers which correspond to the 5′ and 3′ end sequences respectively. The 5′ primer containing an EcoRI site and the 3′ primer having contains a HindIII site. Equal quantities of the Moloney murine sarcoma virus linear backbone and the EcoRI and HindIII fragment are added together, in the presence of T4 DNA ligase. The resulting mixture is maintained under conditions appropriate for ligation of the two fragments. The ligation mixture is used to transform bacteria HB101, which are then plated onto agar-containing kanamycin for the purpose of confirming that the vector had the gene of interest properly inserted.
- The amphotropic pA317 or GP+am12 packaging cells are grown in tissue culture to confluent density in Dulbecco's Modified Eagles Medium (DMEM) with 10% calf serum (CS), penicillin and streptomycin. The MSV vector containing the gene is then added to the media and the packaging cells are transduced with the vector. The packaging cells now produce infectious viral particles containing the gene (the packaging cells are now referred to as producer cells).
- Fresh media is added to the transduced producer cells, and subsequently, the media is harvested from a 10 cm plate of confluent producer cells. The spent media, containing the infectious viral particles, is filtered through a millipore filter to remove detached producer cells and this media is then used to infect fibroblast cells. Media is removed from a sub-confluent plate of fibroblasts and quickly replaced with the media from the producer cells. This media is removed and replaced with fresh media. If the titer of virus is high, then virtually all fibroblasts will be infected and no selection is required. If the titer is very low, then it is necessary to use a retroviral vector that has a selectable marker, such as neo or his.
- The engineered fibroblasts are then injected into the host, either alone or after having been grown to confluence on cytodex 3 microcarrier beads. The fibroblasts now produce the protein product.
- Astrocyte and Neuronal Assays. Recombinant FGF-13, expressed in Escherichia coli and purified as described above, was tested for activity in promoting the survival, neurite outgrowth, or phenotypic differentiation of cortical neuronal cells and for inducing the proliferation of glial fibrillary acidic protein immunopositive cells, astrocytes. The selection of cortical cells for the bioassay is based on the prevalent expression of FGF-1 and FGF-2 in cortical structures and on the previously reported enhancement of cortical neuronal survival resulting from FGF-2 treatment.
- Based on absorption measurements made with calcein AM, treatment with FGF-13 produced a dose dependent increase in the number of cells in cortical cultures (
FIG. 4 ). Half-maximal and saturating responses to FGF-13 were observed at approximately 10 and 50 ng/ml, respectively, and were nearly equivalent, at saturation, to those observed with FGF-2, a previously characterized trophic factor for cortical neurons. - Since a change in calcein AM absorption does not discriminate between an increase in the glial or neuronal cell compartment, FGF-13 was tested to see whether it would induce a change in the level of phenotypic differentiation of one of the neuronal populations, the GABAergic neurons, present in the cortical cultures. After a 7 day treatment period, the level of high-affinity GABA-uptake increased as a function of the concentration of FGF-13 (
FIG. 5 ). The GABAergic neuronal response appeared to be more sensitive to FGF-13 than the general cell survival response since the maximal induction of GABA-uptake occurred with 10 as opposed to 50 ng/ml of FGF-13. - Previous reports describing the biological effects of FGF-2 (basic FGF) on cortical or hippocampal neurons in vitro have demonstrated increases in both neuron survival and neurite outgrowth (Walicke, P. et al., “Fibroblast growth factor promotes survival of dissociated hippocampal neurons and enhances neurite extension.” Proc. Natl. Acad. Sci. USA 83:3012-3016. (1986)). However, reports from experiments done on PC-12 cells suggest that these two responses are not necessarily synonymous and may depend on not only which FGF is being tested but also on which receptor(s) are expressed on the target cells. Using the primary cortical neuronal culture paradigm, the ability of FGF-13 to induce neurite outgrowth was compared to the response achieved with FGF-2 (
FIG. 6 ). Saturating responses to FGF-2 and FGF-13 were achieved with 10 and 50 ng/ml, respectively. - Astrocytes are the major non-neuronal cell type present in the cortical cultures. FGF-1 (acidic FGF), FGF-2, and FGF-9 are mitogens for astrocytes. As shown in
FIG. 7 , FGF-1, FGF-2, or FGF-9 produced a 5- to 10-fold increase in the level of [3H]-thymidine incorporation. In general, maximal responses were achieved in the range of 10 to 50 ng/ml. In comparison, treatment with FGF-13, in the presence of 100 ng/ml heparin, produced a concentration dependent increase in [3H]-thymidine incorporation up to 150 ng/ml. The addition of heparin caused an apparent shift to the left in the dose response curve. - Heterologous ligand competition binding studies were conducted on membranes prepared from adult rat cortex. In these studies, the ability of FGF-13 to displace [1251]-FGF-1 was monitored and compared to the displacement achieved with FGF-2.
