KR102224929B1 - Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof - Google Patents

Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof Download PDF

Info

Publication number
KR102224929B1
KR102224929B1 KR1020190082734A KR20190082734A KR102224929B1 KR 102224929 B1 KR102224929 B1 KR 102224929B1 KR 1020190082734 A KR1020190082734 A KR 1020190082734A KR 20190082734 A KR20190082734 A KR 20190082734A KR 102224929 B1 KR102224929 B1 KR 102224929B1
Authority
KR
South Korea
Prior art keywords
antibacterial
peptide
antibacterial peptide
antimicrobial
resistant
Prior art date
Application number
KR1020190082734A
Other languages
Korean (ko)
Other versions
KR20210007075A (en
Inventor
강충경
Original Assignee
주식회사 펩스젠
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 펩스젠 filed Critical 주식회사 펩스젠
Priority to KR1020190082734A priority Critical patent/KR102224929B1/en
Publication of KR20210007075A publication Critical patent/KR20210007075A/en
Application granted granted Critical
Publication of KR102224929B1 publication Critical patent/KR102224929B1/en

Links

Images

Classifications

    • C—CHEMISTRY; METALLURGY
    • C07—ORGANIC CHEMISTRY
    • C07K—PEPTIDES
    • C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
    • C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
    • C07K14/43504—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans from invertebrates
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N37/00—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids
    • A01N37/44—Biocides, pest repellants or attractants, or plant growth regulators containing organic compounds containing a carbon atom having three bonds to hetero atoms with at the most two bonds to halogen, e.g. carboxylic acids containing at least one carboxylic group or a thio analogue, or a derivative thereof, and a nitrogen atom attached to the same carbon skeleton by a single or double bond, this nitrogen atom not being a member of a derivative or of a thio analogue of a carboxylic group, e.g. amino-carboxylic acids
    • A01N37/46—N-acyl derivatives
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N63/00—Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
    • A—HUMAN NECESSITIES
    • A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
    • A01N—PRESERVATION OF BODIES OF HUMANS OR ANIMALS OR PLANTS OR PARTS THEREOF; BIOCIDES, e.g. AS DISINFECTANTS, AS PESTICIDES OR AS HERBICIDES; PEST REPELLANTS OR ATTRACTANTS; PLANT GROWTH REGULATORS
    • A01N63/00—Biocides, pest repellants or attractants, or plant growth regulators containing microorganisms, viruses, microbial fungi, animals or substances produced by, or obtained from, microorganisms, viruses, microbial fungi or animals, e.g. enzymes or fermentates
    • A01N63/10—Animals; Substances produced thereby or obtained therefrom
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23K—FODDER
    • A23K20/00—Accessory food factors for animal feeding-stuffs
    • A23K20/10—Organic substances
    • A23K20/142—Amino acids; Derivatives thereof
    • A23K20/147—Polymeric derivatives, e.g. peptides or proteins
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23K—FODDER
    • A23K20/00—Accessory food factors for animal feeding-stuffs
    • A23K20/10—Organic substances
    • A23K20/195—Antibiotics
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23L—FOODS, FOODSTUFFS, OR NON-ALCOHOLIC BEVERAGES, NOT COVERED BY SUBCLASSES A21D OR A23B-A23J; THEIR PREPARATION OR TREATMENT, e.g. COOKING, MODIFICATION OF NUTRITIVE QUALITIES, PHYSICAL TREATMENT; PRESERVATION OF FOODS OR FOODSTUFFS, IN GENERAL
    • A23L3/00—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs
    • A23L3/34—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals
    • A23L3/3454—Preservation of foods or foodstuffs, in general, e.g. pasteurising, sterilising, specially adapted for foods or foodstuffs by treatment with chemicals in the form of liquids or solids
    • A23L3/3463—Organic compounds; Microorganisms; Enzymes
    • A23L3/34635—Antibiotics
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K38/00—Medicinal preparations containing peptides
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K8/00—Cosmetics or similar toiletry preparations
    • A61K8/18—Cosmetics or similar toiletry preparations characterised by the composition
    • A61K8/30—Cosmetics or similar toiletry preparations characterised by the composition containing organic compounds
    • A61K8/64—Proteins; Peptides; Derivatives or degradation products thereof
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
    • A61P31/00—Antiinfectives, i.e. antibiotics, antiseptics, chemotherapeutics
    • A61P31/04—Antibacterial agents
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q17/00—Barrier preparations; Preparations brought into direct contact with the skin for affording protection against external influences, e.g. sunlight, X-rays or other harmful rays, corrosive materials, bacteria or insect stings
    • A61Q17/005—Antimicrobial preparations
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61Q—SPECIFIC USE OF COSMETICS OR SIMILAR TOILETRY PREPARATIONS
    • A61Q19/00—Preparations for care of the skin
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2002/00—Food compositions, function of food ingredients or processes for food or foodstuffs
    • A—HUMAN NECESSITIES
    • A23—FOODS OR FOODSTUFFS; TREATMENT THEREOF, NOT COVERED BY OTHER CLASSES
    • A23V—INDEXING SCHEME RELATING TO FOODS, FOODSTUFFS OR NON-ALCOHOLIC BEVERAGES AND LACTIC OR PROPIONIC ACID BACTERIA USED IN FOODSTUFFS OR FOOD PREPARATION
    • A23V2200/00—Function of food ingredients
    • A23V2200/10—Preserving against microbes
    • A—HUMAN NECESSITIES
    • A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
    • A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
    • A61K2800/00—Properties of cosmetic compositions or active ingredients thereof or formulation aids used therein and process related aspects
    • A61K2800/40—Chemical, physico-chemical or functional or structural properties of particular ingredients
    • A61K2800/52—Stabilizers
    • A61K2800/524—Preservatives
    • Y—GENERAL TAGGING OF NEW TECHNOLOGICAL DEVELOPMENTS; GENERAL TAGGING OF CROSS-SECTIONAL TECHNOLOGIES SPANNING OVER SEVERAL SECTIONS OF THE IPC; TECHNICAL SUBJECTS COVERED BY FORMER USPC CROSS-REFERENCE ART COLLECTIONS [XRACs] AND DIGESTS
    • Y02—TECHNOLOGIES OR APPLICATIONS FOR MITIGATION OR ADAPTATION AGAINST CLIMATE CHANGE
    • Y02A—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE
    • Y02A50/00—TECHNOLOGIES FOR ADAPTATION TO CLIMATE CHANGE in human health protection, e.g. against extreme weather
    • Y02A50/30—Against vector-borne diseases, e.g. mosquito-borne, fly-borne, tick-borne or waterborne diseases whose impact is exacerbated by climate change

Landscapes

  • Life Sciences & Earth Sciences (AREA)
  • Health & Medical Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Engineering & Computer Science (AREA)
  • Zoology (AREA)
  • Polymers & Plastics (AREA)
  • Animal Behavior & Ethology (AREA)
  • Public Health (AREA)
  • Veterinary Medicine (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Food Science & Technology (AREA)
  • Organic Chemistry (AREA)
  • Medicinal Chemistry (AREA)
  • Pharmacology & Pharmacy (AREA)
  • Agronomy & Crop Science (AREA)
  • Epidemiology (AREA)
  • Chemical Kinetics & Catalysis (AREA)
  • General Chemical & Material Sciences (AREA)
  • Environmental Sciences (AREA)
  • Dermatology (AREA)
  • Wood Science & Technology (AREA)
  • Dentistry (AREA)
  • Animal Husbandry (AREA)
  • Plant Pathology (AREA)
  • Pest Control & Pesticides (AREA)
  • Microbiology (AREA)
  • Birds (AREA)
  • Oncology (AREA)
  • Tropical Medicine & Parasitology (AREA)
  • Toxicology (AREA)
  • Nutrition Science (AREA)
  • Bioinformatics & Cheminformatics (AREA)
  • Immunology (AREA)
  • Communicable Diseases (AREA)
  • Biotechnology (AREA)
  • Virology (AREA)
  • Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
  • Gastroenterology & Hepatology (AREA)
  • Biochemistry (AREA)

Abstract

본 발명은 해삼에서 분리한 항균 펩타이드로부터 유래한 신규 항균 펩타이드 및 이의 용도에 관한 것으로, 서열번호 5의 아미노산 서열로 이루어진 신규한 항균 펩타이드는 그람 양성균과 그람 음성균에 대해 우수한 항균 활성을 가지며, 항생제 내성균에도 강력한 항균 작용을 나타내므로, 항균용 조성물 또는 감염성 질환의 예방과 치료 및 화장품 조성물, 방부제 조성물 등 다양한 분야에서 유용하게 사용될 수 있을 것이다.The present invention relates to a novel antibacterial peptide derived from an antimicrobial peptide isolated from sea cucumber and its use, wherein the novel antibacterial peptide consisting of the amino acid sequence of SEQ ID NO: 5 has excellent antibacterial activity against Gram-positive bacteria and Gram-negative bacteria, and antibiotic-resistant bacteria Also, since it exhibits a strong antibacterial action, it may be usefully used in various fields such as antibacterial compositions or infectious diseases prevention and treatment, cosmetic compositions, and preservative compositions.

Description

해삼에서 분리한 항균 펩타이드로부터 유래한 신규 항균 펩타이드 및 이의 용도{Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof}Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof}

본 발명은 해삼에서 분리한 항균 펩타이드로부터 유래한 신규 항균 펩타이드 및 이의 용도에 관한 것이다.The present invention relates to a novel antimicrobial peptide derived from an antimicrobial peptide isolated from sea cucumber and a use thereof.

지구상에 존재하는 대부분의 생명체는 외부 미생물로부터의 침입을 막고, 자신을 지키기 위해 항균 펩타이드 (antimicrobial peptide, 이하 AMP)를 만드는 것으로 알려져 있다. 항균 펩타이드란 10∼50개 사이의 아미노산들로 구성된 분자량 2∼6 KDa 정도의 주로 양전하를 띠는 염기성 펩타이드로, 박테리아와 식물 그리고 척추동물과 무척추동물을 포함한 자연계 거의 모든 생물체에 존재하는 중요한 생체방어 인자 (host defense factor)이다. 곤충, 갑각류 등의 면역시스템이 없는 무척추동물에게 항균 펩타이드는 유일한 방어시스템으로, 면역시스템을 갖는 척추동물에게는 외부 미생물의 공격에 대한 초기의 일차적 방어시스템 기작을 갖는 것 뿐만 아니라 이어지는 면역작용에도 중요한 역할을 하는 것으로 알려져 있다(G. Wang, (2014) Pharmaceuticals, 7:545-594; L. Zhang. et al., (2016) Current Biology 26:R1-R21).Most living organisms on the planet are known to make antimicrobial peptides (AMP) to prevent invasion from external microorganisms and protect themselves. Antibacterial peptide is a basic peptide with a molecular weight of 2 to 6 KDa composed of between 10 and 50 amino acids. It is an important biological defense present in almost all living organisms in nature including bacteria, plants, vertebrates and invertebrates. It is a host defense factor. Antibacterial peptides are the only defense system for invertebrates that do not have an immune system such as insects and crustaceans, and for vertebrates with an immune system, not only have the initial primary defense system mechanism against attack by external microorganisms, but also play an important role in the subsequent immune function. (G. Wang, (2014) Pharmaceuticals, 7:545-594; L. Zhang. et al., (2016) Current Biology 26:R1-R21).

