KR102608336B1 - Novel peptide derived from pep27 peptide and uses thereof - Google Patents
Novel peptide derived from pep27 peptide and uses thereof Download PDFInfo
- Publication number
- KR102608336B1 KR102608336B1 KR1020210014180A KR20210014180A KR102608336B1 KR 102608336 B1 KR102608336 B1 KR 102608336B1 KR 1020210014180 A KR1020210014180 A KR 1020210014180A KR 20210014180 A KR20210014180 A KR 20210014180A KR 102608336 B1 KR102608336 B1 KR 102608336B1
- Authority
- KR
- South Korea
- Prior art keywords
- peptide
- pep27
- antibacterial
- confirmed
- present
- Prior art date
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 206
- 230000000844 anti-bacterial effect Effects 0.000 claims abstract description 78
- 239000000203 mixture Substances 0.000 claims abstract description 50
- 239000002537 cosmetic Substances 0.000 claims abstract description 27
- 125000003275 alpha amino acid group Chemical group 0.000 claims abstract description 18
- 206010000269 abscess Diseases 0.000 claims description 29
- 230000003115 biocidal effect Effects 0.000 claims description 27
- 229960004755 ceftriaxone Drugs 0.000 claims description 24
- VAAUVRVFOQPIGI-SPQHTLEESA-N ceftriaxone Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1CSC1=NC(=O)C(=O)NN1C VAAUVRVFOQPIGI-SPQHTLEESA-N 0.000 claims description 24
- 241000750300 Staphylococcus aureus MW2 Species 0.000 claims description 20
- 241000191967 Staphylococcus aureus Species 0.000 claims description 16
- 239000008194 pharmaceutical composition Substances 0.000 claims description 11
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 9
- 229960002260 meropenem Drugs 0.000 claims description 7
- DMJNNHOOLUXYBV-PQTSNVLCSA-N meropenem Chemical compound C=1([C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)S[C@@H]1CN[C@H](C(=O)N(C)C)C1 DMJNNHOOLUXYBV-PQTSNVLCSA-N 0.000 claims description 7
- 229960000484 ceftazidime Drugs 0.000 claims description 6
- RJQXTJLFIWVMTO-TYNCELHUSA-N Methicillin Chemical compound COC1=CC=CC(OC)=C1C(=O)N[C@@H]1C(=O)N2[C@@H](C(O)=O)C(C)(C)S[C@@H]21 RJQXTJLFIWVMTO-TYNCELHUSA-N 0.000 claims description 4
- 229960003085 meticillin Drugs 0.000 claims 2
- NMVPEQXCMGEDNH-TZVUEUGBSA-N ceftazidime pentahydrate Chemical compound O.O.O.O.O.S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC(C)(C)C(O)=O)C=2N=C(N)SC=2)CC=1C[N+]1=CC=CC=C1 NMVPEQXCMGEDNH-TZVUEUGBSA-N 0.000 claims 1
- 239000003242 anti bacterial agent Substances 0.000 abstract description 39
- 229940088710 antibiotic agent Drugs 0.000 abstract description 38
- 102000004196 processed proteins & peptides Human genes 0.000 abstract description 33
- 239000004480 active ingredient Substances 0.000 abstract description 22
- 150000001413 amino acids Chemical class 0.000 abstract description 19
- 239000003814 drug Substances 0.000 abstract description 15
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 abstract description 14
- 231100000135 cytotoxicity Toxicity 0.000 abstract description 14
- 230000003013 cytotoxicity Effects 0.000 abstract description 14
- 229940079593 drug Drugs 0.000 abstract description 14
- 229960004799 tryptophan Drugs 0.000 abstract description 14
- 125000000430 tryptophan group Chemical group [H]N([H])C(C(=O)O*)C([H])([H])C1=C([H])N([H])C2=C([H])C([H])=C([H])C([H])=C12 0.000 abstract description 12
- 239000003674 animal food additive Substances 0.000 abstract description 8
- 235000013373 food additive Nutrition 0.000 abstract description 7
- 239000002778 food additive Substances 0.000 abstract description 7
- 239000000575 pesticide Substances 0.000 abstract description 6
- 239000006035 Tryptophane Substances 0.000 abstract description 3
- 101800002712 p27 Proteins 0.000 description 47
- 241000894006 Bacteria Species 0.000 description 43
- 210000004027 cell Anatomy 0.000 description 40
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 24
- 239000004615 ingredient Substances 0.000 description 24
- 238000000034 method Methods 0.000 description 24
- 208000015181 infectious disease Diseases 0.000 description 19
- 238000011282 treatment Methods 0.000 description 19
- DNIAPMSPPWPWGF-UHFFFAOYSA-N Propylene glycol Chemical compound CC(O)CO DNIAPMSPPWPWGF-UHFFFAOYSA-N 0.000 description 18
- -1 cefpodoxin Chemical compound 0.000 description 18
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 17
- 239000002953 phosphate buffered saline Substances 0.000 description 17
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerol Natural products OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 16
- 235000001014 amino acid Nutrition 0.000 description 16
- 238000004519 manufacturing process Methods 0.000 description 16
- 238000002835 absorbance Methods 0.000 description 14
- 239000000243 solution Substances 0.000 description 14
- 210000001519 tissue Anatomy 0.000 description 14
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 14
- 241000588724 Escherichia coli Species 0.000 description 13
- 230000001580 bacterial effect Effects 0.000 description 13
- 230000014509 gene expression Effects 0.000 description 12
- 238000002156 mixing Methods 0.000 description 12
- 239000003755 preservative agent Substances 0.000 description 11
- 239000008213 purified water Substances 0.000 description 11
- 241000192125 Firmicutes Species 0.000 description 10
- 239000012528 membrane Substances 0.000 description 10
- 239000003910 polypeptide antibiotic agent Substances 0.000 description 10
- 230000002195 synergetic effect Effects 0.000 description 10
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 9
- 230000000694 effects Effects 0.000 description 9
- 108010036176 Melitten Proteins 0.000 description 8
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 8
- 230000006378 damage Effects 0.000 description 8
- 235000011187 glycerol Nutrition 0.000 description 8
- 239000005090 green fluorescent protein Substances 0.000 description 8
- 230000002757 inflammatory effect Effects 0.000 description 8
- VDXZNPDIRNWWCW-JFTDCZMZSA-N melittin Chemical compound NCC(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H]([C@@H](C)O)C(=O)NCC(=O)N[C@@H](CC(C)C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CO)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(N)=O)CC1=CNC2=CC=CC=C12 VDXZNPDIRNWWCW-JFTDCZMZSA-N 0.000 description 8
- 241000699670 Mus sp. Species 0.000 description 7
- 102000000852 Tumor Necrosis Factor-alpha Human genes 0.000 description 7
- 230000002401 inhibitory effect Effects 0.000 description 7
- 102000010907 Cyclooxygenase 2 Human genes 0.000 description 6
- 108010037462 Cyclooxygenase 2 Proteins 0.000 description 6
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 6
- 102000004889 Interleukin-6 Human genes 0.000 description 6
- 108090001005 Interleukin-6 Proteins 0.000 description 6
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 6
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 6
- 239000006071 cream Substances 0.000 description 6
- 210000003743 erythrocyte Anatomy 0.000 description 6
- 229940100601 interleukin-6 Drugs 0.000 description 6
- 239000006210 lotion Substances 0.000 description 6
- HQKMJHAJHXVSDF-UHFFFAOYSA-L magnesium stearate Chemical compound [Mg+2].CCCCCCCCCCCCCCCCCC([O-])=O.CCCCCCCCCCCCCCCCCC([O-])=O HQKMJHAJHXVSDF-UHFFFAOYSA-L 0.000 description 6
- 238000005259 measurement Methods 0.000 description 6
- 244000005700 microbiome Species 0.000 description 6
- 239000000843 powder Substances 0.000 description 6
- 238000002360 preparation method Methods 0.000 description 6
- 230000002335 preservative effect Effects 0.000 description 6
- 210000003491 skin Anatomy 0.000 description 6
- 239000007858 starting material Substances 0.000 description 6
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 5
- 108090000790 Enzymes Proteins 0.000 description 5
- 102000004190 Enzymes Human genes 0.000 description 5
- 206010018910 Haemolysis Diseases 0.000 description 5
- 241000589517 Pseudomonas aeruginosa Species 0.000 description 5
- 108010025307 buforin II Proteins 0.000 description 5
- ORFOPKXBNMVMKC-DWVKKRMSSA-N ceftazidime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC(C)(C)C(O)=O)C=2N=C(N)SC=2)CC=1C[N+]1=CC=CC=C1 ORFOPKXBNMVMKC-DWVKKRMSSA-N 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 235000014113 dietary fatty acids Nutrition 0.000 description 5
- 239000000194 fatty acid Substances 0.000 description 5
- 229930195729 fatty acid Natural products 0.000 description 5
- 238000009472 formulation Methods 0.000 description 5
- 230000035876 healing Effects 0.000 description 5
- 230000008588 hemolysis Effects 0.000 description 5
- 239000012071 phase Substances 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- 239000006228 supernatant Substances 0.000 description 5
- PUPZLCDOIYMWBV-UHFFFAOYSA-N (+/-)-1,3-Butanediol Chemical compound CC(O)CCO PUPZLCDOIYMWBV-UHFFFAOYSA-N 0.000 description 4
- CBHVAFXKOYAHOY-NHCYSSNCSA-N Asn-Val-Leu Chemical compound [H]N[C@@H](CC(N)=O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O CBHVAFXKOYAHOY-NHCYSSNCSA-N 0.000 description 4
- 102000004127 Cytokines Human genes 0.000 description 4
- 108090000695 Cytokines Proteins 0.000 description 4
- YMWUJEATGCHHMB-UHFFFAOYSA-N Dichloromethane Chemical compound ClCCl YMWUJEATGCHHMB-UHFFFAOYSA-N 0.000 description 4
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 4
- 206010061218 Inflammation Diseases 0.000 description 4
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 4
- 229920003171 Poly (ethylene oxide) Polymers 0.000 description 4
- 239000004698 Polyethylene Substances 0.000 description 4
- 241000589516 Pseudomonas Species 0.000 description 4
- 206010039509 Scab Diseases 0.000 description 4
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 4
- DTQVDTLACAAQTR-UHFFFAOYSA-N Trifluoroacetic acid Chemical compound OC(=O)C(F)(F)F DTQVDTLACAAQTR-UHFFFAOYSA-N 0.000 description 4
- 230000009435 amidation Effects 0.000 description 4
- 238000007112 amidation reaction Methods 0.000 description 4
- 229940126575 aminoglycoside Drugs 0.000 description 4
- 230000027455 binding Effects 0.000 description 4
- 230000003833 cell viability Effects 0.000 description 4
- 239000001913 cellulose Substances 0.000 description 4
- 235000010980 cellulose Nutrition 0.000 description 4
- 229920002678 cellulose Polymers 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 238000011284 combination treatment Methods 0.000 description 4
- 210000000805 cytoplasm Anatomy 0.000 description 4
- 238000011161 development Methods 0.000 description 4
- 238000000799 fluorescence microscopy Methods 0.000 description 4
- 235000013305 food Nutrition 0.000 description 4
- 239000003205 fragrance Substances 0.000 description 4
- 230000002068 genetic effect Effects 0.000 description 4
- 230000002949 hemolytic effect Effects 0.000 description 4
- 230000004054 inflammatory process Effects 0.000 description 4
- 239000008101 lactose Substances 0.000 description 4
- 239000007788 liquid Substances 0.000 description 4
- 235000016709 nutrition Nutrition 0.000 description 4
- 238000010647 peptide synthesis reaction Methods 0.000 description 4
- 108090000623 proteins and genes Proteins 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 235000013599 spices Nutrition 0.000 description 4
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N squalane Chemical compound CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 4
- MYPYJXKWCTUITO-LYRMYLQWSA-N vancomycin Chemical class O([C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=C2C=C3C=C1OC1=CC=C(C=C1Cl)[C@@H](O)[C@H](C(N[C@@H](CC(N)=O)C(=O)N[C@H]3C(=O)N[C@H]1C(=O)N[C@H](C(N[C@@H](C3=CC(O)=CC(O)=C3C=3C(O)=CC=C1C=3)C(O)=O)=O)[C@H](O)C1=CC=C(C(=C1)Cl)O2)=O)NC(=O)[C@@H](CC(C)C)NC)[C@H]1C[C@](C)(N)[C@H](O)[C@H](C)O1 MYPYJXKWCTUITO-LYRMYLQWSA-N 0.000 description 4
- 150000003952 β-lactams Chemical class 0.000 description 4
- UZFHNLYQWMGUHU-DCAQKATOSA-N Asp-Lys-Arg Chemical compound OC(=O)C[C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O UZFHNLYQWMGUHU-DCAQKATOSA-N 0.000 description 3
- NJLLRXWFPQQPHV-SRVKXCTJSA-N Asp-Tyr-Asn Chemical compound [H]N[C@@H](CC(O)=O)C(=O)N[C@@H](CC1=CC=C(O)C=C1)C(=O)N[C@@H](CC(N)=O)C(O)=O NJLLRXWFPQQPHV-SRVKXCTJSA-N 0.000 description 3
- 108010062877 Bacteriocins Proteins 0.000 description 3
- XEKOWRVHYACXOJ-UHFFFAOYSA-N Ethyl acetate Chemical compound CCOC(C)=O XEKOWRVHYACXOJ-UHFFFAOYSA-N 0.000 description 3
- XFAUJGNLHIGXET-AVGNSLFASA-N Gln-Leu-Leu Chemical compound [H]N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O XFAUJGNLHIGXET-AVGNSLFASA-N 0.000 description 3
- 108010043121 Green Fluorescent Proteins Proteins 0.000 description 3
- 102000004144 Green Fluorescent Proteins Human genes 0.000 description 3
- RVKIPWVMZANZLI-UHFFFAOYSA-N H-Lys-Trp-OH Natural products C1=CC=C2C(CC(NC(=O)C(N)CCCCN)C(O)=O)=CNC2=C1 RVKIPWVMZANZLI-UHFFFAOYSA-N 0.000 description 3
- YDKYJRZWRJTILC-WDSOQIARSA-N Met-Trp-Lys Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](N)CCSC)C(=O)N[C@@H](CCCCN)C(O)=O)=CNC2=C1 YDKYJRZWRJTILC-WDSOQIARSA-N 0.000 description 3
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 description 3
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 3
- SECXISVLQFMRJM-UHFFFAOYSA-N N-Methylpyrrolidone Chemical compound CN1CCCC1=O SECXISVLQFMRJM-UHFFFAOYSA-N 0.000 description 3
- 108010087066 N2-tryptophyllysine Proteins 0.000 description 3
- VXCHGLYSIOOZIS-GUBZILKMSA-N Pro-Ala-Arg Chemical compound NC(N)=NCCC[C@@H](C(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H]1CCCN1 VXCHGLYSIOOZIS-GUBZILKMSA-N 0.000 description 3
- 238000011529 RT qPCR Methods 0.000 description 3
- 241000607142 Salmonella Species 0.000 description 3
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 3
- SRSPTFBENMJHMR-WHFBIAKZSA-N Ser-Ser-Gly Chemical compound OC[C@H](N)C(=O)N[C@@H](CO)C(=O)NCC(O)=O SRSPTFBENMJHMR-WHFBIAKZSA-N 0.000 description 3
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 3
- GSEJCLTVZPLZKY-UHFFFAOYSA-N Triethanolamine Chemical compound OCCN(CCO)CCO GSEJCLTVZPLZKY-UHFFFAOYSA-N 0.000 description 3
- VUMCLPHXCBIJJB-PMVMPFDFSA-N Trp-Phe-His Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CC3=CNC4=CC=CC=C43)N VUMCLPHXCBIJJB-PMVMPFDFSA-N 0.000 description 3
- 125000000539 amino acid group Chemical group 0.000 description 3
- 238000004458 analytical method Methods 0.000 description 3
- 230000002421 anti-septic effect Effects 0.000 description 3
- 108010062796 arginyllysine Proteins 0.000 description 3
- 108010060035 arginylproline Proteins 0.000 description 3
- 239000002775 capsule Substances 0.000 description 3
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 3
- 239000004359 castor oil Substances 0.000 description 3
- 235000019438 castor oil Nutrition 0.000 description 3
- 210000000170 cell membrane Anatomy 0.000 description 3
- 238000001142 circular dichroism spectrum Methods 0.000 description 3
- 238000012790 confirmation Methods 0.000 description 3
- 230000007423 decrease Effects 0.000 description 3
- 230000007547 defect Effects 0.000 description 3
- 239000003085 diluting agent Substances 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 238000000684 flow cytometry Methods 0.000 description 3
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 3
- 239000006260 foam Substances 0.000 description 3
- ZEMPKEQAKRGZGQ-XOQCFJPHSA-N glycerol triricinoleate Natural products CCCCCC[C@@H](O)CC=CCCCCCCCC(=O)OC[C@@H](COC(=O)CCCCCCCC=CC[C@@H](O)CCCCCC)OC(=O)CCCCCCCC=CC[C@H](O)CCCCCC ZEMPKEQAKRGZGQ-XOQCFJPHSA-N 0.000 description 3
- 108010010147 glycylglutamine Proteins 0.000 description 3
- 210000002510 keratinocyte Anatomy 0.000 description 3
- 235000019359 magnesium stearate Nutrition 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- LXCFILQKKLGQFO-UHFFFAOYSA-N methylparaben Chemical compound COC(=O)C1=CC=C(O)C=C1 LXCFILQKKLGQFO-UHFFFAOYSA-N 0.000 description 3
- 239000003921 oil Substances 0.000 description 3
- 235000019198 oils Nutrition 0.000 description 3
- 239000000546 pharmaceutical excipient Substances 0.000 description 3
- XJMOSONTPMZWPB-UHFFFAOYSA-M propidium iodide Chemical compound [I-].[I-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CCC[N+](C)(CC)CC)=C1C1=CC=CC=C1 XJMOSONTPMZWPB-UHFFFAOYSA-M 0.000 description 3
- 238000004626 scanning electron microscopy Methods 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000002904 solvent Substances 0.000 description 3
- 241000894007 species Species 0.000 description 3
- 239000007921 spray Substances 0.000 description 3
- 230000001954 sterilising effect Effects 0.000 description 3
- 239000000725 suspension Substances 0.000 description 3
- 239000000454 talc Substances 0.000 description 3
- 229910052623 talc Inorganic materials 0.000 description 3
- 235000012222 talc Nutrition 0.000 description 3
- 108010045269 tryptophyltryptophan Proteins 0.000 description 3
- 239000000230 xanthan gum Substances 0.000 description 3
- 235000010493 xanthan gum Nutrition 0.000 description 3
- 229920001285 xanthan gum Polymers 0.000 description 3
- 229940082509 xanthan gum Drugs 0.000 description 3
- AYIRNRDRBQJXIF-NXEZZACHSA-N (-)-Florfenicol Chemical class CS(=O)(=O)C1=CC=C([C@@H](O)[C@@H](CF)NC(=O)C(Cl)Cl)C=C1 AYIRNRDRBQJXIF-NXEZZACHSA-N 0.000 description 2
- CUNWUEBNSZSNRX-RKGWDQTMSA-N (2r,3r,4r,5s)-hexane-1,2,3,4,5,6-hexol;(z)-octadec-9-enoic acid Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO.OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO.CCCCCCCC\C=C/CCCCCCCC(O)=O.CCCCCCCC\C=C/CCCCCCCC(O)=O.CCCCCCCC\C=C/CCCCCCCC(O)=O CUNWUEBNSZSNRX-RKGWDQTMSA-N 0.000 description 2
- LOGFVTREOLYCPF-KXNHARMFSA-N (2s,3r)-2-[[(2r)-1-[(2s)-2,6-diaminohexanoyl]pyrrolidine-2-carbonyl]amino]-3-hydroxybutanoic acid Chemical compound C[C@@H](O)[C@@H](C(O)=O)NC(=O)[C@H]1CCCN1C(=O)[C@@H](N)CCCCN LOGFVTREOLYCPF-KXNHARMFSA-N 0.000 description 2
- DNIAPMSPPWPWGF-GSVOUGTGSA-N (R)-(-)-Propylene glycol Chemical compound C[C@@H](O)CO DNIAPMSPPWPWGF-GSVOUGTGSA-N 0.000 description 2
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 2
- 229940058015 1,3-butylene glycol Drugs 0.000 description 2
- 102000007469 Actins Human genes 0.000 description 2
- 108010085238 Actins Proteins 0.000 description 2
- 229920001817 Agar Polymers 0.000 description 2
- 241000193830 Bacillus <bacterium> Species 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 2
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 2
- 108010051109 Cell-Penetrating Peptides Proteins 0.000 description 2
- 102000020313 Cell-Penetrating Peptides Human genes 0.000 description 2
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 2
- LCGLNKUTAGEVQW-UHFFFAOYSA-N Dimethyl ether Chemical compound COC LCGLNKUTAGEVQW-UHFFFAOYSA-N 0.000 description 2
- ULGZDMOVFRHVEP-RWJQBGPGSA-N Erythromycin Chemical class O([C@@H]1[C@@H](C)C(=O)O[C@@H]([C@@]([C@H](O)[C@@H](C)C(=O)[C@H](C)C[C@@](C)(O)[C@H](O[C@H]2[C@@H]([C@H](C[C@@H](C)O2)N(C)C)O)[C@H]1C)(C)O)CC)[C@H]1C[C@@](C)(OC)[C@@H](O)[C@H](C)O1 ULGZDMOVFRHVEP-RWJQBGPGSA-N 0.000 description 2
- 241000588722 Escherichia Species 0.000 description 2
- 229930182566 Gentamicin Natural products 0.000 description 2
- CEAZRRDELHUEMR-URQXQFDESA-N Gentamicin Chemical compound O1[C@H](C(C)NC)CC[C@@H](N)[C@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](NC)[C@@](C)(O)CO2)O)[C@H](N)C[C@@H]1N CEAZRRDELHUEMR-URQXQFDESA-N 0.000 description 2
- WZUVPPKBWHMQCE-UHFFFAOYSA-N Haematoxylin Chemical compound C12=CC(O)=C(O)C=C2CC2(O)C1C1=CC=C(O)C(O)=C1OC2 WZUVPPKBWHMQCE-UHFFFAOYSA-N 0.000 description 2
- 102000003777 Interleukin-1 beta Human genes 0.000 description 2
- 108090000193 Interleukin-1 beta Proteins 0.000 description 2
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 2
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 2
- 241000186781 Listeria Species 0.000 description 2
- 241001465754 Metazoa Species 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- 229930193140 Neomycin Natural products 0.000 description 2
- 102000008299 Nitric Oxide Synthase Human genes 0.000 description 2
- 108010021487 Nitric Oxide Synthase Proteins 0.000 description 2
- 229930182555 Penicillin Natural products 0.000 description 2
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 2
- ISWSIDIOOBJBQZ-UHFFFAOYSA-N Phenol Chemical compound OC1=CC=CC=C1 ISWSIDIOOBJBQZ-UHFFFAOYSA-N 0.000 description 2
- NQRYJNQNLNOLGT-UHFFFAOYSA-N Piperidine Chemical compound C1CCNCC1 NQRYJNQNLNOLGT-UHFFFAOYSA-N 0.000 description 2
- 239000002202 Polyethylene glycol Substances 0.000 description 2
- 229920001214 Polysorbate 60 Polymers 0.000 description 2
- ATUOYWHBWRKTHZ-UHFFFAOYSA-N Propane Chemical compound CCC ATUOYWHBWRKTHZ-UHFFFAOYSA-N 0.000 description 2
- 108010076504 Protein Sorting Signals Proteins 0.000 description 2