FIG. 8 summarizes the displacement curves for FGF-2, FGF-10, and FGF-13. The concentration of FGF-2 or FGF-13 required to achieve 50% displacement was 200 and 1000 pM, respectively. - Fibroblast and endothelial cell assays. Human lung fibroblasts were obtained from Clonetics (San Diego, Calif.) and maintained in growth media from Clonetics. Dermal microvascular endothelial cells were obtained from Cell Applications (San Diego, Calif.). For proliferation assays, the human lung fibroblasts and dermal microvascular endothelial cells were cultured at 5,000 cells/well in a 96-well plate for one day in growth medium. The cells were then incubated for one day in 0.1% BSA basal medium. After replacing the medium with fresh 0.1% BSA medium, the cells were incubated with the test proteins for 3 days. ALAMAR BLUE™ (Alamar Biosciences, Sacramento, Calif.) was added to each well to a final concentration of 10%. The cells were incubated for 4 hr. Cell viability was measured by reading in a CytoFluor fluorescence reader. For the PGE2 assays, the human lung fibroblasts were cultured at 5,000 cells/well in a 96-well plate for one day. After a medium change to 0.1% BSA basal medium, the cells were incubated with FGF-2 or FGF-13 with or without IL-lα for 24 hours. The supernatants were collected and assayed for PGE2 by EIA kit (Cayman, Ann Arbor, Mich.). For the IL-6 assays, the human lung fibroblasts were cultured at 5,000 cells/well in a 96-well plate for one day. After a medium change to .0.1% BSA basal medium, the cells were incubated with FGF-2 or FGF-13 with or without IL-la for 24 hours. The supernatants were collected and assayed for IL-6 by ELISA kit (Endogen, Cambridge, Mass.).
- Human lung fibroblasts were cultured with FGF-2 or FGF-13 for 3 days in basal medium before the addition of ALAMAR BLUE™ to assess effects on growth of the fibroblasts. FGF-2 showed stimulation at 10-2500 ng/ml while FGF-13 showed stimulation at 1000-2500 ng/ml (
FIG. 9 ). However, the maximal effect was similar. In contrast to FGF-2, FGF-13 did not have any stimulatory effect on dermal endothelial cells (FIG. 10 ). - FGF-2 and FGF-13 did not have any effect on PGE2 and IL-6 release, from the fibroblasts. IL-la showed stimulation of PGE2 and IL-6. Both FGF-2 and FGF-13 acted synergistically with IL-la to release PGE2 (
FIG. 11 ) and IL-6 (FIG. 12 ). FGF-13 at 2,500 ng/ml gave a similar effects as 100 ng/ml FGF-2. Indomethacin at 100 ng/ml inhibited PGE2 release but not IL-6 release from the fibroblasts. - Angiogenesis assays. In vivo angiogenesis assay of FGF-13 measures the ability of an existing capillary network to form new vessels in an implanted capsule of marine extracellular matrix material (Matrigel). The protein is mixed with the liquid Matrigel at 4° C. and the mixture is then injected subcutaneously in mice where it solidifies. After 7 days, the solid “plug” of Matrigel is removed and examined for the presence of new blood vessels. Matrigel was purchased. from Becton Dickinson Labware/Collaborative Biomedical Products.
- When thawed at 4° C. the Matrigel material is a liquid. The Matrigel was mixed with FGF-13 at 150 ng/ml at 4° C. and drawn into cold 3 ml syringes. Female C57B1/6 mice approximately 8 weeks old were injected with the mixture of Matrigel and experimental protein at 2 sites at the midventral aspect of the abdomen (0.5 ml/site). After 7 days, the mice were sacrificed by cervical dislocation, the Matrigel plugs were removed and cleaned (i.e., all clinging membranes and fibrous tissue is removed). Replicate whole plugs were fixed in neutral buffered 10% formaldehyde, embedded in paraffin and used to produce sections for histological examination after staining with Masson's Trichrome. Cross sections from 3 different regions of each plug were processed. Selected sections were stained for the presence of vWF. The positive control for this assay was bovine basic FGF (150 ng/ml). Matrigel alone was used to determine basal levels of angiogenesis.
- FGF-13 was weakly positive in that a small number of infiltrating of cells were observed at the peripheral edge of the Matrigel plug. Immunostaining with antibody to vWF did not reveal vWF-positive endothelial cells. Protocols such as the above which are known in the art generally quantify angiogenesis only by determining the total cellularity of the plug, a procedure which may not give a complete assessment of angiogenic activity of the protein.
- Parkinson's Model.
- The observed loss of motor function in Parkinson's disease is attributed to a deficiency of striatal dopamine resulting from the degeneration of the nigrostriatal dopaminergic projection neurons. An animal model for Parkinson's that has been extensively characterized involves the systemic administration of 1-methyl-4
phenyl - It has been demonstrated in tissue culture paradigms that FGF-2 (basic FGF) has trophic activity towards nigral dopaminergic neurons (Ferrari et al., Dev. Biol. 1989). Recently, Dr. Unsicker's group has demonstrated that administering FGF-2 in gel foam implants in the striatum results in the near complete protection of nigral dopaminergic neurons from the toxicity associated with MPTP exposure (Otto and Unsicker, J. Neuroscience, 1990).
- Based on the data with FGF-2, FGF-13 was evaluated to determine whether it has an action similar to that of FGF-2 in enhancing dopaminergic neuronal survival in vitro and it was then be tested in vivo for protection of dopaminergic neurons in the striatum from the damage associated with MPTP treatment. The potential effect of FGF-13 was first examined in vitro in a dopaminergic neuronal cell culture paradigm. The cultures were prepared by dissecting the midbrain floor plate from gestation day 14 Wistar rat embryos. The tissue was dissociated with trypsin and seeded at a density of 200,000 cells/cm2 on polyorthinine-laminin coated glass coverslips. The cells were maintained in Dulbecco's Modified Eagle's medium and F12 medium containing hormonal supplements (N1). The cultures were fixed with paraformaldehyde after 8 days in vitro and were processed for tyrosine hydroxylase, a specific marker for dopminergic neurons, immunohistochemical staining.