최초로 발견된 항생제는 1928년 알렉산더 플레밍(Alexander Fleming)이 발견한 페니실린으로 알려졌지만 그 이전인 1922년에 플레밍은 사람 침 속에 항균활성을 갖는 라이소자임(lysozyme)을 찾아냈다. 이후 1940년대 그라미시딘 (Gramicidin) 등 펩타이드 항생제가 개발되어 치료에 사용되었고 1980년대 이후 과학기술이 발달하면서 펩타이드의 분리와 구조분석을 위한 과학기술이 발달되면서 많은 펩타이드가 발견되었다. 특히 의료계에서 주목을 받기 시작한 것은 미국 국립보건원(National Institutes of Health)의 자슬로프 박사가 1987년 아프리카산 개구리에서 메가이닌(magainin)이란 항균 펩타이드를 당뇨성족부궤양(diabetic food ulcer) 치료용으로 FDA 임상을 완료하고 신약 허가를 시도하면서 많은 주목을 받기 시작했다. 그 이후 1996년 한국산 두꺼비(Bufo bufo gargarizans)의 위(stomach)로부터 부포린(buforin)이란 펩타이드가 발견되는 등 여러 생물들로부터 다양한 항균 펩타이드들의 존재가 밝혀졌고, 특성 및 기능에 관한 많은 연구가 수행되고 있으며, 지금까지 약 1,500종류에 달하는 다양한 생물들에서 항균 펩타이드가 분리되었다. 그러나 이제까지 발견된 많은 항균 펩타이드들에 대한 연구들을 보았을 때 구조나 활성의 측면에서 알파 헬릭스(α-helix) 또는 베타 시트(β-sheet) 그리고 염기성 등 일반적 경향성을 가지지만 아미노산의 서열상에서는 거의 유사성을 보이지 않고 있다. 이는 각각의 생물체가 자신이 살고 있는 환경에 적합하도록 자신의 펩타이드 구조 및 서열을 각기 다르게 진화시켜왔기 때문이라고 판단된다. 다양한 기작 모델이 제시되었고 하나의 예로 알파 헬릭스 구조의 항균 펩타이드는 세균의 세포막에 작용하여 세포막을 파괴함으로써 세포를 사멸시키는 것으로 알려져 있다.The first antibiotic discovered was known as penicillin discovered by Alexander Fleming in 1928, but before that, in 1922, Fleming discovered lysozyme, which has antimicrobial activity in human saliva. Later, in the 1940s, peptide antibiotics such as Gramicidin were developed and used for treatment. As science and technology developed after the 1980s, many peptides were discovered as science and technology for isolation and structural analysis of peptides developed. In particular, Dr. Jaslov of the National Institutes of Health in the U.S. began to draw attention from the FDA in 1987 using an antimicrobial peptide called magainin in African frogs for the treatment of diabetic food ulcers. As it completed clinical trials and tried to approve new drugs, it began to receive a lot of attention. Since then, in 1996, a peptide called buforin was discovered from the stomach of a Korean toad (Bufo bufo gargarizans). And, so far, about 1,500 kinds of antibacterial peptides have been isolated from various organisms. However, when looking at the studies on many antimicrobial peptides discovered so far, in terms of structure and activity, there is a general tendency such as α-helix or β-sheet and basicity, but almost similarity in the sequence of amino acids. I don't see it. This is believed to be because each organism has evolved its own peptide structure and sequence differently to suit the environment in which it lives. Various mechanism models have been suggested, and as an example, an antimicrobial peptide with an alpha helix structure is known to kill cells by acting on the cell membrane of bacteria and destroying the cell membrane.

이러한 항균 펩타이드가 새로운 의약품 및 화장품 원료 등으로써 지니고 있는 우수한 점을 요약하면 다음과 같다.The advantages of these antimicrobial peptides as raw materials for new pharmaceuticals and cosmetics are summarized as follows.

첫째, 항생제의 오남용으로 항생제에 내성을 갖는 균주들이 계속 등장하여 인류 건강에 심각한 위협요소로 대두되고 있다. 대표적인 내성균으로 그람 양성균인 메치실린 저항성 녹농균(Methicillin-resistant Staphylococcus aureus, MRSA), 반코마이신 내성 장알균(Vancomycin-resistant Enterococci, VRE), 그람 음성균인 슈도모나스 에루지노사(Pseudomonas aeruginosa), 아시네토박터 바우마니(Acinetobacter baumannii) 등이 있으며 이외에도 새로운 다제내성세균들이 계속 발견되면서 급성폐혈증, 호흡기계 감염, 낭포성 섬유증, 요로 감염 등 인체 부위와 장기를 가리지 않고 항생제 내성균이 살아남으면서 치료가 어려워 높은 사망률을 유발하고 있다. 그러나, 항균 펩타이드는 미생물 세포막을 물리적으로 파괴하는 작용기전을 갖고 있어 항생제 내성균의 출현을 막을 수 있다. 항균 펩타이드는 세포벽이나 핵산 합성을 방해함으로써 세균의 성장을 멈추는 일반 화학합성 펩타이드와 달리 세포막을 뚫으면서 직접 세포를 파괴시킴으로써 항생제에 의한 내성이 생기는 적응기작을 피할 수 있다.First, due to the abuse of antibiotics, strains resistant to antibiotics continue to appear, and are emerging as a serious threat to human health. Representative resistant bacteria include Gram-positive bacteria, Methicillin-resistant Staphylococcus aureus (MRSA), Vancomycin-resistant Enterococci (VRE), and Gram-negative bacteria, Pseudomonas aeruginosa , A. ( Acinetobacter baumannii ), etc., as new multidrug resistant bacteria continue to be discovered, antibiotic-resistant bacteria survive regardless of body parts and organs such as acute sepsis, respiratory tract infections, cystic fibrosis, and urinary tract infections, causing high mortality. have. However, antimicrobial peptides have a mechanism of action that physically destroys microbial cell membranes, so they can prevent the appearance of antibiotic-resistant bacteria. Antimicrobial peptides can avoid the adaptation mechanism of antibiotic resistance by directly destroying cells while penetrating the cell membrane, unlike general chemical synthetic peptides that stop the growth of bacteria by interfering with cell wall or nucleic acid synthesis.

둘째, 항균 펩타이드는 신속하고 효과적이며 광범위한 항균 스펙트럼(antimicrobial spectrum)을 가진다.Second, antimicrobial peptides are fast and effective and have a broad antimicrobial spectrum.

셋째, 항균 펩타이드는 선택적으로 병원균에만 작용하므로 인체에 유효하다. 이는 사람의 진핵세포 경우 세포막에 중성전하를 띄는 콜레스테롤 등이 다량 존재하여 항균 펩타이드의 통과를 방해하기 때문이다. Third, antibacterial peptides are effective for the human body because they selectively act only on pathogens. This is because, in the case of human eukaryotic cells, there is a large amount of cholesterol, which has a neutral charge, on the cell membrane, preventing the passage of antibacterial peptides.

넷째, 항균 펩타이드는 글리코실화(glycosylation) 등의 2차 변형이 없기 때문에, 유전공학의 공정을 이용한 대량생산이 가능하여 개발시 낮은 생산원가를 가진다.Fourth, because antimicrobial peptides do not have secondary modifications such as glycosylation, they can be mass-produced using the process of genetic engineering and thus have a low production cost during development.

다섯째, 대부분의 항균 펩타이드는 세포재생 즉 상처회복(wound healing)의 활성을 함께 갖고 있으므로 항균 활성과 함께 피부 미용에 활용될 수 있다(Ana Gomes et. al., (2017) Molecules, 22:1743-1761).Fifth, most of the antimicrobial peptides have cell regeneration, that is, wound healing, so they can be used for skin beauty along with antibacterial activity (Ana Gomes et. al., (2017) Molecules, 22:1743- 1761).

자연계 중에서 식물이나 육상 생물에 대한 항균 펩타이드 연구는 활발히 진행 중에 있고, 또한 지금까지 척추동물에서부터 무척추동물에 이르기까지 다양한 조직으로부터 정제되었다. 물리화학적 성질을 기초로 항균 펩타이드 라이브러리를 제조하고 이로부터 단점이 개선된 펩타이드를 탐색하려는 연구를 하거나, 자연계에서 신규 펩타이드를 탐색하여 개량하려는 연구가 수행되어 왔다. 특히 항균 펩타이드의 역가는 여러 물리적 성질 즉, 길이와 전기적 특성 등에 영향을 많이 받는다. 일반적으로 아미노산 길이는 50개 이하, 양이온(cationic) 아미노산이 많아야 하고 소수성(hydrophobic)을 띄며 양친매성(amphipathic) 구조를 가져야 한다. 특히 양이온 아미노산의 분포와 소수성이 중요한데 이는 세균의 세포막 표면이 음전하를 띄기 때문에 쉽게 결합할 수 있게 하기 때문이다. 알파 헬릭스 구조의 경우 아미노산 조성에 따라 헬릭스 회전의 수, 구조 및 특성에 영향을 미치므로 이를 시각적으로 표현하기 위한 수단으로써 소프트웨어 프로그램을 이용할 수 있다. 이들 프로그램을 이용하면 헬릭스의 어느 부분에 소수성 아미노산이 몰려 있고, 세균의 세포막에 결합하기 쉬운 양이온 아미노산들 배열을 분석할 수 있다. 또한 알파 헬릭스 구조의 항균 펩타이드는 중간 부분에 구조적으로 꺾이는 부분(hinge) 역할을 하게끔 프롤린(proline)이 존재하면 항균력이 증가됨이 밝혀졌다(Ruth Ann Veach. et al., (2004) J. Biol. Chem. 279:(3), 11425-11431). 따라서 이러한 특성이 반영되면서 항균력을 증가시키는 펩타이드의 개량이 필요하다.Research on antimicrobial peptides against plants and terrestrial organisms in the natural world is actively underway, and has been purified from various tissues from vertebrates to invertebrates until now. Studies have been conducted to prepare antimicrobial peptide libraries based on physicochemical properties and to search for peptides with improved shortcomings from them, or to search for new peptides in nature and improve them. In particular, the titer of antimicrobial peptides is greatly affected by various physical properties, such as length and electrical properties. In general, the length of amino acids should be less than 50, cationic amino acids should be large, and should have hydrophobic and amphipathic structures. In particular, the distribution and hydrophobicity of cationic amino acids are important because the surface of the bacterial cell membrane has a negative charge, so that it can be easily bound. In the case of an alpha helix structure, a software program can be used as a means for visually expressing the number, structure, and characteristics of the helix rotation according to the amino acid composition. By using these programs, it is possible to analyze the sequence of cationic amino acids that are easily bound to bacterial cell membranes, where hydrophobic amino acids are concentrated in a part of the helix. In addition, it was found that the antimicrobial activity of the alpha-helix-structured antibacterial peptide increases the antimicrobial activity when proline is present so that it acts as a structural hinge in the middle part (Ruth Ann Veach. et al., (2004) J. Biol. Chem. 279:(3), 11425-11431). Therefore, it is necessary to improve peptides that increase antibacterial activity while reflecting these characteristics.

한편, 한국등록특허 제1734331호에는 '한국산 해삼에서 분리한 신규 항균활성 펩타이드 및 이의 용도'가 개시되어 있고, 한국등록특허 제1341210호에는 '신규한 항균 펩타이드 및 이의 용도'가 개시되어 있으나, 본 발명의 해삼에서 분리한 항균 펩타이드로부터 유래한 신규 항균 펩타이드 및 이의 용도에 대해서는 기재된 바가 없다.On the other hand, Korean Patent No. 1734331 discloses'a new antimicrobial active peptide isolated from Korean sea cucumber and its use', and Korean Patent No. 1341210 discloses a'new antimicrobial peptide and its use'. There is no description of the novel antibacterial peptide derived from the antibacterial peptide isolated from the sea cucumber of the present invention and the use thereof.

