CA2438030A1 - Methods of diagnosis of angiogenesis, compositions and methods of screening for angiogenesis modulators - Google Patents

Abstract

Described herein are methods and compositions that can be used for diagnosis and treatment of angiogenic phenotypes and angiogenesis-associated diseases.
Also described herein are methods that can be used to identify modulators of angiogenesis.

Description

DEMANDE OU BREVET VOLUMINEUX
LA PRESENTE PARTIE DE CETTE DEMANDE OU CE BREVET COMPREND
PLUS D'UN TOME.

~~ TTENANT LES PAGES 1 A 196 NOTE : Pour les tomes additionels, veuillez contacter 1e Bureau canadien des brevets JUMBO APPLICATIONS/PATENTS
THIS SECTION OF THE APPLICATION/PATENT CONTAINS MORE THAN ONE
VOLUME

NOTE: For additional volumes, please contact the Canadian Patent Office NOM DU FICHIER / FILE NAME
NOTE POUR LE TOME / VOLUME NOTE:

METHODS OF DIAGNOSIS OF ANGIOGENESIS, COMPOSITIONS
AND METHODS OF SCREENING FOR ANGIOGENESIS
MODULATORS
CROSS-REFERENCES TO RELATED APPLICATIONS
This application claims priority to USSN 09/784,356, filed February 14 2001;
USSN 09/791,390, filed February 22, 2001; USSN 60/285,475, filed April 19, 2001, USSN
60/310,025, filed August 3, 2001, and USSN 60/334,244, filed November 29, 2001, each of which is herein incorporated by reference in its entirety.
FIELD OF THE INVENTION
The invention relates to the identification of nucleic acid and protein expression profiles and nucleic acids, products, and antibodies thereto that are involved in angiogenesis; and to the use of such expression profiles and compositions in diagnosis and therapy of angiogenesis. The invention further relates to methods for identifying and using agents and/or targets that modulate angiogenesis.
BACKGROUND OF THE INVENTION
Both vasculogenesis, the development of an interactive vascular system comprising arteries and veins, and angiogenesis, the generation of new blood vessels, play a role in embryonic development. In contrast, angiogenesis is limited in a normal adult to the placenta, ovary, endometrium and sites of wound healing. However, angiogenesis, or its absence, plays an important role in the maintenance of a variety of pathological states. Some of these states are characterized by neovascularization, e.g., cancer, diabetic retinopathy, glaucoma, and age related macular degeneration. Others, e.g., stroke, infertility, heart disease, ulcers, and scleroderma, are diseases of angiogenic insufficiency.
Angiogenesis has a number of stages (see, e.g., Folkman, J.Natl Cancer Ihst.
82:4-6, 1990; Firestein, J Cliff Invest.103:3-4, 1999; Koch, Arthritis Rheum.41:951-62, 1998;
Carter, Oncologist 5(Suppl 1):51-4, 2000; Browder et al., Cancer Res. 60:1878-86, 2000; and Zhu and Witte, Invest New Drugs 17:195-212, 1999). The early stages of angiogenesis include endothelial cell protease production, migration of cells, and proliferation. The early stages also appear to require some growth factors, with VEGF, TGF-a, angiostatin, and selected chemokines all putatively playing a role. Later stages of angiogenesis include population of the vessels with mural cells (pericytes or smooth muscle cells), basement membrane production, and the induction of vessel bed specializations. The final stages of vessel formation include what is known as "remodeling", wherein a forming vasculature becomes a stable, mature vessel bed. Thus, the process is lughly dynamic, often requiring coordinated spatial and temporal waves of gene expression.
Conversely, the complex process may be subject to disruption by interfering with one or more critical steps. Thus, the lack of understanding of the dynamics of angiogenesis prevents therapeutic intervention in serious diseases such as those indicated. It is an object of the invention to provide methods that can be used to screen compounds for the ability to modulate angiogenesis. Additionally, it is an object to provide molecular targets for therapeutic intervention in disease states which either have an undesirable excess or a deficit in angiogenesis. The present invention provides solutions to both.
SUMMARY OF THE INVENTION
The present invention provides compositions and methods for detecting or modulating angiogenesis associated sequences.
In one aspect, the invention provides a method of detecting an angiogenesis-associated transcript in a cell in a patient, the method comprising contacting a biological sample from the patient with a polynucleotide that selectively hybridized to a sequence at least 80% identical to a sequence as shown in Tables 1-8. In one embodiment, the biological sample is a tissue sample. In another embodiment, the biological sample comprises isolated nucleic acids, which are often mRNA.
In another embodiment, the method further comprises the step of amplifying nucleic acids before the step of contacting the biological sample with the polynucleotide.
Often, the polynucleotide comprises a sequence as shown in Tables 1-8. The polynucleotide can be labeled, for example, with a fluorescent label and can be immobilized on a solid surface.
In other embodiments the patient is undergoing a therapeutic regimen to treat a disease associated with angiogenesis or the patient is suspected of having an angiogenesis-associated disorder.