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 2
- 241000191940 Staphylococcus Species 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 239000004098 Tetracycline Substances 0.000 description 2
- 108010059993 Vancomycin Proteins 0.000 description 2
- XLOMVQKBTHCTTD-UHFFFAOYSA-N Zinc monoxide Chemical compound [Zn]=O XLOMVQKBTHCTTD-UHFFFAOYSA-N 0.000 description 2
- 230000009471 action Effects 0.000 description 2
- 239000008272 agar Substances 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 239000003963 antioxidant agent Substances 0.000 description 2
- 239000000823 artificial membrane Substances 0.000 description 2
- 208000022362 bacterial infectious disease Diseases 0.000 description 2
- 235000013871 bee wax Nutrition 0.000 description 2
- 239000012166 beeswax Substances 0.000 description 2
- 239000000440 bentonite Substances 0.000 description 2
- 229910000278 bentonite Inorganic materials 0.000 description 2
- SVPXDRXYRYOSEX-UHFFFAOYSA-N bentoquatam Chemical compound O.O=[Si]=O.O=[Al]O[Al]=O SVPXDRXYRYOSEX-UHFFFAOYSA-N 0.000 description 2
- SESFRYSPDFLNCH-UHFFFAOYSA-N benzyl benzoate Chemical compound C=1C=CC=CC=1C(=O)OCC1=CC=CC=C1 SESFRYSPDFLNCH-UHFFFAOYSA-N 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 235000019437 butane-1,3-diol Nutrition 0.000 description 2
- 239000000378 calcium silicate Substances 0.000 description 2
- 229910052918 calcium silicate Inorganic materials 0.000 description 2
- 235000012241 calcium silicate Nutrition 0.000 description 2
- OYACROKNLOSFPA-UHFFFAOYSA-N calcium;dioxido(oxo)silane Chemical compound [Ca+2].[O-][Si]([O-])=O OYACROKNLOSFPA-UHFFFAOYSA-N 0.000 description 2
- 229910002091 carbon monoxide Inorganic materials 0.000 description 2
- 239000000969 carrier Substances 0.000 description 2
- WIIZWVCIJKGZOK-RKDXNWHRSA-N chloramphenicol Chemical compound ClC(Cl)C(=O)N[C@H](CO)[C@H](O)C1=CC=C([N+]([O-])=O)C=C1 WIIZWVCIJKGZOK-RKDXNWHRSA-N 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 230000000052 comparative effect Effects 0.000 description 2
- 235000009508 confectionery Nutrition 0.000 description 2
- 230000008878 coupling Effects 0.000 description 2
- 238000010168 coupling process Methods 0.000 description 2
- 238000005859 coupling reaction Methods 0.000 description 2
- 230000009089 cytolysis Effects 0.000 description 2
- 230000003247 decreasing effect Effects 0.000 description 2
- 239000000645 desinfectant Substances 0.000 description 2
- 230000003828 downregulation Effects 0.000 description 2
- 238000001962 electrophoresis Methods 0.000 description 2
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 2
- 229960005542 ethidium bromide Drugs 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 238000011156 evaluation Methods 0.000 description 2
- 150000004665 fatty acids Chemical class 0.000 description 2
- 239000012091 fetal bovine serum Substances 0.000 description 2
- 239000000945 filler Substances 0.000 description 2
- 239000005452 food preservative Substances 0.000 description 2
- 235000019249 food preservative Nutrition 0.000 description 2
- YMDXZJFXQJVXBF-STHAYSLISA-N fosfomycin Chemical class C[C@@H]1O[C@@H]1P(O)(O)=O YMDXZJFXQJVXBF-STHAYSLISA-N 0.000 description 2
- 239000000499 gel Substances 0.000 description 2
- 229960002518 gentamicin Drugs 0.000 description 2
- 239000011521 glass Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 238000001727 in vivo Methods 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical class O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 2
- OJMMVQQUTAEWLP-KIDUDLJLSA-N lincomycin Chemical class CN1C[C@H](CCC)C[C@H]1C(=O)N[C@H]([C@@H](C)O)[C@@H]1[C@H](O)[C@H](O)[C@@H](O)[C@@H](SC)O1 OJMMVQQUTAEWLP-KIDUDLJLSA-N 0.000 description 2
- 229940057995 liquid paraffin Drugs 0.000 description 2
- 238000004949 mass spectrometry Methods 0.000 description 2
- 235000013372 meat Nutrition 0.000 description 2
- 230000007246 mechanism Effects 0.000 description 2
- 230000010534 mechanism of action Effects 0.000 description 2
- 238000005497 microtitration Methods 0.000 description 2
- 239000011259 mixed solution Substances 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- JXTPJDDICSTXJX-UHFFFAOYSA-N n-Triacontane Natural products CCCCCCCCCCCCCCCCCCCCCCCCCCCCCC JXTPJDDICSTXJX-UHFFFAOYSA-N 0.000 description 2
- 229960004927 neomycin Drugs 0.000 description 2
- 231100001083 no cytotoxicity Toxicity 0.000 description 2
- 239000005416 organic matter Substances 0.000 description 2
- 239000012188 paraffin wax Substances 0.000 description 2
- 239000006072 paste Substances 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 239000008188 pellet Substances 0.000 description 2
- 229940049954 penicillin Drugs 0.000 description 2
- 150000002960 penicillins Chemical class 0.000 description 2
- 239000000825 pharmaceutical preparation Substances 0.000 description 2
- 239000008020 pharmaceutical preservative Substances 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 229920001223 polyethylene glycol Polymers 0.000 description 2
- 239000001818 polyoxyethylene sorbitan monostearate Substances 0.000 description 2
- 235000010989 polyoxyethylene sorbitan monostearate Nutrition 0.000 description 2
- 229940113124 polysorbate 60 Drugs 0.000 description 2
- DWHGNUUWCJZQHO-ZVDZYBSKSA-M potassium;(2s,5r,6r)-6-[[(2r)-2-amino-2-(4-hydroxyphenyl)acetyl]amino]-3,3-dimethyl-7-oxo-4-thia-1-azabicyclo[3.2.0]heptane-2-carboxylic acid;(2r,3z,5r)-3-(2-hydroxyethylidene)-7-oxo-4-oxa-1-azabicyclo[3.2.0]heptane-2-carboxylate Chemical compound [K+].[O-]C(=O)[C@H]1C(=C/CO)/O[C@@H]2CC(=O)N21.C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=C(O)C=C1 DWHGNUUWCJZQHO-ZVDZYBSKSA-M 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 150000007660 quinolones Chemical class 0.000 description 2
- 239000004460 silage Substances 0.000 description 2
- 239000000377 silicon dioxide Substances 0.000 description 2
- 210000002027 skeletal muscle Anatomy 0.000 description 2
- 239000000344 soap Substances 0.000 description 2
- 239000001509 sodium citrate Substances 0.000 description 2
- NLJMYIDDQXHKNR-UHFFFAOYSA-K sodium citrate Chemical compound O.O.[Na+].[Na+].[Na+].[O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O NLJMYIDDQXHKNR-UHFFFAOYSA-K 0.000 description 2
- 229960005078 sorbitan sesquioleate Drugs 0.000 description 2
- 239000000600 sorbitol Substances 0.000 description 2
- 235000010356 sorbitol Nutrition 0.000 description 2
- 229940032094 squalane Drugs 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 238000004659 sterilization and disinfection Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical class CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 229940124530 sulfonamide Drugs 0.000 description 2
- 150000003456 sulfonamides Chemical class 0.000 description 2
- 239000004094 surface-active agent Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 229960002180 tetracycline Drugs 0.000 description 2
- 229930101283 tetracycline Natural products 0.000 description 2
- 235000019364 tetracycline Nutrition 0.000 description 2
- 150000003522 tetracyclines Chemical class 0.000 description 2
- 230000001988 toxicity Effects 0.000 description 2
- 231100000419 toxicity Toxicity 0.000 description 2
- IEDVJHCEMCRBQM-UHFFFAOYSA-N trimethoprim Chemical class COC1=C(OC)C(OC)=CC(CC=2C(=NC(N)=NC=2)N)=C1 IEDVJHCEMCRBQM-UHFFFAOYSA-N 0.000 description 2
- 229960003165 vancomycin Drugs 0.000 description 2
- MYPYJXKWCTUITO-UHFFFAOYSA-N vancomycin Natural products O1C(C(=C2)Cl)=CC=C2C(O)C(C(NC(C2=CC(O)=CC(O)=C2C=2C(O)=CC=C3C=2)C(O)=O)=O)NC(=O)C3NC(=O)C2NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(CC(C)C)NC)C(O)C(C=C3Cl)=CC=C3OC3=CC2=CC1=C3OC1OC(CO)C(O)C(O)C1OC1CC(C)(N)C(O)C(C)O1 MYPYJXKWCTUITO-UHFFFAOYSA-N 0.000 description 2
- 235000015112 vegetable and seed oil Nutrition 0.000 description 2
- 239000008158 vegetable oil Substances 0.000 description 2
- 239000011782 vitamin Substances 0.000 description 2
- 235000013343 vitamin Nutrition 0.000 description 2
- 229940088594 vitamin Drugs 0.000 description 2
- 229930003231 vitamin Natural products 0.000 description 2
- 239000001993 wax Substances 0.000 description 2
- KZJWDPNRJALLNS-VPUBHVLGSA-N (-)-beta-Sitosterol Natural products O[C@@H]1CC=2[C@@](C)([C@@H]3[C@H]([C@H]4[C@@](C)([C@H]([C@H](CC[C@@H](C(C)C)CC)C)CC4)CC3)CC=2)CC1 KZJWDPNRJALLNS-VPUBHVLGSA-N 0.000 description 1
- CSVWWLUMXNHWSU-UHFFFAOYSA-N (22E)-(24xi)-24-ethyl-5alpha-cholest-22-en-3beta-ol Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(C)C=CC(CC)C(C)C)C1(C)CC2 CSVWWLUMXNHWSU-UHFFFAOYSA-N 0.000 description 1
- JNYAEWCLZODPBN-JGWLITMVSA-N (2r,3r,4s)-2-[(1r)-1,2-dihydroxyethyl]oxolane-3,4-diol Chemical compound OC[C@@H](O)[C@H]1OC[C@H](O)[C@H]1O JNYAEWCLZODPBN-JGWLITMVSA-N 0.000 description 1
- WDLWHQDACQUCJR-ZAMMOSSLSA-N (6r,7r)-7-[[(2r)-2-azaniumyl-2-(4-hydroxyphenyl)acetyl]amino]-8-oxo-3-[(e)-prop-1-enyl]-5-thia-1-azabicyclo[4.2.0]oct-2-ene-2-carboxylate Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)/C=C/C)C(O)=O)=CC=C(O)C=C1 WDLWHQDACQUCJR-ZAMMOSSLSA-N 0.000 description 1
- ALSTYHKOOCGGFT-KTKRTIGZSA-N (9Z)-octadecen-1-ol Chemical compound CCCCCCCC\C=C/CCCCCCCCO ALSTYHKOOCGGFT-KTKRTIGZSA-N 0.000 description 1
- 125000003088 (fluoren-9-ylmethoxy)carbonyl group Chemical group 0.000 description 1
- WNWHHMBRJJOGFJ-UHFFFAOYSA-N 16-methylheptadecan-1-ol Chemical class CC(C)CCCCCCCCCCCCCCCO WNWHHMBRJJOGFJ-UHFFFAOYSA-N 0.000 description 1
- PRDFBSVERLRRMY-UHFFFAOYSA-N 2'-(4-ethoxyphenyl)-5-(4-methylpiperazin-1-yl)-2,5'-bibenzimidazole Chemical compound C1=CC(OCC)=CC=C1C1=NC2=CC=C(C=3NC4=CC(=CC=C4N=3)N3CCN(C)CC3)C=C2N1 PRDFBSVERLRRMY-UHFFFAOYSA-N 0.000 description 1
- KLEXDBGYSOIREE-UHFFFAOYSA-N 24xi-n-propylcholesterol Natural products C1C=C2CC(O)CCC2(C)C2C1C1CCC(C(C)CCC(CCC)C(C)C)C1(C)CC2 KLEXDBGYSOIREE-UHFFFAOYSA-N 0.000 description 1
- AZKSAVLVSZKNRD-UHFFFAOYSA-M 3-(4,5-dimethylthiazol-2-yl)-2,5-diphenyltetrazolium bromide Chemical compound [Br-].S1C(C)=C(C)N=C1[N+]1=NC(C=2C=CC=CC=2)=NN1C1=CC=CC=C1 AZKSAVLVSZKNRD-UHFFFAOYSA-M 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- JDDWRLPTKIOUOF-UHFFFAOYSA-N 9h-fluoren-9-ylmethyl n-[[4-[2-[bis(4-methylphenyl)methylamino]-2-oxoethoxy]phenyl]-(2,4-dimethoxyphenyl)methyl]carbamate Chemical compound COC1=CC(OC)=CC=C1C(C=1C=CC(OCC(=O)NC(C=2C=CC(C)=CC=2)C=2C=CC(C)=CC=2)=CC=1)NC(=O)OCC1C2=CC=CC=C2C2=CC=CC=C21 JDDWRLPTKIOUOF-UHFFFAOYSA-N 0.000 description 1
- 244000215068 Acacia senegal Species 0.000 description 1
- 235000006491 Acacia senegal Nutrition 0.000 description 1
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 1
- ZXRQJQCXPSMNMR-XIRDDKMYSA-N Asp-Lys-Trp Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(=O)O)N ZXRQJQCXPSMNMR-XIRDDKMYSA-N 0.000 description 1
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 1
- 238000011725 BALB/c mouse Methods 0.000 description 1
- 244000063299 Bacillus subtilis Species 0.000 description 1
- 235000014469 Bacillus subtilis Nutrition 0.000 description 1
- YDNKGFDKKRUKPY-JHOUSYSJSA-N C16 ceramide Natural products CCCCCCCCCCCCCCCC(=O)N[C@@H](CO)[C@H](O)C=CCCCCCCCCCCCCC YDNKGFDKKRUKPY-JHOUSYSJSA-N 0.000 description 1
- LPZCCMIISIBREI-MTFRKTCUSA-N Citrostadienol Natural products CC=C(CC[C@@H](C)[C@H]1CC[C@H]2C3=CC[C@H]4[C@H](C)[C@@H](O)CC[C@]4(C)[C@H]3CC[C@]12C)C(C)C LPZCCMIISIBREI-MTFRKTCUSA-N 0.000 description 1
- 235000005979 Citrus limon Nutrition 0.000 description 1
- 244000131522 Citrus pyriformis Species 0.000 description 1
- 206010010144 Completed suicide Diseases 0.000 description 1
- 229920002261 Corn starch Polymers 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- ARVGMISWLZPBCH-UHFFFAOYSA-N Dehydro-beta-sitosterol Natural products C1C(O)CCC2(C)C(CCC3(C(C(C)CCC(CC)C(C)C)CCC33)C)C3=CC=C21 ARVGMISWLZPBCH-UHFFFAOYSA-N 0.000 description 1
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 1
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 1
- 241000194032 Enterococcus faecalis Species 0.000 description 1
- 239000004386 Erythritol Substances 0.000 description 1
- UNXHWFMMPAWVPI-UHFFFAOYSA-N Erythritol Natural products OCC(O)C(O)CO UNXHWFMMPAWVPI-UHFFFAOYSA-N 0.000 description 1
- 101150066002 GFP gene Proteins 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- RXESHTOTINOODU-JYJNAYRXSA-N Glu-Phe-His Chemical compound C1=CC=C(C=C1)C[C@@H](C(=O)N[C@@H](CC2=CN=CN2)C(=O)O)NC(=O)[C@H](CCC(=O)O)N RXESHTOTINOODU-JYJNAYRXSA-N 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 229920000084 Gum arabic Polymers 0.000 description 1
- 102000001554 Hemoglobins Human genes 0.000 description 1
- 108010054147 Hemoglobins Proteins 0.000 description 1
- 241000238631 Hexapoda Species 0.000 description 1
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 1
- 206010021703 Indifference Diseases 0.000 description 1
- JUZNIMUFDBIJCM-ANEDZVCMSA-N Invanz Chemical compound O=C([C@H]1NC[C@H](C1)SC=1[C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)NC1=CC=CC(C(O)=O)=C1 JUZNIMUFDBIJCM-ANEDZVCMSA-N 0.000 description 1
- 241000186660 Lactobacillus Species 0.000 description 1
- 239000004166 Lanolin Substances 0.000 description 1
- 241000589902 Leptospira Species 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- OLWAOWXIADGIJG-AVGNSLFASA-N Met-Arg-Lys Chemical compound CSCC[C@H](N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCCN)C(O)=O OLWAOWXIADGIJG-AVGNSLFASA-N 0.000 description 1
- 229920000168 Microcrystalline cellulose Polymers 0.000 description 1
- 208000029549 Muscle injury Diseases 0.000 description 1
- 241000187479 Mycobacterium tuberculosis Species 0.000 description 1
- CRJGESKKUOMBCT-VQTJNVASSA-N N-acetylsphinganine Chemical compound CCCCCCCCCCCCCCC[C@@H](O)[C@H](CO)NC(C)=O CRJGESKKUOMBCT-VQTJNVASSA-N 0.000 description 1
- AJHCSUXXECOXOY-UHFFFAOYSA-N N-glycyl-L-tryptophan Natural products C1=CC=C2C(CC(NC(=O)CN)C(O)=O)=CNC2=C1 AJHCSUXXECOXOY-UHFFFAOYSA-N 0.000 description 1
- 206010034133 Pathogen resistance Diseases 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 229920002565 Polyethylene Glycol 400 Polymers 0.000 description 1
- 239000004372 Polyvinyl alcohol Substances 0.000 description 1
- 101710088675 Proline-rich peptide Proteins 0.000 description 1
- 241000606701 Rickettsia Species 0.000 description 1
- BCAVNDNYOGTQMQ-AAEUAGOBSA-N Ser-Trp-Gly Chemical compound [H]N[C@@H](CO)C(=O)N[C@@H](CC1=CNC2=C1C=CC=C2)C(=O)NCC(O)=O BCAVNDNYOGTQMQ-AAEUAGOBSA-N 0.000 description 1
- 206010072170 Skin wound Diseases 0.000 description 1
- 229920002125 Sokalan® Polymers 0.000 description 1
- 241000193998 Streptococcus pneumoniae Species 0.000 description 1
- 229930006000 Sucrose Natural products 0.000 description 1
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 1
- ULUAUXLGCMPNKK-UHFFFAOYSA-N Sulfobutanedioic acid Chemical compound OC(=O)CC(C(O)=O)S(O)(=O)=O ULUAUXLGCMPNKK-UHFFFAOYSA-N 0.000 description 1
- 244000269722 Thea sinensis Species 0.000 description 1
- WKDDRNSBRWANNC-UHFFFAOYSA-N Thienamycin Natural products C1C(SCCN)=C(C(O)=O)N2C(=O)C(C(O)C)C21 WKDDRNSBRWANNC-UHFFFAOYSA-N 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- HJWVPKJHHLZCNH-DVXDUOKCSA-N Trp-Ala-Trp Chemical compound C1=CC=C2C(C[C@H](NC(=O)[C@@H](NC(=O)[C@@H](N)CC=3C4=CC=CC=C4NC=3)C)C(O)=O)=CNC2=C1 HJWVPKJHHLZCNH-DVXDUOKCSA-N 0.000 description 1
- CCZXBOFIBYQLEV-IHPCNDPISA-N Trp-Leu-Leu Chemical compound CC(C)C[C@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)Cc1c[nH]c2ccccc12)C(O)=O CCZXBOFIBYQLEV-IHPCNDPISA-N 0.000 description 1
- SGQSAIFDESQBRA-IHPCNDPISA-N Trp-Tyr-Asn Chemical compound C1=CC=C2C(=C1)C(=CN2)C[C@@H](C(=O)N[C@@H](CC3=CC=C(C=C3)O)C(=O)N[C@@H](CC(=O)N)C(=O)O)N SGQSAIFDESQBRA-IHPCNDPISA-N 0.000 description 1
- 206010052428 Wound Diseases 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- TVXBFESIOXBWNM-UHFFFAOYSA-N Xylitol Natural products OCCC(O)C(O)C(O)CCO TVXBFESIOXBWNM-UHFFFAOYSA-N 0.000 description 1
- IDNYCOXVOUHNHN-SLBHZGEVSA-N [1-heptadecanoyloxy-3-[[3-heptadecanoyloxy-2-[(10z,13z)-nonadeca-10,13-dienoyl]oxypropoxy]-hydroxyphosphoryl]oxypropan-2-yl] (10z,13z)-nonadeca-10,13-dienoate Chemical compound CCCCC\C=C/C\C=C/CCCCCCCCC(=O)OC(COC(=O)CCCCCCCCCCCCCCCC)COP(O)(=O)OCC(COC(=O)CCCCCCCCCCCCCCCC)OC(=O)CCCCCCCC\C=C/C\C=C/CCCCC IDNYCOXVOUHNHN-SLBHZGEVSA-N 0.000 description 1
- 235000010489 acacia gum Nutrition 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 239000011543 agarose gel Substances 0.000 description 1
- 230000002776 aggregation Effects 0.000 description 1
- 238000004220 aggregation Methods 0.000 description 1
- 235000013334 alcoholic beverage Nutrition 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- WNROFYMDJYEPJX-UHFFFAOYSA-K aluminium hydroxide Chemical compound [OH-].[OH-].[OH-].[Al+3] WNROFYMDJYEPJX-UHFFFAOYSA-K 0.000 description 1
- 239000003708 ampul Substances 0.000 description 1
- 239000010775 animal oil Substances 0.000 description 1
- 230000003042 antagnostic effect Effects 0.000 description 1
- 230000008485 antagonism Effects 0.000 description 1
- 230000003214 anti-biofilm Effects 0.000 description 1
- 239000012984 antibiotic solution Substances 0.000 description 1
- 230000002358 autolytic effect Effects 0.000 description 1
- URQAMACHHWVNRD-UHFFFAOYSA-N azane;1-hydroxybenzotriazole Chemical compound N.C1=CC=C2N(O)N=NC2=C1 URQAMACHHWVNRD-UHFFFAOYSA-N 0.000 description 1
- 229960002903 benzyl benzoate Drugs 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- MJVXAPPOFPTTCA-UHFFFAOYSA-N beta-Sistosterol Natural products CCC(CCC(C)C1CCC2C3CC=C4C(C)C(O)CCC4(C)C3CCC12C)C(C)C MJVXAPPOFPTTCA-UHFFFAOYSA-N 0.000 description 1
- LGJMUZUPVCAVPU-UHFFFAOYSA-N beta-Sitostanol Natural products C1CC2CC(O)CCC2(C)C2C1C1CCC(C(C)CCC(CC)C(C)C)C1(C)CC2 LGJMUZUPVCAVPU-UHFFFAOYSA-N 0.000 description 1
- NJKOMDUNNDKEAI-UHFFFAOYSA-N beta-sitosterol Natural products CCC(CCC(C)C1CCC2(C)C3CC=C4CC(O)CCC4C3CCC12C)C(C)C NJKOMDUNNDKEAI-UHFFFAOYSA-N 0.000 description 1
- 235000013361 beverage Nutrition 0.000 description 1
- 235000008429 bread Nutrition 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- 239000001273 butane Substances 0.000 description 1
- 238000010805 cDNA synthesis kit Methods 0.000 description 1
- 239000001506 calcium phosphate Substances 0.000 description 1
- 229910000389 calcium phosphate Inorganic materials 0.000 description 1
- 235000011010 calcium phosphates Nutrition 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- QYIYFLOTGYLRGG-GPCCPHFNSA-N cefaclor Chemical compound C1([C@H](C(=O)N[C@@H]2C(N3C(=C(Cl)CS[C@@H]32)C(O)=O)=O)N)=CC=CC=C1 QYIYFLOTGYLRGG-GPCCPHFNSA-N 0.000 description 1
- 229960005361 cefaclor Drugs 0.000 description 1
- 229960004841 cefadroxil Drugs 0.000 description 1
- NBFNMSULHIODTC-CYJZLJNKSA-N cefadroxil monohydrate Chemical compound O.C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=C(O)C=C1 NBFNMSULHIODTC-CYJZLJNKSA-N 0.000 description 1
- 229960001139 cefazolin Drugs 0.000 description 1
- MLYYVTUWGNIJIB-BXKDBHETSA-N cefazolin Chemical compound S1C(C)=NN=C1SCC1=C(C(O)=O)N2C(=O)[C@@H](NC(=O)CN3N=NN=C3)[C@H]2SC1 MLYYVTUWGNIJIB-BXKDBHETSA-N 0.000 description 1
- 229960003719 cefdinir Drugs 0.000 description 1
- RTXOFQZKPXMALH-GHXIOONMSA-N cefdinir Chemical compound S1C(N)=NC(C(=N\O)\C(=O)N[C@@H]2C(N3C(=C(C=C)CS[C@@H]32)C(O)=O)=O)=C1 RTXOFQZKPXMALH-GHXIOONMSA-N 0.000 description 1
- 229960004069 cefditoren Drugs 0.000 description 1
- KMIPKYQIOVAHOP-YLGJWRNMSA-N cefditoren Chemical compound S([C@@H]1[C@@H](C(N1C=1C(O)=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1\C=C/C=1SC=NC=1C KMIPKYQIOVAHOP-YLGJWRNMSA-N 0.000 description 1
- 229960002100 cefepime Drugs 0.000 description 1
- HVFLCNVBZFFHBT-ZKDACBOMSA-N cefepime Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OC)C=2N=C(N)SC=2)CC=1C[N+]1(C)CCCC1 HVFLCNVBZFFHBT-ZKDACBOMSA-N 0.000 description 1
- 229960002129 cefixime Drugs 0.000 description 1
- OKBVVJOGVLARMR-QSWIMTSFSA-N cefixime Chemical compound S1C(N)=NC(C(=N\OCC(O)=O)\C(=O)N[C@@H]2C(N3C(=C(C=C)CS[C@@H]32)C(O)=O)=O)=C1 OKBVVJOGVLARMR-QSWIMTSFSA-N 0.000 description 1
- 229960004261 cefotaxime Drugs 0.000 description 1
- GPRBEKHLDVQUJE-VINNURBNSA-N cefotaxime Chemical compound N([C@@H]1C(N2C(=C(COC(C)=O)CS[C@@H]21)C(O)=O)=O)C(=O)/C(=N/OC)C1=CSC(N)=N1 GPRBEKHLDVQUJE-VINNURBNSA-N 0.000 description 1
- SRZNHPXWXCNNDU-RHBCBLIFSA-N cefotetan Chemical compound N([C@]1(OC)C(N2C(=C(CSC=3N(N=NN=3)C)CS[C@@H]21)C(O)=O)=O)C(=O)C1SC(=C(C(N)=O)C(O)=O)S1 SRZNHPXWXCNNDU-RHBCBLIFSA-N 0.000 description 1
- 229960005495 cefotetan Drugs 0.000 description 1
- 229960002682 cefoxitin Drugs 0.000 description 1
- WZOZEZRFJCJXNZ-ZBFHGGJFSA-N cefoxitin Chemical compound N([C@]1(OC)C(N2C(=C(COC(N)=O)CS[C@@H]21)C(O)=O)=O)C(=O)CC1=CC=CS1 WZOZEZRFJCJXNZ-ZBFHGGJFSA-N 0.000 description 1