본 발명은 상기와 같은 요구에 의해 도출된 것으로서, 본 발명자들은 한국산 해삼으로부터 분리된 항균 펩타이드(서열번호 1)의 아미노산 서열 중 일부 잔기를 치환하고, 아미노산 서열을 추가하여 제조한 신규의 항균 펩타이드(서열번호 5)가 모체 항균 펩타이드에 비해 그람 양성균 및 그람 음성균에 대한 항균 활성이 현저히 증가된 것을 확인하였으며, 상기 신규의 항균 펩타이드가 항생제 내성균에 대해서도 우수한 항균 활성을 보임을 확인함으로써, 본 발명을 완성하였다.The present invention was derived from the above requirements, and the present inventors substituted some residues of the amino acid sequence of the antimicrobial peptide isolated from Korean sea cucumber (SEQ ID NO: 1), and a novel antibacterial peptide prepared by adding an amino acid sequence ( It was confirmed that the antimicrobial activity of SEQ ID NO: 5) was significantly increased against Gram-positive bacteria and Gram-negative bacteria compared to the parental antibacterial peptide, and by confirming that the novel antibacterial peptide showed excellent antibacterial activity against antibiotic-resistant bacteria, the present invention was completed. I did.

상기 과제를 해결하기 위해, 본 발명은 서열번호 5의 아미노산 서열로 이루어진 항균 펩타이드를 제공한다.In order to solve the above problems, the present invention provides an antibacterial peptide consisting of the amino acid sequence of SEQ ID NO: 5.

또한, 본 발명은 상기 항균 펩타이드를 코딩하는 폴리뉴클레오티드를 제공한다.In addition, the present invention provides a polynucleotide encoding the antibacterial peptide.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항생제를 제공한다.In addition, the present invention provides an antibiotic containing the antibacterial peptide as an active ingredient.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 의약외품 조성물을 제공한다.In addition, the present invention provides an antibacterial quasi-drug composition containing the antibacterial peptide as an active ingredient.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 화장료 조성물을 제공한다.In addition, the present invention provides an antibacterial cosmetic composition containing the antibacterial peptide as an active ingredient.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 식품 첨가제를 제공한다.In addition, the present invention provides an antibacterial food additive containing the antibacterial peptide as an active ingredient.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 사료 첨가제를 제공한다.In addition, the present invention provides an antibacterial feed additive containing the antibacterial peptide as an active ingredient.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 생물 농약을 제공한다.In addition, the present invention provides an antimicrobial biological pesticide containing the antibacterial peptide as an active ingredient.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 방부 조성물을 제공한다.In addition, the present invention provides an antiseptic composition containing the antibacterial peptide as an active ingredient.

또한, 본 발명은 약학적으로 유효한 양의 상기 항균 펩타이드를 개체에 투여하는 단계를 포함하는 개체 내 항균 방법을 제공한다.In addition, the present invention provides an antibacterial method in an individual comprising administering to the individual an effective amount of the antimicrobial peptide.

본 발명의 신규한 항균 펩타이드는 그람 양성균과 그람 음성균에 대한 우수한 항균 활성을 가지며, 특히 항생제 내성균에도 강력한 항균 작용을 구비하여 항균용 조성물 또는 감염성 질환의 예방과 치료 및 화장품 조성물, 방부제 조성물 등 다양한 분야에서 유용하게 사용될 수 있을 것이다.The novel antibacterial peptide of the present invention has excellent antimicrobial activity against Gram-positive and Gram-negative bacteria, and especially has strong antibacterial activity against antibiotic-resistant bacteria, and thus various fields such as antibacterial compositions or infectious diseases prevention and treatment, cosmetic compositions, and preservative compositions. It can be usefully used in

도 1은 서열번호 5의 아미노산 서열로 이루어진, 본 발명의 신규한 항균 펩타이드의 헬리컬 휠 다이어그램(helical wheel diagram)이다.
도 2는 서열번호 1의 아미노산 서열로 이루으로 이루어진 펩타이드의 헬리컬 휠 다이어그램이다.1 is a helical wheel diagram of a novel antibacterial peptide of the present invention, consisting of the amino acid sequence of SEQ ID NO: 5.
2 is a helical wheel diagram of a peptide consisting of the amino acid sequence of SEQ ID NO: 1.

본 발명의 목적을 달성하기 위하여, 본 발명은 서열번호 5의 아미노산 서열로 이루어진 항균 펩타이드를 제공한다.In order to achieve the object of the present invention, the present invention provides an antibacterial peptide consisting of the amino acid sequence of SEQ ID NO: 5.

본 발명에서 용어, "항균 펩타이드"는 아미드 결합(또는 펩타이드 결합)으로 연결된 아미노산으로 이루어진 폴리머로서, 미생물에 대한 생육 저해 활성을 가진 것을 의미한다.In the present invention, the term "antibacterial peptide" refers to a polymer consisting of amino acids linked by an amide bond (or a peptide bond) and has an activity that inhibits growth of microorganisms.

본 발명의 서열번호 5의 아미노산 서열을 가지는 신규한 항균 펩타이드는, 해삼으로부터 분리된 서열번호 1의 아미노산 서열(KPDVSEVYSFDKTKLKTAETNEL)로 이루어진 항균 펩타이드에서 1번째 및 2번째 아미노산을 제거하고, 3번째, 6번째, 11번째, 19번째 및 22번째의 음이온성 아미노산 5개를 소수성 아미노산인 루신(Leucine, L)으로 모두 치환한 유도체 펩타이드(LVSLVYSFLKTKLKTALTNLL, 서열번호 4)와 항균 활성이 공지된 서열번호 2의 아미노산 서열(RLLRRLLR)로 이루어진 항균 펩타이드를 이용하여 제조된 것으로, 구체적으로는 서열번호 2의 아미노산 서열로 이루어진 항균 펩타이드와 서열번호 4의 아미노산 서열로 이루어진 유도체 펩타이드의 1 내지 12번째 아미노산을 조합하고, 항균 활성 증가 효과를 배가시키기 위해 상기 두 서열 사이에 구조적으로 꺾이는 부분(힌지, hinge) 역할을 하도록 프롤린(Proline, P)을 삽입하여 신규한 항균 펩타이드(RLLRRLLRPLVSLVYSFLKTK, 서열번호 5)를 제조하였다. 상기 항균 펩타이드의 아미노산은 바람직하게는 L 형태를 가지나, D-형으로 치환된 것도 본 발명에서 배제하지 않는다.The novel antibacterial peptide having the amino acid sequence of SEQ ID NO: 5 of the present invention removes the first and second amino acids from the antibacterial peptide consisting of the amino acid sequence of SEQ ID NO: 1 (KPDVSEVYSFDKTKLKTAETNEL) isolated from sea cucumber, and , A derivative peptide (LVSLVYSFLKTKLKTALTNLL, SEQ ID NO: 4) in which all 5 anionic amino acids of the 11th, 19th and 22nd anionic amino acids are replaced with a hydrophobic amino acid leucine (L) and the amino acid sequence of SEQ ID NO: 2, which is known for its antimicrobial activity. It is prepared using an antibacterial peptide consisting of (RLLRRLLR), specifically combining the 1st to 12th amino acids of the antibacterial peptide consisting of the amino acid sequence of SEQ ID NO: 2 and the derivative peptide consisting of the amino acid sequence of SEQ ID NO: 4, and antibacterial activity In order to double the increasing effect, a novel antimicrobial peptide (RLLRRLLRPLVSLVYSFLKTK, SEQ ID NO: 5) was prepared by inserting Proline (P) to serve as a structurally bent part (hinge) between the two sequences. The amino acid of the antimicrobial peptide preferably has an L form, but a D-type substitution is not excluded from the present invention.

상기 항균 펩타이드는 당업계에 알려진 통상의 펩타이드 합성 방법에 의해 제조할 수 있다. 상기 합성을 위한 방법으로는 화학적 합성 방법(W. H. Freeman and Co., Proteins; structures and molecular principles, 1983)으로 합성하는 것이 바람직하며, 구체적으로는 액상 펩타이드 합성법(solution phase peptide synthesis), 고상 펩타이드 합성법(solid-phase peptide synthesis), 단편 응축법 및 F-moc 또는 T-BOC 화학법으로 합성하는 것이 보다 바람직할 수 있으나, 이에 한정되지 않는다. 또한, 항균 펩타이드를 코딩하는 폴리뉴클레오티드를 퓨전 단백질(fusion protein)과 함께 유전자 조작 대장균에서 발현시켜 생물학적으로 생산하는 방법이 있으나(Cheng KT et al., (2018) Molecules, 23(4):800-811), 이에 제한되지 않는다.The antimicrobial peptide can be prepared by a conventional peptide synthesis method known in the art. As a method for the synthesis, it is preferable to synthesize by a chemical synthesis method (WH Freeman and Co., Proteins; structures and molecular principles, 1983), and specifically, a solution phase peptide synthesis method, a solid peptide synthesis method ( solid-phase peptide synthesis), fragment condensation, and synthesis by F-moc or T-BOC chemistry may be more preferable, but are not limited thereto. In addition, there is a method of biologically producing a polynucleotide encoding an antibacterial peptide together with a fusion protein in genetically engineered E. coli (Cheng KT et al., (2018) Molecules, 23(4):800- 811), but not limited thereto.

상기 항균 펩타이드는 그람 양성균, 그람 음성균 또는 항생제 내성균에 대해 항균 활성을 가지는 것이 바람직하나, 이에 한정되지 않는다.The antibacterial peptide preferably has antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, or antibiotic-resistant bacteria, but is not limited thereto.

상기 그람 양성균은 바실러스 속(Bacillus), 스타필로코커스 속(Staphylococcus), 엔테로코커스 속(Enterococcus), 리스테리아 속(Listeria) 또는 락토바실러스 속(Lactobacillus)을 포함하는 그람 양성균으로 당업계에 공지된 모든 그람 양성균일 수 있고, 바람직하게는 바실러스 속, 스타필로코커스 속 또는 엔테로코커스 속의 그람 양성균일 수 있으며, 가장 바람직하게는 바실러스 세레우스(Bacillus cereus), 스타필로코커스 아우레우스(Staphylococcus aureus) 및 엔테로코커스 패시움(Enterococcus faecium)로 이루어진 군으로부터 선택되는 어느 하나 이상일 수 있으나, 이에 제한되지 않는다.The gram-positive bacteria are all gram-positive bacteria known in the art, including Bacillus, Staphylococcus, Enterococcus, Listeria, or Lactobacillus. It may be a positive bacteria, preferably Bacillus, Staphylococcus or Enterococcus Gram-positive bacteria, most preferably Bacillus cereus (Bacillus cereus), Staphylococcus aureus (Staphylococcus aureus) and Enterococcus It may be any one or more selected from the group consisting of faecium (Enterococcus faecium), but is not limited thereto.

상기 그람 음성균은 대장균 속(Escherichia), 슈도모나스 속(Pseudomonas), 아시네토박터 속(Acinetobacter), 살모넬라 속(Salmonella), 렙토스피라 속(Leptospira) 또는 리케치아 속(Rickettsia)을 포함하는 그람 음성균으로 당업계에 공지된 모든 그람 음성균일 수 있고, 바람직하게는 대장균 속 또는 슈도모나스 속의 그람 음성균일 수 있으며, 가장 바람직하게는 대장균(Escherichia coli) 또는 슈도모나스 에루지노사(Pseudomonas aeruginosa)일 수 있으나, 이에 제한되지 않는다.The gram-negative bacteria are gram-negative bacteria including Escherichia, Pseudomonas, Acinetobacter, Salmonella, Leptospira, or Rickettsia. All known gram-negative bacteria may be, preferably, gram-negative bacteria of the genus Escherichia coli or Pseudomonas genus, most preferably Escherichia coli or Pseudomonas aeruginosa , but are not limited thereto.