FIG. 14 . FGF-13 Increases the Number of Tyrosine Hydroxylase immunopositive Neurons. Dissociated cell cultures were prepared from embryonic rats. The culture medium was changed every third day and the factors were also added at that time. - Parkinson's Conclusion: Since the dopaminergic neurons were isolated from animals at gestation day 14, a developmental time which is past the stage when the dopaminergic precursor cells are proliferating, the increase in the number of tyrosine hydroxylase immunopositive neurons represents an increase in the number of dopaminergic neurons surviving in vitro. Therefore, FGF-13 acts to prolong the survival of dopaminergic neurons which is needed in Parkinson's Disease.
- FGF-13 Biological Activity Conclusions. FGF-13 increases the number of cells, neurite outgrowth, and the level of neuronal specific high-affinity GABA-uptake in cortical cultures derived from embryos at gestation day 16. The results from proliferation assays using purified hippocampal astrocytes demonstrate that FGF-13 increases the amount of [3H]-thymidine incorporation in astrocyte cultures. Although the cortical cell cultures are maintained in serum-free medium in order to inhibit non-neuronal cell proliferation, increases in the number of astrocytes were noted following FGF-2 and FGF-13 treatments. Thus, a portion of the increase in the number of cells observed following FGF-13 treatment is due to the proliferation of astrocytes. However, the robust increase in the neuronal marker (GABA-uptake) suggests that a direct neuronal response is also occurring.
- FGF-13 acted similarly to FGF-2 in human lung fibroblasts to stimulate proliferation. Neither had any—effect on IL-6 and PGE2 release from fibroblasts but both acted synergisticly with IL-lα. In contrast to FGF-2, however, FGF-13 did not stimulate proliferation in the dermal microvascular endothelial cells. Dopaminergic neuron survival was increased by FGF-13 administration indicating it may have therapeutic benefits in Parkinson's Disease.
- The bacterial expression vector pHE-4 or pHE-4-5 is used for bacterial expression in this example. pHE-4 encodes kanamycin antibiotic resistance (“Kan”) and contains a bacterial origin of replication (“ori”), an IPTG inducible promoter, a ribosome binding site (“RBS”), and suitable single restriction enzyme cleavage sites. These elements are arranged such that a DNA fragment encoding a polypeptide may be inserted in such a way as to produce that polypeptide corresponding to the DNA fragment.
- The novel pHE4 series of bacterial expression vectors, in particular, the pHE4-5 vector may be used for bacterial expression in this example. (QIAGEN, Inc., 9259 Eton Avenue, Chatsworth, Calif., 91311). The expression plasmid pHE4-5/MPIFΔ23 vector plasmid DNA contains an insert which encodes another ORF. The construct was deposited with the American Type Culture Collection, 12301 Park Lawn Drive, Rockville, Md. 20852, on Sep. 30, 1997 and given Accession No. 209311. Using the Nde I and Asp 718 restriction sites flanking the irrelevant MPIF ORF insert, one of ordinary skill in the art could easily use current molecular biological techniques to replace the irrelevant ORF in the pHE4-5 vector with the FGF-13 ORF of the present invention.
- The pHE4-5 bacterial expression vector includes a neomycin phosphotransferase gene for selection, an E. coli origin of replication, a T5 phage promoter sequence, two lac operator sequences, a Shine-Delgarno sequence, and the lactose operon repressor gene (lacIq). These elements are arranged such that an inserted DNA fragment encoding a polypeptide expresses that polypeptide with the six His residues (i.e., a “6×His tag”) covalently linked to the amino terminus of that polypeptide. The promoter and operator sequences of the pHE4-5 vector were made synthetically. Synthetic production of nucleic acid sequences is well known in the art (CLONETECH 95/96 Catalog, pages 215-216, CLONETECH, 1020 East Meadow Circle, Palo Alto, Calif. 94303).
- The DNA sequence encoding the desired portion of the mature FGF-13 protein (i.e., amino acids 20-193 of SEQ ID NO:2) was amplified from the deposited cDNA clone using PCR oligonucleotide primers which anneal to the amino terminal sequences encoding the desired portion of the FGF-13 protein and to sequences in the deposited construct 3′ to the cDNA coding sequence. Additional nucleotides containing restrictions sites to facilitate cloning in the pHE-4 vector were added to the 5′ and 3′ sequences respectively.
- A. For cloning the delta 42 form of FGF-13 protein, the 5′ primer had the sequence 5′ GGG AAT TCC ATA TGA CCG ACC AGC TGA GCA GG (SEQ ID NO:19) containing the underlined Nde I restriction site, which includes an initiation codon and following the initiation codon, 19 nucleotides of the amino terminal coding sequence of the FGF-13 sequence in SEQ ID NO:2. One of ordinary skill in the art would appreciate, of course, that the point in the protein coding sequence where the 5′ primer begins may be varied to amplify a desired portion of the complete protein shorter or longer than the mature form. The 3′ primer had the sequence GCCCGGGGTACCTTACGTGAGGGGCTUGGGCCG (SEQ ID NO:20 containing the underlined ASP 718 restriction site followed by a stop codon and 18 nucleotides complementary to the 3′ end of the coding sequence in the FGF-13 DNA sequence in SEQ ID NO:1.