- 229960002580 cefprozil Drugs 0.000 description 1
- 229940036735 ceftaroline Drugs 0.000 description 1
- ZCCUWMICIWSJIX-NQJJCJBVSA-N ceftaroline fosamil Chemical compound S([C@@H]1[C@@H](C(N1C=1C([O-])=O)=O)NC(=O)\C(=N/OCC)C=2N=C(NP(O)(O)=O)SN=2)CC=1SC(SC=1)=NC=1C1=CC=[N+](C)C=C1 ZCCUWMICIWSJIX-NQJJCJBVSA-N 0.000 description 1
- 229960004086 ceftibuten Drugs 0.000 description 1
- UNJFKXSSGBWRBZ-BJCIPQKHSA-N ceftibuten Chemical compound S1C(N)=NC(C(=C\CC(O)=O)\C(=O)N[C@@H]2C(N3C(=CCS[C@@H]32)C(O)=O)=O)=C1 UNJFKXSSGBWRBZ-BJCIPQKHSA-N 0.000 description 1
- 229940000163 ceftriaxone injection Drugs 0.000 description 1
- 229960001668 cefuroxime Drugs 0.000 description 1
- JFPVXVDWJQMJEE-IZRZKJBUSA-N cefuroxime Chemical compound N([C@@H]1C(N2C(=C(COC(N)=O)CS[C@@H]21)C(O)=O)=O)C(=O)\C(=N/OC)C1=CC=CO1 JFPVXVDWJQMJEE-IZRZKJBUSA-N 0.000 description 1
- 230000005779 cell damage Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 208000037887 cell injury Diseases 0.000 description 1
- 230000004700 cellular uptake Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 229940106164 cephalexin Drugs 0.000 description 1
- ZAIPMKNFIOOWCQ-UEKVPHQBSA-N cephalexin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@@H]3N(C2=O)C(=C(CS3)C)C(O)=O)=CC=CC=C1 ZAIPMKNFIOOWCQ-UEKVPHQBSA-N 0.000 description 1
- 229940106189 ceramide Drugs 0.000 description 1
- ZVEQCJWYRWKARO-UHFFFAOYSA-N ceramide Natural products CCCCCCCCCCCCCCC(O)C(=O)NC(CO)C(O)C=CCCC=C(C)CCCCCCCCC ZVEQCJWYRWKARO-UHFFFAOYSA-N 0.000 description 1
- 229940081733 cetearyl alcohol Drugs 0.000 description 1
- 238000010611 checkerboard assay Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 229960005091 chloramphenicol Drugs 0.000 description 1
- 150000005827 chlorofluoro hydrocarbons Chemical class 0.000 description 1
- 235000019219 chocolate Nutrition 0.000 description 1
- 229960004912 cilastatin Drugs 0.000 description 1
- DHSUYTOATWAVLW-WFVMDLQDSA-N cilastatin Chemical compound CC1(C)C[C@@H]1C(=O)N\C(=C/CCCCSC[C@H](N)C(O)=O)C(O)=O DHSUYTOATWAVLW-WFVMDLQDSA-N 0.000 description 1
- 238000002983 circular dichroism Methods 0.000 description 1
- 239000002299 complementary DNA Substances 0.000 description 1
- 238000009833 condensation Methods 0.000 description 1
- 230000005494 condensation Effects 0.000 description 1
- 239000008120 corn starch Substances 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 238000003235 crystal violet staining Methods 0.000 description 1
- 238000012258 culturing Methods 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 1
- 230000001086 cytosolic effect Effects 0.000 description 1
- 235000013365 dairy product Nutrition 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 210000004207 dermis Anatomy 0.000 description 1
- 239000003599 detergent Substances 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 239000008121 dextrose Substances 0.000 description 1
- RNPXCFINMKSQPQ-UHFFFAOYSA-N dicetyl hydrogen phosphate Chemical compound CCCCCCCCCCCCCCCCOP(O)(=O)OCCCCCCCCCCCCCCCC RNPXCFINMKSQPQ-UHFFFAOYSA-N 0.000 description 1
- 229940093541 dicetylphosphate Drugs 0.000 description 1
- 229960004132 diethyl ether Drugs 0.000 description 1
- 229910001873 dinitrogen Inorganic materials 0.000 description 1
- 238000002845 discoloration Methods 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 238000009826 distribution Methods 0.000 description 1
- 229960000895 doripenem Drugs 0.000 description 1
- AVAACINZEOAHHE-VFZPANTDSA-N doripenem Chemical compound C=1([C@H](C)[C@@H]2[C@H](C(N2C=1C(O)=O)=O)[C@H](O)C)S[C@@H]1CN[C@H](CNS(N)(=O)=O)C1 AVAACINZEOAHHE-VFZPANTDSA-N 0.000 description 1
- 238000001647 drug administration Methods 0.000 description 1
- 238000001035 drying Methods 0.000 description 1
- 239000003995 emulsifying agent Substances 0.000 description 1
- 229940032049 enterococcus faecalis Drugs 0.000 description 1
- YQGOJNYOYNNSMM-UHFFFAOYSA-N eosin Chemical compound [Na+].OC(=O)C1=CC=CC=C1C1=C2C=C(Br)C(=O)C(Br)=C2OC2=C(Br)C(O)=C(Br)C=C21 YQGOJNYOYNNSMM-UHFFFAOYSA-N 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 229960002770 ertapenem Drugs 0.000 description 1
- 235000019414 erythritol Nutrition 0.000 description 1
- UNXHWFMMPAWVPI-ZXZARUISSA-N erythritol Chemical compound OC[C@H](O)[C@H](O)CO UNXHWFMMPAWVPI-ZXZARUISSA-N 0.000 description 1
- 229940009714 erythritol Drugs 0.000 description 1
- LYCAIKOWRPUZTN-UHFFFAOYSA-N ethylene glycol Natural products OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 1
- 230000001747 exhibiting effect Effects 0.000 description 1
- 238000010195 expression analysis Methods 0.000 description 1
- 150000002191 fatty alcohols Chemical class 0.000 description 1
- 238000000855 fermentation Methods 0.000 description 1
- 230000004151 fermentation Effects 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 239000000796 flavoring agent Substances 0.000 description 1
- 235000019634 flavors Nutrition 0.000 description 1
- 238000002073 fluorescence micrograph Methods 0.000 description 1
- 238000001943 fluorescence-activated cell sorting Methods 0.000 description 1
- 235000012041 food component Nutrition 0.000 description 1
- 239000005417 food ingredient Substances 0.000 description 1
- 239000010794 food waste Substances 0.000 description 1
- 239000012634 fragment Substances 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 235000021189 garnishes Nutrition 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000007903 gelatin capsule Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 231100000171 higher toxicity Toxicity 0.000 description 1
- 230000003301 hydrolyzing effect Effects 0.000 description 1
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 235000015243 ice cream Nutrition 0.000 description 1
- 238000003384 imaging method Methods 0.000 description 1
- MTNDZQHUAFNZQY-UHFFFAOYSA-N imidazoline Chemical class C1CN=CN1 MTNDZQHUAFNZQY-UHFFFAOYSA-N 0.000 description 1
- 229960002182 imipenem Drugs 0.000 description 1
- ZSKVGTPCRGIANV-ZXFLCMHBSA-N imipenem Chemical compound C1C(SCC\N=C\N)=C(C(O)=O)N2C(=O)[C@H]([C@H](O)C)[C@H]21 ZSKVGTPCRGIANV-ZXFLCMHBSA-N 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 230000028709 inflammatory response Effects 0.000 description 1
- 238000001802 infusion Methods 0.000 description 1
- 229940090044 injection Drugs 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- 150000002540 isothiocyanates Chemical class 0.000 description 1
- 229940039696 lactobacillus Drugs 0.000 description 1
- 229940041476 lactose 100 mg Drugs 0.000 description 1
- 235000019388 lanolin Nutrition 0.000 description 1
- 229940039717 lanolin Drugs 0.000 description 1
- VMPHSYLJUKZBJJ-UHFFFAOYSA-N lauric acid triglyceride Natural products CCCCCCCCCCCC(=O)OCC(OC(=O)CCCCCCCCCCC)COC(=O)CCCCCCCCCCC VMPHSYLJUKZBJJ-UHFFFAOYSA-N 0.000 description 1
- 244000144972 livestock Species 0.000 description 1
- 230000007774 longterm Effects 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 239000000845 maltitol Substances 0.000 description 1
- 235000010449 maltitol Nutrition 0.000 description 1
- VQHSOMBJVWLPSR-WUJBLJFYSA-N maltitol Chemical compound OC[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O VQHSOMBJVWLPSR-WUJBLJFYSA-N 0.000 description 1
- 229940035436 maltitol Drugs 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000000816 matrix-assisted laser desorption--ionisation Methods 0.000 description 1
- HEBKCHPVOIAQTA-UHFFFAOYSA-N meso ribitol Natural products OCC(O)C(O)C(O)CO HEBKCHPVOIAQTA-UHFFFAOYSA-N 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 229920000609 methyl cellulose Polymers 0.000 description 1
- 235000010270 methyl p-hydroxybenzoate Nutrition 0.000 description 1
- 239000004292 methyl p-hydroxybenzoate Substances 0.000 description 1
- 239000001923 methylcellulose Substances 0.000 description 1
- 235000010981 methylcellulose Nutrition 0.000 description 1
- 229960002216 methylparaben Drugs 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 239000013081 microcrystal Substances 0.000 description 1
- 239000008108 microcrystalline cellulose Substances 0.000 description 1
- 229940016286 microcrystalline cellulose Drugs 0.000 description 1
- 235000019813 microcrystalline cellulose Nutrition 0.000 description 1
- 235000013336 milk Nutrition 0.000 description 1
- 239000008267 milk Substances 0.000 description 1
- 210000004080 milk Anatomy 0.000 description 1
- 239000002480 mineral oil Substances 0.000 description 1
- 235000010446 mineral oil Nutrition 0.000 description 1
- CQDGTJPVBWZJAZ-UHFFFAOYSA-N monoethyl carbonate Chemical compound CCOC(O)=O CQDGTJPVBWZJAZ-UHFFFAOYSA-N 0.000 description 1
- 206010028320 muscle necrosis Diseases 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- IJDNQMDRQITEOD-UHFFFAOYSA-N n-butane Chemical compound CCCC IJDNQMDRQITEOD-UHFFFAOYSA-N 0.000 description 1
- OFBQJSOFQDEBGM-UHFFFAOYSA-N n-pentane Natural products CCCCC OFBQJSOFQDEBGM-UHFFFAOYSA-N 0.000 description 1
- 230000017074 necrotic cell death Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- VVGIYYKRAMHVLU-UHFFFAOYSA-N newbouldiamide Natural products CCCCCCCCCCCCCCCCCCCC(O)C(O)C(O)C(CO)NC(=O)CCCCCCCCCCCCCCCCC VVGIYYKRAMHVLU-UHFFFAOYSA-N 0.000 description 1
- 231100000252 nontoxic Toxicity 0.000 description 1
- 230000003000 nontoxic effect Effects 0.000 description 1
- 231100000956 nontoxicity Toxicity 0.000 description 1
- 235000012149 noodles Nutrition 0.000 description 1
- 108020004707 nucleic acids Proteins 0.000 description 1
- 102000039446 nucleic acids Human genes 0.000 description 1
- 230000030648 nucleus localization Effects 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- GLDOVTGHNKAZLK-UHFFFAOYSA-N octadecan-1-ol Chemical compound CCCCCCCCCCCCCCCCCCO GLDOVTGHNKAZLK-UHFFFAOYSA-N 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 229940049964 oleate Drugs 0.000 description 1
- 229940055577 oleyl alcohol Drugs 0.000 description 1
- XMLQWXUVTXCDDL-UHFFFAOYSA-N oleyl alcohol Natural products CCCCCCC=CCCCCCCCCCCO XMLQWXUVTXCDDL-UHFFFAOYSA-N 0.000 description 1
- 230000003287 optical effect Effects 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 238000002135 phase contrast microscopy Methods 0.000 description 1
- WVDDGKGOMKODPV-ZQBYOMGUSA-N phenyl(114C)methanol Chemical compound O[14CH2]C1=CC=CC=C1 WVDDGKGOMKODPV-ZQBYOMGUSA-N 0.000 description 1
- 239000002504 physiological saline solution Substances 0.000 description 1
- 239000000049 pigment Substances 0.000 description 1
- 235000013550 pizza Nutrition 0.000 description 1
- 230000004260 plant-type cell wall biogenesis Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 239000000244 polyoxyethylene sorbitan monooleate Substances 0.000 description 1
- 235000010482 polyoxyethylene sorbitan monooleate Nutrition 0.000 description 1
- 229920001296 polysiloxane Polymers 0.000 description 1
- 229920000136 polysorbate Polymers 0.000 description 1
- 229920000053 polysorbate 80 Polymers 0.000 description 1
- 229920002451 polyvinyl alcohol Polymers 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 239000002244 precipitate Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 239000001294 propane Substances 0.000 description 1
- 239000003380 propellant Substances 0.000 description 1
- QELSKZZBTMNZEB-UHFFFAOYSA-N propylparaben Chemical compound CCCOC(=O)C1=CC=C(O)C=C1 QELSKZZBTMNZEB-UHFFFAOYSA-N 0.000 description 1
- 229960003415 propylparaben Drugs 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 235000018102 proteins Nutrition 0.000 description 1
- 102000004169 proteins and genes Human genes 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 239000002994 raw material Substances 0.000 description 1
- 230000001105 regulatory effect Effects 0.000 description 1
- 239000011347 resin Substances 0.000 description 1
- 229920005989 resin Polymers 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000002441 reversible effect Effects 0.000 description 1
- 229940071089 sarcosinate Drugs 0.000 description 1
- FSYKKLYZXJSNPZ-UHFFFAOYSA-N sarcosine Chemical compound C[NH2+]CC([O-])=O FSYKKLYZXJSNPZ-UHFFFAOYSA-N 0.000 description 1
- 235000013580 sausages Nutrition 0.000 description 1
- 238000013207 serial dilution Methods 0.000 description 1
- KZJWDPNRJALLNS-VJSFXXLFSA-N sitosterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CC[C@@H](CC)C(C)C)[C@@]1(C)CC2 KZJWDPNRJALLNS-VJSFXXLFSA-N 0.000 description 1
- 229950005143 sitosterol Drugs 0.000 description 1
- NLQLSVXGSXCXFE-UHFFFAOYSA-N sitosterol Natural products CC=C(/CCC(C)C1CC2C3=CCC4C(C)C(O)CCC4(C)C3CCC2(C)C1)C(C)C NLQLSVXGSXCXFE-UHFFFAOYSA-N 0.000 description 1
- 235000015500 sitosterol Nutrition 0.000 description 1
- 206010040872 skin infection Diseases 0.000 description 1
- 235000011888 snacks Nutrition 0.000 description 1
- 239000011734 sodium Substances 0.000 description 1
- 229910052708 sodium Inorganic materials 0.000 description 1
- 239000007790 solid phase Substances 0.000 description 1
- 235000014347 soups Nutrition 0.000 description 1
- 108010005652 splenotritin Proteins 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 239000012192 staining solution Substances 0.000 description 1
- 229940031000 streptococcus pneumoniae Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000005720 sucrose Substances 0.000 description 1
- 230000004083 survival effect Effects 0.000 description 1
- 239000000375 suspending agent Substances 0.000 description 1
- 230000002194 synthesizing effect Effects 0.000 description 1
- 229940104261 taurate Drugs 0.000 description 1
- 235000013616 tea Nutrition 0.000 description 1
- UEUXEKPTXMALOB-UHFFFAOYSA-J tetrasodium;2-[2-[bis(carboxylatomethyl)amino]ethyl-(carboxylatomethyl)amino]acetate Chemical compound [Na+].[Na+].[Na+].[Na+].[O-]C(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O UEUXEKPTXMALOB-UHFFFAOYSA-J 0.000 description 1
- HNKJADCVZUBCPG-UHFFFAOYSA-N thioanisole Chemical compound CSC1=CC=CC=C1 HNKJADCVZUBCPG-UHFFFAOYSA-N 0.000 description 1
- 238000004448 titration Methods 0.000 description 1
- 238000013518 transcription Methods 0.000 description 1
- 230000035897 transcription Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- ZGYICYBLPGRURT-UHFFFAOYSA-N tri(propan-2-yl)silicon Chemical compound CC(C)[Si](C(C)C)C(C)C ZGYICYBLPGRURT-UHFFFAOYSA-N 0.000 description 1
- QORWJWZARLRLPR-UHFFFAOYSA-H tricalcium bis(phosphate) Chemical compound [Ca+2].[Ca+2].[Ca+2].[O-]P([O-])([O-])=O.[O-]P([O-])([O-])=O QORWJWZARLRLPR-UHFFFAOYSA-H 0.000 description 1
- GPRLSGONYQIRFK-MNYXATJNSA-N triton Chemical compound [3H+] GPRLSGONYQIRFK-MNYXATJNSA-N 0.000 description 1
- 239000002691 unilamellar liposome Substances 0.000 description 1
- 229940099259 vaseline Drugs 0.000 description 1
- 150000003722 vitamin derivatives Chemical class 0.000 description 1
- 238000005406 washing Methods 0.000 description 1
- 239000003643 water by type Substances 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 230000029663 wound healing Effects 0.000 description 1
- 239000000811 xylitol Substances 0.000 description 1
- 235000010447 xylitol Nutrition 0.000 description 1
- HEBKCHPVOIAQTA-SCDXWVJYSA-N xylitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)CO HEBKCHPVOIAQTA-SCDXWVJYSA-N 0.000 description 1
- 229960002675 xylitol Drugs 0.000 description 1
- 239000011787 zinc oxide Substances 0.000 description 1
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/195—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria
- C07K14/315—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci
- C07K14/3156—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from bacteria from Streptococcus (G), e.g. Enterococci from Streptococcus pneumoniae (Pneumococcus)
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
- A01N63/00—Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
- A01N63/50—Isolated enzymes; Isolated proteins
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/142—Amino acids; Derivatives thereof
- A23K20/147—Polymeric derivatives, e.g. peptides or proteins
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23K—FODDER
- A23K20/00—Accessory food factors for animal feeding-stuffs
- A23K20/10—Organic substances
- A23K20/195—Antibiotics
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L3/00—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs
- A23L3/34—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals
- A23L3/3454—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals in the form of liquids or solids
- A23L3/3463—Organic compounds; Microorganisms; Enzymes
- A23L3/3571—Microorganisms; Enzymes
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
- A23L33/00—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof
- A23L33/10—Modifying nutritive qualities of foods; Dietetic products; Preparation or treatment thereof using additives
- A23L33/17—Amino acids, peptides or proteins
- A23L33/18—Peptides; Protein hydrolysates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K8/00—Cosmetics or similar toiletry preparations
- A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
- A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
- A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
- A61P31/04—Antibacterial agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q17/00—Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings
- A61Q17/005—Antimicrobial preparations
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/007—Preparations for dry skin
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
- A61Q19/00—Preparations for care of the skin
- A61Q19/10—Washing or bathing preparations
-
- A—HUMAN NECESSITIES
- A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
- A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
- A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
-
- C—CHEMISTRY; METALLURGY
- C12—BIOCHEMISTRY; BEER; SPIRITS; WINE; VINEGAR; MICROBIOLOGY; ENZYMOLOGY; MUTATION OR GENETIC ENGINEERING
- C12R—INDEXING SCHEME ASSOCIATED WITH SUBCLASSES C12C - C12Q, RELATING TO MICROORGANISMS
- C12R2001/00—Microorganisms ; Processes using microorganisms
- C12R2001/01—Bacteria or Actinomycetales ; using bacteria or Actinomycetales
- C12R2001/46—Streptococcus ; Enterococcus; Lactococcus
-
- Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
- Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
- Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
- Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
- Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change
Landscapes
- Life Sciences & Earth Sciences (AREA)
- Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Polymers & Plastics (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Veterinary Medicine (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Engineering & Computer Science (AREA)
- Organic Chemistry (AREA)
- Medicinal Chemistry (AREA)
- Food Science & Technology (AREA)
- Zoology (AREA)
- Dermatology (AREA)
- Molecular Biology (AREA)
- Epidemiology (AREA)
- Pharmacology & Pharmacy (AREA)
- General Chemical & Material Sciences (AREA)
- Chemical Kinetics & Catalysis (AREA)
- Animal Husbandry (AREA)
- Microbiology (AREA)
- Communicable Diseases (AREA)
- Genetics & Genomics (AREA)
- Pulmonology (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Oncology (AREA)
- Birds (AREA)
- Nutrition Science (AREA)
- Gastroenterology & Hepatology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Mycology (AREA)
- Virology (AREA)
- Plant Pathology (AREA)
- Immunology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Environmental Sciences (AREA)
- Pest Control & Pesticides (AREA)
- Dentistry (AREA)
Abstract
본 발명은 신규 펩타이드에 관한 것으로, 보다 상세하게 서열번호 1의 아미노산 서열에서 ⅰ) 2번째 및 4번째 아미노산이 트립토판(tryptophane, W)으로 치환되거나; ⅱ) 2번째, 4번째, 11번째 및 13번째 아미노산이 트립토판으로 치환되거나; ⅲ) 2번째, 4번째, 19번째, 20번째, 22번째, 23번째, 26번째 및 27번째 아미노산이 트립토판으로 치환된 펩타이드는 우수한 항균 활성 및 낮은 세포 독성을 나타내며, 궁극적으로 항생제, 화장료 조성물, 식품 첨가제, 사료 첨가제, 생물 농약 및 의약외품 등의 유효성분으로 유용하게 사용될 수 있다.The present invention relates to a new peptide, and more specifically, in the amino acid sequence of SEQ ID NO: 1: i) the 2nd and 4th amino acids are substituted with tryptophane (W); ii) the 2nd, 4th, 11th and 13th amino acids are replaced with tryptophan; iii) Peptides in which the 2nd, 4th, 19th, 20th, 22nd, 23rd, 26th, and 27th amino acids are substituted with tryptophan exhibit excellent antibacterial activity and low cytotoxicity, and are ultimately used in antibiotics, cosmetic compositions, It can be usefully used as an active ingredient in food additives, feed additives, biological pesticides, and quasi-drugs.
Description
본 발명은 PEP27 펩타이드로부터 유래한 신규 펩타이드 및 이의 용도에 관한 것이다.The present invention relates to novel peptides derived from PEP27 peptide and their uses.