Tn another aspect, the invention comprises an isolated nucleic acid molecule consisting of a polynucleotide sequence as shown in Tables 1-8. The nucleic acid molecule can be labeled, for example, with a fluorescent label, In other aspects, the invention provides an expression vector comprising an isolated nucleic acid molecule consisting of a polynucleotide sequence as shown in Tables 1-8 or a host cell comprising the expression vector.
In another embodiment, the isolated nucleic acid molecule encodes a polypeptide having an amino acid sequence as shown in Table 8.
In another aspect, the invention provides an isolated polypeptide which is encoded by a nucleic acid molecule having polynucleotide sequence as shown in Tables 1-8.
In one embodiment, the isolated polypeptide has an amino acid sequence as shown in Table 8.
In another embodiment, the invention provides an antibody that specifically binds a polypeptide that has an amino acid sequence as shown in Table 8 or which is encoded by a nucleotide sequence of Tables 1-8 . The antibody can be conjugated or fused to an effector component such as a fluorescent label, a toxin, or a radioisotope. In some embodiments, the antibody is an antibody fragment or a humanized antibody.
In another aspect, the invention provides a method of detecting a cell undergoing angiogenesis in a biological sample from a patient, the method comprising contacting the biological sample with an antibody that specifically binds to a polypeptide that has an amino acid sequence as shown in Table 8 or which is encoded by a nucleotide sequence of Tables 1-8 . ' In some embodiments, the antibody is further conjugated or fused to an effector component, for example, a fluorescent label.
In another embodiment, the invention provides a method of detecting antibodies specific to angiogenesis in a patient, the method comprising contacting a biological sample from the patient with a polypeptide which is encoded by a nucleotide sequence of Tables 1-8.
The invention also provides a method of identifying a compound that modulates the activity of an angiogenesis-associated polypeptide, the method comprising the steps of: (i) contacting the compound with a polypeptide that comprises at least 80% identity to an amino acid sequence as shown in Table 8 or Which is encoded by a nucleotide sequence of Tables 1-8; and (ii) detecting an increase or a decrease in the activity of the polypeptide.
In one embodiment, the polypeptide has an amino acid sequence as shown in Table 8 or is a polypeptide encoded by a nucleotide sequence of Tables 1-8. In a~iother embodiment, the polypeptide is expressed in a cell.
The invention also provides a method of identifying a compound that modulates angiogenesis, the method comprising steps of (i) contacting the compound with a cell undergoing angiogenesis; and (ii) detecting an increase or a decrease in the expression of a polypeptide sequence as shown in Table 8 or a polypeptide which is encoded by a nucleotide sequence of Tables 1-8. In one embodiment, the detecting step comprises hybridizing a nucleic acid sample from the cell with a polynucleotide that selectively hybridizes to a sequence at least 80% identical to a sequence as shown in Tables 1-8. In another embodiment, the method further comprises detecting an increase or decrease in the expression of a second sequence as shown in Table 8 or a polypeptide which is encoded by a nucleotide sequence of Tables 1-8 .
In another embodiment, the invention provides a method of inhibiting angiogenesis in a cell that expresses a polypeptide at least 80% identical to a sequence as shown in Table 8 or which is 80% identical to a polypeptide encoded by a nucleotide sequence of Tables 1-8 , the method comprising the step of contacting the cell with a therapeutically effective amount of an inhibitor of the polypeptide. In one embodiment, the polypeptide has an amino acid sequence shown in Table 8 or is a polypeptide which is encoded by a nucleotide sequence of Tables 1-8 . In another embodiment, the inhibitor is an antibody.
In other embodiments, the invention provides a method of activating angiogenesis in a cell that expresses a polypeptide at least 80% identical to a sequence as shown in Table 8 or at least 80% identical to a polypeptide which is encoded by a nucleotide sequence of Tables 1-8 , the method comprising the step of contacting the cell with a therapeutically effective amount of an activator of the polypeptide. In one embodiment, the polypeptide has an amino acid sequence shown in Table 8 or is a polypeptide which is encoded by a nucleotide sequence of Tables 1-8.
Other aspects of the invention will become apparent to the skilled artisan by the following description of the invention.
Tables 1-8 provide nucleotide sequence of genes that exhibit changes in expression levels as a function of time in tissue undergoing angiogenesis compared to tissue that is not.

DESCRIPTION OF THE SPECIFIC EMBODIMENTS
In accordance with the obj ects outlined above, the present invention provides novel methods for diagnosis and treatment of disorders associated with angiogenesis (sometimes referred to herein as angiogenesis disorders or AD), as well as methods for screening for compositions which modulate angiogenesis. By "disorder associated with angiogenesis" or "disease associated with angiogenesis" herein is meant a disease state which is marked by either an excess or a deficit of blood vessel development.
Angiogenesis disorders asociated with increased angiogenesis include, but are not limited to, cancer and proliferative diabetic retinopathy. Pathological states for which it may be desirable to increase angiogenesis include stroke, heart disease, infertility, ulcers, wound healing, ischemia, and scleradoma. Solid tumors typically require angiogenesis to support or sustain growth, e.g., breast, colon, lung, brain, bladder, and prostate tumors. Other AD include, e.g., arthritis, inflammatory bowel disease, diabetis retinopathy, macular degeneration, atherosclerosis, and psoriasis. Also provided are methods for treating AD.
Definitions The term "angiogenesis protein" or "angiogenesis polynucleotide" refers to nucleic acid and polypeptide polymorphic variants, alleles, mutants, and interspecies homologs that: (1) have an amino acid sequence that has greater than about 60%
amino acid sequence identity, 65%, 70%, 75%, 80%, 85%, 90%, preferably 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98% or 99% or greater amino acid sequence identity, preferably over a region of over a region of at least about 25, 50, 100, 200, 500, 1000, or more amino acids, to an angiogenesis protein sequence of Table 8; (2) bind to antibodies, e.g., polyclonal antibodies, raised against an imrnunogen comprising an amino acid sequence of Table 8, and conservatively modified variants thereof; (3) specifically hybridize under stringent hybridization conditions to an anti-sense strand corresponding to a nucleic acid sequence of Tables 1-8 and conservatively modified variants thereof; (4) have a nucleic acid sequence that has greater than about 95%, preferably greater than about 96%, 97%, 98%, 99%, or higher nucleotide sequence identity, preferably over a region of at least about 25, 50, 100, 200, 500, 1000, or more nucleotides, to a sense sequence corresponding to one set out in Tables 1-8 . A polynucleotide or polypeptide sequence is typically from a mammal including, but not limited to, primate, e.g., human; rodent, e.g., rat, mouse, hamster; cow, pig, horse, sheep, or any mammal. An "angiogenesis polypeptide" and an "angiogenesis polynucleotide," include both naturally occurring or recombinant.