- B. For cloning the 3″
delta 9 form of FGF-13 protein, the 5′ primer had the sequence 5′ GGGAATTCCATATGCAGGGGGAGAATCACCCGTCT 3′ (SEQ ID NO:21 containing the underlined Nde I restriction site, which includes an initiation codon and following the initiation codon, 18 nucleotides of the amino terminal coding sequence of the FGF-13 sequence in SEQ ID NO:2. One of ordinary skill in the art would appreciate, of course, that the point in the protein coding sequence where the 5′ primer begins may be varied to amplify a desired portion of the complete protein shorter or longer than the mature form. The 3′ primer had the sequence GCCCGGGGTACCTTACTTGGTCCGACGGGTGGG (SEQ ID NO:22) containing the underlined ASP 718 restriction site followed by a stop codon and 18 nucleotides complementary to the 3′ end of the coding sequence in the FGF-13 DNA sequence in SEQ ID NO:1. - C. In the mature form of FGF-13, there exists a codon coding for a methione at
amino acid position 20 according the SEQ ID NO:2. Upstream of this ATG is a nucleotide sequence that may promote ribosome binding in E. coli (Shine-Delgarno sequence). To prevent alternate ATG usage in E. coli, this sequence was mutated using a 5′ primer of the sequence GGGAATTCCATATGCAGGGGGAGAATCACCCGTCTCCTAATT TTAACCAGTAGGTGCGTGACCAGGGCGCCATG (SEQ ID NO 23) containing the underlined Nde I restriction site which includes an initiation codon and following theinitiation codon 60 nucleotides of the amino terminal coding sequence of the FGF-13 sequence is SEQ ID NO:2. The 3′ primer has the sequence of either SEQ ID NO:20 or SEQ ID NO:22. - The amplified FGF-13 DNA fragments and the vector pHE-4 were digested with Nde I and ASP 718 and the digested DNAs were then ligated together. Insertion of the FGF-13 DNA into the restricted pHE-4 vector places the FGF-13 protein coding region including its associated stop codon downstream from the IPTG-inducible promoter and in-frame with the initiating AUG in the 5′ primer.
- The ligation mixture was transformed into competent E. coli cells using standard procedures such as those described in Sambrook et al., Molecular Cloning: a Laboratory Manual, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold Spring Harbor, N.Y. (1989). E. coli strain DH5α was used in carrying out the illustrative example described herein. This strain, which is only one of many that are suitable for expressing FGF-13 protein, is available commercially from Life Technologies, Inc., Rockville, Md. Transformants were identified by their ability to grow on LB plates in the presence of kanamycin. Plasmid DNA was isolated from resistant colonies and the identity of the cloned DNA confirmed by restriction analysis, PCR and DNA screening.
- Clones containing the desired constructs were grown overnight (“O/N”) in liquid culture in LB media supplemented with kanamycin (25 μg/ml). The O/N culture was used to inoculate a large culture, at a dilution of approximately 1:25 to 1:250. The cells are grown to an optical density at 600 nm (“OD600”) of between 0.4 and 0.6. Isopropyl-b-d-thiogalactopyranoside (“IPTG”) is then added to a final concentration of 1 mM to induce transcription from the lac repressor sensitive promoter, by inactivating the lacI repressor. Cells subsequently were incubated further for 3 to 4 hours and were then harvested by centrifugation.
- Amino and/or Carboxy terminal deletion variants of FGF-13 may be prepared using the primers disclosed in A-D to produce the variants described below. The restriction enzyme sites created are indicated. These variants may be produced using the expression systems disclosed in Example 6.