세균 감염은 인간의 질병에서 가장 흔하고 치명적인 원인 중 하나인데, 불행하게도 항생제의 남용으로 인하여 세균의 항생제 저항성(resistance)이 야기되었다. 실제로, 세균이 새로운 항생제에 저항성을 나타내는 속도는 새로운 항생제의 유사체가 개발되는 속도보다 훨씬 더 빨리 일어난다. 예를 들면, 생명에 위협을 가할 수 있는 엔테로코커스 패칼리스(Enterococcus faecalis), 마이코박테리움 투버쿨로시스(Mycobacterium tuberculosis) 및 슈도모나스 에루지노사(Pseudomonas aeruginosa) 등의 세균 종들은 지금까지 알려진 모든 항생제에 대한 저항력을 키워왔다.Bacterial infections are one of the most common and fatal causes of human disease, and unfortunately, the overuse of antibiotics has led to antibiotic resistance in bacteria. In fact, the rate at which bacteria develop resistance to new antibiotics occurs much faster than the rate at which analogues of new antibiotics are developed. For example, life-threatening bacterial species such as Enterococcus faecalis , Mycobacterium tuberculosis , and Pseudomonas aeruginosa are resistant to all known antibiotics. has developed resistance to
항생제 내성(tolerance)은 항생제에 대한 저항성(resistance)과는 구별되는 현상인데, 1970년대에 뉴모코커스(Pneumococcus sp.)에서 최초로 발견되었으며 페니실린의 작용 기작에 대한 중요한 단서를 제공하였다. 내성을 보이는 종은 통상적인 농도의 항생제 존재하에서는 성장을 멈추지만 죽지는 않는다. 내성은 항생제가 세포벽 합성 효소를 저해할 때 오토라이신(autolysin) 등과 같은 세균의 자가분해(autolytic) 효소의 활성이 일어나지 않기 때문에 생기는데, 이러한 사실은 페니실린이 내인성 가수분해 효소(endogenous hydrolytic enzyme)를 활성화시킴으로써 세균을 죽이며 세균은 또한 이들의 활성을 억제해서 항생제 치료시에도 생존하는 결과를 나타내게 된다. 세균이 여러 가지 항생제에 대해 내성을 가지는 것은 임상적으로 대단히 중요한데, 이는 내성 세균을 박멸하는 것이 불가능하게 되면 임상적인 감염에서 항생제 치료의 효용이 떨어지기 때문이다. 아울러, 내성이 생기는 것은 항생제에 대한 저항성이 생기게 되는 선행조건이라고 간주되는데 이것은 항생제 치료에도 불구하고 살아남는 균주가 생기기 때문이다. 이러한 균주는 항생제에 저항성을 가지는 새로운 유전 요소를 획득해서 항생제의 존재 하에서도 계속 성장하게 된다. 실제로 모든 저항성을 보이는 세균들은 내성도 가지고 있는 것으로 알려져 있으므로, 이러한 항생제 저항성을 가지는 세균을 죽일 수 있는 신규한 항생제의 개발이 필요하다. 작용 기작의 측면에서 항생제 내성은 크게 두가지 경로로 이루어지는데, 첫 번째는 모든 세균에 있어서 성장속도가 감소할 때 일어나는 외형적(phenotypic) 내성이며, 두 번째는 특정 세균에서 일어나는 돌연변이에 의한 유전적인 내성이다. 두 가지 경우 모두 기본적인 현상은 오토라이신 활성의 하부조절(down regulation)이 일어난다는 것인데, 이러한 하부조절은 외부자극에 대한 외형적인 내성일 경우에는 일시적이며, 세포 용혈을 조절하는 경로의 변화를 야기하는 돌연변이가 일어난 유전적인 내성의 경우에는 영구적이다. 가장 간단한 유전적인 내성의 경우는 오토라이신 효소에 결손이 일어나는 것인데, 확실하지 않은 여러 가지 이유로 인해서 이러한 자살 효소의 결손에 의해 내성을 가지는 균주가 임상적으로 발견된 적은 없으며, 오히려 임상적인 내성은 오토라이신의 활성을 조절함으로써 이루어진다. 항생제에 저항성을 나타내는 세균들과 싸우기 위해서는 새로운 항생제의 개발이 필요하며, 아울러 오토라이신 활성과는 독립적으로 작용하는 새로운 항생제의 개발이 필요하다.Antibiotic resistance, a phenomenon distinct from resistance to antibiotics, was first discovered in Pneumococcus sp. in the 1970s and provided important clues to the mechanism of action of penicillin. Resistant species stop growing but do not die in the presence of conventional concentrations of antibiotics. Resistance occurs because when antibiotics inhibit cell wall synthesis enzymes, the activity of bacterial autolytic enzymes such as autolysin does not occur. This fact occurs because penicillin activates endogenous hydrolytic enzymes. This kills bacteria and inhibits their activity, resulting in their survival even when treated with antibiotics. It is clinically very important for bacteria to be resistant to various antibiotics, because if it becomes impossible to eradicate resistant bacteria, the effectiveness of antibiotic treatment in clinical infections decreases. In addition, the development of resistance is considered a prerequisite for the development of resistance to antibiotics because it creates strains that survive despite antibiotic treatment. These strains acquire new genetic elements that make them resistant to antibiotics and continue to grow even in the presence of antibiotics. In fact, it is known that all resistant bacteria are also resistant, so it is necessary to develop new antibiotics that can kill these antibiotic-resistant bacteria. In terms of the mechanism of action, antibiotic resistance is largely composed of two pathways. The first is phenotypic resistance that occurs when the growth rate is reduced in all bacteria, and the second is genetic resistance caused by mutations that occur in specific bacteria. am. In both cases, the basic phenomenon is that downregulation of autolysin activity occurs. This downregulation is temporary in the case of apparent resistance to external stimuli and causes changes in the pathways that control cell hemolysis. In the case of genetic resistance caused by mutation, it is permanent. The simplest case of genetic resistance is a defect in the autolysin enzyme. However, for various reasons that are unclear, no strain with resistance due to a defect in this suicide enzyme has been clinically discovered. Rather, clinical resistance is caused by a defect in the autolysin enzyme. This is achieved by regulating the activity of lysine. In order to combat bacteria that are resistant to antibiotics, the development of new antibiotics is necessary, and in addition, the development of new antibiotics that act independently of autolysin activity is necessary.
한편, 박테리오신(bacteriocin)은 여러 종류의 미생물이 생산하는 천연항균성 단백질로 생산균과 유사한 균종에 대하여 살균 작용을 갖는다. 박테리오신은 구조적으로 세 부류로 분류된다. 첫 번째는 란티바이오틱스(lantibiotics)이며, 두 번째는 비란티바이오틱스(nonlantibiotics)이고, 세 번째는 신호 펩타이드(signal peptide)에 의해 분비되는 것들이다. 곤충을 포함하는 동물들 역시 자연적으로 생성되는 펩타이드 항생제를 생산하는데, 상기 펩타이드 항생제는 구조적으로 세 개의 그룹으로 나누어진다. 첫 번째는 시스테인이 풍부한(cysteine-rich) β-쉬트(sheet) 펩타이드이고, 두 번째는 α-나선형(helical)의 양친화성 분자이며, 세 번째는 프롤린이 풍부한(proline-rich) 펩타이드이다. 이들 항균 펩타이드들은 숙주방어 및 선천적 면역계에 있어서 중요한 역할을 담당하는 것으로 알려져 있는데, 이러한 항균 펩타이드들은 아미노산 서열에 따라 다양한 구조를 가진다.Meanwhile, bacteriocin is a natural antibacterial protein produced by various types of microorganisms and has a bactericidal effect on bacterial species similar to the producing bacteria. Bacteriocins are structurally classified into three classes. The first are lantibiotics, the second are nonlantibiotics, and the third are those secreted by signal peptides. Animals, including insects, also produce naturally occurring peptide antibiotics, which are structurally divided into three groups. The first is a cysteine-rich β-sheet peptide, the second is an α-helical amphiphilic molecule, and the third is a proline-rich peptide. These antibacterial peptides are known to play an important role in host defense and the innate immune system, and these antibacterial peptides have various structures depending on their amino acid sequences.
본 발명은 신규 펩타이드 및 이의 용도를 제공하는 것을 목적으로 한다.The purpose of the present invention is to provide new peptides and uses thereof.
1. 서열번호 1의 아미노산 서열에서 ⅰ) 2번째 및 4번째 아미노산이 트립토판(tryptophane, W)으로 치환되거나; ⅱ) 2번째, 4번째, 11번째 및 13번째 아미노산이 트립토판으로 치환되거나; ⅲ) 2번째, 4번째, 19번째, 20번째, 22번째, 23번째, 26번째 및 27번째 아미노산이 트립토판으로 치환된 펩타이드.1. In the amino acid sequence of SEQ ID NO: 1, i) the 2nd and 4th amino acids are replaced with tryptophane (W); ii) the 2nd, 4th, 11th and 13th amino acids are substituted with tryptophan; iii) A peptide in which the 2nd, 4th, 19th, 20th, 22nd, 23rd, 26th and 27th amino acids are substituted with tryptophan.
2. 위 1에 있어서, 상기 펩타이드는 서열번호 3의 아미노산 서열을 갖는 펩타이드.2. In item 1 above, the peptide has the amino acid sequence of SEQ ID NO: 3.
3. 위 1에 있어서, 상기 펩타이드는 그람 양성균, 그람 음성균 및 항생제 내성균으로 이루어진 군에서 선택된 적어도 하나에 대해 항균 활성을 갖는 펩타이드.3. The peptide of 1 above, wherein the peptide has antibacterial activity against at least one selected from the group consisting of Gram-positive bacteria, Gram-negative bacteria, and antibiotic-resistant bacteria.
4. 위 3에 있어서, 상기 그람 양성균은 스타필로코커스 아우레우스(Staphylococcus aureus), 바실러스 서브틸리스(Bacillus subtilis) 및 리스테리아 모노사이토젠스(Listeria monocytogenes)로 이루어진 군에서 선택된 적어도 하나인 펩타이드.4. The peptide of 3 above, wherein the Gram-positive bacteria are at least one selected from the group consisting of Staphylococcus aureus, Bacillus subtilis , and Listeria monocytogenes .
5. 위 3에 있어서, 상기 그람 음성균은 에스케리키아 콜라이(Escherichia coli), 슈도모나스 에루지노사(Pseudomonas aeruginosa) 및 살모넬라 티피뮤리움(Salmonella typhimurium)으로 이루어진 군에서 선택된 적어도 하나인 펩타이드.5. The peptide of 3 above, wherein the Gram-negative bacteria are at least one selected from the group consisting of Escherichia coli, Pseudomonas aeruginosa , and Salmonella typhimurium .
6. 위 3에 있어서, 상기 항생제 내성균은 항생제 내성을 갖는 스타필로코커스 아우레우스(S. aureus), 에스케리키아 콜라이(E. coli), 슈도모나스 에루지노사(P. aeruginosa) 및 살모넬라 티피뮤리움(Salmonella typhimurium)으로 이루어진 군에서 선택된 적어도 하나인 펩타이드.6. In 3 above, the antibiotic-resistant bacteria are antibiotic-resistant Staphylococcus aureus ( S. aureus ), Escherichia coli ( E. coli ), Pseudomonas aeruginosa ( P. aeruginosa ), and Salmonella Typhimu. At least one peptide selected from the group consisting of Salmonella typhimurium .
7. 위 1 내지 6 중 어느 한 항의 펩타이드를 유효성분으로 포함하는 항균용 조성물.7. An antibacterial composition containing the peptide of any one of items 1 to 6 above as an active ingredient.
8. 위 7에 있어서, 상기 항균용 조성물은 약학 조성물인, 항균용 조성물.8. The antibacterial composition of item 7 above, wherein the antibacterial composition is a pharmaceutical composition.
9. 위 7에 있어서, 상기 항균용 조성물은 화장료 조성물, 식품 첨가제, 사료 첨가제, 생물 농약, 방부용 조성물 및 의약외품 조성물로 이루어진 군에서 선택되는 어느 하나인, 항균용 조성물.9. The antibacterial composition of item 7 above, wherein the antibacterial composition is any one selected from the group consisting of cosmetic compositions, food additives, feed additives, biological pesticides, preservative compositions, and quasi-drug compositions.
본 발명 펩타이드는 우수한 항균 활성 및 낮은 세포 독성을 나타내며, 이에 항생제, 화장료 조성물, 식품 첨가제, 사료 첨가제, 생물 농약 및 의약외품 등의 유효성분으로 유용하게 사용될 수 있다.The peptide of the present invention exhibits excellent antibacterial activity and low cytotoxicity, and can therefore be usefully used as an active ingredient in antibiotics, cosmetic compositions, food additives, feed additives, biological pesticides, and quasi-drugs.
도 1은 항균 펩타이드인 PEP27(대조군) 및 아미노산 잔기가 치환된 PEP27 유사체 신규 펩타이드인 PEP27-2(실험군)의 막 유사환경에서 2차 구조를 확인한 결과로, 도 1a는 수용액 상태(10 mM PBS 용액), 도 1b는 PE/PG(7/3)로 구성된 박테리아 막 모방 인공막 및 도 1c는 PC/CH/SM(1/1/1)로 구성된 진핵세포 막 모방 인공막을 의미한다.
도 2는 대조군인 PEP27 펩타이드 및 신규 펩타이드 PEP27-2의 대장균(Escherichia coli) 막에 대한 작용 여부를 유세포분석기(FACS)로 확인한 결과이다.
도 3은 대조군인 PEP27 펩타이드 및 신규 펩타이드 PEP27-2의 박테리아 내부 물질인 DNA에 대한 결합능을 확인한 결과로, 펩타이드:DNA 비율은 각각 DNA 단독(0), 0.25:1, 0.5:1, 1:1, 1.5:1, 2:1, 3:1, 4:1 이다.
도 4는 대조군인 PEP27 펩타이드 및 신규 펩타이드 PEP27-2의 대장균 및 스타필로코커스 아우레우스 (Starphylococcus aureus) 막에 대한 작용을 주사전자현미경(SEM)으로 확인한 결과이다.
도 5는 사람의 각질 형성 세포주 (HaCaT cell line, Dr. NE. Fusenig, Heidelberg, Germany)에 FITC로 표지된 PEP27-2 펩타이드 (FITC-PEP27-2)의 내재화를 형광현미경으로 확인한 결과이다.
도 6는 다제 내성 균주인 스타필로코코스 아우레우스(Starphylococcus aureus) MW2에 감염된 후 형성된 농양에 대한 PEP27 펩타이드과 항생제인 세프트리악손 (ceftriaxone)의 단독처리 또는 병용처리시 치유 효과를 확인한 결과이다.
도 7은 다제 내성 균주인 스타필로코코스 아우레우스 MW2에 감염된 후 형성된 농양 부분을 회수하여 회복되는 총 균수(CFU/g)를 확인한 결과이다.
도 8는 다제 내성 균주인 스타필로코코스 아우레우스 MW2에 GFP(green fluorescent protein) 유전자가 삽입된 균주 (스타필로코코스 아우레우스 MW2-GFP) 감염된 후 형성된 농양에 대한 PEP27 펩타이드과 항생제인 세프트리악손 (ceftriaxone)의 단독처리 또는 병용처리시 균주의 분포도와 치유 효과를 확인한 결과이다.
도 9은 다제 내성 균주인 스타필로코코스 아우레우스 MW2에 감염된 후 형성된 농양에 대한 PEP27 펩타이드과 항생제인 세프트리악손 (ceftriaxone)의 단독처리 또는 병용처리시 농양 조직의 변화를 확인한 결과이다.
도 10은 다제 내성 균주인 스타필로코코스 아우레우스 MW2에 감염된 후 형성된 농양 조직에서 염증반응에 관련된 유전자의 상대적인 발현율을 확인한 결과이다 (TNF-α: 종양괴사인자-알파, IL-1β: 인터루킨-1 베타, IL-6: 인터루킨-6, iNOS: 산화질소 합성효소, COX-2: 시클로옥시게나제-2).Figure 1 shows the results of confirming the secondary structure of the antibacterial peptide PEP27 (control group) and the new peptide PEP27-2 (experimental group), a PEP27 analog with substituted amino acid residues, in a membrane-like environment. ), Figure 1b refers to a bacterial membrane-mimicking artificial membrane composed of PE/PG (7/3), and Figure 1c refers to a eukaryotic cell membrane-mimicking artificial membrane composed of PC/CH/SM (1/1/1).
Figure 2 shows the results of confirming the action of the control PEP27 peptide and the new peptide PEP27-2 on the Escherichia coli membrane using flow cytometry (FACS).
Figure 3 shows the results of confirming the binding ability of the control PEP27 peptide and the new peptide PEP27-2 to DNA, an internal material of bacteria. The peptide:DNA ratios are DNA alone (0), 0.25:1, 0.5:1, and 1:1, respectively. , 1.5:1, 2:1, 3:1, 4:1.
Figure 4 shows the results of confirming the action of the control PEP27 peptide and the new peptide PEP27-2 on the membranes of E. coli and Staphylococcus aureus using scanning electron microscopy (SEM).
Figure 5 shows the results of fluorescence microscopy confirming the internalization of the FITC-labeled PEP27-2 peptide (FITC-PEP27-2) in a human keratinocyte cell line (HaCaT cell line, Dr. NE. Fusenig, Heidelberg, Germany).
Figure 6 shows the results of confirming the healing effect of PEP27 peptide and the antibiotic ceftriaxone on abscesses formed after infection with the multi-drug resistant strain Starphylococcus aureus MW2, when treated alone or in combination.
Figure 7 shows the results of confirming the total number of bacteria recovered (CFU/g) by recovering the abscess area formed after infection with Staphylococcus aureus MW2, a multi-drug resistant strain.
Figure 8 shows PEP27 peptide and the antibiotic ceftriaxone for abscesses formed after infection with a strain (Staphylococcus aureus MW2-GFP) in which a GFP (green fluorescent protein) gene was inserted into the multidrug-resistant strain Staphylococcus aureus MW2. This is the result of confirming the distribution of strains and the healing effect when treated alone or in combination with (ceftriaxone).
Figure 9 shows the results of confirming changes in abscess tissue when the abscess formed after infection with the multi-drug resistant strain Staphylococcus aureus MW2 was treated alone or in combination with PEP27 peptide and the antibiotic ceftriaxone.
Figure 10 shows the results of confirming the relative expression rates of genes related to the inflammatory response in abscess tissue formed after infection with Staphylococcus aureus MW2, a multidrug-resistant strain (TNF-α: tumor necrosis factor-alpha, IL-1β: interleukin- 1 beta, IL-6: interleukin-6, iNOS: nitric oxide synthase, COX-2: cyclooxygenase-2).
이하, 본 발명을 상세히 설명한다.Hereinafter, the present invention will be described in detail.
본 발명은 서열번호 1의 아미노산 서열에서 ⅰ) 2번째 및 4번째 아미노산이 트립토판(tryptophane, W)으로 치환되거나; ⅱ) 2번째, 4번째, 11번째 및 13번째 아미노산이 트립토판으로 치환되거나; ⅲ) 2번째, 4번째, 19번째, 20번째, 22번째, 23번째, 26번째 및 27번째 아미노산이 트립토판으로 치환된 펩타이드를 제공한다.The present invention relates to the amino acid sequence of SEQ ID NO: 1 where i) the 2nd and 4th amino acids are substituted with tryptophane (W); ii) the 2nd, 4th, 11th and 13th amino acids are replaced with tryptophan; iii) Provides a peptide in which the 2nd, 4th, 19th, 20th, 22nd, 23rd, 26th and 27th amino acids are substituted with tryptophan.
기존에 알려진 서열번호 1의 아미노산 서열을 갖는 모체 펩타이드인 PEP27은 트렙토코코스 뉴모니아 (Streptococcus pneumoniae)에서 분비되며, PEP27은 Vex123-Pep27-VncRS 유전자좌에 존재하는 "죽음 신호 펩티드"로 알려져 있다.PEP27, the parent peptide with the previously known amino acid sequence of SEQ ID NO: 1, is secreted by Streptococcus pneumoniae , and PEP27 is known as a "death signal peptide" present in the Vex123-Pep27-VncRS locus.
[서열번호 1][SEQ ID NO: 1]
MRKEFHNVLSSGQLLADKRPARDYNRK-NH2 MRKEFHNVLSSGQLLADKRPARDYNRK-NH 2
PEP27 펩타이드는 당업계에 알려진 통상의 펩타이드 합성 방법에 의해 제조가 가능하며, 제조 방법에 특별히 한정되지 않는다. 예를 들어, PEP27 펩타이드의 합성을 위한 방법으로 당업계의 통상적인 펩타이드의 화학적 합성 방법을 이용할 수 있으며, 구체적으로 액상 펩타이드 합성법(solution-phase peptide synthesis), 고상 펩타이드 합성법(solid-phase peptide synthesis), 단편 응축법 및 F-moc 또는 T-BOC 화학법을 이용할 수 있다.PEP27 peptide can be produced by conventional peptide synthesis methods known in the art, and the production method is not particularly limited. For example, as a method for synthesizing the PEP27 peptide, conventional peptide chemical synthesis methods in the art can be used, specifically solution-phase peptide synthesis and solid-phase peptide synthesis. , fragment condensation method, and F-moc or T-BOC chemical methods can be used.
본 발명의 펩타이드는 서열번호 2 내지 서열번호 4의 아미노산 서열을 가지는 펩타이드일 수 있다.The peptide of the present invention may be a peptide having the amino acid sequence of SEQ ID NO: 2 to SEQ ID NO: 4.
[서열번호 2][SEQ ID NO: 2]
MWKWFHNVLSSGQLLADKRPARDYNRK-NH2 MWKWFHNVLSSGQLLADKRPARDYNRK-NH 2
[서열번호 3][SEQ ID NO: 3]
MWKWFHNVLSWGWLLADKRPARDYNRK-NH2 MWKWFHNVLSWGWLLADKRPARDYNRK-NH 2
[서열번호 4][SEQ ID NO: 4]
MWKWFHNVLSSGQLLADKWWAWWYNWW-NH2 MWKWFHNVLSSGQLLADKWWAWWYNWW-NH 2
서열번호 2의 아미노산 서열을 가지는 펩타이드는 모체 펩타이드인 PEP27로부터 2번째 및 4번째 아미노산이 트립토판(W)으로 치환된 펩타이드로, PEP27-1로 명명하였다.The peptide having the amino acid sequence of SEQ ID NO: 2 was a peptide in which the 2nd and 4th amino acids were substituted with tryptophan (W) from the parent peptide, PEP27, and was named PEP27-1.
서열번호 3의 아미노산 서열을 가지는 펩타이드는 모체 펩타이드인 PEP27로부터 2번째, 4번째, 11번째 및 13번째 아미노산이 트립토판(W)으로 치환된 펩타이드로, PEP27-2로 명명하였다.The peptide having the amino acid sequence of SEQ ID NO: 3 was a peptide in which the 2nd, 4th, 11th, and 13th amino acids from the parent peptide, PEP27, were substituted with tryptophan (W), and was named PEP27-2.
서열번호 4의 아미노산 서열을 가지는 펩타이드는 모체 펩타이드인 PEP27로부터 2번째, 4번째, 19번째, 20번째, 22번째, 23번째, 26번째 및 27번째 아미노산이 트립토판(W)으로 치환된 펩타이드로, PEP27-5로 명명하였다.The peptide having the amino acid sequence of SEQ ID NO: 4 is a peptide in which the 2nd, 4th, 19th, 20th, 22nd, 23rd, 26th, and 27th amino acids from the parent peptide, PEP27, are substituted with tryptophan (W), It was named PEP27-5.
상기 서열번호 1 내지 서열번호 4의 아미노산 서열의 “-NH2”는 C 말단의 카르복시기가 아미드화되어 있는 것을 나타낸다.“-NH 2 ” in the amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 4 indicates that the carboxyl group at the C terminus is amidated.
구체적으로, 본 발명 펩타이드는 서열번호 3의 아미노산 서열을 가지는 펩타이드일 수 있다.Specifically, the peptide of the present invention may be a peptide having the amino acid sequence of SEQ ID NO: 3.
전술한 아미노산의 치환에 의해 펩타이드의 전극의 증/감이 일어날 수 있고 세포독성을 감소시킬 수 있다. 또한, 전술한 아미노산의 치환에 의해 펩타이드의 그람 양성균, 그람 음성균 및 항생제 내성균에 대해 항균 활성을 나타낼 수 있다.By substitution of the above-mentioned amino acids, the electrode of the peptide can be increased/decreased and cytotoxicity can be reduced. In addition, by substitution of the above-mentioned amino acids, the peptide can exhibit antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and antibiotic-resistant bacteria.
본 발명의 펩타이드는 그람 양성균, 그람 음성균 및 항생제 내성균에 대해 항균 활성을 나타낼 수 있다.The peptide of the present invention can exhibit antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and antibiotic-resistant bacteria.
그람 양성균은 스타필로코커스 속(Staphylococcus), 리스테리아 속(Listeria), 코리네박테리움 속(Corynebacterium), 락토바실러스 속(Lactobacillus) 및 바실러스 속(Bacillus)으로 이루어진 군에서 선택된 적어도 하나일 수 있으나, 이에 제한되지 않는다. 구체적으로 본 발명의 펩타이드는 스타필로코커스 속, 바실러스 속 또는 리스테리아 속으로 이루어진 군으로부터 선택된 적어도 하나에 대해 우수한 항균 활성을 나타낸다.The gram-positive bacteria may be at least one selected from the group consisting of Staphylococcus , Listeria , Corynebacterium , Lactobacillus , and Bacillus . Not limited. Specifically, the peptide of the present invention exhibits excellent antibacterial activity against at least one selected from the group consisting of Staphylococcus genus, Bacillus genus, or Listeria genus.
그람 음성균은 슈도모나스 속(Pseudomonas), 에스케리키아 속(Escherichia), 살모넬라 속(Salmonella), 렙토스피라 속(Leptospira) 및 리케치아 속(Rickettsia)으로 이루어진 군에서 선택된 적어도 하나일 수 있으나, 이에 제한되지 않는다. 구체적으로 본 발명의 펩타이드는 슈도모나스 속, 에스케리키아 속 또는 살모넬라 속으로 이루어진 군으로부터 선택된 적어도 하나에 대해 우수한 항균 활성을 나타낸다.The gram-negative bacteria may be at least one selected from the group consisting of Pseudomonas , Escherichia , Salmonella , Leptospira , and Rickettsia , but is not limited thereto. Specifically, the peptide of the present invention exhibits excellent antibacterial activity against at least one selected from the group consisting of Pseudomonas genus, Escherichia genus, or Salmonella genus.
항생제 내성균은 항생제 내성을 갖는 슈도모나스 에루지노사(Pseudomonas aeruginosa), 에스케리키아 콜라이(Escherichia coli), 살모넬라 티피뮤리움(Salmonella typhimurium) 및 스타필로코커스 아우레우스(Staphylococcus aureus)로 이루어진 군으로부터 선택된 적어도 하나일 수 있으나, 이에 제한되지 않는다. 상기 항생제는 아미노글리코사이드 계열(아미노글리코사이드, 겐타마이신, 네오마이신 등), 페니실린 계열(앰피실린 등), 술폰아미드 계열, 베타-락탐 계열(베타-락탐, 아목시실린/클라불란산 등), 클로람페니콜 계열, 에리트로마이신 계열, 플로르페니콜 계열, 포스포마이신 계열, 카나마이신 계열, 린코마이신 계열, 메티실린 계열, 퀴놀론 계열, 스트렙토마이신 계열, 테트라사이클린 계열, 트리메소프림 계열 및 반코마이신 계열의 항생제로 이루어진 군에서 선택된 적어도 하나일 수 있으나, 이에 제한되지 않는다.Antibiotic-resistant bacteria are at least selected from the group consisting of antibiotic-resistant Pseudomonas aeruginosa , Escherichia coli, Salmonella typhimurium , and Staphylococcus aureus . It may be one, but is not limited thereto. The above antibiotics include aminoglycoside series (aminoglycoside, gentamicin, neomycin, etc.), penicillin series (ampicillin, etc.), sulfonamide series, beta-lactam series (beta-lactam, amoxicillin/clavulanic acid, etc.), and chloramphenicol. A group consisting of antibiotics of the erythromycin series, florfenicol series, fosfomycin series, kanamycin series, lincomycin series, methicillin series, quinolone series, streptomycin series, tetracycline series, trimethoprim series, and vancomycin series. It may be at least one selected from, but is not limited to.