A "full length" angiogenesis protein or nucleic acid refers to an agiogenesis polypeptide or polynucleotide sequence, or a variant thereof, that contains all of the elements normally contained in one or more naturally occurring, wild type angiogenesis polynucleotide or polypeptide sequences. The "full length" may be prior to, or after, various stages of post-s translation processing.
"Biological sample" as used herein is a sample of biological tissue or fluid that contains nucleic acids or polypeptides, e.g., of an angiogenic protein. Such samples include, but are not limited to, tissue isolated from primates, e.g., humans, or rodents, e.g., rnice, and rats. Biological samples may also include sections of tissues such as biopsy and autopsy samples, and frozen sections taken for histologic purposes. A biological sample is typically obtained from a eukaryotic organism, most preferably a mammal such as a primate e.g., chimpanzee or human; cow; dog; cat; a rodent, e.g., guinea pig, rat, mouse;
rabbit; or a bird;
reptile; or fish.
"Providing a biological sample" means to obtain a biological sample for use in methods described in this invention. Most often, this will be done by removing a sample of cells from an animal, but can also be accomplished by using previously isolated cells (e.g., isolated by another person, at another time, and/or for another purpose), or by performing the methods of the invention ifz vivo. Archival tissues, having treatment or outcome histroy, will be particularly useful.
The terms "identical" or percent "identity," in the context of two or more nucleic acids or polypeptide sequences, refer to two or more sequences or subsequences that are the same or have a specified percentage of amino acid residues or nucleotides that are the same (i.e., about 70% identity, preferably 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or higher identity over a specified region (e.g., SEQ ID
NOS:1-229), when compared and aligned for maximum correspondence over a comparison window or designated region) as measured using a BLAST or BLAST 2.0 sequence comparison algorithms with default parameters described below, or by manual alignment and visual inspection (see, e.g., NCBI web site http://www.ncbi.nlm.nih.gov/BLAST/ or the like). Such sequences are then said to be "substantially identical." This definition also refers to, or may be applied to, the compliment of a test sequence. The definition also includes sequences that have deletions and/or additions, as well as those that have substitutions. As described below, the preferred algorithms can account for gaps and the like. Preferably, identity exists over a region that is at least about 25 amino acids or nucleotides in length, or more preferably over a region that is 50-100 amino acids or nucleotides in length.