- A. Deletion Variant 1 (FGF13 Primers & Construct Seqs) 5′ Delta 42/3′ Delta 9
(SEQ ID NO 24) 5′ Nde I delta 42 ggg aat tcc ata tga ccg acc agc tga gca gg (SEQ ID NO 25) 3′ delta 9 Asp 718 (6335) gcc cgg ggt acc tta cttggt ccg acg ggt ggg (SEQ ID NO 26) ATGACCGACCAGCTGAGCAGGCGGCAGATCCGCGAGTACCAACTCTACAG CAGGACCAGTGGCAAGCACGTGCAGGTCACCGGGCGTCGCATCTCCGCCA CCGCCGAGGACGGCAACAAGTTTGCCAAGCTCATAGTGGAGACGGACACG TTTGGCAGCCGGGTTCGCATCAAAGGGGCTGAGAGTGAGAAGTACATCTG TATGAACAAGAGGGGCAAGCTCATCGGGAAGCCCAGCGGGAAGAGCAAAG ACTGCGTGTTCACGGAGATCGTGCTGGAGAACAACTATACGGCCTTCCAG AACGCCCGGCACGAGGGCTGGTTCATGGCCTTCACGCGGCAGGGGCGGCC CCGCCAGGCTTCCCGCAGCCGCCAGAACCAGCGCGAGGCCCACTTCATCA AGCGCCTCTACCAAGGCCAGCTGCCCTTCCCCAACCACGCCGAGAAGCAG AAGCAGTTCGAGTTTGTGGGCTCCGCCCCCACCCGTCGGACCAAGTAA
MTDQLSRRQIREYQLYSRTSGKHVQVTGRRISATAEDGNKFAKLIVETDTFGSR VRIKGAE S EKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAFQNARHE GWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEKQKQFEFV GSAPTRRTK. (SEQ ID NO 27) - B. Deletion Variant 2 (5′ Delta 42/3′ Full)
(SEQ ID NO 28) 5′ Nde I delta 42 ggg aat tcc ata tga ccg acc agc tga gca gg (SEQ ID NO 29) 3′ full Asp 718 (6638) gcc cgg ggt acc tta cgt gag ggg ctg ggg ccg (SEQ ID NO 30) ATGACCGACCAGCTGAGCAGGCGGCAGATCCGCGAGTACCAACTYTACAG CAGGACCAGTGGCAAGCACGTGCAGGTCACCGGGCGTCGCATCTCCGCCA CCGCCGAGGACGGCAACAAGTTTGCCAAGCTCATAGTGGAGACGGACACG TTTGGCAGCCGGGTTCGCATCAAAGGGGCTGAGAGTGAGAAGTACATCTG TATGAACAAGAGGGGCAAGCTCATCGGGAAGCCCAGCGGGAAGAGCAAAG ACTGCGTGTTCACGGAGATCGTGCTGGAGAACAACTATACGGCCTTCCAG AACGCCCGGCACGAGGGCTGGTTCATGGCCTTCACGCGGCAGGGGCGGCC CCGCCAGGCTTCCCGCAGCCGCCAGAACCAGCGCGAGGCCCACTTCATCA AGCGCCTCTACCAAGGCCAGCTGCCCTTCCCCAACCACGCCGAGAAGCAG AAGCAGTTCGAGTTTGTGGGCTCCGCCCCCACCCGYCGGACCAAGCGCAC ACGGCGGCCCCAGCCCCTCACGTAA (SEQ ID NO 31) MTDQLSRRQIREYQLYSRTS GKHVQVTGRRISATAEDGNKFAKLIVETD TFGSRVRIKGAESEKYICMNKRGKLIGKPSGKSKDCVFTEIVLENNYTAF QNARHEGWFMAFTRQGRPRQASRSRQNQREAHFIKRLYQGQLPFPNHAEK QKQFEFVGSAPTRRTKRTRRPQPLT. - C. Deletion Variant 3 (5′ Delta23/3′ Full)
(SEQ ID NO 32) 5′ NdeI Delta 23 SDG (6881) deletion ggg aat tcc ata tgc agg ggg aga atc acc cgt ctc cta att tta acc agt acg tgc gtg acc agg gcg cca tg (SEQ ID NO 33) 3′ delta 9 Asp 718 (6335) gcc cgg ggt acc tta cttggt ccg acg ggt ggg (SEQ ID NO 34) ATGCAGGGGGAGAATCACCCGTCTCCTAATTTTAACCAGTACGTGCGTGA CCAGGGCGCCATGACCGACCAGCTGAGCAGGCGGCAGATCCGCGAGTACC AACTCTACAGCAGGACCAGTGGCAAGCACGTGCAGGTCACCGGGCGTCGC ATCTCCGCCACCGCCGAGGACGGCAACAAGTTTGCCAAGCTCATAGTGGA GACGGACACGTTTGGCAGCCGGGTTCGCATCAAAGGGGCTGAGAGTGAGA AGTACATCTGTATGAACAAGAGGGGCAAGCTCATCGGGAAGCCCAGCGGG AAGAGCAAAGACTGCGTGTTCACGGAGATCGTGCTGGAGAACAACTATAC GGCCTTCCAGAACGCCCGGCACGAGGGCTGGTTCATGGCCTTCACGCGGC AGGGGCGGCCCCGCCAGGCTTCCCGCAGCCGCCAGAACCAGCGCGAGGCC CACTTCATCAAGCGCCTCTACCAAGGCCAGCTGCCCTTCCCCAACCACGC CGAGAAGCAGAAGCAGTTCGAGTTTGTGGGCTCCGCCCCCACCCGTCGGA CCAAGTAA (SEQ ID NO 35) MQGENHPSPNFNQYVRDQGAMTDQLSRRQIREYQLYSRTSGKHVQVTGRR ISATAEDGNKFAKLIVETDTFGSRVRIKGAESEKYICMNKRGKLIGKPSG KSKDCVFTEIVLENNYTAFQNARHEGWFMAFTRQGRPRQASRSRQNQREA HFIK RLYQGQLPFPNHAEKQKQFEFVGSAPTRRTK. - D. Deletion Variant 4 (5′ Delta 23 SDG Deletion/3′ Full)
(SEQ ID NO 36) 5′ NdeI Delta 23 SDG (6881) deletion GGG AAT TCC ATA TGC AGG GGG AGA ATC ACC CGT CTC CTA ATT TTA ACC AGT ACG TGC GTG ACC AGG GCG CCA TG (SEQ ID NO 37) 3′ FULL ASP 718 (6638) GCC CGG GGT ACC TTA CGT GAG GGG CTG GGG CCG - It will be clear that the invention may be practiced otherwise than as particularly described in the foregoing description and examples. Numerous modifications and variations of the present invention are possible in light of the above teachings and, therefore, are within the scope of the appended claims. The entire disclosure of all publications (including patents, patent applications, journal articles, laboratory manuals, books, or other documents) cited herein are hereby incorporated by reference.