본 발명의 펩타이드는 그람 양성균, 그람 음성균 및 항생제 내성균에 대해 우수한 항균 활성을 나타내면서, 인간 유래 세포에 대하여는 항균 농도 내에서 낮은 세포 독성을 나타낼 수 있다.The peptide of the present invention exhibits excellent antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and antibiotic-resistant bacteria, while exhibiting low cytotoxicity against human-derived cells within the antibacterial concentration.
또한, 본 발명은 전술한 펩타이드를 유효성분으로 포함하는 항균용 조성물을 제공한다.Additionally, the present invention provides an antibacterial composition containing the above-described peptide as an active ingredient.
상기 항균용 조성물은 약학 조성물일 수 있다. 즉, 본 발명은 전술한 펩타이드를 유효성분으로 포함하는 항균용 약학 조성물을 제공한다.The antibacterial composition may be a pharmaceutical composition. That is, the present invention provides an antibacterial pharmaceutical composition containing the above-described peptide as an active ingredient.
본 발명의 PEP27 항균 펩타이드로부터 유래된 유사체 펩타이드인 서열번호 2 내지 4는 강한 항균 활성을 나타내면서 인간 유래 세포에 대하여 낮은 세포독성을 나타내므로, 본 발명의 펩타이드는 항균용 약학 조성물의 유효성분으로 유용하게 사용될 수 있다. 예를 들어, 본 발명의 펩타이드는 항생제로서 사용될 수 있다. 예를 들어, 본 발명의 펩타이드는 다른 항생제와 병용될 수 있으며, 다른 항생제와 병용시 단독으로 사용하는 경우에 비해 상승적 항균 활성을 나타낼 수 있다.SEQ ID NOs: 2 to 4, which are analogue peptides derived from the PEP27 antibacterial peptide of the present invention, exhibit strong antibacterial activity and low cytotoxicity to human-derived cells, so the peptide of the present invention is useful as an active ingredient in an antibacterial pharmaceutical composition. can be used For example, the peptides of the present invention can be used as antibiotics. For example, the peptide of the present invention can be used in combination with other antibiotics, and when used in combination with other antibiotics, it can exhibit synergistic antibacterial activity compared to when used alone.
약학 조성물은 유효성분인 펩타이드 이외에도 약학적 조성물의 제조에 통상적으로 사용하는 적절한 담체, 부형제 및 희석제를 더 포함할 수 있다.In addition to the peptide as an active ingredient, the pharmaceutical composition may further include appropriate carriers, excipients, and diluents commonly used in the preparation of pharmaceutical compositions.
약학 조성물에 포함될 수 있는 담체, 부형제 및 희석제로는 락토오스, 덱스트로오스, 수크로오스, 소르비톨, 만니톨, 자일리톨, 에리스리톨, 말티톨, 전분, 아카시아 고무, 알지네이트, 젤라틴, 칼슘포스페이트, 칼슘 실리케이트, 셀룰로오스, 메틸 셀룰로오스, 미정질 셀룰로오스, 폴리비닐 피롤리돈, 물, 메틸히드록시벤조에이트, 프로필히드록시벤조에이트, 탈크, 마그네슘 스테아레이트 및 광물유를 들 수 있다.Carriers, excipients, and diluents that may be included in pharmaceutical compositions include lactose, dextrose, sucrose, sorbitol, mannitol, xylitol, erythritol, maltitol, starch, gum acacia, alginate, gelatin, calcium phosphate, calcium silicate, cellulose, and methyl cellulose. , microcrystalline cellulose, polyvinyl pyrrolidone, water, methylhydroxybenzoate, propylhydroxybenzoate, talc, magnesium stearate, and mineral oil.
약학 조성물은 임상투여시 경구 또는 비경구로 투여가능하며 일반적인 의약품 제제의 형태로 사용될 수 있다. 비경구 투여는 직장, 정맥, 복막, 근육, 동맥, 경피, 비강(nasal), 흡입, 안구 및 피하와 같은 경구 이외의 투여경로를 통한 투여를 의미할 수 있다.Pharmaceutical compositions can be administered orally or parenterally during clinical administration and can be used in the form of general pharmaceutical preparations. Parenteral administration may mean administration through routes of administration other than oral, such as rectal, intravenous, peritoneal, muscular, arterial, transdermal, nasal, inhalation, ocular, and subcutaneous.
약학 조성물은 유효성분인 펩타이드와 동일 또는 유사한 기능을 나타내는 유효성분을 1종 이상 추가로 함유할 수 있다.The pharmaceutical composition may additionally contain one or more active ingredients that exhibit the same or similar functions as the peptide, which is the active ingredient.
예를 들어, 본 발명 약학 조성물은 공지된 항생제를 더 포함할 수 있다.For example, the pharmaceutical composition of the present invention may further include known antibiotics.
공지된 항생제는 아미노글리코사이드 계열(아미노글리코사이드, 겐타마이신, 네오마이신 등), 페니실린 계열(앰피실린 등), 술폰아미드 계열, 베타-락탐 계열(베타-락탐, 아목시실린/클라불란산 등), 클로람페니콜 계열, 에리트로마이신 계열, 플로르페니콜 계열, 포스포마이신 계열, 카나마이신 계열, 린코마이신 계열, 메티실린 계열, 퀴놀론 계열, 스트렙토마이신 계열, 테트라사이클린 계열, 트리메소프림 계열 및 반코마이신 계열의 항생제로 이루어진 군에서 선택된 적어도 하나일 수 있다. 구체적으로 항생제는 메로페넴, 세프타지딤, 세프트리악손, 도리페넴, 에르타페넴, 이미페넴 및 실라스타틴, 세파드록실, 세파졸린, 세팔렉신, 세파클로르, 세포테탄, 세폭시틴, 세프프로질, 세푸록심, 세프디니르, 세프디토렌, 세픽심, 세포탁심, 세프포독신, 세프티부텐, 세페핌 및 세프타롤린으로 이루어진 군에서 선택된 적어도 하나일 수 있다. 보다 구체적으로 항생제는 메로페넴, 세프타지딤 및 세프트리악손으로 이루어진 군에서 선택된 적어도 하나일 수 있다.Known antibiotics include aminoglycoside series (aminoglycoside, gentamicin, neomycin, etc.), penicillin series (ampicillin, etc.), sulfonamide series, beta-lactam series (beta-lactam, amoxicillin/clavulanic acid, etc.), Consists of antibiotics of the chloramphenicol series, erythromycin series, florfenicol series, fosfomycin series, kanamycin series, lincomycin series, methicillin series, quinolone series, streptomycin series, tetracycline series, trimethoprim series, and vancomycin series. It may be at least one selected from the group. Specifically, the antibiotics are meropenem, ceftazidime, ceftriaxone, doripenem, ertapenem, imipenem, and cilastatin, cefadroxil, cefazolin, cephalexin, cefaclor, cefotetan, cefoxitin, and cefprozil. , cefuroxime, cefdinir, cefditoren, cefixime, cefotaxime, cefpodoxin, ceftibuten, cefepime, and ceftaroline. More specifically, the antibiotic may be at least one selected from the group consisting of meropenem, ceftazidime, and ceftriaxone.
본 발명의 펩타이드의 유효용량은 0.1 내지 2 mg/kg일 수 있고, 하루 1 회 내지 3 회 투여될 수 있다.The effective dose of the peptide of the present invention may be 0.1 to 2 mg/kg and may be administered once to three times a day.
본 발명의 펩타이드의 총 유효량은 볼루스(bolus) 형태 혹은 상대적으로 짧은 기간 동안 주입(infusion) 등에 의해 단일 투여량(single dose)으로 환자에게 투여될 수 있으며, 다중 투여량(multiple dose)이 장기간 투여되는 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수 있다. 상기 농도는 약의 투여 경로 및 치료 횟수뿐만 아니라 환자의 나이 및 건강상태 등 다양한 요인들을 고려하여 환자의 유효 투여량이 결정되는 것이므로 이러한 점을 고려할 때, 이 분야의 통상적인 지식을 가진 자라면 본 발명의 펩타이드의 항생제로서의 특정한 용도에 따른 적절한 유효 투여량을 결정할 수 있을 것이다.The total effective amount of the peptide of the present invention can be administered to the patient in a single dose in the form of a bolus or by infusion for a relatively short period of time, and multiple doses can be administered for a long period of time. It may be administered by a fractionated treatment protocol. The concentration is determined by considering various factors such as the drug administration route and number of treatments as well as the patient's age and health condition, so that the effective dose for the patient is determined. Considering this, those skilled in the art will understand the present invention. It will be possible to determine an appropriate effective dosage according to the specific use of the peptide as an antibiotic.
상기 항균용 조성물은 화장료 조성물, 식품 첨가제, 사료 첨가제, 생물 농약, 방부용 조성물 및 의약외품 조성물로 이루어진 군에서 선택되는 어느 하나일 수 있다.The antibacterial composition may be any one selected from the group consisting of cosmetic compositions, food additives, feed additives, biological pesticides, preservative compositions, and quasi-drug compositions.
본 발명은 전술한 펩타이드를 유효성분으로 함유하는 항균용 화장료 조성물을 제공한다.The present invention provides an antibacterial cosmetic composition containing the above-described peptide as an active ingredient.
본 발명의 PEP27 항균 펩타이드로부터 유래된 유사체 펩타이드인 서열번호 2 내지 4는 강한 항균 활성을 나타내면서 인간 유래 세포에 대하여 낮은 세포독성을 나타내므로, 본 발명의 펩타이드는 항균용 화장료 조성물의 유효성분으로 유용하게 사용될 수 있다.SEQ ID NOs: 2 to 4, which are analogue peptides derived from the PEP27 antibacterial peptide of the present invention, exhibit strong antibacterial activity and low cytotoxicity to human-derived cells, so the peptide of the present invention is useful as an active ingredient in antibacterial cosmetic compositions. can be used
화장료 조성물은 유효성분인 펩타이드 이외에 화장료 조성물에 통상적으로 이용되는 성분들이 포함할 수 있다. 예컨대 화장료 조성물은 항산화제, 안정화제, 용해화제, 비타민, 안료 및 향료와 같은 통상적인 보조제, 및 담체 중 적어도 하나를 더 포함할 수 있다.The cosmetic composition may contain ingredients commonly used in cosmetic compositions in addition to the peptide, which is an active ingredient. For example, the cosmetic composition may further include at least one of antioxidants, stabilizers, solubilizers, vitamins, conventional auxiliaries such as pigments and fragrances, and a carrier.
화장료 조성물은 유효성분인 펩타이드를 0.1 내지 50 중량%, 바람직하게는 1 내지 10 중량%의 양으로 포함할 수 있다.The cosmetic composition may contain 0.1 to 50% by weight of the peptide, which is an active ingredient, and preferably 1 to 10% by weight.
화장료 조성물은 당업계에서 통상적으로 제조되는 어떠한 제형으로도 제조될 수 있으며, 예를 들어, 용액, 현탁액, 유탁액, 페이스트, 겔, 크림, 로션, 파우더, 비누, 계면활성제-함유 클렌징, 오일, 분말 파운데이션, 유탁액 파운데이션, 왁스 파운데이션 및 스프레이 등으로 제형화될 수 있으나, 이에 제한되는 것은 아니다.Cosmetic compositions can be prepared in any formulation commonly prepared in the art, for example, solutions, suspensions, emulsions, pastes, gels, creams, lotions, powders, soaps, surfactant-containing cleansers, oils, It may be formulated as powder foundation, emulsion foundation, wax foundation, spray, etc., but is not limited thereto.
화장료 조성물의 제형이 페이스트, 크림 또는 겔인 경우에는 담체 성분으로서 동물성 유, 식물성 유, 왁스, 파라핀, 전분, 트라가칸타, 셀룰로오스 유도체, 폴리에틸렌 글리콜, 실리콘, 벤토나이트, 실리카, 탈크 또는 산화아연 등이 이용될 수 있다.When the cosmetic composition is in the form of a paste, cream or gel, animal oil, vegetable oil, wax, paraffin, starch, tragacantha, cellulose derivatives, polyethylene glycol, silicone, bentonite, silica, talc or zinc oxide are used as carrier ingredients. It can be.
화장료 조성물의 제형이 파우더 또는 스프레이인 경우에는 담체 성분으로서 락토스, 탈크, 실리카, 알루미늄 히드록시드, 칼슘 실리케이트 또는 폴리아미드 파우더가 이용될 수 있고, 특히 스프레이인 경우에는 추가적으로 클로로플루오로히드로카본, 프로판/부탄 또는 디메틸 에테르와 같은 추진체를 포함할 수 있다.When the formulation of the cosmetic composition is powder or spray, lactose, talc, silica, aluminum hydroxide, calcium silicate, or polyamide powder can be used as the carrier ingredient, and especially in the case of spray, chlorofluorohydrocarbon and propane may be used as carrier ingredients. /May contain propellants such as butane or dimethyl ether.
화장료 조성물의 제형이 용액 또는 유탁액인 경우에는 담체 성분으로서 용매, 용해화제 또는 유탁화제가 이용되고, 예컨대 물, 에탄올, 이소프로판올, 에틸 카보네이트, 에틸 아세테이트, 벤질 알코올, 벤질 벤조에이트, 프로필렌글리콜, 1,3-부틸글리콜 오일, 글리세롤 지방족 에스테르, 폴리에틸렌 글리콜 또는 소르비탄의 지방산 에스테르가 있다.When the formulation of the cosmetic composition is a solution or emulsion, a solvent, solubilizing agent, or emulsifying agent is used as a carrier component, such as water, ethanol, isopropanol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1 , 3-butyl glycol oil, glycerol aliphatic esters, polyethylene glycol or fatty acid esters of sorbitan.
화장료 조성물의 제형이 현탁액인 경우에는 담체 성분으로서 물, 에탄올 또는 프로필렌 글리콜과 같은 액상의 희석제, 에톡실화 이소스테아릴 알코올, 폴리옥시에틸렌 소르비톨 에스테르 및 폴리옥시에틸렌 소르비탄 에스테르와 같은 현탁제, 미소 결정성 셀룰로오스, 알루미늄 메타히드록시드, 벤토나이트, 아가 또는 트라가칸타 등이 이용될 수 있다.When the formulation of the cosmetic composition is a suspension, the carrier ingredients include water, a liquid diluent such as ethanol or propylene glycol, a suspending agent such as ethoxylated isostearyl alcohol, polyoxyethylene sorbitol ester, and polyoxyethylene sorbitan ester, and microcrystals. Cellulose, aluminum metahydroxide, bentonite, agar or tragacantha can be used.
화장료 조성물의 제형이 계면-활성제 함유 클렌징인 경우에는 담체 성분으로서 지방족 알코올 설페이트, 지방족 알코올 에테르 설페이트, 설포숙신산 모노에스테르, 이세티오네이트, 이미다졸리늄 유도체, 메틸타우레이트, 사르코시네이트, 지방산 아미드 에테르 설페이트, 알킬아미도베타인, 지방족 알코올, 지방산 글리세리드, 지방산 디에탄올아미드, 식물성 유, 라놀린 유도체 또는 에톡실화 글리세롤 지방산 에스테르 등이 이용될 수 있다.When the formulation of the cosmetic composition is a cleansing surfactant, the carrier ingredients include aliphatic alcohol sulfate, aliphatic alcohol ether sulfate, sulfosuccinic acid monoester, isethionate, imidazolinium derivative, methyl taurate, sarcosinate, and fatty acid amide. Ether sulfate, alkylamidobetaine, fatty alcohol, fatty acid glyceride, fatty acid diethanolamide, vegetable oil, lanolin derivative, or ethoxylated glycerol fatty acid ester can be used.
본 발명은 전술한 펩타이드를 유효성분으로 함유하는 항균용 식품 첨가제를 제공한다.The present invention provides an antibacterial food additive containing the above-mentioned peptide as an active ingredient.
본 발명의 PEP27 항균 펩타이드로부터 유래된 유사체 펩타이드인 서열번호 2 내지 4는 강한 항균 활성을 나타내면서 인간 유래 세포에 대하여 낮은 세포독성을 나타내므로, 본 발명의 펩타이드는 항균용 식품 첨가제의 유효성분으로 유용하게 사용될 수 있다.SEQ ID NOs. 2 to 4, which are analogue peptides derived from the PEP27 antibacterial peptide of the present invention, exhibit strong antibacterial activity and low cytotoxicity to human-derived cells, so the peptide of the present invention is useful as an active ingredient in an antibacterial food additive. can be used
본 발명의 펩타이드를 식품 첨가물로 사용하는 경우 상기 펩타이드를 그대로 첨가하거나 다른 식품 성분과 함께 사용될 수 있다. 유효성분의 혼합 양은 그의 사용 목적에 따라 적절하게 결정될 수 있다. 예를 들어, 본 발명의 펩타이드는 식품 원료에 대하여 15 중량부 이하, 바람직하게는 10 중량부 이하의 양으로 첨가될 수 있다. 그러나, 장기간의 섭취의 경우에는 상기 양은 상기 범위 이하일 수 있으며, 안정성 면에서 아무런 문제가 없기 때문에 유효성분은 상기 범위 이상의 양으로도 사용될 수 있다.When using the peptide of the present invention as a food additive, the peptide can be added as is or used together with other food ingredients. The mixing amount of the active ingredient can be appropriately determined depending on the purpose of use. For example, the peptide of the present invention may be added in an amount of 15 parts by weight or less, preferably 10 parts by weight or less, based on the food raw material. However, in case of long-term intake, the amount may be below the above range, and since there is no problem in terms of safety, the active ingredient may be used in an amount above the above range.
본 발명의 펩타이드를 첨가할 수 있는 식품은 육류, 소시지, 빵, 쵸코렛, 캔디류, 스넥류, 과자류, 피자, 라면, 기타 면류, 껌류, 아이스크림류를 포함한 낙농제품, 각종스프, 음료수, 차, 드링크제, 알코올 음료 또는 비타민 복합제일 수 있으며, 통상적인 의미에서의 식품을 모두 포함한다.Foods to which the peptide of the present invention can be added include meat, sausages, bread, chocolate, candy, snacks, confectionery, pizza, ramen, other noodles, gum, dairy products including ice cream, various soups, beverages, tea, drinks, etc. It may be an alcoholic beverage or a vitamin complex, and includes all foods in the conventional sense.
본 발명은 전술한 펩타이드를 유효성분으로 함유하는 항균용 사료 첨가제를 제공한다.The present invention provides an antibacterial feed additive containing the above-mentioned peptide as an active ingredient.
본 발명의 PEP27 항균 펩타이드로부터 유래된 유사체 펩타이드인 서열번호 2 내지 4는 강한 항균 활성을 나타내면서 인간 유래 세포에 대하여 낮은 세포독성을 나타내므로, 본 발명의 펩타이드는 항균용 사료 첨가제의 유효성분으로 유용하게 사용될 수 있다.SEQ ID NOs. 2 to 4, which are analogue peptides derived from the PEP27 antibacterial peptide of the present invention, exhibit strong antibacterial activity and low cytotoxicity to human-derived cells, so the peptide of the present invention is useful as an active ingredient in an antibacterial feed additive. can be used
본 발명의 펩타이드를 사료 첨가제로 사용하는 경우 기존의 항생제를 대체하고 유해한 식품 병원성균의 생장을 억제하여 동물체의 건강상태를 양호하게 하고, 가축의 증체량과 육질을 개선시키며, 산유량 및 면역력을 증가시키는 효과를 나타낼 수 있다. 본 발명의 펩타이드를 사료 첨가제로 사용하는 경우 사료는 발효사료, 배합사료, 펠렛 형태 및 사일레지 등의 형태로 제조될 수 있다.When the peptide of the present invention is used as a feed additive, it replaces existing antibiotics and inhibits the growth of harmful food pathogens to improve the health of the animal, improve the weight gain and meat quality of livestock, and increase milk production and immunity. It can show an effect. When the peptide of the present invention is used as a feed additive, the feed can be manufactured in the form of fermented feed, compounded feed, pellet form, and silage.
발효사료는 본 발명의 펩타이드 이외의 여러 가지 미생물군 또는 효소들을 첨가함으로서 유기물을 발효시켜 제조할 수 있으며, 배합사료는 여러 종류의 일반사료와 본 발명의 펩타이드를 혼합하여 제조할 수 있다. 펠렛 형태의 사료는 상기 배합사료 등을 펠렛기에서 열과 압력을 가하여 제조할 수 있으며, 사일레지는 청예사료를 미생물로 발효시킴으로써 제조할 수 있다. 습식발효사료는 음식물 쓰레기 등과 같은 유기물을 수집 및 운반하여 살균과정과 수분조절을 위한 부형제를 일정비율로 혼합한 후, 발효에 적당한 온도에서 24시간 이상 발효하여, 수분함량이 약 70%로 포함되도록 조절하여 제조할 수 있다. 발효건조사료는 습식발효사료를 건조과정을 추가로 거쳐 수분함량이 30% 내지 40% 정도 함유되도록 조절하여 제조할 수 있다.Fermented feed can be manufactured by fermenting organic matter by adding various microorganisms or enzymes other than the peptide of the present invention, and compounded feed can be manufactured by mixing various types of general feed with the peptide of the present invention. Pellet-type feed can be manufactured by applying heat and pressure to the above-mentioned mixed feed, etc. in a pellet machine, and silage can be manufactured by fermenting green feed with microorganisms. Wet fermented feed collects and transports organic matter such as food waste, mixes excipients for sterilization and moisture control at a certain ratio, and then ferments for more than 24 hours at a temperature suitable for fermentation to ensure that the moisture content is approximately 70%. It can be manufactured by adjusting it. Fermented dried feed can be manufactured by adjusting wet fermented feed to an additional drying process so that the moisture content is about 30% to 40%.
본 발명은 전술한 펩타이드를 유효성분으로 함유하는 항균용 방부 조성물, 항균용 생물 농약, 및 항균용 의약외품을 제공한다.The present invention provides an antibacterial preservative composition, an antibacterial biological pesticide, and an antibacterial quasi-drug containing the above-described peptide as an active ingredient.
본 발명의 PEP27 항균 펩타이드로부터 유래된 유사체 펩타이드인 서열번호 2 내지 4는 강한 항균 활성을 나타내면서 인간 유래 세포에 대하여 낮은 세포독성을 나타내므로, 본 발명의 펩타이드는 항균용 방부 조성물, 항균용 생물 농약, 및 항균용 의약외품의 유효성분으로 유용하게 사용될 수 있다.SEQ ID NOs: 2 to 4, which are analogue peptides derived from the PEP27 antibacterial peptide of the present invention, exhibit strong antibacterial activity and low cytotoxicity to human-derived cells, so the peptide of the present invention can be used in antibacterial preservative compositions, antibacterial biological pesticides, And it can be usefully used as an active ingredient in antibacterial quasi-drugs.
방부 조성물에는 식품의 방부제, 화장품 보존제 또는 의약품 보존제가 포함될 수 있다. 식품의 방부제, 화장품 보존제 및 의약품 보존제는 변질, 부패, 변색 및 화학변화를 방지하기 위해 사용되는 첨가물로서 살균제, 산화방지제가 이에 포함될 수 있고, 세균, 곰팡이, 효모 등 미생물의 증식을 억제하여 식품 및 의약품에서 부패미생물의 발육저지 또는 살균작용을 하는 등의 기능성 항생제도 포함될 수 있다. 이러한 방부 조성물의 이상적인 조건으로는 독성이 없어야 하며, 미량으로도 효과가 있어야 한다.Preservative compositions may include food preservatives, cosmetic preservatives, or pharmaceutical preservatives. Food preservatives, cosmetic preservatives, and pharmaceutical preservatives are additives used to prevent deterioration, decay, discoloration, and chemical changes. They may include disinfectants and antioxidants, and they inhibit the growth of microorganisms such as bacteria, mold, and yeast, thereby inhibiting the growth of microorganisms such as bacteria, mold, and yeast. In pharmaceuticals, functional antibiotics that inhibit the growth of putrefactive microorganisms or have a sterilizing effect may also be included. The ideal conditions for such a preservative composition are that it should be non-toxic and effective even in trace amounts.
본 발명의 조성물을 의약외품 조성물로 사용할 경우, 유효성분인 펩타이드를 그대로 첨가하거나 다른 의약외품 또는 의약외품 성분과 함께 사용할 수 있다.When using the composition of the present invention as a quasi-drug composition, the peptide, which is an active ingredient, can be added as is or used together with other quasi-drugs or quasi-drug ingredients.
의약외품 조성물은 소독청결제, 샤워폼, 가그린, 물티슈, 세제비누, 핸드워시, 가습기 충진제, 마스크, 연고제, 패치, 또는 필터 충진제일 수 있다.The quasi-drug composition may be a disinfectant cleaner, shower foam, garnish, wet tissue, detergent soap, hand wash, humidifier filler, mask, ointment, patch, or filter filler.
또한, 본 발명은 약학적으로 유효한 양의 상기 항균 펩타이드를 개체에 투여하는 단계를 포함하는 항균 방법을 제공한다.Additionally, the present invention provides an antibacterial method comprising administering a pharmaceutically effective amount of the antibacterial peptide to a subject.