상기 그람 양성균 및 그람 음성균 외, 본 발명의 항균 펩타이드는 항생제 내성균에 대해 항균 활성을 가질 수 있다. 상기 항생제 내성균은 반코마이신(vancomycin) 내성 엔테로코커스 패시움(Enterococcus faecium), 메치실린(meticillin) 내성 스타필로코커스 아우레우스(Staphylococcus aureus), ESBL(Extended-spectrum β-lactamase)을 생성하는 대장균(Escherichia coli), 카바페넴(carbapenem) 내성 대장균, 카바페넴 내성 슈도모나스 에루지노사(Pseudomonas aeruginosa), 카바페넴 내성 아시네토박터 바우마니(Acinetobacter baumannii) 및 카바페넴 내성 클렙시엘라 뉴모니애(Klebsiella pneumoniae)로 이루어진 군으로부터 선택되는 어느 하나 이상일 수 있으나, 이에 제한되지 않는다.In addition to the gram-positive and gram-negative bacteria, the antimicrobial peptide of the present invention may have antimicrobial activity against antibiotic-resistant bacteria. The antibiotic resistant bacteria are vancomycin (vancomycin) resistant Enterococcus passive help (Enterococcus faecium), mechi cylinder (meticillin) resistant Staphylococcus aureus (Staphylococcus aureus), Escherichia coli for generating the ESBL (Extended-spectrum β-lactamase ) (Escherichia coli ), carbapenem resistant E. coli, carbapenem resistant Pseudomonas aeruginosa , carbapenem resistant Acinetobacter baumannii and carbapenem resistant Klebsiella pneumoniae It may be any one or more selected from the group consisting of, but is not limited thereto.

상기 항생제는 이에 제한되지는 않으나, 아미노글리코사이드 계열(아미노글리코사이드, 겐타마이신, 네오마이신 등), 페니실린 계열(앰피실린 등), 술폰아미드 계열, 베타-락탐 계열(베타-락탐, 아목시실린/클라불란산 등), 클로람페니콜 계열, 에리트로마이신 계열, 플로르페니콜 계열, 포스포마이신 계열, 카나마이신 계열, 린코마이신 계열, 메티실린 계열, 퀴놀론 계열, 스트렙토마이신 계열, 테트라사이클린 계열, 트리메소프림 계열 및 반코마이신 계열의 항생제를 포함한다.The antibiotics are not limited thereto, but aminoglycoside series (aminoglycoside, gentamicin, neomycin, etc.), penicillin series (ampicillin, etc.), sulfonamide series, beta-lactam series (beta-lactam, amoxicillin/cla Fluoranic acid), chloramphenicol series, erythromycin series, florfenicol series, fosfomycin series, kanamycin series, lincomycin series, methicillin series, quinolone series, streptomycin series, tetracycline series, trimesoprim series and vancomycin Includes a family of antibiotics.

또한, 본 발명은 상기 항균 펩타이드를 코딩하는 폴리뉴클레오티드를 제공한다.In addition, the present invention provides a polynucleotide encoding the antibacterial peptide.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항생제를 제공한다.In addition, the present invention provides an antibiotic containing the antibacterial peptide as an active ingredient.

본 발명의 상기 항균 펩타이드는 서열번호 5의 아미노산 서열을 갖는 펩타이드로 전술한 바와 같다. 본 발명의 항균 펩타이드는 그람 음성균, 그람 양성균 그리고 항생제 내성균에 대해 강한 항균 활성을 나타내므로, 본 발명의 항균 펩타이드는 항균용 항생제의 유효성분으로 유용하게 사용될 수 있다.The antimicrobial peptide of the present invention is a peptide having an amino acid sequence of SEQ ID NO: 5 as described above. Since the antimicrobial peptide of the present invention exhibits strong antibacterial activity against Gram-negative bacteria, Gram-positive bacteria, and antibiotic-resistant bacteria, the antimicrobial peptide of the present invention can be usefully used as an active ingredient of an antibacterial antibiotic.

본 발명의 펩타이드는 임상투여시 비경구로 투여가 가능하며 일반적인 의약품 제제의 형태로 사용될 수 있다. 비경구 투여는 직장, 정맥, 복막, 근육, 동맥, 경피, 비강(nasal), 흡입, 안구 및 피하와 같은 경구 이외의 투여경로를 통한 투여를 의미할 수 있다. 본 발명의 항균 펩타이드를 의약품으로 사용하는 경우, 추가로 동일 또는 유사한 기능을 나타내는 유효성분을 1종 이상 함유할 수 있다.The peptide of the present invention can be administered parenterally during clinical administration and can be used in the form of a general pharmaceutical formulation. Parenteral administration may mean administration through a route other than oral administration such as rectal, intravenous, peritoneal, muscle, arterial, transdermal, nasal, inhalation, ocular and subcutaneous. When using the antimicrobial peptide of the present invention as a pharmaceutical, it may further contain one or more active ingredients exhibiting the same or similar function.

즉, 본 발명의 항균 펩타이드는 실제의 비경구의 여러가지 제형으로 투여될 수 있는데, 제제화할 경우에는 보통 사용하는 충진제, 증량제, 결합제, 습윤제, 붕해제, 계면활성제 등의 희석제 또는 부형제를 사용하여 조제된다. 비경구투여를 위한 제제에는 멸균된 수용액, 비수용성제, 현탁제, 유제, 동결건조제제, 좌제가 포함된다. 비수용성용제, 현탁용제로는 프로필렌글리콜(Propylene glycol), 폴리에틸렌 글리콜, 올리브 오일과 같은 식물성 기름, 에틸올레이트(Ethyl oleate)와 같은 주사 가능한 에스테르 등이 사용될 수 있다. 좌제의 기제로는 위텝솔(Witepsol), 마크로골, 트윈(Tween) 61, 카카오지, 리우린지, 글리세로제라틴 등이 사용될 수 있다.That is, the antimicrobial peptide of the present invention can be administered in various actual parenteral formulations, but when formulated, it is prepared using diluents or excipients such as commonly used fillers, extenders, binders, wetting agents, disintegrants, and surfactants. . Formulations for parenteral administration include sterilized aqueous solutions, non-aqueous agents, suspensions, emulsions, freeze-dried preparations, and suppositories. As the non-aqueous solvent and suspension, propylene glycol, polyethylene glycol, vegetable oil such as olive oil, and injectable ester such as ethyl oleate may be used. As a base for the suppository, Witepsol, Macrogol, Tween 61, cacao butter, liurinji, glycerogelatin, and the like may be used.

또한, 본 발명의 항균 펩타이드는 생리식염수 또는 유기용매와 같이 약제로 허용된 여러 전달체(carrier)와 혼합하여 사용될 수 있고, 안정성이나 흡수성을 증가시키기 위하여 글루코스, 수크로스 또는 덱스트란과 같은 카보하이드레이트, 아스코르브산(ascorbic acid) 또는 글루타치온과 같은 항산화제(antioxidants), 킬레이트화제(chelating agents), 저분자 단백질 또는 다른 안정화제(stabilizers)들이 약제로 사용될 수 있다.In addition, the antimicrobial peptide of the present invention may be used in combination with various carriers permitted as drugs such as physiological saline or organic solvents, and carbohydrates such as glucose, sucrose or dextran, in order to increase stability or absorption, Antioxidants such as ascorbic acid or glutathione, chelating agents, small molecule proteins or other stabilizers can be used as pharmaceuticals.

본 발명의 항균 펩타이드의 유효용량은 0.1 내지 2mg/kg이고, 바람직하게는 0.5 내지는 1mg/kg 이며, 하루 1 회 내지 3 회 투여될 수 있다.The effective dose of the antimicrobial peptide of the present invention is 0.1 to 2 mg/kg, preferably 0.5 to 1 mg/kg, and may be administered once to three times a day.

본 발명의 항생제에서 본 발명의 신규한 펩타이드의 총 유효량은 볼루스(bolus) 형태 혹은 상대적으로 짧은 기간 동안 주입(infusion) 등에 의해 단일 투여량(single dose)으로 환자에게 투여될 수 있으며, 다중 투여량(multiple dose)이 장기간 투여되는 분할 치료 방법(fractionated treatment protocol)에 의해 투여될 수 있다. 상기 농도는 약의 투여 경로 및 치료 횟수뿐만 아니라 환자의 나이 및 건강상태 등 다양한 요인들을 고려하여 환자의 유효 투여량이 결정되는 것이므로 이러한 점을 고려할 때, 이 분야의 통상적인 지식을 가진 자라면 본 발명의 신규한 펩타이드의 항생제로서의 특정한 용도에 따른 적절한 유효 투여량을 결정할 수 있을 것이다. In the antibiotic of the present invention, the total effective amount of the novel peptide of the present invention can be administered to a patient in a single dose by infusion or the like in a bolus form or for a relatively short period of time, and multiple administrations Multiple doses can be administered by a fractionated treatment protocol that is administered over a long period of time. Since the concentration is determined by taking into account various factors such as the patient's age and health status, as well as the route of administration and the number of treatments of the drug, the effective dosage of the patient is determined. It will be possible to determine an appropriate effective dosage according to the specific use of the novel peptide as an antibiotic.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 의약외품 조성물을 제공한다.In addition, the present invention provides an antibacterial quasi-drug composition containing the antibacterial peptide as an active ingredient.

본 발명의 조성물을 의약외품 첨가물로 사용할 경우, 상기 펩타이드를 그대로 첨가하거나 다른 의약외품 또는 의약외품 성분과 함께 사용할 수 있고, 통상적인 방법에 따라 적절하게 사용할 수 있다. 유효성분의 혼합량은 사용 목적에 따라 적합하게 결정될 수 있다.When the composition of the present invention is used as a quasi-drug additive, the peptide may be added as it is or may be used together with other quasi-drug or quasi-drug components, and may be appropriately used according to a conventional method. The mixing amount of the active ingredient may be appropriately determined according to the purpose of use.

본 발명의 항균용 의약외품은 이에 제한되지는 않으나, 바람직하게는 소독청결제, 샤워폼, 가그린, 물티슈, 세제비누, 핸드워시, 가습기 충진제, 마스크, 연고제, 패치, 또는 필터 충진제일 수 있다.The antibacterial quasi-drug product of the present invention is not limited thereto, but preferably, it may be a disinfectant cleaner, a shower foam, a gagrin, a wet tissue, a detergent soap, a hand wash, a humidifier filler, a mask, an ointment, a patch, or a filter filler.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 화장료 조성물을 제공한다.In addition, the present invention provides an antibacterial cosmetic composition containing the antibacterial peptide as an active ingredient.

본 발명의 화장료 조성물은 상기 항균 펩타이드 이외에 화장료 조성물에 통상적으로 이용되는 성분들이 포함되며, 예켠대 항산화제, 안정화제, 용해화제, 비타민, 안료 및 향료와 같은 통상적인 보조제, 그리고 담체를 포함한다. The cosmetic composition of the present invention includes ingredients commonly used in cosmetic compositions in addition to the antibacterial peptide, and includes conventional auxiliary agents such as antioxidants, stabilizers, solubilizers, vitamins, pigments and fragrances, and a carrier.

본 발명의 화장료 조성물에 있어서, 통상적으로 함유되는 화장료 조성물에 본 발명의 펩타이드는 0.1 내지 50 중량%, 바람직하게는 1 내지 10 중량%의 양으로 첨가될 수 있다. In the cosmetic composition of the present invention, the peptide of the present invention may be added in an amount of 0.1 to 50% by weight, preferably 1 to 10% by weight, to the cosmetic composition usually contained.