Claims (22)
1. An isolated nucleic acid molecule nucleic acid molecule comprising a polynucleotide having a nucleotide sequence at least 95% identical to a sequence selected from the group consisting of:
(a) a nucleotide sequence encoding the FGF-13 polypeptide having the amino acid sequence at positions −22 to 193 of SEQ ID NO:2;
(b) a nucleotide sequence encoding the mature FGF-13 polypeptide having the amino acid sequence from about position 1 to about position 193 in SEQ ID NO:2;
(c) a nucleotide sequence encoding the FGF-13 polypeptide having the complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147;
(d) a nucleotide sequence encoding the mature FGF-13 polypeptide having the amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147; and
(e) a nucleotide sequence complementary to any of the nucleotide sequences in (a), (b), (c) or (d) above.
2. The nucleic acid molecule of claim 1 wherein said polynucleotide has the complete nucleotide sequence in FIGS. 1A-D (SEQ ID NO:1).
3. The nucleic acid molecule of claim 1 wherein said polynucleotide has the nucleotide sequence in FIGS. 1A-D (SEQ ID NO:1) encoding the FGF-13 polypeptide having the complete amino acid sequence in SEQ ID NO:2.
4. The nucleic acid molecule of claim 1 wherein said polynucleotide has the nucleotide sequence in FIGS. 1A-D (SEQ NO:1) encoding the mature FGF-13 polypeptide having the amino acid sequence from about 1 to about 193 in SEQ ID NO:2.
5. An isolated nucleic acid molecule comprising a polynucleotide having a nucleotide sequence at least 95% identical to a sequence selected from the group consisting of:
(a) a nucleotide sequence encoding a polypeptide comprising the amino acid sequence of residues n-193 of SEQ ID NO:2, where n is an integer other than zero in the range of −23 to +10;
(b) a nucleotide sequence encoding a polypeptide comprising the amino acid sequence of residues −22 to -m of SEQ ID NO:2, where m is an integer in the range of 154 to 192;
(c) a nucleotide sequence encoding a polypeptide having the amino acid sequence consisting of residues n-m of SEQ ID NO:2, where n and m are integers as defined respectively in (a) and (b) above; and
(d) a nucleotide sequence encoding a polypeptide consisting of a portion of the complete FGF-13 amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147 wherein said portion excludes from 1 to about 33 amino acids from the amino terminus of said complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147;
(e) a nucleotide sequence encoding a polypeptide consisting of a portion of the complete FGF-13 amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147 wherein said portion excludes from 1 to about 39 amino acids from the carboxy terminus of said complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147; and
(f) a nucleotide sequence encoding a polypeptide consisting of a portion of the complete FGF-13 amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147 wherein said portion includes a combination of any of the amino terminal and carboxy terminal deletions in (d) and (e), above.
6. The nucleic acid molecule of claim 1 wherein said polynucleotide has the complete nucleotide sequence of the cDNA clone contained in, ATCC™ Deposit No. 97147.
7. The nucleic acid molecule of claim 1 wherein said polynucleotide has the nucleotide sequence encoding the FGF-13 polypeptide having the complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147.
8. The nucleic acid molecule of claim 1 wherein said polynucleotide has the nucleotide sequence encoding the mature FGF-13 polypeptide having the amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147.
9. An isolated nucleic acid molecule comprising a polynucleotide which hybridizes under stringent hybridization conditions to a polynucleotide having a nucleotide sequence identical to a nucleotide sequence in (a), (b), (c) or (d) of claim 1 wherein said polynucleotide which hybridizes does not hybridize under stringent hybridization conditions to a polynucleotide having a nucleotide sequence consisting of only A residues or of only T residues.
10. An isolated nucleic acid molecule comprising a polynucleotide which encodes the amino acid sequence of an epitope-bearing portion of an FGF-13 polypeptide having an amino acid sequence in (a), (b), (c) or (d) of claim 1 .
11. The isolated nucleic acid molecule of claim 10 , which encodes an epitope-bearing portion of an FGF-13 polypeptide wherein the amino acid sequence of said portion is selected from the group of sequences in SEQ NO:2 consisting of: about Gln 22 to about Asn 32, about Asn 34 to about Met 43, about Gln 46 to about Tyr 55, about Ser 59 to about Val 66, about Val 68 to about Phe 83, about Val 88 to about Glu 105, about Met 110 to about Val 128, about Phe 153 to about His 173, about Leu 178 to about Gln 182, about Phe 185 to about Gln 194, and about Val 198 to about Gln 213.
12. A method for making a recombinant vector comprising inserting an isolated nucleic acid molecule of claim 1 into a vector.
13. A recombinant vector produced by the method of claim 12 .
14. A method of making a recombinant host cell comprising introducing the recombinant vector of claim 13 into a host cell.
15. A recombinant host cell produced by the method of claim 14 .
16. A recombinant method for producing an FGF-13 polypeptide, comprising culturing the recombinant host cell of claim 15 under conditions such that said polypeptide is expressed and recovering said polypeptide.