For sequence comparison, typically one sequence acts as a reference sequence, to which test sequences are compared. When using a sequence comparison algorithm, test a.nd reference sequences are entered into a computer, subsequence coordinates are designated, if necessary, and sequence algorithm program parameters are designated.
Preferably, default program parameters can be used, or alternative parameters can be designated.
The sequence comparison algorithm then calculates the percent sequence identities for the test sequences relative to the reference sequence, based on the program parameters.
A "comparison window", as used herein, includes reference to a segment of any one of the number of contiguous positions selected from the group consisting of from 20 to 600, usually about 50 to about 200, more usually about 100 to about 150 in which a sequence may be compared to a reference sequence of the same number of contiguous positions after the two sequences are optimally aligned. Methods of alignment of sequences for comparison are well-known in the art. Optimal alignment of sequences for comparison can be conducted, e.g., by the local homology algorithm of Smith & Waterman, Adv. Appl.
Math. 2:482 (1981), by the homology alignment algorithm of Needleman & Wunsch, .J. Mol.
Biol. 48:443 (1970), by the search for similarity method of Pearson & Lipman, PYOG. Nat'l.
Acad. Sci. USA 85:2444 (1988), by computerized implementations of these algorithms (GAP, BESTFIT, FASTA, and TFASTA in the Wisconsin Genetics Software Package, Genetics Computer Group, 575 Science Dr., Madison, WI), or by manual alignment and visual inspection (see, e.g., Cu~ret~t Protocols ira Molecular Biology (Ausubel et al., eds.
1995 supplement)).
A preferred example of algorithm that is suitable for determining percent sequence identity and sequence similarity are the BLAST and BLAST 2.0 algorithms, which are described in Altschul et al., Nuc. Acids Res. 25:3389-3402 (1977) and Altschul et al., J.
Mol. Biol. 215:403-410 (1990), respectively. BLAST and BLAST 2.0 are used, with the parameters described herein, to determine percent sequence identity for the nucleic acids and proteins of the invention. Software for performing BLAST analyses is publicly available through the National Center for Biotechnology Information (http://www.ncbi.nlin.nih.gov/).
This algorithm involves first identifying high scoring sequence pairs (HSPs) by identifying short words of length W in the query sequence, which either match or satisfy some positive-valued threshold score T when aligned with a word of the same length in a database sequence. T is referred to as the neighborhood word score threshold (Altschul et al., supra).
These initial neighborhood word hits act as seeds for initiating searches to find longer HSPs containing them. The word hits are extended in both directions along each sequence for as far as the cumulative alignment score can be increased. Cumulative scores are calculated using, for nucleotide sequences, the parameters M (reward score for a pair of matching residues; always > 0) and N (penalty score for mismatching residues; always <
0). For amino acid sequences, a scoring matrix is used to calculate the cumulative score.
Extension of the word hits in each direction are halted when: the cumulative alignment score falls off by the quantity X from its maximum achieved value; the cumulative score goes to zero or below, due to the accumulation of one or more negative-scoring residue alignments; or the end of either sequence is reached. The BLAST algorithm parameters W, T, and X
determine the sensitivity and speed of the alignment. The BLASTN program (for nucleotide sequences) uses as defaults a wordlength (W) of 11, an expectation (E) of 10, M=5, N=-4 and a comparison of both strands. For amino acid sequences, the BLASTP program uses as defaults a wordlength of 3, and expectation (E) of 10, and the BLOSUM62 scoring matrix (see Henikoff & Henikoff, Proc. Natl. Acad. Sci. USA 89:10915 (1989)) alignments (B) of 50, expectation (E) of 10, M=5, N=-4, and a comparison of both strands.
The BLAST algorithm also performs a statistical analysis of the similarity between two sequences (see, e.g., Marlin &. Altschul, Proc. Nat'l. Acad. Sci.
USA 90:5873-5787 (1993)). One measure of similarity provided by the BLAST algorithm is the smallest sum probability (P(1~), which provides an indication of the probability by which a match between two nucleotide or amino acid sequences would occur by chance. For example, a nucleic acid is considered similar to a reference sequence if the smallest sum probability in a comparison of the test nucleic acid to the reference nucleic acid is less than about 0.2, more preferably less than about 0.01, and most preferably less than about 0.001.
An indication that two nucleic acid sequences or polypeptides are substantially identical is that the polypeptide encoded by the first nucleic acid is immunologically cross reactive with the antibodies raised against the polypeptide encoded by the second nucleic acid, as described below. Thus, a polypeptide is typically substantially identical to a second polypeptide, for example, where the two peptides differ only by conservative substitutions.
Another indication that two nucleic acid sequences are substantially identical is that the two molecules or their complements hybridize to each other under stringent conditions, as described below. Yet another indication that two nucleic acid sequences are substantially identical is that the same primers can be used to amplify the sequences.
A "host cell" is a naturally occurring cell or a transformed cell that contains an expression vector and supports the replication or expression of the expression vector. Host cells may be cultured cells, explants, cells in vivo, and the like. Host cells may be prokaryotic cells such as E. coli, or eukaryotic cells such as yeast, insect, amphibian, or mammalian cells such as CHO, HeLa, and the like (see, e.g., the American Type Culture Collection catalog or web site, www.atcc.org).
The terms "polypeptide," "peptide" and "protein" are used interchangeably herein to refer to a polymer of amino acid residues. The terms apply to amino acid polymers in which one or more amino acid residue is an artificial chemical mimetic of a corresponding naturally occurring amino acid, as well as to naturally occurnng amino acid polymers and non-naturally occurring amino acid polymer.
The term "amino acid" refers to naturally occurnng and synthetic amino acids, as well as amino acid analogs and amino acid mimetics that function in a manner similar to the naturally occurring amino acids. Naturally occurring amino acids are those encoded by the genetic code, as well as those amino acids that are later modified, e.g., hydroxyproline, y-carboxyglutamate, and O-phosphoserine. Amino acid analogs refers to compounds that have the same basic chemical structure as a naturally occurring amino acid, i.e., an a carbon that is bound to a hydrogen, a carboxyl group, an amino group, and an R group, e.g., homoserine, norleucine, methionine sulfoxide, methionine methyl sulfonium. Such analogs have modified R groups (e.g., norleucine) or modified peptide backbones, but retain the same basic chemical structure as a naturally occurnng amino acid. Amino acid mimetics refers to chemical compounds that have a structure that is different from the general chemical structure of an amino acid, but that functions in a manner similar to a naturally occurring amino acid.
Amino acids may be referred to herein by either their commonly known three letter symbols or by the one-letter symbols recommended by the IUPAC-IUB
Biochemical Nomenclature Commission. Nucleotides, likewise, may be referred to by their commonly accepted single-letter codes.