개체는 인간을 제외한 포유류일 수 있으나, 이에 제한되지 않는다.The entity may be, but is not limited to, a mammal other than a human.
이하, 본 발명을 구체적으로 설명하기 위해 실시예를 들어 상세하게 설명한다. 그러나 아래 실시예는 본 발명에 대한 이해를 돕기 위해 예시의 목적으로만 제공된 것일 뿐 본 발명의 범주 및 범위가 그에 의해 제한되는 것은 아니다.Hereinafter, the present invention will be described in detail with reference to examples. However, the examples below are provided only for illustrative purposes to aid understanding of the present invention, and the scope and scope of the present invention are not limited thereto.
실시예Example
1. 펩타이드의 합성 및 분리 정제1. Synthesis and isolation purification of peptides
메리필드(Merrifield)의 액상 펩타이드 합성법(Merrifield, RB., J.Am. Chem. Soc., 85, 2149, 196)에 따라, 서열번호 1의 아미노산 서열로 기재된 모체 펩타이드인 PEP27의 아미노산 서열에서 2번째와 4번째 잔기를 트립토판 (tryptophan, W)으로 치환하여 펩타이드를 합성(서열번호 2)하였다. 서열번호 2의 아미노산 서열에서 11번째, 13번째 또는 19번째, 20번째, 22번째, 23번째, 26번째, 27번째 잔기를 트립토판으로 치환하여 펩타이드를 합성하였다 (표 1).According to Merrifield's liquid peptide synthesis method (Merrifield, RB., J.Am. Chem. Soc., 85, 2149, 196), 2 in the amino acid sequence of PEP27, the parent peptide shown in the amino acid sequence of SEQ ID NO: 1. The peptide was synthesized (SEQ ID NO: 2) by substituting the 4th and 4th residues with tryptophan (W). A peptide was synthesized by substituting the 11th, 13th, 19th, 20th, 22nd, 23rd, 26th, and 27th residues in the amino acid sequence of SEQ ID NO: 2 with tryptophan (Table 1).
구체적으로, 본 발명에서 설계한 펩타이드의 카르복실 말단이 NH2 형태인 펩타이드는 링크 아미드 MBHA-레진(Rink Amide MBHA-Resin)을 출발물질로 사용하였으며, 카르복실 말단이 OH 형태의 펩타이드는 Fmoc(9-fluorenylmethoxycarbonyl)-아미노산-Wang Resin을 출발물질로 사용하였다. Fmoc-아미노산의 커플링(coupling)에 의한 펩타이드 사슬(chain)의 연장은 DCC(N-hydroxybenzo trizole(HOBt)-dicyclo-hexycarbodiimide)법에 의해 실시하였다. 각 펩타이드의 아미노 말단의 Fmoc-아미노산을 커플링시킨 후, NMP(20% piperidine/N-methyl pyrolidone) 용액으로 Fmoc기를 제거하고, NMP 및 DCM(dichoromethane)으로 여러 번 씻어준 다음 질소 가스로 건조시켰다. 여기에 TFA(trifluoroacetic acid), 페놀(phenol), 씨이오아니졸(thioanisole), H2O 및 트리이소프로필실레인(triisopropylsilane)을 각각 85:5:5:2.5:2.5(v/v)의 비율로 혼합한 용액을 가하고 2~3시간 동안 반응시켜 보호기의 제거 및 레진으로부터 펩타이드를 분리시킨 후, 디에틸에테르(diethylether)로 펩타이드를 침전하여 이를 수득하였다. 수득한 크루드(crude) 펩타이드는 0.05% TFA가 포함된 아세토니트릴 농도구배(acetonitrile gradient)에서 정제형 역상(reverse phase, RP)-HPLC 컬럼(Delta Pak, C18300Å,15,19.0mm×30 cm, Waters, USA)을 이용하여 정제하였다. 합성 펩타이드를 6N 염산으로 110℃에서 가수분해한 후 잔사를 감압 농축하고, 0.02N 염산에 녹여서 아미노산 분석기(Hitachi 8500 A)로 아미노산 조성을 측정한 후, 펩타이드의 순도 및 분자량을 확인하기 위하여 MALDI 질량 분석법(Hill, et al., Rapid Commun. Mass Spectrometry, 5: 395, 1991)을 수행하였다.Specifically, Rink Amide MBHA-Resin was used as a starting material for the peptide designed in the present invention whose carboxyl terminus is in NH2 form, and for the peptide whose carboxyl terminus is in OH form, Fmoc (9 -fluorenylmethoxycarbonyl)-amino acid-Wang Resin was used as a starting material. Peptide chain extension by Fmoc-amino acid coupling was performed by the DCC (N-hydroxybenzo trizole (HOBt)-dicyclo-hexycarbodiimide) method. After coupling the Fmoc-amino acid at the amino terminus of each peptide, the Fmoc group was removed with NMP (20% piperidine/N-methyl pyrolidone) solution, washed several times with NMP and DCM (dichoromethane), and dried with nitrogen gas. . Here, trifluoroacetic acid (TFA), phenol, thioanisole, H 2 O, and triisopropylsilane were added at a ratio of 85:5:5:2.5:2.5 (v/v), respectively. The mixed solution was added and reacted for 2 to 3 hours to remove the protecting group and separate the peptide from the resin, and then precipitate the peptide with diethylether to obtain the peptide. The obtained crude peptide was purified on a purified reverse phase (RP)-HPLC column (Delta Pak, C18300Å, 15,19.0mm×30 cm, It was purified using Waters, USA). The synthetic peptide was hydrolyzed with 6N hydrochloric acid at 110°C, the residue was concentrated under reduced pressure, dissolved in 0.02N hydrochloric acid, and the amino acid composition was measured using an amino acid analyzer (Hitachi 8500 A), followed by MALDI mass spectrometry to confirm the purity and molecular weight of the peptide. (Hill, et al., Rapid Commun. Mass Spectrometry, 5: 395, 1991) was performed.
그 결과, 표 1의 서열번호 1 내지 서열번호 4의 아미노산 서열로 기재되는 펩타이드를 95% 이상의 순도로 합성하였고, 이의 분자량은 예상한 분자량과 동일한 분자량을 나타내는 것을 확인하였다. As a result, it was confirmed that the peptide described in the amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 4 in Table 1 was synthesized with a purity of 95% or more, and its molecular weight was the same as the expected molecular weight.
PEP27의 서열(서열번호 1)을 기준으로 신규 펩타이드(서열번호 2 내지 4)의 치환된 아미노산의 종류 및 치환된 위치를 표 2에 나타내었다.Table 2 shows the types of substituted amino acids and positions of substitution in the new peptides (SEQ ID NOs: 2 to 4) based on the sequence of PEP27 (SEQ ID NO: 1).
[공백: 아미노산 치환 없음][Blank: No amino acid substitution]
2. 항균 활성 측정2. Measurement of antibacterial activity
위 1의 방법으로 제조된 펩타이드들의 항균 활성을 평가하기 위하여, 균체가 분열되지 않는 펩타이드의 최소 농도인 생육 최소저해농도(Minimal Inhibitory Concentration, MIC) 값을 측정하였다.In order to evaluate the antibacterial activity of the peptides prepared by the method of 1 above, the Minimum Inhibitory Concentration (MIC) value, which is the minimum concentration of the peptide that does not cause cell division, was measured.
구체적으로, 하기 표 3에 기재된 균주를 구입하여, 각 균주에 적합한 조성의 배지에서 중간-로그 상(mid-log phase)까지 배양한 다음, 2×104 세포/100㎕의 농도로 희석하여 마이크로 적정 플레이트(Nunc, USA)에 준비하였다. 그런 다음 위 1에서 합성한 PEP27, PEP27-1, PEP27-2 또는 PEP27-5 펩타이드를 각 웰에 1/2배씩 계열 희석(serial dilution)하여 첨가한 후 37℃에서 18시간 동안 배양하였고, 마이크로 적정 플레이트 판독기(Merck Elisa reader, 독일)를 이용하여 600nm의 파장에서 흡광도를 측정하여 각 균주에 대한 MIC 값을 결정하였다. 모체 펩타이드인 PEP27를 대조군으로 사용하였고, 부포린 2 (buforin 2)와 멜리틴 (melittin)은 비교 펩타이드로 사용하였다.Specifically, the strains listed in Table 3 below were purchased, cultured to mid-log phase in a medium with a composition suitable for each strain, and then diluted to a concentration of 2×10 4 cells/100 ㎕ and micro It was prepared in a titration plate (Nunc, USA). Then, the PEP27, PEP27-1, PEP27-2, or PEP27-5 peptide synthesized in step 1 above was serially diluted 1/2-fold and added to each well, incubated at 37°C for 18 hours, and micro-titrated. The MIC value for each strain was determined by measuring absorbance at a wavelength of 600 nm using a plate reader (Merck Elisa reader, Germany). The parent peptide, PEP27, was used as a control, and buforin 2 and melittin were used as comparison peptides.
그 결과, 하기 표 4에서 나타난 바와 같이 PEP27-2 펩타이드는 대조군인 모체 펩타이드 PEP27 및 다른 신규 펩타이드들에 비해 그람 양성균, 그람음성균 및 항생제 내성균에 대해 현저히 우수한 항균활성을 나타내는 것을 확인하였다.As a result, as shown in Table 4 below, the PEP27-2 peptide was confirmed to exhibit significantly superior antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and antibiotic-resistant bacteria compared to the control parent peptide PEP27 and other new peptides.
3. 용혈 활성 측정3. Measurement of hemolytic activity
위 1의 방법으로 제조된 펩타이드들의 세포독성을 비교하기 위하여, 합성한 펩타이드들의 적혈구 용혈 활성을 측정하였다.In order to compare the cytotoxicity of the peptides prepared by the method of 1 above, the red blood cell hemolytic activity of the synthesized peptides was measured.
구체적으로, 쥐(Balb/c, 6주령, 수컷) 적혈구를 8%의 농도가 되도록 PBS(pH 7.0)로 희석하고, PEP27, PEP27-1, PEP27-2 또는 PEP27-5 펩타이드를 각각 3.13, 6.25, 12.5, 25.0, 50.0, 및 100.0 μM/웰의 농도로 처리하여, 37℃에서 1시간 동안 반응하였다. 그런 다음, 1,000 x g로 원심 분리하여 수득한 상등액 속에 포함된 헤모글로빈 량을 414 ㎚ 파장에서 흡광도를 측정하여 확인하였다. 세포 파괴 정도의 기준이 되는 대조군으로, 1% 트리톤 X-100(sigma, USA)을 처리하여 37℃에서 1시간 동안 반응한 후 수득한 상등액의 흡광도를 측정하였고, 상기 흡광도 값을 적혈구 용혈 활성 100%로 하여, 하기 수학식 1을 사용하여 각 펩타이드의 용혈 활성(hemolysis)을 계산하였다.Specifically, mouse (Balb/c, 6-week-old, male) red blood cells were diluted with PBS (pH 7.0) to a concentration of 8%, and PEP27, PEP27-1, PEP27-2, or PEP27-5 peptides were added at 3.13 and 6.25, respectively. , were treated at concentrations of 12.5, 25.0, 50.0, and 100.0 μM/well, and reacted at 37°C for 1 hour. Then, the amount of hemoglobin contained in the supernatant obtained by centrifugation at 1,000 x g was confirmed by measuring the absorbance at a wavelength of 414 nm. As a control that serves as a standard for the degree of cell destruction, the absorbance of the supernatant obtained after treatment with 1% Triton In percentage terms, the hemolysis activity (hemolysis) of each peptide was calculated using Equation 1 below.
[수학식 1][Equation 1]
적혈구 파괴능(%) = (흡광도 A-흡광도 B)/(흡광도 C-흡광도 B) × 100Red blood cell destruction ability (%) = (Absorbance A-Absorbance B)/(Absorbance C-Absorbance B) × 100
(상기 식에 있어서, 흡광도 A는 414㎚ 파장에서 측정한 각 펩타이드를 처리한 반응 용액의 흡광도를 나타내며; 흡광도 B는 414㎚ 파장에서 측정한 PBS를 처리한 반응 용액의 흡광도를 나타내며; 흡광도 C는 414㎚ 파장에서 측정한 1% 트리톤 X-100를 처리한 반응 용액의 흡광도를 나타낸다.)(In the above equation, absorbance A represents the absorbance of the reaction solution treated with each peptide measured at a wavelength of 414 nm; absorbance B represents the absorbance of the reaction solution treated with PBS measured at a wavelength of 414 nm; absorbance C is Shows the absorbance of the reaction solution treated with 1% Triton X-100 measured at a wavelength of 414 nm.)
그 결과, 하기 표 5와 같이 모체 펩타이드인 PEP27 펩타이드는 100μM 농도를 처리하였을 때 쥐 적혈구에 대하여 3.58%의 용혈 작용만 나타나는 것을 확인한 것에 비해, PEP27-2 펩타이드는 100 μM 농도에서도 적혈구에 대한 75.8% 용혈 작용이 유발되는 것으로 확인하여 독성이 증가됨을 확인하였다. 그러나, 이는 활성 증가에 따른 독성도 증가 된 것이며, 항균 활성의 범위 내에서는 독성이 없음을 확인하였다.As a result, as shown in Table 5 below, it was confirmed that the parent peptide, PEP27 peptide, showed only a 3.58% hemolytic effect on mouse red blood cells when treated at a concentration of 100 μM, whereas the PEP27-2 peptide showed a 75.8% hemolytic effect on red blood cells even at a concentration of 100 μM. It was confirmed that hemolysis was induced and that toxicity was increased. However, this indicates increased toxicity due to increased activity, and it was confirmed that there was no toxicity within the range of antibacterial activity.
100 μMPeptide concentration
100 μM
50 μMPeptide concentration
50 μM
25 μMPeptide concentration
25 μM
12.5 μMPeptide concentration
12.5 μM
6.25 μMPeptide concentration
6.25 μM
3.13 μMPeptide concentration
3.13 μM
(서열번호 1)PEP27
(SEQ ID NO: 1)
4. 정상 세포주에서 세포 독성 확인4. Confirmation of cytotoxicity in normal cell lines
위 1의 방법으로 제조된 펩타이드들의 정상 세포주에서의 세포 독성을 확인하기 위해, 사람의 각질 형성 세포주(HaCaT cell line, Dr. NE. Fusenig, Heidelberg, Germany)을 이용하여 독성을 측정하였다.To confirm the cytotoxicity of the peptides prepared by the method of 1 above in normal cell lines, toxicity was measured using a human keratinocyte cell line (HaCaT cell line, Dr. NE. Fusenig, Heidelberg, Germany).
구체적으로, 10% FBS(Fetal Bovine Serum)가 함유된 DMEM 배지에서 배양된 HaCaT 세포를 2×105 세포/웰로 마이크로 적정 플레이트에 분주하고 24시간 배양한 후, PEP27, PEP27-1, PEP27-2 또는 PEP27-5 펩타이드를 펩타이드를 각각 3.13, 6.25, 12.5, 25.0, 50.0 또는 100.0 μM/웰의 농도로 처리하여, 24시간 동안 5% CO2 인큐베이터에서 반응시켰다. 24시간 후, 인산 완충액 생리식염수(phosphate buffered saline; PBS)에 0.5 mg/㎖ MTT(Thiazolyl Blue Tetrazolium Bromide)를 녹인 반응 용액 100 ㎕를 각 웰에 넣고 4시간 동안 반응시켰다. 그런 다음, 상층액을 제거하고, 200 ㎕의 DMSO(dimethyl sulfoxide)를 넣어 형성된 MTT 크리스탈을 녹인 후, 560 nm에서 파장을 확인하여 세포 생존능을 확인하였다.Specifically, HaCaT cells cultured in DMEM medium containing 10% FBS (Fetal Bovine Serum) were distributed at 2 × 10 5 cells/well on a micro titration plate and cultured for 24 hours, and then PEP27, PEP27-1, and PEP27-2 Alternatively, PEP27-5 peptide was treated at a concentration of 3.13, 6.25, 12.5, 25.0, 50.0, or 100.0 μM/well, respectively, and reacted in a 5% CO 2 incubator for 24 hours. 24 hours later, 100 ㎕ of a reaction solution containing 0.5 mg/ml MTT (Thiazolyl Blue Tetrazolium Bromide) dissolved in phosphate buffered saline (PBS) was added to each well and reacted for 4 hours. Then, the supernatant was removed, 200 μl of DMSO (dimethyl sulfoxide) was added to dissolve the formed MTT crystals, and cell viability was confirmed by checking the wavelength at 560 nm.
그 결과, 하기 표 6과 같이 100 μM의 모체 PEP27 펩타이드를 처리했을 때, HaCaT 세포는 100%의 세포 생존력을 나타내어 세포 독성이 없음을 확인하였다. 이에 반해, PEP27-2는 펩타이드는 100 μM 농도에서도 세포 생존력이 각각 69.3%로 확인하였다. 이는 용혈 현상보다 세포 독성이 낮게 나옴을 확인하여, 본 발명의 항균 펩타이드가 모체 펩타이드에 비해 항균 활성이 증가되었고, 항균 활성 범위 내에서는 세포 독성이 없음을 확인하였다.As a result, when treated with 100 μM of the parent PEP27 peptide, as shown in Table 6 below, HaCaT cells showed 100% cell viability, confirming that there was no cytotoxicity. On the other hand, the cell viability of PEP27-2 peptide was confirmed to be 69.3% even at a concentration of 100 μM. This confirmed that the cytotoxicity was lower than the hemolysis phenomenon, and it was confirmed that the antibacterial peptide of the present invention had increased antibacterial activity compared to the parent peptide and had no cytotoxicity within the range of antibacterial activity.
100 μMPeptide concentration
100 μM
50 μMPeptide concentration
50 μM
25 μMPeptide concentration
25 μM
12.5 μMPeptide concentration
12.5 μM
6.25 μMPeptide concentration
6.25 μM
3.13 μMPeptide concentration
3.13 μM
(서열번호 1)PEP27
(SEQ ID NO: 1)
5. 원이색법 스펙트럼 측정5. Circular dichroism spectrum measurement
위 1의 방법으로 제조된 펩타이드를 이용하여 2차 구조인 α-나선형 구조를 유도하는지 확인하고자 원이색법(circular dichroism) 방법을 이용하여 측정하였다. In order to confirm whether the peptide prepared by the method of 1 above induces an α-helical structure, which is a secondary structure, it was measured using the circular dichroism method.
구체적으로, 10mM PBS(pH 7.4), PE/PG (L-α-Phosphatidylethanolamine/L-α-Phosphatidyl-DL-glycerol; 7/3, w/w) 또는 PC/CH/SM (L-α-phosphatidylcholine/cholesterol/sphingomyelin); 1/1/1, w/w/w)로 구성된 1 mM의 큰 단일 라멜라 소포(Large unilamellar vesicles, LUV)의 현탁액에 PEP27, PEP27-1, PEP27-2 또는 PEP27-5 펩타이드를 40 μM로 0.1 cm 길이(path-length)의 셀에 가한 후, jasco 810 분광광도계(spectrophotometer)에 온도를 25℃로 고정하여 원이색법 스펙트럼을 측정하였다. 원이색법 스펙트럼을 위한 α-나선형 구조 계산식은 하기 수학식 2를 사용하였다. Specifically, 10mM PBS (pH 7.4), PE/PG (L-α-Phosphatidylethanolamine/L-α-Phosphatidyl-DL-glycerol; 7/3, w/w) or PC/CH/SM (L-α-phosphatidylcholine /cholesterol/sphingomyelin); 1/1/1, w/w/w) of PEP27, PEP27-1, PEP27-2, or PEP27-5 peptides at 40 μM in 0.1 μM suspension of large unilamellar vesicles (LUV). After applying it to a cm-length (path-length) cell, the temperature was fixed at 25°C in a jasco 810 spectrophotometer and the circular dichroism spectrum was measured. The α-helical structure calculation formula for the circular dichroism spectrum was used as Equation 2 below.
[수학식 2][Equation 2]
(위 수학식 2의 θobs는 신호의 밀리도(milidegrees)를 나타내며, l은 셀 크기(cm)의 광학 길이(optical path-length)를 나타내고, c는 첨가한 펩타이드의 농도(mol/L)를 나타낸다)(θ obs in Equation 2 above represents the millidegrees of the signal, l represents the optical path-length of the cell size (cm), and c represents the concentration of the added peptide (mol/L) indicates)
결과, 10 mM PBS 용액에 펩타이드를 첨가하였을 때에는 구조를 형성하지 않은 반면, PE/PG(7/3) 또는 PC/CH/SM(1/1/1)로 구성된 LUV 용액에 펩타이드를 첨가하였을 때에는 정도의 차이를 보이지만 모든 펩타이드에서 2차 구조인 α-나선형 구조를 형성하는 것을 확인하였다. 이의 결과를 통해, 본 발명의 항균 펩타이드는 미생물인 박테리아 막과 유사한 PE/PG(7/3)와 진핵세포의 막과 유사한 PC/CH/SM(1/1/1)용액 상에서 α-나선형 구조를 형성하는 것을 확인하였다 (도 1).As a result, when the peptide was added to a 10 mM PBS solution, no structure was formed, whereas when the peptide was added to a LUV solution composed of PE/PG (7/3) or PC/CH/SM (1/1/1), it did not form a structure. Although there were differences in degree, it was confirmed that all peptides formed an α-helical structure, which is a secondary structure. As a result, the antibacterial peptide of the present invention has an α-helical structure in PE/PG (7/3), which is similar to the membrane of microbial bacteria, and PC/CH/SM (1/1/1), which is similar to the membrane of eukaryotic cells. was confirmed to form (Figure 1).
6. 유세포분석기(Flow cytometry) 측정6. Flow cytometry measurement
위 1의 방법으로 제조된 펩타이드가 박테리아 막에 작용하는지 여부를 확인하기 위하여, 모체 펩타이드보다 항균활성이 우수한 PEP27-2 펩타이드를 유세포분석기(Flow cytometry)를 이용하여 분석하였다.In order to confirm whether the peptide prepared by method 1 above acts on the bacterial membrane, the PEP27-2 peptide, which has better antibacterial activity than the parent peptide, was analyzed using flow cytometry.
구체적으로, 모체 PEP27 펩타이드 또는 PEP27-2 펩타이드의 최소저해농도(MIC) 값을 대장균에 처리한 후 1시간 동안 37℃에서 반응시켰다. 그 후, 원심분리기(10,000rpm)를 이용해 상층액을 제거한 다음 10 ㎍/㎖ 농도의 프로피디움 요오드화물(Propidium iodide, PI)로 4℃에서 30분간 염색하였다. 그런 다음, 결합하지 않은 프로피디움 요오드화물을 원심분리기를 이용해 제거하고 생리식염수(PBS) 1 ㎖를 첨가하여 세포의 뭉침 현상을 제거한 후, Bechman 유세포분석기를 이용하여 박테리아 막에 대한 펩타이드의 영향을 확인하였다.Specifically, the minimum inhibitory concentration (MIC) value of the parent PEP27 peptide or PEP27-2 peptide was treated with E. coli and then reacted at 37°C for 1 hour. Afterwards, the supernatant was removed using a centrifuge (10,000 rpm), and then stained with propidium iodide (PI) at a concentration of 10 μg/ml for 30 minutes at 4°C. Then, unbound propidium iodide was removed using a centrifuge, 1 ml of physiological saline (PBS) was added to remove cell aggregation, and the effect of the peptide on the bacterial membrane was confirmed using a Bechman flow cytometer. did.
그 결과, 대장균 세포에서 PEP27 (19.9%) 보다 PEP27-2 (21.84%) 펩타이드가 막 파괴능이 조금 증가함을 확인하였다. 그러나, 상기 펩타이드들은 세포 투과성 펩타이드인 부포린 2와 같이 박테리아 막을 손상시키는 능력이 없음을 확인했다. 이는 PEP27과 PEP27-2가 대장균 막 파괴 없이 대장균을 사멸시킴을 확인했다. 대조 펩타이드 중 세균의 세포막을 파괴하는 멜리틴은 대장균(91.6%)에 대해서 세포막 파괴능을 확인하여 멜리틴과는 다른 기작을 가짐을 확인하였다.As a result, it was confirmed that the membrane destruction ability of PEP27-2 (21.84%) peptide was slightly increased compared to PEP27 (19.9%) in E. coli cells. However, it was confirmed that the above peptides do not have the ability to damage bacterial membranes like Buforin 2, a cell-penetrating peptide. This confirmed that PEP27 and PEP27-2 kill E. coli without destroying the E. coli membrane. Among the control peptides, melittin, which destroys bacterial cell membranes, was confirmed to have a cell membrane-destroying ability against E. coli (91.6%), confirming that it has a different mechanism from melittin.
7. 항균 펩타이드와 DNA의 결합 유무 분석7. Analysis of the presence or absence of binding between antibacterial peptides and DNA
위 1의 방법으로 제조된 합성 펩타이드가 항균활성을 나타내는 기작이 무엇인지 구체적으로 확인하기 위하여, PEP27, PEP27-1, PEP27-2 또는 PEP27-5 합성 펩타이드가 박테리아 내부 물질인 DNA와 결합하는지 여부를 전기영동을 통해 확인하였다.In order to specifically confirm the mechanism by which the synthetic peptide prepared by method 1 above exhibits antibacterial activity, it was tested whether the PEP27, PEP27-1, PEP27-2 or PEP27-5 synthetic peptide binds to DNA, an internal material of bacteria. This was confirmed through electrophoresis.