17. An isolated FGF-13 polypeptide comprising an amino acid sequence at least 95% identical to a sequence selected from the group consisting of:
(a) the amino acid sequence at positions −22 to 193 of SEQ ID NO:2;
(b) the amino acid sequence from about position 1 to about position 193 in SEQ ID NO:2;
(c) the complete amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147; and
(d) the mature FGF-13 amino acid sequence encoded by the cDNA clone contained in ATCC™ Deposit No. 97147.
18. An isolated polypeptide comprising an epitope-bearing portion of the FGF-13 protein, wherein the amino acid sequence of said portion is selected from the group of sequences in SEQ ID NO:2 consisting of: about Gln 22 to about Asn 32, about Asn 34 to about Met 43, about Gln 46 to about Tyr 55, about Ser 59 to about Val 66, about Val 68 to about Phe 83, about Val 88 to about Glu 105, about Met 110 to about Val 128, about Phe 153 to about His 173, about Leu 178 to about Gln 182, about Phe 185 to about Gin 194, and about Val 198 to about Gln 213.
19. An isolated antibody that binds specifically to an FGF-13 polypeptide of claim 17 .
20. An isolated nucleic acid molecule comprising a polynucleotide having a sequence at least 95% identical to a sequence selected from the group consisting of:
(a) the nucleotide sequence of a portion of the sequence shown in FIGS. 1A-D (SEQ ID NO:1) wherein said portion comprises at least 50 contiguous nucleotides; and
(b) a nucleotide sequence complementary to any nucleotide sequence in (a) above.
21. A method of increasing the survival of dopaminergic neurons comprising contacting a life prolonging concentration of FGF-13 with dopaminergic neurons.
22. The method of claim 22 wherein said dopaminergic neuron is in a Parkinson's Disease patient.
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US11/738,563 US20070281890A1 (en) | 1995-06-05 | 2007-04-23 | Fibroblast Growth Factor-13 |
Applications Claiming Priority (7)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
PCT/US1995/007108 WO1996039508A1 (en) | 1995-06-05 | 1995-06-05 | Fibroblast growth factor 13 |
US08/462,965 US5728546A (en) | 1995-06-05 | 1995-06-05 | Fibroblast growth factor 13 |
US3196996P | 1996-11-27 | 1996-11-27 | |
US3157596P | 1996-12-04 | 1996-12-04 | |
US08/976,315 US6403557B1 (en) | 1996-11-27 | 1997-11-21 | Fibroblast growth factor-13 |
US10/123,481 US7208584B2 (en) | 1995-06-05 | 2002-04-17 | Fibroblast growth factor-13 |
US11/738,563 US20070281890A1 (en) | 1995-06-05 | 2007-04-23 | Fibroblast Growth Factor-13 |
Related Parent Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US10/123,481 Continuation US7208584B2 (en) | 1995-06-05 | 2002-04-17 | Fibroblast growth factor-13 |
Publications (1)
Publication Number | Publication Date |
---|---|
US20070281890A1 true US20070281890A1 (en) | 2007-12-06 |
Family
ID=26707408
Family Applications (3)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US08/976,315 Expired - Lifetime US6403557B1 (en) | 1995-06-05 | 1997-11-21 | Fibroblast growth factor-13 |
US10/123,481 Expired - Fee Related US7208584B2 (en) | 1995-06-05 | 2002-04-17 | Fibroblast growth factor-13 |
US11/738,563 Abandoned US20070281890A1 (en) | 1995-06-05 | 2007-04-23 | Fibroblast Growth Factor-13 |
Family Applications Before (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
US08/976,315 Expired - Lifetime US6403557B1 (en) | 1995-06-05 | 1997-11-21 | Fibroblast growth factor-13 |
US10/123,481 Expired - Fee Related US7208584B2 (en) | 1995-06-05 | 2002-04-17 | Fibroblast growth factor-13 |
Country Status (6)
Country | Link |
---|---|
US (3) | US6403557B1 (en) |
EP (1) | EP0942981A1 (en) |
JP (1) | JP2001505426A (en) |
AU (1) | AU5433798A (en) |
CA (1) | CA2272239A1 (en) |
WO (1) | WO1998023749A1 (en) |
Families Citing this family (4)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5728546A (en) | 1995-06-05 | 1998-03-17 | Human Genome Sciences, Inc. | Fibroblast growth factor 13 |
JP2001505426A (en) * | 1996-11-27 | 2001-04-24 | ヒューマン・ジェノム・サイエンシズ・インコーポレイテッド | Fibroblast growth factor 13 |
WO2000071567A2 (en) * | 1999-05-06 | 2000-11-30 | Human Genome Sciences, Inc. | Fibroblast growth factor 13 |
WO2013149191A1 (en) * | 2012-03-29 | 2013-10-03 | The Trustees Of Columbia University In The City Of New York | Methods for regulating hair growth disorders |
Family Cites Families (18)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
JP3187113B2 (en) | 1992-01-28 | 2001-07-11 | 塩野義製薬株式会社 | Cell growth factor |