"Conservatively modified variants" applies to both amino acid and nucleic acid sequences. With respect to particular nucleic acid sequences, conservatively modified variants refers to those nucleic acids which encode identical or essentially identical amino acid sequences, or where the nucleic acid does not encode an amino acid sequence, to essentially identical sequences. Because of the degeneracy of the genetic code, a large number of functionally identical nucleic acids encode any given protein. For instance, the codons GCA, GCC, GCG and GCU all encode the amino acid alanine. Thus, at every position where an alanine is specified by a codon, the codon can be altered to any of the corresponding codons described without altering the encoded polypeptide. Such nucleic acid variations are "silent variations," which are one species of conservatively modified variations. Every nucleic acid sequence herein wl>ich encodes a polypeptide also describes every possible silent variation of the nucleic acid. One of skill will recognize that each codon in a nucleic acid (except AUG, which is ordinarily the only codon for methionine, and TGG, which is ordinarily the only codon for tryptophan) can be modified to yield a functionally identical molecule. Accordingly, each silent variation of a nucleic acid which encodes a polypeptide is implicit in each described sequence with respect to the expression product, but not with respect to actual probe sequences.
As to amino acid sequences, one of skill will recognize that individual substitutions, deletions or additions to a nucleic acid, peptide, polypeptide, or protein sequence which alters, adds or deletes a single amino acid or a small percentage of amino acids in the encoded sequence is a "conservatively modified variant" where the alteration results in the substitution of an amino acid with a chemically similar amino acid.
Conservative substitution tables providing functionally similar amino acids are well known in the art. Such conservatively modified variants are in addition to and do not exclude polymorphic variants, interspecies homologs, and alleles of the invention.
The following eight groups each contain amino acids that are conservative substitutions for one another: l) Alanine (A), Glycine (G); 2) Aspartic acid (D), Glutamic acid (E); 3) Asparagine (1~, Glutamine (Q); 4) Arginine (R), Lysine (I~); 5) Isoleucine (I), Leucine (L), Methionine (M), Valine (V); 6) Phenylalanine (F), Tyrosine (Y), Tryptophan (W); 7) Serine (S), Threonine (T); and 8) Cysteine (C), Methionine (M) (see, e.g., Creighton, Proteins (1984)).
Macromolecular structures such as polypeptide structures can be described in terms of various levels of organization. For a general discussion of this organization, see, e.g., Alberts et al., Molecular Biology of the Cell (3rd ed., 1994) and Cantor and Schimmel, Biophysical ChemistYy Part L' The Confof~tnatioh of Biological Macromolecules (1980).
"Primary structure" refers to the amino acid sequence of a particular peptide.
"Secondary structure" refers to locally ordered, three dimensional structures within a polypeptide. These structures are commonly known as domains. Domains are portions of a polypeptide that form a compact unit of the polypeptide and are typically 25 to approximately 500 amino acids long. Typical domains are made up of sections of lesser organization such as stretches of (3-sheet and a,-helices. "Tertiary structure" refers to the complete three dimensional structure of a polypeptide monomer. "Quaternary structure" refers to the three dimensional structure formed, usually by the noncovalent association of independent tertiary units.
Anisotropic terms are also known as energy teens.
A "label" or a "detectable moiety" is a composition detectable by spectroscopic, photochemical, biochemical, immunochemical, chemical, or other physical means. For example, useful labels include 3aP, fluorescent dyes, electron-dense reagents, enzymes (e.g., as commonly used in an ELISA), biotin, digoxigenin, or haptens and proteins which ca.n be made detectable, e.g., by incorporating a radiolabel into the peptide or used to detect antibodies specifically reactive with the peptide.
An "effector" or "effector moiety" or "effector component" is a molecule that is bound (or linked, or conjugated), either covalently, through a linker or a chemical bond, or noncovalently, through ionic, van der Waals, electrostatic, or hydrogen bonds, to an antibody.
The "effector" can be a variety of molecules including, for example, detection moieties including radioactive compounds, fluroescent compounds, an enzyme or substrate, tags such as epitope tags, a toxin; a chemotherapeutic agent; a lipase; an antibiotic;
or a radioisotope emitting "hard" e.g., beta radiation.
A "labeled nucleic acid probe or oligonucleotide" is one that is bound, either covalently, through a linker or a chemical bond, or noncovalently, through ionic, van der Waals, electrostatic, or hydrogen bonds .to a label such that the presence of the probe may be detected by detecting the presence of the label bound to the probe.
Alternatively, method using high affinity interactions may achieve the same results where one of a pair of binding partners binds to the other, e.g., biotin, streptavidin.
As used herein a "nucleic acid probe or oligonucleotide" is defined as a nucleic acid capable of binding to a target nucleic acid of complementary sequence through one or more types of chemical bonds, usually through complementary base pairing, usually through hydrogen bond formation. As used herein, a probe may include natural (i.e., A, G, C, or T) or modified bases (7-deazaguanosine, inosine, etc.). In addition, the bases in a probe may be joined by a linkage other than a phosphodiester bond, so long as it does not interfere with hybridization. Thus, for example, probes may be peptide nucleic acids in which the constituent bases are joined by peptide bonds rather than phosphodiester linkages. It will be understood by one of skill in the art that probes may bind target sequences lacking complete complementarity with the probe sequence depending upon the stringency of the hybridization conditions. The probes are preferably directly labeled as with isotopes, chrom~phores, luxniphores, chromogens, or indirectly labeled such as with biotin to which a streptavidin complex may later bind. By assaying for the presence or absence of the probe, one can detect the presence or absence of the select sequence or subsequence.
The term "recombinant" when used with reference, e.g., to a cell, or nucleic acid, protein, or vector, indicates that the cell, nucleic acid, protein or vector, has been modified by the introduction of a heterologous nucleic acid or protein or the alteration of a native nucleic acid or protein, or that the cell is derived from a cell so modified. Thus, for example, recombinant cells express genes that are not found within the native (non-recombinant) form of the cell or express native genes that are otherwise abnormally expressed, under expressed or not expressed at all.
The term "heterologous" when used with reference to portions of a nucleic acid indicates that the nucleic acid comprises two or more subsequences that are not found in the same relationship to each other in nature. For instance, the nucleic acid is typically recombinantly produced, having two or more sequences from unrelated genes arranged to make a new functional nucleic acid, e.g., a promoter from one source and a coding region from another source. Similarly, a heterologous protein indicates that the protein comprises two or more subsequences that are not found in the same relationship to each other in nature (e.g., a fusion protein).
A "promoter" is defined as an array of nucleic acid control sequences that direct transcription of a nucleic acid. As used herein, a promoter includes necessary nucleic acid sequences near the start site of transcription, such as, in the case of a polymerise II type promoter, a TATA element. A promoter also optionally includes distal enhancer or repressor elements, which can be located as much as several thousand base pairs from the start site of transcription. A "constitutive" promoter is a promoter that is active under most environmental and developmental conditions. An "inducible" promoter is a promoter that is active under environmental or developmental regulation. The term "operably linked" refers to a functional linkage between a nucleic acid expression control sequence (such as a promoter, or array of transcription factor binding sites) and a second nucleic acid sequence, wherein the expression control sequence directs transcription of the nucleic acid corresponding to the second sequence.
An "expression vector" is a nucleic acid construct, generated recombinantly or synthetically, with a series of specified nucleic acid elements that permit transcription of a particular nucleic acid in a host cell. The expression vector can be part of a plasmid, virus, or nucleic acid fragment. Typically, the expression vector includes a nucleic acid to be transcribed operably linked to a promoter.