구체적으로, 300 ng의 플라스미드 DNA(pRSETB)를 펩타이드와 비율별(펩타이드/DNA 비율은 각각 DNA 단독, 0.25:1, 0.5:1, 1:1, 1.5:1, 2:1, 3:1, 4:1로 실시)로 37℃에서 10분 동안 반응시킨 후, 1% 아가로스 겔에 전기영동을 수행하여 브로민화 에티듐(Ethidium bromide, EtBr)으로 염색하고 UV로 확인하였다.Specifically, 300 ng of plasmid DNA (pRSETB) was mixed with peptide in different ratios (peptide/DNA ratios were DNA alone, 0.25:1, 0.5:1, 1:1, 1.5:1, 2:1, 3:1, respectively). After reacting at 37°C for 10 minutes (performed at 4:1 ratio), electrophoresis was performed on a 1% agarose gel, stained with ethidium bromide (EtBr), and confirmed by UV.
그 결과, 도 3과 같이 비교 펩타이드인 멜리틴은 DNA와 어떠한 결합도 하지 않았으며 PEP27, PEP27-2 및 대조펩타이드인 부포린 2는 정도의 차이는 있지만 모두 DNA와 결합하는 결과를 보여주었다(도 3). 이때 PEP27보다 PEP27-2 펩타이드가 DNA 결합능이 더 높음을 확인하였다. 상기 결과를 통해, PEP27-2 펩타이드가 일부 아미노산 잔기의 치환으로 인해, 모체 펩타이드인 PEP27 에 비해 PEP27-2 펩타이드가 박테리아 내부 물질인 DNA와 결합능이 높아 더 높은 항균활성을 나타내는 것임을 확인할 수 있었다.As a result, as shown in Figure 3, melittin, a comparative peptide, did not bind to DNA at all, and PEP27, PEP27-2, and Buforin 2, a control peptide, all showed binding to DNA, although there were differences in degree (Figure 3). At this time, it was confirmed that PEP27-2 peptide had higher DNA binding ability than PEP27. Through the above results, it was confirmed that the PEP27-2 peptide exhibits higher antibacterial activity due to the substitution of some amino acid residues due to the higher binding ability of the PEP27-2 peptide to DNA, an internal material of bacteria, compared to the parent peptide, PEP27.
8. 주사전자현미경(Scanning Electron Microscope, SEM) 분석8. Scanning Electron Microscope (SEM) analysis
위 1의 방법으로 제조된 합성 펩타이드가 세균의 세포막에 손상을 주는지 확인하기 위해서 주사전자현미경을 통해 확인하였다.In order to confirm whether the synthetic peptide prepared by method 1 above damages the bacterial cell membrane, it was confirmed using a scanning electron microscope.
구체적으로, 대장균과 스타필로코커스 아우레우스 세포를 OD600에서 0.2의 농도로 PBS에 현탁시킨 후, PEP27-2 펩타이드를 최소저해농도(MIC)로 처리하고 37℃에서 1 시간 동안 반응시켰다. 대조군은 펩타이드가 없는 균주를 사용하였다. 배양 후, 세포를 회수하고, 2.5% 글루타르알데하이드로 4℃에서 18시간 처리한 후 PBS 완충용액으로 2회 세척하였다. 고정된 세포를 100% 에탄올 및 희석된 에탄올(50%, 70%, 90% 및 100%)을 이용하여 순차적으로 10분 동안 탈수시킨 후 표본을 건조시키고 백금으로 코팅한 후 저진공 주사형 전자현미경을 사용하여 확인하였다.Specifically, E. coli and Staphylococcus aureus cells were suspended in PBS at a concentration of 0.2 at OD 600 , then treated with PEP27-2 peptide at the minimum inhibitory concentration (MIC) and reacted at 37°C for 1 hour. As a control group, a strain without peptide was used. After culturing, the cells were recovered, treated with 2.5% glutaraldehyde at 4°C for 18 hours, and then washed twice with PBS buffer solution. The fixed cells were sequentially dehydrated using 100% ethanol and diluted ethanol (50%, 70%, 90%, and 100%) for 10 minutes, then the specimen was dried, coated with platinum, and subjected to low vacuum scanning electron microscopy. It was confirmed using .
그 결과, 도 4와 같이 처리되지 않은 대조군 세포는 밝고 매끄러운 표면을 가지는 반면, 비교 대조군으로 사용한 막파괴 펩타이드인 멜리틴을 처리한 세포는 상당한 막 손상이 일어났음을 확인하였다. 펩타이드에 노출된 세포 표면은 구멍이 생기면서 물집 모양의 손상을 입은 모양이 관찰되었고, 일부 경우에는 세포질 내 내용물의 누출이 관찰되었다. 그러나, PEP27-2 펩타이드를 처리한 세포는 대조군과 거의 동일하게 세포 손상을 거의 확인할 수 없었다. 이는 세포막 파괴 없이 박테리아를 사멸시킴을 확인하였다. As a result, it was confirmed that while the untreated control cells as shown in Figure 4 had a bright and smooth surface, the cells treated with melittin, a membrane-destroying peptide used as a comparative control, had significant membrane damage. The cell surface exposed to the peptide was observed to have blister-like damage with holes forming, and in some cases, leakage of cytoplasmic contents was observed. However, cells treated with PEP27-2 peptide showed almost no cell damage, almost the same as the control group. It was confirmed that this kills bacteria without destroying the cell membrane.
9. 펩타이드의 세포 흡수9. Cellular uptake of peptides
위 1의 방법으로 제조된 합성 펩타이드가 세포에 침투하는 능력을 위상차 현미경을 통해 확인하였다. 구체적으로, 사람의 각질 형성 세포주(HaCaT 세포)를 폴리라이신 코팅 커버 슬립 (SPL Life Sciences, 경기도, 대한민국)이 포함된 6 웰 플레이트에 2 x 105 세포/웰로 분주하고 24시간 배양한 후, 플로오레세인이소티오시아네이트 (FITC) 표지된 PEP27-2 (FITC-PEP27-2)를 5μM의 농도로 처리하여 1 시간 동안 5% CO2 인큐베이터에서 배양하였다. 1시간 반응 후 세포의 핵을 Hoechst 33342 핵산 염색액 (Invitrogen, Carlsbad, CA, USA; 8 μM)을 처리하여 10 분 동안 염색하였다. PBS로 3 회 세척 한 후, 위상차 현미경 (EVOS ™ FL Auto 2 Imaging System, Thermo Fisher Scientific)을 사용하여 세포 내 형광을 이미지화하였다.The ability of the synthetic peptide prepared by method 1 above to penetrate cells was confirmed through phase contrast microscopy. Specifically, human keratinocyte cell line (HaCaT cells) was dispensed at 2 Orecein isothiocyanate (FITC)-labeled PEP27-2 (FITC-PEP27-2) was treated at a concentration of 5 μM and cultured in a 5% CO 2 incubator for 1 hour. After 1 hour of reaction, the nuclei of the cells were stained with Hoechst 33342 nucleic acid stain (Invitrogen, Carlsbad, CA, USA; 8 μM) for 10 minutes. After washing with PBS three times, intracellular fluorescence was imaged using a phase contrast microscope (EVOS™ FL Auto 2 Imaging System, Thermo Fisher Scientific).
그 결과, 도 5와 같이 FITC-PEP27-2는 HaCaT 세포에 의해 명확하게 흡수되고 세포 내 녹색 형광으로 고르게 분포되어 세포질과 핵 모두에 나타났다. PEP27-2의 핵 국소화를 확인하기 위해 FITC 표지된 펩티드로 처리된 세포의 핵을 핵 염색 염료 Hoechst 33342 로 대조 염색한 결과, PEP27-2는 HaCaT 세포의 세포질과 핵 모두에 분포하는 것을 확인했다. HaCaT 세포에서 FITC-PEP27-2는 세포질과 핵 내로 세포흡수한 것을 확인하였다. 대조 펩타이드인 TAT (GRKKRRQRRRPQ)는 11개 아미노산 잔기를 가진 고도로 양전하를 띠는 세포 침투성 펩타이드로 PEP27-2 펩타이드와 같이 HaCaT 세포에서 세포질과 핵내로 흡수한 것으로 확인되었다.As a result, as shown in Figure 5, FITC-PEP27-2 was clearly absorbed by HaCaT cells and evenly distributed with intracellular green fluorescence, appearing in both the cytoplasm and nucleus. To confirm the nuclear localization of PEP27-2, the nuclei of cells treated with FITC-labeled peptide were counterstained with the nuclear stain Hoechst 33342, and it was confirmed that PEP27-2 was distributed in both the cytoplasm and nucleus of HaCaT cells. In HaCaT cells, FITC-PEP27-2 was confirmed to be absorbed into the cytoplasm and nucleus. The control peptide, TAT (GRKKRRQRRRPQ), is a highly positively charged cell-penetrating peptide with 11 amino acid residues and, like the PEP27-2 peptide, was confirmed to be absorbed into the cytoplasm and nucleus in HaCaT cells.
10. 항생물막 활성 측정10. Measurement of antibiofilm activity
위 1의 방법으로 제조된 펩타이드들 중 항균활성이 가장 우수한 펩타이드인 PEP27-2의 생물막 억제 농도값을 측정하였다.The biofilm inhibition concentration value of PEP27-2, the peptide with the best antibacterial activity among the peptides prepared by method 1 above, was measured.
구체적으로, 상기 표 3에 기재된 균주 중 스타필로코커스 아우레우스, 대장균, 슈도모나스 에루지노사 균을 각 배지에서 중간-로그 상(mid-log phase)까지 배양한 다음, 5×104 세포/100 ㎕의 균체 농도로 희석하여 마이크로 플레이트(SPL)에 접종하였다. 그런 다음, Pse-T2 펩타이드를 각 웰에 1/10배씩 10 mM PBS 용액(pH 7.2)으로 희석하여 10 ㎕ 첨가한 후 37℃에서 24시간 배양하였다. 상층액을 완벽히 제거한 후 100% 메탄올로 15분간 고정시키고 크리스탈 바이올렛 염색용액으로 1시간 염색시킨 후, 3번 세척한 뒤 95% 에탄올로 용해하여 마이크로 적정 플레이드 판독기를 이용하여 595 nm의 파장에서 흡광도를 측정하여 각 균주에 대한 생물막 최소억제 농도값을 확인하였다.Specifically, among the strains listed in Table 3, Staphylococcus aureus, Escherichia coli, and Pseudomonas aeruginosa were cultured in each medium to mid-log phase, and then cultured at 5×10 4 cells/100. The cells were diluted to a concentration of ㎕ and inoculated into a microplate (SPL). Then, 10 ㎕ of Pse-T2 peptide diluted 1/10 times with 10 mM PBS solution (pH 7.2) was added to each well and incubated at 37°C for 24 hours. After completely removing the supernatant, it was fixed with 100% methanol for 15 minutes, stained with crystal violet staining solution for 1 hour, washed three times, dissolved in 95% ethanol, and measured for absorbance at a wavelength of 595 nm using a micro titration plate reader. was measured to confirm the minimum biofilm inhibitory concentration value for each strain.
그 결과, 하기 표 7에 개시된 바와 같이 모든 균주에서 PEP27-2 펩타이드가 대조 펩타이드인 멜리틴과 거의 유사한 강한 생물막 저해활성을 나타내는 것을 확인하였다.As a result, as shown in Table 7 below, it was confirmed that in all strains, the PEP27-2 peptide exhibited strong biofilm inhibitory activity almost similar to that of the control peptide, melittin.
11. 항균 펩타이드와 항생제의 항균 활성 확인11. Confirmation of antibacterial activity of antibacterial peptides and antibiotics
위 1의 방법으로 제조된 펩타이드들 중 항균 활성이 가장 우수한 펩타이드인 PEP27-2의 항균 활성을 기존 항생제와 비교하기 위해서, 동일한 그람 양성균 (스타필로코코스 아우레우스) 및 그람 음성균 (슈토모나스 에로우지노사) 균주에 대하여 항생제이 나타내는 MIC 농도를 확인하였다. 구체적으로, 상기 실시예 2와 동일한 방법으로 대상 균주를 준비하고, 항생제인 메로페넴 (Meropenem), 세프타지딤 (Ceftazidime), 세프트리악스 (Ceftriaxone) 또는 반코마이신(Vancomycin)을 각각 처리하여 항생제의 MIC를 확인하였다.In order to compare the antibacterial activity of PEP27-2, which is the peptide with the best antibacterial activity among the peptides prepared by the method of 1 above, with existing antibiotics, the same Gram-positive bacteria (Staphylococcus aureus) and Gram-negative bacteria (Pseudomonas aerosi) were used. The MIC concentration of the antibiotic for the Nosa) strain was confirmed. Specifically, the target strain was prepared in the same manner as in Example 2, and treated with the antibiotics Meropenem, Ceftazidime, Ceftriaxone, or Vancomycin, respectively, to determine the MIC of the antibiotic. was confirmed.
그 결과, 하기 표 8과 같이 11 개 균주에 대한 PEP27-2의 MIC는 2 ~ 4μM 범위의 활성을 확인하였다. 메로페넴 (Meropenem), 세프타지딤 (Ceftazidime), 세프트리악손 (Ceftriaxone) 및 반코마이신(Vancomycin)의 MIC는 0.25 ~ 512μM 범위의 항균 활성을 나타냄을 확인하였다 (표 8).As a result, as shown in Table 8 below, the MIC of PEP27-2 for 11 strains was confirmed to be in the range of 2 to 4 μM. The MICs of Meropenem, Ceftazidime, Ceftriaxone, and Vancomycin were confirmed to exhibit antibacterial activity in the range of 0.25 to 512 μM (Table 8).
12. 항균 펩타이드 및 항생제 병용 처리시 상승 효과 확인12. Confirmation of synergistic effect when combined treatment with antibacterial peptides and antibiotics
각 혼합액에 대하여 결정한 MIC 값을 이용하여, 균주에 대한 항균 활성에서 펩타이드와 항생제의 상승효과를 평가하였다. 평가를 위하여, 분할 저해 농도 (Fractional inhibitory concentration; FIC) 분석은 체커보드 분석법 (checkerboard assay)을 사용하였다. Using the MIC values determined for each mixture, the synergistic effect of peptides and antibiotics in antibacterial activity against strains was evaluated. For evaluation, fractional inhibitory concentration (FIC) analysis was performed using a checkerboard assay.
구체적으로, 100 ㎕의 박테리아 (5 x 105 CFU / mL)를 96 웰 플레이트의 각 웰에 접종한 후 MIC 값부터 희석한 펩타이드 용액 (2:1 단계적으로 희석된 용액)을 각 웰에 50 ㎕씩 첨가하였다. 그 후 항생제 용액을 희석하여 각 웰에 50 ㎕씩 첨가하고 상반된 조건으로도 동일하게 실시하여 각 혼합액의 MIC 값을 결정하였다. FIC 값은 다음과 같이 계산되었다: FIC 지수 = FIC (A) + FIC (B) = [A]/MIC (A) + [B]/MIC (B), 여기서 [A]는 PEP27-2 항생제가 있는 경우 MIC (A)는 PEP27-2 단독의 MIC이고 FIC (A)는 PEP27-2의 FIC 이다. [B], MIC (B) 및 FIC (B)는 항생제에 해당하는 값이다. 계산한 FIC 값에 따라 다음과 같이 평가하였다: <0.5, 상승 효과 (Synergy effect); 0.5~4, 무차별(Indifference); >4.0, 길항작용 (Antagonism).Specifically, 100 ㎕ of bacteria ( 5 were added one at a time. Afterwards, the antibiotic solution was diluted and 50 μl was added to each well, and the same procedure was performed under different conditions to determine the MIC value of each mixed solution. The FIC value was calculated as follows: FIC index = FIC (A) + FIC (B) = [A]/MIC (A) + [B]/MIC (B), where [A] is the PEP27-2 antibiotic. If present, MIC(A) is the MIC of PEP27-2 alone and FIC(A) is the FIC of PEP27-2. [B], MIC (B) and FIC (B) are values corresponding to antibiotics. According to the calculated FIC value, the following evaluations were made: <0.5, Synergy effect; 0.5~4, Indifference; >4.0, Antagonism.
그 결과, 펩타이드와 항생제의 어떤 조합도 길항작용은 없음을 확인하였다. 그 결과, 하기 표 9에서 나타난 바와 같이 스타필로코코스 아우레우스 CCARM 3089 및 CCARM 3090에서 PEP27-2의 0.25x MIC와 조합하여 메로페넴, 세프타지딤 또는 세프트리악손에 대해 상승 효과를 확인하였다. 또한, 슈도모나스 에로우지노사 4891 및 스타필로코코스 아우레우스 MW2의 경우 PEP27-2의 0.25x MIC와 조합시 각각 메로페넴 또는 세프트리악손에서만 상승효과를 확인하였다 (표 9 및 표10). 하기 표 9과 표10에서 나타난 바와 같이 소수의 표준 균주와 비교하여 대부분의 항생제 내성 균주에서 상승 작용 활성을 확인하였다.As a result, it was confirmed that no combination of peptide and antibiotic had an antagonistic effect. As a result, as shown in Table 9 below, a synergistic effect was confirmed for meropenem, ceftazidime or ceftriaxone in combination with 0.25x MIC of PEP27-2 in Staphylococcus aureus CCARM 3089 and CCARM 3090. In addition, in the case of Pseudomonas aeroginosa 4891 and Staphylococcus aureus MW2, a synergistic effect was confirmed only with meropenem or ceftriaxone, respectively, when combined with 0.25x MIC of PEP27-2 (Tables 9 and 10). As shown in Tables 9 and 10 below, synergistic activity was confirmed in most antibiotic-resistant strains compared to a small number of standard strains.
13. 다제 내성 스타필로코코스 아우레우스에 감염된 농양의 치유능 측정13. Measurement of healing ability of abscesses infected with multidrug-resistant Staphylococcus aureus
위 1의 방법으로 제조된 펩타이드들 중 항균활성이 가장 우수한 펩타이드인 Pse-T2의 효능을 마우스 모델을 사용하여 in vivo에서 평가했다.The efficacy of Pse-T2, the peptide with the best antibacterial activity among the peptides prepared by the method of 1 above, was evaluated in vivo using a mouse model.
구체적으로, 6-7 주령의 BALB/c 마우스 뒷면(등쪽)의 표피에 GFP 유전자가 삽입된 스타필로코코스 아우레우스 MW2 (S. aureus MW2-GFP, 1×109 CFU/100㎕ PBS)을 감염시켰다. 감염 2시간 후 PEP27-2 (0.2 mg/kg, 50 ㎕) 단독, 세프트리악손 (0.2 mg/kg, 50㎕) 단독 또는 펩타이드와 항생제의 병용처리 (0.05 mg/kg PEP27-2 +0.1 mg/kg 세프트리악손, 50㎕)를 주입하였다. 대조군 마우스에는 펩타이드가 없는 동량의 PBS(20 ㎕)를 주입하였다. 처리 후 1일, 2일, 3일, 4일, 5일, 및 7일에 농양의 형태를 촬영하고 농양 및 주변 조직을 회수하였다. 농양 조직은 조직 분쇄기를 사용하여 멸균된 PBS 500 ㎕에서 균질화 시켰다. 한천 플레이트에 상기 균질화물의 연속 희석액을 플레이팅하여 24시간 동안 배양하여 스타필로코코스 아우레우스 MW2 균주를 정량화하였다.Specifically, Staphylococcus aureus MW2 ( S. aureus MW2-GFP, 1×10 9 CFU/100㎕ PBS) with the GFP gene inserted into the epidermis of the back (dorsal) of 6-7 week old BALB/c mice. infected. 2 hours after infection, PEP27-2 (0.2 mg/kg, 50 ㎕) alone, ceftriaxone (0.2 mg/kg, 50 ㎕) alone, or a combination of peptide and antibiotics (0.05 mg/kg PEP27-2 +0.1 mg/ kg ceftriaxone, 50 μl) was injected. Control mice were injected with the same amount of PBS (20 μl) without peptide. At 1, 2, 3, 4, 5, and 7 days after treatment, the morphology of the abscess was photographed and the abscess and surrounding tissue were recovered. Abscess tissue was homogenized in 500 μl of sterilized PBS using a tissue grinder. Serial dilutions of the homogenate were plated on agar plates and cultured for 24 hours to quantify Staphylococcus aureus MW2 strain.
그 결과, 스타필로코코스 아우레우스 MW2 균주의 감염이 없는 PBS만 주입한 실험군에서는 농양이 형성되지 않음을 확인할 수 있었다 (도 6). 반면 스타필로코코스 아우레우스 MW2를 감염시킨 후 PBS만 주입한 실험군에서는 농양이 1일 후부터 형성되면서 7일까지 농양의 크기가 감소하지 않았고, 농양에 심한 염증이 생겼음을 알 수 있었다. 그러나, 스타필로코코스 아우레우스 MW2를 감염시킨 후 PEP27-2만 주입한 실험군, 세프트리악손만 주입한 실험군 및 PEP27-2 + 세프트리악손만 주입한 실험군 모두 PBS를 주입한 실험군에 비해 농양의 크기가 적게 형성됨을 알 수 있었다. 반면, 스타필로코코스 아우레우스 MW2를 감염시킨 후 PEP27-2 단독으로 처리한 경우보다 병용처리시 농양 치유 효과가 유의하게 비슷하거나 약간 효과가 큼을 육안으로 확인하였다 (도 6). 농양 치유 효과를 더 명확하게 확인하기 위해, 농양 조직의 균질화물을 배양하여 박테리아 수를 확인한 결과에서도, 세균 감염 후 PEP27-2 또는 세프트리악손으로 처리한 후, 세균 수는 0 일에 비해 각각 3 일에 80.0 % 또는 46.0 %, 7 일에 89.3 % 또는 61.5 % 감소하였다. 병용처리 후의 콜로니 수는 7 일에 91.1 %로 단일처리 후 보다 스타필로코코스 아우레우스 MW2 균수가 낮게 확인되었다 (도 7). 이는 병용 치료가 PEP27-2 또는 세프트리악손을 사용한 단일 치료에 비해 감염 부위에서 박테리아의 제거를 개선하는 상승 효과를 가짐을 알 수 있었다. 또한 PEP27-2를 단독으로 처리시에도 농양 부위의 균주 제거에 효과적임을 확인하였다.As a result, it was confirmed that no abscess was formed in the experimental group injected only with PBS, which was not infected with Staphylococcus aureus MW2 strain (FIG. 6). On the other hand, in the experimental group where only PBS was injected after infection with Staphylococcus aureus MW2, abscesses formed after 1 day, and the size of the abscess did not decrease until the 7th day, and it was found that the abscess was severely inflamed. However, after infection with Staphylococcus aureus MW2, the experimental group injected with only PEP27-2, the experimental group injected only with ceftriaxone, and the experimental group injected with only PEP27-2 + ceftriaxone had a higher incidence of abscess compared to the experimental group injected with PBS. It was found that the size was small. On the other hand, it was visually confirmed that the abscess healing effect when treated in combination with PEP27-2 was significantly similar or slightly greater than when treated with PEP27-2 alone after infection with Staphylococcus aureus MW2 (FIG. 6). To more clearly confirm the abscess healing effect, the homogenate of the abscess tissue was cultured to determine the bacterial count. After bacterial infection and treatment with PEP27-2 or ceftriaxone, the bacterial count was 3 compared to 0 day, respectively. It decreased by 80.0% or 46.0% at 1 day and 89.3% or 61.5% at 7 days. The number of colonies after combined treatment was 91.1% at 7 days, confirming that the number of Staphylococcus aureus MW2 bacteria was lower than after single treatment (FIG. 7). This showed that the combination treatment had a synergistic effect in improving the removal of bacteria from the site of infection compared to single treatment with PEP27-2 or ceftriaxone. In addition, it was confirmed that treatment with PEP27-2 alone was effective in removing strains from the abscess area.
14. 농양 마우스 모델의 라이브 형광 이미징14. Live fluorescence imaging of an abscess mouse model
위 1의 방법으로 제조된 펩타이드들 중 항균활성이 가장 감염 진행 상황을 실시간으로 추적하기 위해 형광 (GFP) 표지된 스타필로코코스 아우레우스 MW2 (스타필로코코스 아우레우스 MW2-GFP)를 사용하였다. 형광 이미지는 FOBI 형광 이미징 시스템 (Neo Science, 수원, 대한민국)을 사용하여 감염 시작부터 6시간, 1일, 2일, 3일 동안 촬영하고 라이브 이미지 소프트웨어로 분석하였다. Among the peptides prepared by method 1 above, fluorescent (GFP)-labeled Staphylococcus aureus MW2 (Staphylococcus aureus MW2-GFP), which has the highest antibacterial activity, was used to track the progress of infection in real time. . Fluorescence images were taken for 6 hours, 1 day, 2 days, and 3 days from the start of infection using a FOBI fluorescence imaging system (Neo Science, Suwon, Korea) and analyzed with live image software.