본 발명의 화장료 조성물은 당업계에서 통상적으로 제조되는 어떠한 제형으로도 제조될 수 있으며, 예를 들어, 용액, 현탁액, 유탁액, 페이스트, 겔, 크림, 로션, 파우더, 비누, 계면활성제-함유 클렌징, 오일, 분말 파운데이션, 유탁액 파운데이션, 왁스 파운데이션 및 스프레이 등으로 제형화될 수 있으나, 이에 한정되는 것은 아니다. 보다 상세하게는, 유연 화장수(스킨), 영양 화장수(밀크로션), 영양 크림, 맛사지 크림, 에센스, 아이크림, 클렌징 크림, 클렌징 포옴, 클렌징 워터, 팩, 스프레이 또는 파우더의 제형으로 제조될 수 있다.The cosmetic composition of the present invention may be prepared in any formulation conventionally prepared in the art, for example, solution, suspension, emulsion, paste, gel, cream, lotion, powder, soap, surfactant-containing cleansing , Oil, powder foundation, emulsion foundation, wax foundation, and may be formulated as a spray, but is not limited thereto. In more detail, it may be prepared in the form of a flexible lotion (skin), nutritional lotion (milk lotion), nutritional cream, massage cream, essence, eye cream, cleansing cream, cleansing foam, cleansing water, pack, spray, or powder. .

본 발명의 제형이 페이스트, 크림 또는 겔인 경우에는 담체 성분으로서 동물성 유, 식물성 유, 왁스, 파라핀, 전분, 트라가칸타, 셀룰로오스 유도체, 폴리에틸렌 글리콜, 실리콘, 벤토나이트, 실리카, 탈크 또는 산화아연 등이 이용될 수 있다.When the formulation of the present invention is a paste, cream, or gel, animal oil, vegetable oil, wax, paraffin, starch, tragacantha, cellulose derivatives, polyethylene glycol, silicone, bentonite, silica, talc, or zinc oxide are used as carrier components. Can be.

본 발명의 제형이 파우더 또는 스프레이인 경우에는 담체 성분으로서 락토스, 탈크, 실리카, 알루미늄 히드록시드, 칼슘 실리케이트 또는 폴리아미드 파우더가 이용될 수 있고, 특히 스프레이인 경우에는 추가적으로 클로로플루오로히드로카본, 프로판/부탄 또는 디메틸 에테르와 같은 추진체를 포함할 수 있다.When the formulation of the present invention is a powder or spray, lactose, talc, silica, aluminum hydroxide, calcium silicate, or polyamide powder may be used as a carrier component. In particular, in the case of a spray, additionally chlorofluorohydrocarbon, propane / May contain propellants such as butane or dimethyl ether.

본 발명의 제형이 용액 또는 유탁액인 경우에는 담체 성분으로서 용매, 용해화제 또는 유탁화제가 이용되고, 예컨대 물, 에탄올, 이소프로판올, 에틸 카보네이트, 에틸 아세테이트, 벤질 알코올, 벤질 벤조에이트, 프로필렌글리콜, 1,3-부틸글리콜 오일, 글리세롤 지방족 에스테르, 폴리에틸렌 글리콜 또는 소르비탄의 지방산 에스테르가 있다. When the formulation of the present invention is a solution or emulsion, a solvent, a solubilizing agent or an emulsifying agent is used as a carrier component, such as water, ethanol, isopropanol, ethyl carbonate, ethyl acetate, benzyl alcohol, benzyl benzoate, propylene glycol, 1 ,3-butylglycol oil, glycerol aliphatic ester, polyethylene glycol or fatty acid ester of sorbitan.

본 발명의 제형이 현탁액인 경우에는 담체 성분으로서 물, 에탄올 또는 프로필렌 글리콜과 같은 액상의 희석제, 에톡실화 이소스테아릴 알코올, 폴리옥시에틸렌 소르비톨 에스테르 및 폴리옥시에틸렌 소르비탄 에스테르와 같은 현탁제, 미소 결정성 셀룰로오스, 알루미늄 메타히드록시드, 벤토나이트, 아가 또는 트라가칸타 등이 이용될 수 있다.When the formulation of the present invention is a suspension, as a carrier component, a liquid diluent such as water, ethanol or propylene glycol, an ethoxylated isostearyl alcohol, a suspending agent such as polyoxyethylene sorbitol ester and polyoxyethylene sorbitan ester, microcrystals Sex cellulose, aluminum metahydroxide, bentonite, agar or tragacantha, and the like may be used.

본 발명의 제형이 계면-활성제 함유 클렌징인 경우에는 담체 성분으로서 지방족 알코올 설페이트, 지방족 알코올 에테르 설페이트, 설포숙신산 모노에스테르, 이세티오네이트, 이미다졸리늄 유도체, 메틸타우레이트, 사르코시네이트, 지방산 아미드 에테르 설페이트, 알킬아미도베타인, 지방족 알코올, 지방산 글리세리드, 지방산 디에탄올아미드, 식물성 유, 라놀린 유도체 또는 에톡실화 글리세롤 지방산 에스테르 등이 이용될 수 있다.When the formulation of the present invention is a surfactant containing cleansing, as a carrier component, aliphatic alcohol sulfate, aliphatic alcohol ether sulfate, sulfosuccinic acid monoester, isethionate, imidazolinium derivative, methyltaurate, sarcosinate, fatty acid amide Ether sulfates, alkylamidobetaines, fatty alcohols, fatty acid glycerides, fatty acid diethanolamides, vegetable oils, lanolin derivatives or ethoxylated glycerol fatty acid esters may be used.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 식품 첨가제를 제공한다.In addition, the present invention provides an antibacterial food additive containing the antibacterial peptide as an active ingredient.

본 발명의 펩타이드를 식품 첨가물로 사용하는 경우, 상기 펩타이드를 그대로 첨가하거나 다른 식품 성분과 함께 사용될 수 있고, 통상적인 방법에 따라 적절하게 사용될 수 있다. 유효성분의 혼합양은 그의 사용 목적에 따라 적절하게 결정될 수 있다. 일반적으로, 본 발명의 펩타이드는 원료에 대하여 15 중량부이하, 바람직하게는 10 중량부 이하의 양으로 첨가된다. 그러나, 장기간의 섭취의 경우에는 상기 양은 상기 범위 이하일 수 있으며, 안정성 면에서 아무런 문제가 없기 때문에 유효성분은 상기 범위 이상의 양으로도 사용될 수 있다. When the peptide of the present invention is used as a food additive, the peptide may be added as it is or may be used together with other food ingredients, and may be appropriately used according to a conventional method. The mixing amount of the active ingredient can be appropriately determined according to the purpose of use. In general, the peptide of the present invention is added in an amount of 15 parts by weight or less, preferably 10 parts by weight or less based on the raw material. However, in the case of long-term intake, the amount may be below the above range, and since there is no problem in terms of stability, the active ingredient may be used in an amount above the above range.

상기 식품의 종류에는 특별한 제한은 없다. 상기 물질을 첨가할 수 있는 식품의 예로는 육류, 소시지, 빵, 쵸코렛, 캔디류, 스넥류, 과자류, 피자, 라면, 기타 면류, 껌류, 아이스크림류를 포함한 낙농제품, 각종스프, 음료수, 차, 드링크제, 알코올 음료 및 비타민 복합제 등이 있으며, 통상적인 의미에서의 식품을 모두 포함한다.There is no particular limitation on the type of the food. Examples of foods to which the above substances can be added include meat, sausage, bread, chocolate, candies, snacks, confectionery, pizza, ramen, other noodles, gums, dairy products including ice cream, various soups, beverages, tea, drinks, There are alcoholic beverages and vitamin complexes, and all foods in the usual sense are included.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 사료 첨가제를 제공한다.In addition, the present invention provides an antibacterial feed additive containing the antibacterial peptide as an active ingredient.

본 발명의 사료 조성물은 기존의 항생제를 대체하고 유해한 식품 병원성균의 생장을 억제하여 동물체의 건강상태를 양호하게 하고, 가축의 증체량과 육질을 개선시키며, 산유량 및 면역력을 증가시키는 효과가 있다. 본 발명의 사료 조성물은 발효사료, 배합사료, 펠렛 형태 및 사일레지 등의 형태로 제조될 수 있다. The feed composition of the present invention has the effect of replacing the existing antibiotics and suppressing the growth of harmful food pathogens to improve the health of the animal body, improve the weight gain and meat quality of livestock, and increase the milk production and immunity. The feed composition of the present invention may be prepared in the form of fermented feed, blended feed, pellet form, and silage.

상기 발효사료는 본 발명의 펩타이드 이외의 여러 가지 미생물군 또는 효소들을 첨가함으로서 유기물을 발효시켜 제조할 수 있으며, 배합사료는 여러 종류의 일반사료와 본 발명의 펩타이드를 혼합하여 제조할 수 있다. 펠렛 형태의 사료는 상기 배합사료 등을 펠렛기에서 열과 압력을 가하여 제조할 수 있으며, 사일레지는 청예사료를 미생물로 발효시킴으로써 제조할 수 있다. 습식발효사료는 음식물 쓰레기 등과 같은 유기물을 수집 및 운반하여 살균과정과 수분조절을 위한 부형제를 일정비율로 혼합한 후, 발효에 적당한 온도에서 24시간 이상 발효하여, 수분함량이 약 70%로 포함되도록 조절하여 제조할 수 있다. 발효건조사료는 습식발효사료를 건조과정을 추가로 거쳐 수분함량이 30% 내지 40% 정도 함유되도록 조절하여 제조할 수 있다.The fermented feed may be prepared by fermenting organic matter by adding various microbial groups or enzymes other than the peptide of the present invention, and the compounded feed may be prepared by mixing various types of general feed and the peptide of the present invention. The pellet-type feed can be prepared by applying heat and pressure to the blended feed in a pellet machine, and the silage can be prepared by fermenting the blue-green feed with microorganisms. Wet fermented feed collects and transports organic matter such as food waste, mixes excipients for sterilization and moisture control at a certain ratio, and then ferments at a temperature suitable for fermentation for more than 24 hours, so that the moisture content is about 70%. It can be manufactured by controlling. The fermented dried feed can be prepared by controlling the wet fermented feed to contain about 30% to 40% of moisture through an additional drying process.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 항균용 생물 농약을 제공한다.In addition, the present invention provides an antimicrobial biological pesticide containing the antibacterial peptide as an active ingredient.

또한, 본 발명은 상기 항균 펩타이드를 유효성분으로 함유하는 방부 조성물을 제공한다.In addition, the present invention provides an antiseptic composition containing the antibacterial peptide as an active ingredient.

본 발명의 상기 항균 펩타이드는 서열번호 5의 아미노산 서열을 갖는 펩타이드로서, 그람 음성균, 그람 양성균 그리고 항생제 내성균에 대해 강한 항균 활성을 나타내므로, 본 발명의 항균 펩타이드는 항균용 생물농약 또는 방부 조성물의 유효성분으로 유용하게 활용될 수 있다.The antimicrobial peptide of the present invention is a peptide having the amino acid sequence of SEQ ID NO: 5, and exhibits strong antibacterial activity against Gram-negative bacteria, Gram-positive bacteria, and antibiotic-resistant bacteria. Therefore, the antimicrobial peptide of the present invention is effective in an antimicrobial biopesticide or antiseptic composition. It can be usefully used as an ingredient.