The phrase "selectively (or specifically) hybridizes to" refers to the binding, duplexing, or hybridizing of a molecule only to a particular nucleotide sequence under stringent hybridization conditions when that sequence is present in a complex mixture (e.g., total cellular or library DNA or RNA).
The phrase "stringent hybridization conditions" refers to conditions under which a probe will hybridize to its target subsequence, typically in a complex mixture of nucleic acids, but to no other sequences. Stringent conditions are sequence-dependent and will be different in different circumstances. Longer sequences hybridize specifically at higher temperatures. An extensive guide to the hybridization of nucleic acids is found in Tijssen, Tech.fziques in Biochemistry and Molecular Biology--Hyb~idi~atiou with Nucleic Probes, "Overview of principles of hybridization and the strategy of nucleic acid assays"
(1993). Generally, stringent conditions are selected to be about 5-10°C
lower than the thermal melting point (Tm) for the specific sequence at a defined ionic strength pH. The Tm is the temperature (under defined ionic strength, pH, and nucleic concentration) at which 50%
of the probes complementary to the target hybridize to the target sequence at equilibrium (as the target sequences are present in excess, at Tm, 50% of the probes are occupied at equilibrium). Stringent conditions will be those in which the salt concentration is less than about 1.0 M sodium ion, typically about 0.01 to 1.0 M sodium ion concentration (or other salts) at pH 7.0 to 8.3 and the temperature is at least about 30°C for short probes (e.g., 10 to SO nucleotides) and at least about 60°C for long probes (e.g., greater than 50 nucleotides).
Stringent conditions may also be achieved with the addition of destabilizing agents such as formamide. For selective or specific hybridization, a positive signal is at least two times background, preferably 10 times background hybridization. Exemplary stringent hybridization conditions can be as following: 50% formamide, Sx SSC, and 1%
SDS, incubating at 42°C, or, Sx SSC, 1% SDS, incubating at 65°C, with wash in 0.2x SSC, and 0.1% SDS at 65°C. For PCR, a temperature of about 36°C is typical for low stringency amplification, although annealing temperatures may vary between about 32°C and 48°C
depending on primer length. For high stringency PCR amplification, a temperature of about 62°C is typical, although high stringency annealing temperatures can range from about 50°C
to about 65°C, depending on the primer length and specificity. Typical cycle conditions for both high and low stringency amplifications include a denaturation phase of 90°C - 95°C for 30 sec - 2 min., an annealing phase lasting 30 sec. - 2 min., and an extension phase of about 72°C for 1 - 2 min. Protocols and guidelines for low and high stringency amplification reactions are provided, e.g., in Innis et al. (1990) PCR Protocols, A Guide to Methods and Applications, Academic Press, Inc. N.Y.).
Nucleic acids that do not hybridize to each other under stringent conditions are still substantially identical if the polypeptides which they encode are substantially identical.
This occurs, for example, when a copy of a nucleic acid is created using the maximum codon degeneracy permitted by the genetic code. Iii such cases, the nucleic acids typically hybridize under moderately stringent hybridization conditions. Exemplary "moderately stringent hybridization conditions" include a hybridization in a buffer of 40%
formamide, 1 M NaCI, 1% SDS at 37°C, and a wash in 1X SSC at 45°C. A positive hybridization is at least twice background. Those of ordinary skill will readily recognize that alternative hybridization and wash conditions can be utilized to provide conditions of similar stringency.
Additional guidelines for determining hybridization parameters are provided in numerous reference, e.g., and Current Protocols in Molecular Biology, ed. Ausubel, et al The phrase "functional effects" in the context of assays for testing compounds that modulate activity of an angiogenesis protein includes the determination of a parameter that is indirectly or directly under the influence of the angiogenesis protein, e.g., a functional, physical, or chemical effect, such as the ability to increase or decrease angiogenesis. It includes binding activity, the ability of cells to proliferate, expression in cells undergoing angiogenesis, and other characteristics of angiogenic cells. "Functional effects" include ih vitYO, ih vivo, and ex vivo activities.
By "determining the functional effect" is meant assaying for a compound that increases or decreases a parameter that is indirectly or directly under the influence of an angiogenesis protein sequence, e.g., functional, physical and chemical effects. Such functional effects can be measured by any means known to those skilled in the art, e.g., changes in spectroscopic characteristics (e.g., fluorescence, absorbance, refractive index), hydrodynamic (e.g., shape), chromatographic, or solubility properties for the protein, measuring inducible markers or transcriptional activation of the angiogenesis protein;
measuring binding activity or binding assays, e.g. binding to antibodies, and measuring cellular proliferation, particularly endothelial cell proliferation, cell viability, cell division especially of endothelial cells, lumen formation and capillary or vessel growth or formation.
Determination of the functional effect of a compound on angiogenesis can also be performed using angiogenesis assays known to those of skill in the art such as an ih vitf°o assays, e.g., in vitro endothelial cell tube formation assays, and other assays such as the chick CAM assay, the mouse corneal assay, and assays that assess vascularization of an implanted tumor. The functional effects can be evaluated by many means known to those skilled in the art, e.g., microscopy for quantitative or qualitative measures of alterations in morphological features, e.g., tube or blood 'vessel formation, measurement of changes in RNA or protein levels for angiogenesis-associated sequences, measurement of RNA stability, identification of downstream or reporter gene expression (CAT, luciferase, [3-gal, GFP and the like), e.g., via chemiluminescence, fluorescence, colorimetric reactions, antibody binding, inducible markers, and ligand binding assays.
"Inhibitors", "activators", and "modulators" of angiogenic polynucleotide and polypeptide sequences are used to refer to activating, inhibitory, or modulating molecules identified using ih vitro and ih vivo assays of angiogenic polynucleotide and polypeptide sequences. Inhibitors are compounds that, e.g., bind to, partially or totally block activity, decrease, prevent, delay activation, inactivate, desensitize, or down regulate the activity or expression of angiogenesis proteins, e.g., antagonists. "Activators" are compounds that increase, open, activate, facilitate, enhance activation, sensitize, agonize, or up regulate angiogenesis protein activity. Inhibitors, activators, or modulators also include genetically modified versions of angiogenesis proteins, e.g., versions with altered activity, as well as naturally occurring and synthetic ligands, antagonists, agonists, antibodies, small chemical molecules and the like. Such assays for inhibitors and activators include, e.g., expressing the angiogenic protein ih vitf~o, in cells, or cell membranes, applying putative modulator compounds, and then determining the functional effects on activity, as described above.
Activators and inhibitors of angiogenesis can also be identified by incubating angiogenic cells with the test compound and determining increases or decreases in the expression of 1 or more angiogenesis proteins, e.g., 1, 2, 3, 4, 5, 10, 15, 20, 25, 30, 40, 50 or more angiogenesis proteins, such as angiogenesis proteins comprising the sequences set out in Table 8.
Samples or assays comprising angiogenesis proteins that are treated with a potential activator, inhibitor, or modulator are compared to control samples without the inhibitor, activator, or modulator to examine the extent of inhibition.
Control samples (untreated with inhibitors) are assigned a relative protein activity value of 100%. Inhibition of a polypeptide is achieved when the activity value relative to the control is about 80%, preferably 50%, more preferably 25-0%. Activation of an angiogenesis polypeptide is achieved when the activity value relative to the control (untreated with activators) is 110%, more preferably 150%, more preferably 200-500% (i.e., two to five fold higher relative to the control), more preferably 1000-3000% higher.