그 결과, 스타필로코코스 아우레우스 MW2-GFP를 높은 박테리아 용량 (1 × 109 CFU)으로 감염시킨 후 0 시간에 그룹간에 형광 신호에 차이가 없었다 (도 8). 스타필로코코스 아우레우스 MW2-GFP 만 처리한 농양 위의 피부 표면에서 형광 신호가 3 일 동안 지속적으로 증가하였다. PEP27-2 단독 처리 후 형광 신호는 병용 처리와 유사했지만, 세프 트리악손 단독의 형광 신호는 감소하지 않았다 (도 8). 형광성 농양 부위를 기준으로 PEP27-2와 세프트리악손을 병용한 치료는 상승 효과를 나타남을 확인하였다.As a result, there was no difference in fluorescence signal between groups at 0 h after infection with Staphylococcus aureus MW2-GFP at a high bacterial dose (1 × 10 CFU) (Figure 8). Fluorescent signals continued to increase for 3 days on the skin surface over abscesses treated only with Staphylococcus aureus MW2-GFP. The fluorescence signal after PEP27-2 treatment alone was similar to the combination treatment, but the fluorescence signal of ceftriaxone alone did not decrease (Figure 8). Based on the fluorescent abscess area, it was confirmed that the combined treatment of PEP27-2 and ceftriaxone showed a synergistic effect.
15. 다제 내성 스타필로코코스 아우레우스에 감염된 농양 조직 절편 염색15. Staining of abscess tissue sections infected with multidrug-resistant Staphylococcus aureus
위 13에서 회수한 농양 부위와 염증 부위 조직 중 7 일째 조직을 4 % 완충 포르말린에 고정시켰다. 포르말린으로 고정된 염증 부위 또는 농양은 파라핀에 묻히게 되고 단면의 절편은 헤마톡실린과 에오신으로 염색하였다.Among the abscess area and inflammation area tissues recovered in 13 above, the 7th day tissue was fixed in 4% buffered formalin. Inflammatory areas or abscesses fixed with formalin were embedded in paraffin, and the cross-sections were stained with hematoxylin and eosin.
그 결과, 스타필로코코스 아우레우스 MW2 단독으로 감염된 마우스의 감염 부위는 피부 조직에서 심부 골격근 조직으로 확장되었으며 감염 부위 주변에서 호중구와 대식세포가 관찰되었다. 상부 진피의 깊은 염증, 골격근 손상 및 괴사로 인해 상부에 지각/딱지가 있는 큰 농양이 형성 되었다 (도 9). 세균 계수와 생 형광 이미징을 통해 피부 표면에 보이는 딱지가 많은 스타필로코코스 아우레우스 MW2를 함유하고 있음을 확인했습니다. 스타필로코코스 아우레우스 MW2 감염 후 2 시간 후에 PEP27-2, 세프트리악손 또는 이들의 조합으로 처리된 마우스에서 농양 부위, 피부 표면에 형성된 눈에 보이는 딱지, 박테리아의 수가 현저하게 감소함을 확인하였다. 그러나, 염증 반응은 병용 처리시 가장 현저하게 일어남을 조직 절편에서 확인하였다 (도 9).As a result, the infection area of mice infected with Staphylococcus aureus MW2 alone expanded from skin tissue to deep skeletal muscle tissue, and neutrophils and macrophages were observed around the infection area. Deep inflammation of the upper dermis, skeletal muscle damage and necrosis resulted in the formation of a large abscess with crust/crust on the upper surface (Figure 9). Bacterial counting and live fluorescence imaging confirmed that the scabs visible on the skin surface contained abundant Staphylococcus aureus MW2. It was confirmed that the number of abscess areas, visible scabs formed on the skin surface, and number of bacteria were significantly reduced in mice treated with PEP27-2, ceftriaxone, or their combination 2 hours after infection with Staphylococcus aureus MW2. . However, it was confirmed in tissue sections that the inflammatory reaction occurred most significantly during the combined treatment (FIG. 9).
16. 정량적 실시간 PCR을 이용한 전염증성 사이토카인 유전자 발현 분석16. Pro-inflammatory cytokine gene expression analysis using quantitative real-time PCR
종양괴사인자-알파 (TNF-α), 인터루킨-1 베타 (IL-1β), 인터루킨-6 (IL-6), 산화질소 합성효소 (iNOS) 및 시클로옥시게나제-2 (COX-2)와 같은 염증 매개체의 mRNA 발현은 피부 감염 및 상처 치유시 변화가 일어난다. 세균이 감염되지 않은 마우스와 감염된 마우스, 감염 후 PEP27-2 단독 처리, 세프트리악손 단독 처리 또는 병용 처리한 마우스에서 염증 유전자의 발현을 측정하여 PEP27-2 단독 처리시와 항생제와의 병용 처리시의 효능을 검증하였다.Tumor necrosis factor-alpha (TNF-α), interleukin-1 beta (IL-1β), interleukin-6 (IL-6), nitric oxide synthase (iNOS) and cyclooxygenase-2 (COX-2) The mRNA expression of the same inflammatory mediators changes during skin infection and wound healing. The expression of inflammatory genes was measured in mice that were not infected with bacteria, mice that were infected, mice that were treated with PEP27-2 alone, ceftriaxone alone, or in combination after infection, and the difference between PEP27-2 treatment alone and in combination with antibiotics was measured. Efficacy was verified.
구체적으로, 트리졸 시약을 사용하여 상처 조직으로부터 총 RNA를 분리하였다. 준비된 총 RNA는 cDNA 합성 키트를 사용하여 cDNA를 합성하였다. qPCR은 qPCR 2x premix (SYBR Green)를 이용하여 수행하였고, 염증 유전자들 중 TNF-α, IL-1β, IL-6, iNOS 및 COX-2의 발현 양을 확인하였다. 발현 수준은 β-액틴을 기준으로 정량화 하였고, PCR 수행 과정은 50℃에서 2분, 95℃에서 10분; 95℃에서 15초, 60℃에서 1분, 40 사이클; 95℃에서 15초, 60℃에서 1분 및 95℃에서 30초, 60℃에서 15초로 진행하였다. 유전자 발현은 ΔΔCt 방법으로 β-액틴 수준으로 정규화한 후 계산하였다. 대조 세포의 전사는 1로 설정되었고 다른 실험 그룹은 이 값의 배수이다.Specifically, total RNA was isolated from wound tissue using Trizol reagent. The prepared total RNA was synthesized into cDNA using a cDNA synthesis kit. qPCR was performed using qPCR 2x premix (SYBR Green), and the expression levels of inflammatory genes TNF-α, IL-1β, IL-6, iNOS, and COX-2 were confirmed. The expression level was quantified based on β-actin, and the PCR process was 50°C for 2 minutes, 95°C for 10 minutes; 95°C for 15 seconds, 60°C for 1 minute, 40 cycles; 15 seconds at 95°C, 1 minute at 60°C, 30 seconds at 95°C, and 15 seconds at 60°C. Gene expression was calculated after normalizing to β-actin levels using the ΔΔCt method. The transcription of control cells was set to 1 and the other experimental groups were multiples of this value.
TNF-α, IL-1β, IL-6, iNOS 및 COX-2 발현을 확인한 결과, 스타필로코코스 아우레우스 MW2 균주가 감염된 피부의 농양부위에서 상기 각 염증성 사이토카인의 발현이 증가됨이 관찰되었고, 세균에 감염된 피부 상처에 PEP27-2 단독 처리, 세프트리악손 단독 처리 또는 병용 처리한 조건에서는 염증성 사이토카인의 발현이 억제되는 것이 확인되었다 (도 10). PEP27-2 및 세프트리악손과의 병용 치료는 두 약제 단독 치료보다 TNF-α를 제외하고 염증성 사이토카인의 더 큰 억제를 나타났다. TNF-α 발현의 경우, PEP27-2 단독 및 PEP27-2와 세프트리악손의 조합 치료는 유사하게 억제되었다. 이것은 조합 치료가 스타필로코코스 아우레우스 MW2에 감염된 마우스에서 유도된 일부 염증 매개체의 발현을 억제하는 데 상승 효과가 있음을 확인하였다. 따라서 PEP27-2와 세프트리악손 주사를 병용하면 생체 내에서 스타필로코코스 아우레우스 MW2에 대한 항균 효과를 발휘하고 감염에 반응하여 발생하는 염증을 억제함을 확인하였다.As a result of confirming the expression of TNF-α, IL-1β, IL-6, iNOS, and COX-2, it was observed that the expression of each of the above inflammatory cytokines was increased in the abscess area of the skin infected with Staphylococcus aureus MW2 strain, It was confirmed that the expression of inflammatory cytokines was suppressed under conditions in which skin wounds infected with bacteria were treated with PEP27-2 alone, ceftriaxone alone, or in combination (FIG. 10). Combination treatment with PEP27-2 and ceftriaxone showed greater inhibition of inflammatory cytokines except TNF-α than treatment with either agent alone. For TNF-α expression, treatment with PEP27-2 alone and combination of PEP27-2 and ceftriaxone were similarly inhibited. This confirmed that the combination treatment had a synergistic effect in suppressing the expression of some inflammatory mediators induced in mice infected with Staphylococcus aureus MW2. Therefore, it was confirmed that the combined use of PEP27-2 and ceftriaxone injection exerts an antibacterial effect against Staphylococcus aureus MW2 in vivo and suppresses inflammation that occurs in response to infection.
전술한 실험 결과들로부터 본 발명 3종의 PEP27 유사체(서열번호 2 내지 서열번호 4)는 정상 세포에 대한 세포 독성이 낮고, 모체 펩타이드인 PEP27 보다 우수하거나 유사한 수준으로 그람 양성균, 그람 음성균 및 항생제 내성균에 대한 항균 활성을 나타내는 것을 확인하였다. 특히, 합성된 펩타이드 유사체 중, PEP27-2 펩타이드(서열번호 3)는 모체 펩타이드인 PEP27에 비해 현저히 우수한 항균 활성을 나타내는 것을 확인하였다. 또한, 합성된 펩타이드 유사체와 항생제를 병용 처리시 그람 양성균, 그람 음성균 및 항생제 내성균에 대하여 시너지 효과로 항균 활성을 나타냄을 확인하였다.From the above experimental results, the three PEP27 analogues of the present invention (SEQ ID NO: 2 to SEQ ID NO: 4) have low cytotoxicity to normal cells, and are superior to or similar to the parent peptide, PEP27, against Gram-positive bacteria, Gram-negative bacteria, and antibiotic-resistant bacteria. It was confirmed that it exhibits antibacterial activity against. In particular, among the synthesized peptide analogs, PEP27-2 peptide (SEQ ID NO: 3) was confirmed to exhibit significantly superior antibacterial activity compared to the parent peptide, PEP27. In addition, it was confirmed that the combined treatment of the synthesized peptide analog and antibiotics showed synergistic antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, and antibiotic-resistant bacteria.
제조예 1: 약학적 제제의 제조Preparation Example 1: Preparation of pharmaceutical preparation
1-1. 산제의 제조1-1. manufacture of powders
상기의 성분을 혼합한 후, 기밀포에 충진하여 산제를 제조하였다.After mixing the above ingredients, they were filled into an airtight bubble to prepare a powder.
1-2. 정제의 제조1-2. manufacture of tablets
상기의 성분을 혼합한 후, 통상의 정제의 제조 방법에 따라서 타정하여 정제를 제조하였다.After mixing the above ingredients, tablets were manufactured by tableting according to a conventional tablet manufacturing method.
1-3. 캡슐제의 제조1-3. Manufacturing of capsules
상기의 성분을 혼합한 후, 통상의 캡슐제의 제조 방법에 따라서 젤라틴 캡슐에 충전하여 캡슐제를 제조하였다.After mixing the above ingredients, a capsule was prepared by filling a gelatin capsule according to a typical capsule manufacturing method.
1-4. 액제의 제조1-4. Manufacture of liquid
통상의 액제의 제조 방법에 따라 정제수에 각각의 성분을 가하여 용해시키고 레몬향을 적량 가한 다음 상기의 성분을 혼합한 다음 정제수를 가하여 전체를 정제수를 가하여 전체 100 ㎖로 조절한 후 갈색병에 충진하여 멸균시켜 액제를 제조하였다.According to the usual liquid preparation method, add and dissolve each ingredient in purified water, add an appropriate amount of lemon flavor, mix the above ingredients, add purified water, adjust the total to 100 ml by adding purified water, and fill it in a brown bottle. The solution was prepared by sterilization.
1-5. 주사제의 제조1-5. Manufacturing of injectable drugs
적당한 용적의 주이용 염화나트륨 BP 중에 본 발명의 펩타이드를 용해시키고, 생성된 용액의 pH를 묽은 염산 BP를 이용하여 pH 7.6로 조절하고, 주이용 염화나트륨 BP를 이용하여 용적을 조절하고 충분히 혼합하였다. 용액을 투명 유리로 된 5 ㎖ 타입 I 앰플 중에 충전시키고, 유리를 용해시킴으로써 공기의 상부 격자하에 봉입시키고, 120℃에서 15분 이상 고압증기멸균기로 살균하여 주사액제를 제조하였다.The peptide of the present invention was dissolved in an appropriate volume of sodium chloride BP for main use, the pH of the resulting solution was adjusted to pH 7.6 using dilute hydrochloric acid BP, and the volume was adjusted using sodium chloride BP for main use and thoroughly mixed. The solution was filled into a 5 ml Type I ampoule made of transparent glass, sealed under an upper grid of air by dissolving the glass, and sterilized in an autoclave at 120°C for more than 15 minutes to prepare an injection solution.
제조예 2: 화장품의 제조Preparation Example 2: Preparation of cosmetics
2-1. 유연화장수(스킨)2-1. Soft lotion (skin)
본 발명의 펩타이드를 포함하는 항균용 유연화장수를 제조하기 위해 하기 표 16처럼 배합하여 통상적인 화장품 분야에서의 제조 방법에 따라 제조할 수 있다.To prepare an antibacterial softening lotion containing the peptide of the present invention, it can be prepared according to a conventional manufacturing method in the cosmetics field by mixing as shown in Table 16 below.
2-2. 영양화장수(로션)2-2. Nutritional lotion (lotion)
본 발명의 펩타이드를 포함하는 항균용 영양화장수를 제조하기 위해 하기 표 17처럼 배합하여 통상적인 화장품 분야에서의 제조 방법에 따라 제조할 수 있다.To prepare an antibacterial nutritional lotion containing the peptide of the present invention, it can be prepared according to a typical manufacturing method in the cosmetics field by mixing as shown in Table 17 below.
2-3. 에센스2-3. essence
본 발명의 펩타이드를 포함하는 항균용 에센스를 제조하기 위해 하기 표 18처럼 배합하여 통상적인 화장품 분야에서의 제조 방법에 따라 제조할 수 있다.To prepare an antibacterial essence containing the peptide of the present invention, it can be prepared according to a conventional manufacturing method in the cosmetics field by mixing as shown in Table 18 below.
2-4. 세안제(클렌징폼)2-4. Face wash (cleansing foam)
본 발명의 펩타이드를 포함하는 항균용 세안제(클렌징폼)를 제조하기 위해 하기 표 19처럼 배합하여 통상적인 화장품 분야에서의 제조 방법에 따라 제조할 수 있다.To produce an antibacterial face wash (cleansing foam) containing the peptide of the present invention, it can be prepared according to a typical manufacturing method in the cosmetics field by mixing as shown in Table 19 below.
2-5. 영양크림2-5. Nutrition cream
본 발명의 펩타이드를 포함하는 항균용 영양크림을 제조하기 위해 하기 표 20처럼 배합하여 통상적인 화장품 분야에서의 제조 방법에 따라 제조할 수 있다.To prepare an antibacterial nutritional cream containing the peptide of the present invention, it can be prepared according to a conventional manufacturing method in the cosmetics field by mixing as shown in Table 20 below.
2-6. 마사지크림2-6. massage cream
본 발명의 펩타이드를 포함하는 항균용 마사지크림을 제조하기 위해 하기 표 21처럼 배합하여 통상적인 화장품 분야에서의 제조 방법에 따라 제조할 수 있다.To prepare an antibacterial massage cream containing the peptide of the present invention, it can be prepared according to a conventional manufacturing method in the cosmetics field by mixing as shown in Table 21 below.
2-7. 팩2-7. pack
본 발명의 펩타이드를 포함하는 항균용 팩을 제조하기 위해 하기 표 22처럼 배합하여 통상적인 화장품 분야에서의 제조 방법에 따라 제조할 수 있다.To prepare an antibacterial pack containing the peptide of the present invention, it can be prepared according to a conventional manufacturing method in the cosmetics field by mixing as shown in Table 22 below.
<110> Industry-Academic Cooperation Foundation, Chosun University <120> Novel peptide derived from PEP27 peptide and uses thereof <130> 20P12021 <160> 4 <170> KoPatentIn 3.0 <210> 1 <211> 27 <212> PRT <213> Artificial Sequence <220> <223> PEP27 <220> <221> MOD_RES <222> (27) <223> AMIDATION, <400> 1 Met Arg Lys Glu Phe His Asn Val Leu Ser Ser Gly Gln Leu Leu Ala 1 5 10 15 Asp Lys Arg Pro Ala Arg Asp Tyr Asn Arg Lys 20 25 <210> 2 <211> 27 <212> PRT <213> Artificial Sequence <220> <223> PEP27-1 <220> <221> MOD_RES <222> (27) <223> AMIDATION, <400> 2 Met Trp Lys Trp Phe His Asn Val Leu Ser Ser Gly Gln Leu Leu Ala 1 5 10 15 Asp Lys Arg Pro Ala Arg Asp Tyr Asn Arg Lys 20 25 <210> 3 <211> 27 <212> PRT <213> Artificial Sequence <220> <223> PEP27-2 <220> <221> MOD_RES <222> (27) <223> AMIDATION, <400> 3 Met Trp Lys Trp Phe His Asn Val Leu Ser Trp Gly Trp Leu Leu Ala 1 5 10 15 Asp Lys Arg Pro Ala Arg Asp Tyr Asn Arg Lys 20 25 <210> 4 <211> 27 <212> PRT <213> Artificial Sequence <220> <223> PEP27-5 <220> <221> MOD_RES <222> (27) <223> AMIDATION, <400> 4 Met Trp Lys Trp Phe His Asn Val Leu Ser Ser Gly Gln Leu Leu Ala 1 5 10 15 Asp Lys Trp Trp Ala Trp Trp Tyr Asn Trp Trp 20 25 <110> Industry-Academic Cooperation Foundation, Chosun University <120> Novel peptide derived from PEP27 peptide and uses it <130> 20P12021 <160> 4 <170> KoPatentIn 3.0 <210> 1 <211> 27 <212> PRT <213> Artificial Sequence <220> <223>PEP27 <220> <221> MOD_RES <222> (27) <223> AMIDATION, <400> 1 Met Arg Lys Glu Phe His Asn Val Leu Ser Ser Gly Gln Leu Leu Ala 1 5 10 15 Asp Lys Arg Pro Ala Arg Asp Tyr Asn Arg Lys 20 25 <210> 2 <211> 27 <212> PRT <213> Artificial Sequence <220> <223> PEP27-1 <220> <221> MOD_RES <222> (27) <223> AMIDATION, <400> 2 Met Trp Lys Trp Phe His Asn Val Leu Ser Ser Gly Gln Leu Leu Ala 1 5 10 15 Asp Lys Arg Pro Ala Arg Asp Tyr Asn Arg Lys 20 25 <210> 3 <211> 27 <212> PRT <213> Artificial Sequence <220> <223> PEP27-2 <220> <221> MOD_RES <222> (27) <223> AMIDATION, <400> 3 Met Trp Lys Trp Phe His Asn Val Leu Ser Trp Gly Trp Leu Leu Ala 1 5 10 15 Asp Lys Arg Pro Ala Arg Asp Tyr Asn Arg Lys 20 25 <210> 4 <211> 27 <212> PRT <213> Artificial Sequence <220> <223> PEP27-5 <220> <221> MOD_RES <222> (27) <223> AMIDATION, <400> 4 Met Trp Lys Trp Phe His Asn Val Leu Ser Ser Gly Gln Leu Leu Ala 1 5 10 15 Asp Lys Trp Trp Ala Trp Trp Tyr Asn Trp Trp 20 25
Claims (9)
An antibacterial composition against methicillin-resistant Staphylococcus aureus , comprising a peptide consisting of the amino acid sequence of SEQ ID NO: 2 or 3.
The antibacterial composition according to claim 1, further comprising at least one antibiotic selected from the group consisting of meropenem, ceftazidime, and ceftriaxone.
The antibacterial composition according to claim 1, wherein the methicillin-resistant Staphylococcus aureus is S. aureus MW2.
A pharmaceutical composition for preventing or treating skin abscesses, comprising the antibacterial composition of any one of claims 1 to 3.
A cosmetic composition comprising the antibacterial composition of any one of claims 1 to 3.
Priority Applications (3)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020210014180A KR102608336B1 (en) | 2021-02-01 | 2021-02-01 | Novel peptide derived from pep27 peptide and uses thereof |
US17/588,736 US20220242921A1 (en) | 2021-02-01 | 2022-01-31 | Novel peptide derived from pep27 peptide and uses thereof |
US18/210,179 US20230303638A1 (en) | 2021-02-01 | 2023-06-15 | Peptide derived from pep27 peptide and uses thereof |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR1020210014180A KR102608336B1 (en) | 2021-02-01 | 2021-02-01 | Novel peptide derived from pep27 peptide and uses thereof |
Publications (2)
Publication Number | Publication Date |
---|---|
KR20220111039A KR20220111039A (en) | 2022-08-09 |
KR102608336B1 true KR102608336B1 (en) | 2023-11-30 |
Family
ID=82613423
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
KR1020210014180A KR102608336B1 (en) | 2021-02-01 | 2021-02-01 | Novel peptide derived from pep27 peptide and uses thereof |
Country Status (2)
Country | Link |
---|---|
US (2) | US20220242921A1 (en) |
KR (1) | KR102608336B1 (en) |
Family Cites Families (1)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
KR102158036B1 (en) | 2019-03-25 | 2020-09-22 | 조선대학교산학협력단 | Novel antimicrobial peptide derived from Pseudin-2 peptide and uses thereof |
-
2021
- 2021-02-01 KR KR1020210014180A patent/KR102608336B1/en active IP Right Grant
-
2022
- 2022-01-31 US US17/588,736 patent/US20220242921A1/en not_active Abandoned
-
2023
- 2023-06-15 US US18/210,179 patent/US20230303638A1/en active Pending
Non-Patent Citations (2)
Title |
---|
Cancer Cell International, 제5권, 논문번호 21 (2005년 공개) |
조선대학교, "펩타이드 공학을 이용한 항균 펩타이드의 개발", 과학기술부 연구과제 보고서 (2015. 1. 8. 온라인 공개) <https://scienceon.kisti.re.kr/srch/selectPORSrchReport.do?cn=TRKO200900069785>* |
Also Published As
Publication number | Publication date |
---|---|
US20230303638A1 (en) | 2023-09-28 |
KR20220111039A (en) | 2022-08-09 |
US20220242921A1 (en) | 2022-08-04 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
KR101899552B1 (en) | Antimicrobial Peptide Analogues Derived From The Abalone, Haliotis Discus, And Antimicrobial Pharmaceutical Composition Containing The Same | |
KR101734064B1 (en) | Novel antimicrobial peptide derived from myxinidin peptide and uses thereof | |
KR102224929B1 (en) | Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof | |
KR101595440B1 (en) | The effect of antimicrobial activity of CMA3 analogue peptide derived from CA-MA | |
KR102415725B1 (en) | Novel antimicrobial peptide H123 and uses thereof | |
KR102415734B1 (en) | Novel antimicrobial peptide and uses thereof | |
KR102158036B1 (en) | Novel antimicrobial peptide derived from Pseudin-2 peptide and uses thereof | |
JP5202649B2 (en) | Novel antibiotic peptide derived from ribosomal protein L1 of Helicobacter pylori and use thereof | |
KR102506674B1 (en) | Antimicrobial peptide H103B having antimicrobial actvity against antibiotic-resistant pathogen and uses thereof | |
KR102608336B1 (en) | Novel peptide derived from pep27 peptide and uses thereof | |
KR101430084B1 (en) | Novel antibiotic peptide against Propionibacterium acnes and use therof | |
EP1519951A2 (en) | Cationic linear peptides having antibacterial and/or antifungal properties | |
KR101998106B1 (en) | Novel antimicrobial peptide derived from Hp1404 peptide and uses thereof | |
KR102039400B1 (en) | Novel antimicrobial peptide derived from mBjAMP1 peptide and uses thereof | |
KR101980897B1 (en) | Novel antimicrobial peptide derived from LL37 peptide and uses thereof | |
KR101627455B1 (en) | Chimeric peptide having antimicrobial activity and antimicrobial composition comprising the same | |
KR102603281B1 (en) | Novel peptide derived from Hylin a1 peptide and uses thereof | |
KR102540598B1 (en) | Antibacterial peptide derived from Crassostrea gigas and its use | |
US8574556B2 (en) | Antibacterial pharmaceutical composition comprising Aceriphyllum rossii extract and active compounds isolated therefrom | |
KR102451854B1 (en) | Novel antimicrobial peptide H103 and uses thereof | |
KR102557375B1 (en) | Peptides Derived from Mitochondrial Presequence and Uses thereof | |
KR20190033839A (en) | Anti-inflammatory composition comprising macropin peptide as effective component | |
US20190038714A1 (en) | Anti-inflammatory composition comprising clavaspirin peptide analogue as effective ingredient | |
KR20190141955A (en) | Use of papiliocin derivatives |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
E902 | Notification of reason for refusal | ||
E902 | Notification of reason for refusal | ||
E701 | Decision to grant or registration of patent right | ||
GRNT | Written decision to grant |