상기 방부 조성물에는 화장품 보존제 또는 의약품 보존제 등이 있다. 상기 식품의 방부제, 화장품 보존제 및 의약품 보존제는 의약품의 변질, 부패, 변색 및 화학변화를 방지하기 위해 사용되는 첨가물로서 살균제, 산화방지제가 이에 포함되며 세균, 곰팡이, 효모 등 미생물의 증식을 억제하여 식품 및 의약품에서 부패미생물의 발육저지 또는 살균작용을 하는 등의 기능성 항생제도 포함된다. 이러한 방부 조성물의 이상적인 조건으로는 독성이 없어야 하며, 미량으로도 효과가 있어야 한다.The antiseptic composition includes a cosmetic preservative or a pharmaceutical preservative. The food preservatives, cosmetic preservatives and pharmaceutical preservatives are additives used to prevent deterioration, spoilage, discoloration, and chemical change of pharmaceuticals. These include fungicides and antioxidants, and inhibit the growth of microorganisms such as bacteria, mold, and yeast. And functional antibiotics such as inhibiting the growth of decaying microorganisms or sterilizing in medicines are also included. Ideal conditions for such an antiseptic composition should be non-toxic, and should be effective even in trace amounts.

또한, 본 발명은 약학적으로 유효한 양의 상기 항균 펩타이드를 개체에 투여하는 단계를 포함하는 개체 내 항균 방법을 제공한다. 상기 개체는 인간을 제외한 포유류일 수 있으나, 이에 제한되지 않는다.In addition, the present invention provides an antibacterial method in an individual comprising administering to the individual an effective amount of the antimicrobial peptide. The individual may be a mammal other than a human, but is not limited thereto.

본 명세서에서 사용된 아미노산 서열은 IUPAC-IUB 명명법에 따라 다음과 같이 약어로 기재하였다: 알라닌 A, 아르기닌 R, 아스파라긴 N, 아스파르트산 D, 시스테인 C, 글루탐산 E, 글루타민 Q, 글리신 G, 히스티딘 H, 이소루신 I, 루신 L, 라이신 K, 메티오닌 M, 페닐알라닌 F, 프롤린 P, 세린 S, 트레오닌 T, 트립토판 W, 티로신 Y, 발린 V. 또한, 상기 아미노산은 D형 아미노산과 L형 아미노산을 모두 포함할 수 있으나, 이에 제한되지 않는다.The amino acid sequence used herein is abbreviated as follows according to the IUPAC-IUB nomenclature: alanine A, arginine R, asparagine N, aspartic acid D, cysteine C, glutamic acid E, glutamine Q, glycine G, histidine H, Isoleucine I, leucine L, lysine K, methionine M, phenylalanine F, proline P, serine S, threonine T, tryptophan W, tyrosine Y, valine V. In addition, the amino acids include both D-type amino acids and L-type amino acids. However, it is not limited thereto.

이하, 본 발명을 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하는 것일 뿐, 본 발명의 내용이 하기 실시예에 한정되는 것은 아니다.Hereinafter, the present invention will be described in detail by examples. However, the following examples are merely illustrative of the present invention, and the contents of the present invention are not limited to the following examples.

실시예 1. 펩타이드 합성Example 1. Peptide Synthesis

본 발명에서는 펩타이드 합성 기술인 프목-케미스트리(Fmoc chemistry) 방법을 이용한 솔리드/솔루션 단계(Solid/solution phase)를 통해 표 1과 같이 펩타이드를 합성하였고, 순도가 95% 이상이 되도록 고성능 액체 크로마토그래피로 정제하였다.In the present invention, the peptide was synthesized as shown in Table 1 through a solid/solution phase using the Fmoc chemistry method, which is a peptide synthesis technology, and purified by high-performance liquid chromatography so that the purity is 95% or more. I did.

항균 펩타이드 정보Antimicrobial Peptide Information 서열번호Sequence number 항균 펩타이드Antibacterial peptide 아미노산 개수Number of amino acids 비고Remark 1One KPDVSEVYSFDKTKLKTAETNELKPDVSEVYSFDKTKLKTAETNEL 2323 한국등록특허 제1734331호Korean Patent No. 1734331 22 RLLRRLLRRLLRRLLR 88 한국등록특허 제1341210호Korean Patent Registration No. 1341210 33 KPDVSEVYSFLKTKLKTALTNLLKPDVSEVYSFLKTKLKTALTNLL 2323 신규 유도체 펩타이드New derivative peptide 44 LVSLVYSFLKTKLKTALTNLLLVSLVYSFLKTKLKTALTNLL 2121 신규 유도체 펩타이드New derivative peptide 55 RLLRRLLRPLVSLVYSFLKTKRLLRRLLRPLVSLVYSFLKTK 2121 신규 유도체 펩타이드New derivative peptide

위 표의 펩타이드는 모두 L-형태를 가지나 D-형으로 치환된 것도 본 발명에서 배제하지 않는다.All of the peptides in the table above have an L-form, but a D-type substitution is not excluded from the present invention.

실시예 2. 펩타이드의 항균 활성 측정Example 2. Measurement of antimicrobial activity of peptides

합성한 항균 펩타이드의 항균 활성을 비교하기 위하여, 그람 음성균 및 그람 양성균에 대해 항균 활성을 측정하였다. 항균 활성은 영양분이 충분한 MH(Mueller Hinton) 배지에서 균체가 분열되지 않는 펩타이드의 최소성장 억제농도(Minimal inhibitory concentration, MIC)를 측정하였다. 하기 표 2에 기재된 균주를 입수하여, 세균수가 ㎖ 당 2×106 CFUs(colony-forming units)가 되도록 MH 배지로 희석하고 100 ㎕씩 96-웰 마이크로 적정 플레이트(Microtiter plate)에 분주한 후, MH 배지로 희석한 펩타이드 용액을 각 웰에 100 ㎕씩 첨가하였다. 플레이트를 37℃에서 16시간 동안 배양한 후 620 ㎚에서 흡광도를 측정하여 MIC를 결정하였다.In order to compare the antimicrobial activity of the synthesized antimicrobial peptide, antibacterial activity was measured against Gram-negative bacteria and Gram-positive bacteria. The antimicrobial activity was measured by measuring the minimum inhibitory concentration (MIC) of a peptide that does not divide cells in a nutrient-rich MH (Mueller Hinton) medium. After obtaining the strains shown in Table 2 below , diluting with MH medium so that the number of bacteria is 2×10 6 CFUs (colony-forming units) per ml, and dispensing 100 μl into a 96-well microtiter plate, The peptide solution diluted with MH medium was added to each well by 100 μl. After incubating the plate at 37° C. for 16 hours, the absorbance was measured at 620 nm to determine the MIC.

항균 펩타이드의 그람 양성균 및 그람 음성균에 대한 항균 활성 분석Analysis of antibacterial activity of antibacterial peptides against gram-positive and gram-negative bacteria 펩타이드 MIC (㎍/㎖)Peptide MIC (㎍/mL) BacteriaBacteria strainstrain 서열번호 1SEQ ID NO: 1 서열번호 3SEQ ID NO: 3 서열번호 4SEQ ID NO: 4 서열번호 5SEQ ID NO: 5 그람 양성Gram positive Bacillus cereusBacillus cereus KCTC 3624KCTC 3624 >128>128 1616 6464 88 Enterococcus faeciumEnterococcus faecium BM4147BM4147 >128>128 >128>128 >128>128 3232 Stapylococcus aureusStapylococcus aureus ATCC 29213ATCC 29213 >128>128 >128>128 >128>128 88 그람 음성Gram voice Escherichia coliEscherichia coli ATCC 25922ATCC 25922 >128>128 >128>128 >128>128 1616 Pseudomonas aeruginosaPseudomonas aeruginosa ATCC 27853ATCC 27853 >128>128 >128>128 >128>128 6464

측정 결과, 본 발명의 신규한 유도체 펩타이드인 서열번호 5의 항균 펩타이드가 서열번호 1의 항균 펩타이드 및 서열번호 3 및 4의 유도체 펩타이드에 비해 강력한 항균 활성을 보임을 알 수 있었다. 또한 서열번호 2의 항균 펩타이드는 그람 양성균 및 그람 음성균 모두에 대해 1 ㎎/㎖ 즉, 1,000 ㎍/㎖ 수준의 MIC를 나타내는 것으로 보고된 바 있어(한국등록특허 제1341210호 참고), 본 발명에서 새롭게 합성된 신규의 항균 펩타이드(서열번호 5)가 모체 펩타이드에 비해 현저히 증가된 항균 활성을 나타냄을 확인할 수 있었다.As a result of the measurement, it was found that the antibacterial peptide of SEQ ID NO: 5, which is a novel derivative peptide of the present invention, exhibits strong antibacterial activity compared to the antibacterial peptide of SEQ ID NO: 1 and the derivative peptides of SEQ ID NOs: 3 and 4. In addition, the antimicrobial peptide of SEQ ID NO: 2 has been reported to exhibit MIC at the level of 1 mg/ml, that is, 1,000 μg/ml for both Gram-positive and Gram-negative bacteria (refer to Korean Patent No. 1341210). It was confirmed that the synthesized novel antibacterial peptide (SEQ ID NO: 5) showed significantly increased antibacterial activity compared to the parent peptide.

실시예 3. 신규 펩타이드의 항생제 내성균에 대한 항균 활성 측정Example 3. Measurement of antimicrobial activity of novel peptides against antibiotic-resistant bacteria

상기 실시예 2에서 그람 양성균 및 그람 음성균에 대해 강력한 항균 활성을 보인 서열번호 5의 펩타이드로 하기 표 3과 같이 각종 항생제 내성균에 대한 항균 활성을 분석하였다.In Example 2, the peptide of SEQ ID NO: 5 showing strong antibacterial activity against Gram-positive bacteria and Gram-negative bacteria was analyzed for antibacterial activity against various antibiotic-resistant bacteria as shown in Table 3 below.

신규 펩타이드(서열번호 5)의 항생제 내성균에 대한 항균 활성 분석Antimicrobial activity analysis of new peptides (SEQ ID NO: 5) against antibiotic-resistant bacteria 대상 균주Target strain MIC
(㎍/㎖)MIC
(㎍/mL) BacteriaBacteria StrainStrain 항생제 내성 특성Antibiotic resistance characteristics 그람
양성Gram
positivity Enterococcus faeciumEnterococcus faecium BM 4147BM 4147 비내성 (susceptible)Susceptible 3232 서울성모병원 분리주 70Seoul St. Mary's Hospital Separateju 70 반코마이신 내성(VRE)Vancomycin resistance (VRE) 88 Stapylococcus aureusStapylococcus aureus ATCC 29213ATCC 29213 비내성Intolerance 88 서울성모병원 분리주 25Seoul St. Mary's Hospital Separate Province 25 메치실린 내성 (MRSA)Methicillin resistance (MRSA) 1616 그람
음성Gram
voice Escherichia coliEscherichia coli ATCC 25922ATCC 25922 비내성Intolerance 1616 서울성모병원 분리주 77Seoul St. Mary's Hospital Separate Province 77 ESBL1) ESBL 1) 3232 서울성모병원 분리주 7Seoul St. Mary's Hospital isolate 7 카바페넴 내성Carbapenem resistance 3232 Pseudomonas aeruginosaPseudomonas aeruginosa ATCC 27853ATCC 27853 비내성Intolerance 6464 서울성모병원 분리주 9Seoul St. Mary's Hospital Separation Week 9 카바페넴 내성Carbapenem resistance 3232 Acinetobacter baumanniiAcinetobacter baumannii 서울성모병원 분리주 61Seoul St. Mary's Hospital Separate Province 61 비내성Intolerance 3232 서울성모병원 분리주 58Seoul St. Mary's Hospital Separate Province 58 카바페넴 내성Carbapenem resistance 1616 Klebsiella pneumoniaeKlebsiella pneumoniae 서울성모병원 분리주 2Seoul St. Mary's Hospital Separate Week 2 카바페넴 내성Carbapenem resistance 3232 1) ESBL: 확장스펙트럼 베타 락타메이즈 효소 (Extended-spectrum β-lactamase)1) ESBL: Extended-spectrum β-lactamase

반코마이신 내성 엔테로코커스 패시움(Vancomycin-resistance Enterococcus faecium, VRE)은 질병관리본부의 보고에 의하면 최근 3년간 지역별에 따라 12-23%로 큰 증가를 보이고 있다. VRE에 대한 신규한 항균 펩타이드(서열번호 5)의 MIC는 비내성(susceptible) 균주에 비해 뛰어난 항균 활성을 보이는 것으로 확인되었다.Vancomycin-resistance Enterococcus faecium (VRE) has shown a significant increase of 12-23%, depending on the region, over the past three years, according to a report by the Centers for Disease Control and Prevention. It was confirmed that the MIC of the novel antimicrobial peptide (SEQ ID NO: 5) against VRE exhibits superior antimicrobial activity compared to the non-susceptible strain.