"Antibody" refers to a polypeptide comprising a framework region from an immunoglobulin gene or fragments thereof that specifically binds and recognizes an antigen.
The recognized immunoglobulin genes include the kappa, lambda, alpha, gamma, delta, epsilon, and mu constant region genes, as well as the myriad immunoglobulin variable region genes. Light chains are classified as either kappa or lambda. Heavy chains are classified as gamma, mu, alpha, delta, or epsilon, which in turn define the immunoglobulin classes, IgG, IgM, IgA, IgD and IgE, respectively. Typically, the antigen-binding region of an antibody will be most critical in specificity and affinity of binding.
An exemplary immunoglobulin (antibody) structural unit comprises a tetramer. Each tetramer is composed of two identical pairs of polypeptide chains, each pair having one "light" (about 25 kD) and one "heavy" chain (about 50-70 kD). The N-terminus of each chain defines a variable region of about 100 to 110 or more amino acids primarily responsible for antigen recognition. The terms variable light chain (VL) and variable heavy chain (VH) refer to these light and heavy chains respectively.
Antibodies exist, e.g., as intact imrnunoglobulins or as a number of well-characterized fragments produced by digestion with various peptidases. Thus, for example, pepsin digests an antibody below the disulfide linkages in the hinge region to produce F(ab)'2, a dimer of Fab which itself is a light chain joined to VH-CH1 by a disulfide bond. The F(ab)'?
may be reduced under mild conditions to break the disulfide linkage in the hinge region, thereby converting the F(ab)'2 dimer into an Fab' monomer. The Fab' monomer is essentially Fab with part of the hinge region (see Fundamental Immunology (Paul ed., 3d ed.
1993). While various antibody fragments are defined in terms of the digestion of an intact antibody, one of skill will appreciate that such fragments may be synthesized de nouo either chemically or by using recombinant DNA methodology. Thus, the term antibody, as used herein, also includes antibody fragments either produced by the modification of whole antibodies, or those synthesized de novo using recombinant DNA methodologies (e.g., single chain Fv) or those identified using phage display libraries (see, e.g., McCafferty et al., Nature 348:552-554 (1990)) For preparation of antibodies, e.g., recombinant, monoclonal, or polyclonal antibodies, many technique known in the art can be used (see, e.g., Kohler &
Milstein, Nature 256:495-497 (1975); Kozbor et al., Immunology Today 4: 72 (1983); Cole et al., pp.
77-96 in Moraocloraal Antibodies and Cancey~ Therapy, Alan R. Liss, Inc.
(1985); Coligan, Current Protocols in Immunology (1991); Harlow & Lane, Antibodies, A
Laboratory Maraual (1988); and Coding, Monoclonal Antibodies: Principles and Practice (2d ed.
1986)).