US5767073A (en) * | 1992-12-10 | 1998-06-16 | Beth Israel Hospital Association | D4 gene and methods of use thereof |
AU7475694A (en) | 1993-08-02 | 1995-02-28 | Prizm Pharmaceuticals, Inc. | Monogenous preparations of cytotoxic conjugates |
TW264481B (en) | 1993-09-21 | 1995-12-01 | American Cyanamid Co | Surface loop structural analogues of fibroblast growth factors |
CA2153480A1 (en) | 1993-11-12 | 1995-06-01 | Kenichi Matsubara | Gene signature |
CA2185671A1 (en) | 1994-03-15 | 1995-09-21 | Prizm Pharmaceuticals, Inc. | Heparin-binding growth factors for gene therapy and anterior eye disorders |
US5783568A (en) * | 1994-06-10 | 1998-07-21 | Sugen, Inc. | Methods for treating cancer and other cell proliferative diseases |
WO1999014327A2 (en) | 1997-09-17 | 1999-03-25 | Genentech, Inc. | Genes amplified in tumours, antibodies against the proteins coded thereby, and their use in diagnosis and treatment of cancer |
US5693775A (en) * | 1995-05-12 | 1997-12-02 | The Johns Hopkins University School Of Medicine | Fibroblast growth factor homologous factor-1 (FHF-1) and methods of use |
CA2217301A1 (en) * | 1995-06-05 | 1996-12-12 | Human Genome Sciences, Inc. | Fibroblast growth factor 15 |
US5728546A (en) * | 1995-06-05 | 1998-03-17 | Human Genome Sciences, Inc. | Fibroblast growth factor 13 |
KR19990022315A (en) * | 1995-06-05 | 1999-03-25 | 벤슨 로버트 에이치. | Fibroblast Growth Factor 13 |
US5773252A (en) * | 1995-06-05 | 1998-06-30 | Human Genome Sciences, Inc. | Fibroblast growth factor 15 |
JP2000511418A (en) | 1996-05-20 | 2000-09-05 | シェーリング コーポレイション | Human interleukin-1j and its antagonist |
US6020189A (en) | 1996-08-30 | 2000-02-01 | The Johns Hopkins University School Of Medicine | Fibroblast growth factor homologous factors (FHFs) and methods of use |
PT1632574E (en) | 1996-10-16 | 2011-03-17 | Zymogenetics Inc | Fibroblast growth factor homologs |
JP2001505426A (en) | 1996-11-27 | 2001-04-24 | ヒューマン・ジェノム・サイエンシズ・インコーポレイテッド | Fibroblast growth factor 13 |
NZ503343A (en) | 1997-09-17 | 2002-09-27 | Genentech Inc | Secreted and transmembrane polypeptides and use to induce apoptosis of tumour cells |
-
1997
- 1997-11-21 JP JP52468398A patent/JP2001505426A/en not_active Withdrawn
- 1997-11-21 CA CA002272239A patent/CA2272239A1/en not_active Abandoned
- 1997-11-21 AU AU54337/98A patent/AU5433798A/en not_active Abandoned
- 1997-11-21 WO PCT/US1997/020548 patent/WO1998023749A1/en not_active Application Discontinuation
- 1997-11-21 EP EP97948236A patent/EP0942981A1/en not_active Withdrawn
- 1997-11-21 US US08/976,315 patent/US6403557B1/en not_active Expired - Lifetime
-
2002
- 2002-04-17 US US10/123,481 patent/US7208584B2/en not_active Expired - Fee Related
-
2007
- 2007-04-23 US US11/738,563 patent/US20070281890A1/en not_active Abandoned
Also Published As
Publication number | Publication date |
---|---|
CA2272239A1 (en) | 1998-06-04 |
JP2001505426A (en) | 2001-04-24 |
WO1998023749A1 (en) | 1998-06-04 |
EP0942981A1 (en) | 1999-09-22 |
US6403557B1 (en) | 2002-06-11 |
AU5433798A (en) | 1998-06-22 |
US20030186253A1 (en) | 2003-10-02 |
US7208584B2 (en) | 2007-04-24 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US5773252A (en) | Fibroblast growth factor 15 | |
AU702131B2 (en) | Fibroblast growth factor-14 | |
AU712297B2 (en) | Fibroblast growth factor 11 | |
US5728546A (en) | Fibroblast growth factor 13 | |
US20070281890A1 (en) | Fibroblast Growth Factor-13 | |
AU702682B2 (en) | Fibroblast growth factor 13 | |
WO1996039509A1 (en) | Fibroblast growth factor 15 | |
CA2280287A1 (en) | Dendritic cell-derived growth factor | |
US7338934B2 (en) | Fibroblast growth factor-14 | |
AU748429B2 (en) | Fibroblast growth factor 11 | |
AU711647C (en) | Fibroblast growth factor 15 | |
US20010012624A1 (en) | Human natural killer cell activating factor ii | |
EP0879240A1 (en) | Human criptin growth factor | |
AU752592B2 (en) | Fibroblast growth factor 15 | |
MXPA97007897A (en) | Factor-11 fibroblas growth | |
MXPA97008493A (en) | Factor 15 of fibroblas growth | |
MXPA97006854A (en) | Factor 14 of fibroblas growth | |
MXPA97009217A (en) | Growth factor 13 of fibroblas | |
KR19980703870A (en) | Fibroblast Growth Factor-11 | |
CA2220988A1 (en) | Fibroblast growth factor 13 | |
MXPA97009243A (en) | Human vascular endothelial growth factor |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
STCB | Information on status: application discontinuation |
Free format text: ABANDONED -- FAILURE TO RESPOND TO AN OFFICE ACTION |