다재내성균으로 유명한 메치실린 저항성 스타필로코커스 아우레우스(meticillin-resistance Staphylococcus aureus, MRSA)의 경우, 항균 펩타이드(서열번호 5)가 비내성 균주에 비해 약간 높은 MIC 값을 보였지만 강력한 항균 활성이 있음을 알 수 있었다. 카바페넴 내성 대장균(Escherichia coli) 균주에 대해서는 본 발명의 항균 펩타이드(서열번호 5)는 우수한 항균 활성을 보였다. 그리고 확장스펙트럼 베타 락타메이즈 효소(Extended-spectrum β-lactamase, ESBL)는 플라스미드에 의해 전파되는 β-lactamase로 ESBL을 생성하는 그람 음성 균주들에 의한 병원감염 빈도가 점차 증가하고 있으며 페니실린, 세파로스포린, 카바페넴 등에 다중내성을 보여 감염 시 치료에 어려움이 있는 것으로 보고되었다(윤필훈 등 (2014) Korean J Nosocomial Infect Control 19(2):45-51). 이들은 최후의 수단인 카바페넘 내성도 갖고 있어 12.9%의 사망률을 보였다는 보고도 있다. 서열번호 5의 아미노산 서열로 이루어진 신규한 항균 펩타이드는 이들 ESBL 다중내성 균주에도 항균 활성을 보였다. 녹농균(Pseudomonas aeruginosa)은 피부감염부터 패렴, 욕창, 패혈증, 수막염 등을 유발하는 주요 의료관련 원인균이다. 이것 역시 카바페넴계, 아미코글리코사이드계 등의 항생제에 다재내성을 보이고 있는데 본 발명의 신규 펩타이드는 카바페넴계 비내성 균주에 비해 오히려 뛰어난 항균 활성을 보여주었다. 아시네토박터 바우마니(Acinetobacter baumannii)는 2007년 이후 세계적으로 병원 내 감염발생 수는 증가되었고 그에 따른 카바페넴계 항생제를 포함한 다제내성률도 크게 증가하기 시작하였다. 2010년 일본도쿄대학병원에서 아시네토박터균의 감염으로 46명이 감염되고 이 중 10명이 숨진 사건은 충격적이었고 우리나라의 경우, 질병관리본부에서 발간한 「국가 항균제 내성정보」 (KARMS, 2010)에 의하면 카바페넴계 항생제인 내성율이 2007년 27%에서, 2010년 71.7%으로 급속한 내성률의 증가를 보이고 있다(차정욱 등 (2012), PUBLIC HEALTH WEEKLY REPORT, KCDC 제7권 제29호, 630-632). 다제내성 아시네토박터 바우마니균은 면역저하, 만성폐질환 또는 장기입원환자에게 감염을 유발할 수 있어 병원에서는 특히 주의해야 할 내성균이다. 본 발명의 신규한 항균 펩타이드(서열번호 5)는 비내성균에 비해 카바페넴 내성 아시네토박터 바우마니균에 더 뛰어난 항균 활성을 보여주었다. 폐렴막대균이라 불리는 클렙시엘라 뉴모니애(Klebsiella pneumoniae)의 카바페넴 내성균에도 역시 강력한 항균 활성을 보여주었다. 이상의 결과로부터 본 발명의 신규한 항균 펩타이드(서열번호 5)는 그람 양성균 및 그람 음성균을 비롯하여, 다양한 항생제 내성균에 대해서도 우수한 항균 활성을 보이므로, 항균용 조성물 또는 감염성 질환의 예방과 치료 및 화장품 조성물, 방부제 조성물 등 다양한 분야에서 유용하게 활용될 수 있을 것으로 예측되었다. In the case of methicillin-resistance Staphylococcus aureus (MRSA), which is famous for multi-resistance bacteria, the antimicrobial peptide (SEQ ID NO: 5) showed slightly higher MIC values than the non-resistant strains, but it has strong antibacterial activity. Could know. For carbapenem-resistant E. coli ( Escherichia coli ) strain, the antimicrobial peptide of the present invention (SEQ ID NO: 5) showed excellent antibacterial activity. And Extended-spectrum β-lactamase (ESBL) is a β-lactamase that is propagated by a plasmid, and the frequency of nosocomial infection by Gram-negative strains that produce ESBL is gradually increasing. , Carbapenem, etc. are reported to have multiple resistance to treatment during infection (Pilhun Yoon et al. (2014) Korean J Nosocomial Infect Control 19(2):45-51). They also have carbaphenum resistance, which is the last resort, and there are reports of a 12.9% mortality rate. The novel antibacterial peptide consisting of the amino acid sequence of SEQ ID NO: 5 showed antibacterial activity even in these ESBL multi-resistant strains. Pseudomonas aeruginosa is a major medical-related causative agent that induces skin infections, pneumonia, bedsores, sepsis, and meningitis. This, too, shows versatility to antibiotics such as carbapenem-based and amicoglycoside-based, but the novel peptides of the present invention exhibited superior antimicrobial activity rather than carbapenem-based non-resistant strains. Acinetobacter baumannii (Acinetobacter baumannii) has increased the number of infections in hospitals worldwide since 2007, and accordingly, the multidrug resistance rate including carbapenem antibiotics began to increase significantly. In 2010, 46 people were infected by the Acinetobacterium infection at the University of Tokyo Hospital in Japan, and 10 of them died. In the case of Korea, according to the 「National Antimicrobial Resistance Information」 (KARMS, 2010) published by the Korea Centers for Disease Control and Prevention. The resistance rate, a carbapenem-based antibiotic, is showing a rapid increase from 27% in 2007 to 71.7% in 2010 (Cha Jeong-wook et al. (2012), PUBLIC HEALTH WEEKLY REPORT, KCDC Vol. 7 No. 29, 630-632). Multi-drug-resistant Acinetobacter Baumani bacteria are resistant bacteria that should be especially cautious in hospitals because they can cause infections in immunocompromised, chronic lung disease, or long-term hospitalized patients. The novel antibacterial peptide of the present invention (SEQ ID NO: 5) showed superior antibacterial activity against carbapenem-resistant Acinetobacter Baumani bacteria compared to non-resistant bacteria. It also showed strong antibacterial activity against carbapenem-resistant bacteria of Klebsiella pneumoniae called pneumococcal bacteria. From the above results, the novel antibacterial peptide (SEQ ID NO: 5) of the present invention shows excellent antibacterial activity against various antibiotic-resistant bacteria, including Gram-positive bacteria and Gram-negative bacteria, and thus, antibacterial compositions or infectious diseases prevention and treatment and cosmetic compositions, It is predicted that it will be useful in various fields such as preservative compositions.

실시예 4. 신규 펩타이드의 특성 분석Example 4. Characterization of new peptides

신규한 항균 펩타이드(서열번호 5)의 뛰어난 항균 활성을 분석하기 위해 헬리컬 휠 다이어그램(helical wheel diagrams) 기법을 사용하여 구조적 특성을 규명했다. 서열번호 5의 헬리컬 휠 구조(도 1)와 서열번호 1의 헬리컬 휠 구조(도 2)를 비교해보면 서열번호 1에 비해 서열번호 5의 펩타이드가 하단에 소수성 아미노산이 일정하게 배열되어 있어 항균 펩타이드가 가져야 할 기본적 특성을 잘 갖춘 것으로 판단되었다. 또한 서열번호 5의 펩타이드는 평균 소수성(mean hydrophobicity)이 0.570으로 서열번호 1의 0.100보다 높아 뛰어난 항균 활성을 뒷받침하고 있다.In order to analyze the excellent antimicrobial activity of the novel antibacterial peptide (SEQ ID NO: 5), the structural characteristics were identified using the helical wheel diagrams technique. When comparing the helical wheel structure of SEQ ID NO: 5 (FIG. 1) and the helical wheel structure of SEQ ID NO: 1 (FIG. 2), the peptide of SEQ ID NO: 5 is uniformly arranged at the bottom of the peptide compared to SEQ ID NO: 1. It was judged to be well equipped with basic characteristics to have. In addition, the peptide of SEQ ID NO: 5 has an average hydrophobicity of 0.570, which is higher than 0.100 of SEQ ID NO: 1, supporting excellent antibacterial activity.

<110> PepXGen Inc. <120> Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof <130> PN19237 <160> 5 <170> KoPatentIn 3.0 <210> 1 <211> 23 <212> PRT <213> Artificial Sequence <220> <223> Holothuroidea <400> 1 Lys Pro Asp Val Ser Glu Val Tyr Ser Phe Asp Lys Thr Lys Leu Lys 1 5 10 15 Thr Ala Glu Thr Asn Glu Leu 20 <210> 2 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> Antimicrobial Peptide <400> 2 Arg Leu Leu Arg Arg Leu Leu Arg 1 5 <210> 3 <211> 23 <212> PRT <213> Artificial Sequence <220> <223> Antimicrobial Peptide <400> 3 Lys Pro Asp Val Ser Glu Val Tyr Ser Phe Leu Lys Thr Lys Leu Lys 1 5 10 15 Thr Ala Leu Thr Asn Leu Leu 20 <210> 4 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> Antimicrobial Peptide <400> 4 Leu Val Ser Leu Val Tyr Ser Phe Leu Lys Thr Lys Leu Lys Thr Ala 1 5 10 15 Leu Thr Asn Leu Leu 20 <210> 5 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> Antimicrobial Peptide <400> 5 Arg Leu Leu Arg Arg Leu Leu Arg Pro Leu Val Ser Leu Val Tyr Ser 1 5 10 15 Phe Leu Lys Thr Lys 20 <110> PepXGen Inc. <120> Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof <130> PN19237 <160> 5 <170> KoPatentIn 3.0 <210> 1 <211> 23 <212> PRT <213> Artificial Sequence <220> <223> Holothuroidea <400> 1 Lys Pro Asp Val Ser Glu Val Tyr Ser Phe Asp Lys Thr Lys Leu Lys 1 5 10 15 Thr Ala Glu Thr Asn Glu Leu 20 <210> 2 <211> 8 <212> PRT <213> Artificial Sequence <220> <223> Antimicrobial Peptide <400> 2 Arg Leu Leu Arg Arg Leu Leu Arg 1 5 <210> 3 <211> 23 <212> PRT <213> Artificial Sequence <220> <223> Antimicrobial Peptide <400> 3 Lys Pro Asp Val Ser Glu Val Tyr Ser Phe Leu Lys Thr Lys Leu Lys 1 5 10 15 Thr Ala Leu Thr Asn Leu Leu 20 <210> 4 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> Antimicrobial Peptide <400> 4 Leu Val Ser Leu Val Tyr Ser Phe Leu Lys Thr Lys Leu Lys Thr Ala 1 5 10 15 Leu Thr Asn Leu Leu 20 <210> 5 <211> 21 <212> PRT <213> Artificial Sequence <220> <223> Antimicrobial Peptide <400> 5 Arg Leu Leu Arg Arg Leu Leu Arg Pro Leu Val Ser Leu Val Tyr Ser 1 5 10 15 Phe Leu Lys Thr Lys 20

Claims (14)

서열번호 5의 아미노산 서열로 이루어진 항균 펩타이드.Antibacterial peptide consisting of the amino acid sequence of SEQ ID NO: 5. 제1항에 있어서, 상기 항균 펩타이드는 그람 양성균, 그람 음성균 또는 항생제 내성균에 대해 항균 활성을 가지는 것을 특징으로 하는 항균 펩타이드.The antibacterial peptide according to claim 1, wherein the antibacterial peptide has antibacterial activity against Gram-positive bacteria, Gram-negative bacteria, or antibiotic-resistant bacteria. 제2항에 있어서, 상기 그람 양성균은 바실러스 세레우스(Bacillus cereus), 스타필로코커스 아우레우스(Staphylococcus aureus) 및 엔테로코커스 패시움(Enterococcus faecium)으로 이루어진 군으로부터 선택되는 어느 하나 이상인 것을 특징으로 하는 항균 펩타이드.The method of claim 2, wherein the Gram-positive bacteria is at least one selected from the group consisting of Bacillus cereus , Staphylococcus aureus , and Enterococcus faecium. Antibacterial peptide. 제2항에 있어서, 상기 그람 음성균은 대장균(Escherichia coli) 또는 슈도모나스 에루지노사(Pseudomonas aeruginosa)인 것을 특징으로 하는 항균 펩타이드.The antimicrobial peptide according to claim 2, wherein the Gram-negative bacteria are Escherichia coli or Pseudomonas aeruginosa. 제2항에 있어서, 상기 항생제 내성균은 반코마이신(vancomycin) 내성 엔테로코커스 패시움(Enterococcus faecium), 메치실린(meticillin) 내성 스타필로코커스 아우레우스(Staphylococcus aureus), ESBL(Extended-spectrum β-lactamase)을 생성하는 대장균(Escherichia coli), 카바페넴(carbapenem) 내성 대장균, 카바페넴 내성 슈도모나스 에루지노사(Pseudomonas aeruginosa), 카바페넴 내성 아시네토박터 바우마니(Acinetobacter baumannii) 및 카바페넴 내성 클렙시엘라 뉴모니애(Klebsiella pneumoniae)로 이루어진 군으로부터 선택되는 어느 하나 이상인 것을 특징으로 하는 항균 펩타이드.The method of claim 2, wherein the antibiotic-resistant bacteria are vancomycin-resistant Enterococcus faecium , methicillin-resistant Staphylococcus aureus , and ESBL (Extended-spectrum β-lactamase). Producing Escherichia coli , carbapenem resistant E. coli, carbapenem resistant Pseudomonas aeruginosa , carbapenem resistant Acinetobacter baumannii and carbapenem resistant Klebsiella pneumoniae Ae ( Klebsiella pneumoniae ) antibacterial peptide, characterized in that at least one selected from the group consisting of. 제1항의 항균 펩타이드를 코딩하는 폴리뉴클레오티드.A polynucleotide encoding the antibacterial peptide of claim 1. 제1항의 항균 펩타이드를 유효성분으로 함유하는 항생제.An antibiotic containing the antibacterial peptide of claim 1 as an active ingredient. 제1항의 항균 펩타이드를 유효성분으로 함유하는 항균용 의약외품 조성물.An antibacterial quasi-drug composition containing the antibacterial peptide of claim 1 as an active ingredient. 제1항의 항균 펩타이드를 유효성분으로 함유하는 항균용 화장료 조성물.An antibacterial cosmetic composition containing the antibacterial peptide of claim 1 as an active ingredient. 제1항의 항균 펩타이드를 유효성분으로 함유하는 항균용 식품 첨가제.An antibacterial food additive containing the antibacterial peptide of claim 1 as an active ingredient. 제1항의 항균 펩타이드를 유효성분으로 함유하는 항균용 사료 첨가제.An antibacterial feed additive containing the antibacterial peptide of claim 1 as an active ingredient. 제1항의 항균 펩타이드를 유효성분으로 함유하는 항균용 생물 농약.An antibacterial biological pesticide containing the antibacterial peptide of claim 1 as an active ingredient. 제1항의 항균 펩타이드를 유효성분으로 함유하는 방부 조성물.An antiseptic composition containing the antibacterial peptide of claim 1 as an active ingredient. 약학적으로 유효한 양의 제1항의 항균 펩타이드를 인간을 제외한 개체에 투여하는 단계를 포함하는 인간을 제외한 개체 내 항균 방법.An antibacterial method in an individual other than a human comprising the step of administering a pharmaceutically effective amount of the antimicrobial peptide of claim 1 to an individual other than human.
KR1020190082734A 2019-07-09 2019-07-09 Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof KR102224929B1 (en)

Priority Applications (1)

Application Number Priority Date Filing Date Title
KR1020190082734A KR102224929B1 (en) 2019-07-09 2019-07-09 Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof

Applications Claiming Priority (1)

Application Number Priority Date Filing Date Title
KR1020190082734A KR102224929B1 (en) 2019-07-09 2019-07-09 Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof

Publications (2)

Publication Number Publication Date
KR20210007075A KR20210007075A (en) 2021-01-20
KR102224929B1 true KR102224929B1 (en) 2021-03-10

Family

ID=74305186

Family Applications (1)

Application Number Title Priority Date Filing Date
KR1020190082734A KR102224929B1 (en) 2019-07-09 2019-07-09 Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof

Country Status (1)

Country Link
KR (1) KR102224929B1 (en)

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102419584B1 (en) * 2021-12-29 2022-07-11 주식회사 펩스젠 Composition comprising blood-brain barrier penetrating peptide as effective component and uses thereof

Families Citing this family (6)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
WO2023048411A1 (en) * 2021-09-24 2023-03-30 주식회사 펩스젠 Novel antimicrobial peptide and use thereof
KR102415725B1 (en) * 2021-12-29 2022-07-01 주식회사 펩스젠 Novel antimicrobial peptide H123 and uses thereof
KR102415734B1 (en) * 2021-09-24 2022-07-01 주식회사 펩스젠 Novel antimicrobial peptide and uses thereof
CN114424803B (en) * 2022-02-08 2023-11-10 中国海洋大学三亚海洋研究院 Inducer for urechis unicinctus larva adhesion metamorphosis and preparation method and application thereof
CN115785213B (en) * 2022-07-05 2023-11-03 浙江大学 Antibacterial octapeptide and application thereof
KR102506674B1 (en) * 2022-09-07 2023-03-09 주식회사 펩스젠 Antimicrobial peptide H103B having antimicrobial actvity against antibiotic-resistant pathogen and uses thereof

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110319336A1 (en) 2008-12-03 2011-12-29 Upstream Infinity, Inc. Selective anticancer chimeric peptide
WO2012046922A1 (en) 2010-10-08 2012-04-12 Korea Advanced Institute Of Science And Technology Novel use of antimicrobial peptides in regeneration of skin cells
KR101341210B1 (en) * 2013-01-24 2013-12-12 재단법인 지능형 바이오 시스템 설계 및 합성 연구단 Novel antimicrobial peptide and use thereof

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR101957014B1 (en) * 2017-04-18 2019-06-20 순천대학교 산학협력단 Peptides having anti-inflammatory activity and composition the same for anti-inflammatory

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
US20110319336A1 (en) 2008-12-03 2011-12-29 Upstream Infinity, Inc. Selective anticancer chimeric peptide
WO2012046922A1 (en) 2010-10-08 2012-04-12 Korea Advanced Institute Of Science And Technology Novel use of antimicrobial peptides in regeneration of skin cells
KR101341210B1 (en) * 2013-01-24 2013-12-12 재단법인 지능형 바이오 시스템 설계 및 합성 연구단 Novel antimicrobial peptide and use thereof

Non-Patent Citations (1)

* Cited by examiner, † Cited by third party
Title
MAR. DRUGS 2019, VOL.17, 159; P.1_11 [DOI:10.3390/MD17030159]

Cited By (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR102419584B1 (en) * 2021-12-29 2022-07-11 주식회사 펩스젠 Composition comprising blood-brain barrier penetrating peptide as effective component and uses thereof

Also Published As

Publication number Publication date
KR20210007075A (en) 2021-01-20

Similar Documents

Publication Publication Date Title
KR102224929B1 (en) Novel antimicrobial peptide derived from antimicrobial peptides isolated from Korean sea cucumber and uses thereof
KR102415725B1 (en) Novel antimicrobial peptide H123 and uses thereof
KR101734064B1 (en) Novel antimicrobial peptide derived from myxinidin peptide and uses thereof
KR101896927B1 (en) An anti-microbial peptide, Protaetiamycine 1 isolated from Protaetia brevitarsis seulensis and its synthetic composition
KR101629386B1 (en) An anti-microbial peptide Scolopendrasin-7 isolated from the Scolopendra subspinipes mutilans and its synthetic peptide
KR101595440B1 (en) The effect of antimicrobial activity of CMA3 analogue peptide derived from CA-MA
KR102415734B1 (en) Novel antimicrobial peptide and uses thereof
KR101444257B1 (en) A new scolopendrasin ii peptide isolated from the scolopendra subsinipes and its synthetic composition
KR101953828B1 (en) An anti-microbial peptide, Teleogryllusine 1 isolated from Teleogryllus emma and its synthetic composition
KR20180052181A (en) An anti-microbial peptide, Protaetiamycine 2 isolated from Protaetia brevitarsis seulensis and its synthetic composition
KR101743113B1 (en) An anti-microbial peptide, Oxyasin-1 isolated from Oxya chinensis sinuosa and its synthetic composition
KR102506674B1 (en) Antimicrobial peptide H103B having antimicrobial actvity against antibiotic-resistant pathogen and uses thereof
KR101953834B1 (en) An anti-microbial peptide, Teleogryllusine 2 isolated from Teleogryllus emma and its synthetic composition
KR102158036B1 (en) Novel antimicrobial peptide derived from Pseudin-2 peptide and uses thereof
WO2023048411A1 (en) Novel antimicrobial peptide and use thereof
US11077170B2 (en) Antimicrobial peptide from skate skin and uses thereof
KR102451854B1 (en) Novel antimicrobial peptide H103 and uses thereof
KR101686428B1 (en) An anti-microbial peptide, Periplanetasin-2 isolated from Periplaneta americana and its synthetic composition
KR102039400B1 (en) Novel antimicrobial peptide derived from mBjAMP1 peptide and uses thereof
KR101980897B1 (en) Novel antimicrobial peptide derived from LL37 peptide and uses thereof
KR101998106B1 (en) Novel antimicrobial peptide derived from Hp1404 peptide and uses thereof
KR102603281B1 (en) Novel peptide derived from Hylin a1 peptide and uses thereof
KR101624632B1 (en) A New Scolopendrasin-5 peptide isolated from the Scolopendra subspinipes and its synthetic composition
KR102358469B1 (en) Antimicrobial peptide derived from Impatiens balsamina and antimicrobial composition comprising the same
KR102430003B1 (en) Peptide, zophobacin-1 derived from zophobas atratus orientalis and uses thereof

Legal Events

Date Code Title Description
E701 Decision to grant or registration of patent right
GRNT Written decision to grant