Techniques for the production of single chain antibodies (U.S. Patent 4,946,778) can be adapted to produce antibodies to polypeptides of this invention. Also, transge~uc mice, or other organisms such as other mammals, may be used to express humanized antibodies.
Alternatively, phage display technology can be used to identify antibodies and heteromeric S Fab fragments that specifically bind to selected antigens (see, e.g., McCafferty et al., Nature 348:552-554 (1990); Marks et al., Biotechfaology 10:779-783 (1992)).
A "chimeric antibody" is an antibody molecule in which (a) the constant region, or a portion thereof, is altered, replaced or exchanged so that the antigen binding site (variable region) is linked to a constant region of a different or altered class, effector function andlor species, or an entirely different molecule which confers new properties to the chimeric antibody, e.g., an enzyme, toxin, hormone, growth factor, drug, etc.; or (b) the variable region, or a portion thereof, is altered, replaced or exchanged with a variable region having a different or altered antigen specificity.
The detailed description of the invention includes discussion of the following aspects of the invention: Expression of angiogenesis-associated sequences Informatics Angiogenesis-associated sequences Detection of angiogenesis sequence for diagnostic and therapeutic applications Modulators of angiogenesis Methods of identifying variant angiogenesis-associated sequences Administration of pharmaceutical and vaccine compositions Kits for use in diagnostic and/or prognostic applications.
Expressioya o, f as~giogetzesis-associated sequences In one aspect, the expression levels of genes are determined in different patient samples for which diagnosis information is desired, to provide expression profiles.
An expression profile of a particular sample is essentially a "fingerprint" of the state of the sample; while two states may have any particular gene similarly expressed, the evaluation of a number of genes simultaneously allows the generation of a gene expression profile that is unique to the state of the cell. That is, normal tissue may be distinguished from AD tissue.
By comparing expression profiles of tissue in known different angiogenesis states, information regarding which genes are important (including both up- and down-regulation of genes) in each of these states is obtained. The identification of sequences that axe differentially expressed in angiogenic versus non-angiogenic tissue allows the use of this information in a number of ways. For example, a particular treatment regime may be evaluated: does a chemotherapeutic drug act to down-regulate angiogenesis, and thus tumor growth or recurrence, in a particular patient. Similarly, diagnosis and treatment outcomes may be done or confirmed by comparing patient samples with the known expression profiles.
Angiogenic tissue can also be analyzed to determine the stage of angiogenesis in the tissue.
Furthermore, these gene expression profiles (or individual genes) allow screening of drug candidates with an eye to mimicking or altering a particular expression profile; for example, screening can be done for drugs that suppress the angiogenic expression profile. This may be done by making biochips comprising sets of the important angiogenesis genes, which can then be used in these screens. These methods can also be done on the protein basis; that is, protein expression levels of the angiogenic proteins can be evaluated for diagnostic purposes or to screen candidate agents. In addition, the angiogenic nucleic acid sequences can be administered for gene therapy purposes, including the administration of antisense nucleic 1 S acids, or the angiogenic proteins (including antibodies and other modulators thereof) administered as therapeutic drugs.
Thus the present invention provides nucleic acid and protein sequences that are differentially expressed in angiogenesis, herein termed "angiogenesis sequences". As outlined below, angiogenesis sequences include those that are up-regulated (i.e. expressed at a higher level) in disorders associated with angiogenesis, as well as those that are down-regulated (i.e. expressed at a lower level). In a preferred embodiment, the angiogenesis sequences are from humans; however, as will be appreciated by those in the art, angiogenesis sequences from other organisms may be useful in animal models of disease and drug evaluation; thus, other angiogenesis sequences are provided, from vertebrates, including mammals, including rodents (rats, mice, hamsters, guinea pigs, etc.), primates, farm animals (including sheep, goats, pigs, cows, horses, etc). Angiogenesis sequences from other organisms may be obtained using the techniques outlined below.
Angiogenesis sequences can include both nucleic acid and amino acid sequences. In a preferred embodiment, the angiogenesis sequences are recombinant nucleic acids. By the term "recombinant nucleic acid" herein is meant nucleic acid, originally formed ih vitro, in general, by the manipulation of nucleic acid e.g., using polymerases and endonucleases, in a form not normally found in nature. Thus an isolated nucleic acid, in a linear form, or an expression vector formed iya vitro by ligating DNA
molecules that are not normally joined, are both considered recombinant for the purposes of this invention. It is understood that once a recombinant nucleic acid is made and reintroduced into a host cell or organism, it will replicate non-recombinantly, i.e. using the ih vivo cellular machinery of the host cell rather than ifa vitro manipulations; however, such nucleic acids, once produced recombinantly, although subsequently replicated non-recombinantly, are still considered recombinant for the purposes of the invention. ' Similarly, a "recombinant protein" is a protein made using recombinant techniques, i. e. through the expression of a recombinant nucleic acid as depicted above. A
recombinant protein is distinguished from naturally occurnng protein by at least one or more characteristics. For example, the protein may be isolated or purified away from some or all of the proteins and compounds with which it is normally associated in its wild type host, and thus may be substantially pure. For example, an isolated protein is unaccompanied by at least some of the material with which it is normally associated in its natural state, preferably constituting at least about 0.5%, more preferably at least about 5% by weight of the total protein in a given sample. A substantially pure protein comprises at least about 75% by weight of the total protein, with at least about 80% being preferred, and at least about 90%
being particularly preferred. The definition includes the production of an angiogenesis protein from one organism in a different organism or host cell. Alternatively, the protein may be made at a significantly higher concentration than is normally seen, through the use of an inducible promoter or high expression promoter, such that the protein is made at increased concentration levels. Alternatively, the protein may be in a form not normally found in nature, as in the addition of an epitope tag or amino acid substitutions, insertions and deletions, as discussed below.
In a preferred embodiment, the angiogenesis sequences are nucleic acids. As will be appreciated by those in the art and is more fully outlined below, angiogenesis sequences are useful in a variety of applications, including diagnostic applications, which will detect naturally occurnng nucleic acids, as well as screening applications;
for example, biochips comprising nucleic acid probes to the angiogenesis sequences can be generated. In the broadest sense, then, by "nucleic acid" or "oligonucleotide" or grammatical equivalents herein means at least two nucleotides covalently linked together. A nucleic acid of the present invention will generally contain phosphodiester bonds, although in some cases, nucleic acid analogs are included that may have alternate backbones, comprising, for example, phosphoramidate, phosphorothioate, phosphorodithioate, or O-methylphophoroamidite linkages (see Eckstein, Oligonucleotides and Analogues:
A Practical Approach, Oxford University Press); and peptide nucleic acid backbones and linkages. Other analog nucleic acids include those with positive backbones; non-ionic backbones, and non-ribose backbones, including those described in U.S. Patent Nos. 5,235,033 and 5,034,506, and Chapters 6 and 7, ASC Symposium Series 580, "Carbohydrate Modifications in Antisense Research", Ed. Y.S. Sanghui and P. Dan Cook. Nucleic acids containing one or more carbocyclic sugars are also included within one definition of nucleic acids.
Modifications of the ribose-phosphate backbone may be done for a variety of reasons, for example to increase the stability and half life of such molecules in physiological environments or as probes on a biochip.
As will be appreciated by those in the art, nucleic acid analogs may find use in the present invention. In addition, mixtures of naturally occurring nucleic acids and analogs can be made; alternatively, mixtures of different nucleic acid analogs, and mixtures of naturally occurring nucleic acids and analogs may be made.
Particularly preferred are peptide nucleic acids (PNA) which includes peptide nucleic acid analogs. These backbones are substantially non-ionic under neutral conditions, in contrast to the highly charged phosphodiester backbone of naturally occurnng nucleic acids.
This results in two advantages. First, the PNA backbone exhibits improved hybridization kinetics. PNAs have larger changes in the melting temperature (Tm) for mismatched versus perfectly matched basepairs. DNA and RNA typically exhibit a 2-4°C drop in Tm for an internal mismatch. With the non-ionic PNA backbone, the drop is closer to 7-9°C. Similarly, due to their non-ionic nature, hybridization of the bases attached to these backbones is relatively insensitive to salt concentration. In addition, PNAs are not degraded by cellular enzymes, and thus can be more stable.
The nucleic acids may be single stranded or double stranded, as specified, or contain portions of both double stranded or single stranded sequence. As will be appreciated by those in the art, the depiction of a single strand also defines the sequence of the complementary strand; thus the sequences described herein also provide the complement of the sequence. The nucleic acid may be DNA, both genomic and cDNA, RNA or a hybrid, where the nucleic acid may contain combinations of deoxyribo- and ribo-nucleotides, and combinations of bases, including uracil, adenine, thymine, cytosine, guanine, inosine, xanthine hypoxanthine, isocytosine, isoguanine, etc. As used herein, the term "nucleoside"
includes nucleotides and nucleoside and nucleotide analogs, and modified nucleosides such as amino modified nucleosides. In addition, "nucleoside" includes non-naturally occurring analog structures. Thus for example the individual units of a peptide nucleic acid, each containing a base, are referred to herein as a nucleoside.

An angiogenesis sequence can be initially identified by substantial nucleic acid and/or amino acid sequence homology to the angiogenesis sequences outlined herein.
Such homology can be based upon the overall nucleic acid or amino acid sequence, and is generally determined as outlined below, using either homology programs or hybridization conditions.
For identifying angiogenesis-associated sequences, the angiogenesis screen typically includes comparing genes identified in a modification of an ifa vitro model of angiogenesis as described in Hiraoka, Cell 95:365 (1998) with genes identified in controls.
Samples of normal tissue and tissue undergoing angiogenesis are applied to biochips comprising nucleic acid probes. The samples are first microdissected, if applicable, and treated as is known in the art for the preparation of mRNA. Suitable biochips are commercially available, for example from Affyrnetrix. Gene expression profiles as described herein are generated and the data analyzed.
In a preferred embodiment, the genes showing changes in expression as between normal and disease states are compared to genes expressed in other normal tissues, including, but not limited to lung, heart, brain, liver, breast, kidney, muscle, prostate, small intestine, large intestine, spleen, bone and placenta. In a preferred embodiment, those genes identified during the angiogenesis screen that are expressed in any significant amount in other tissues are removed from the profile, although in some embodiments, this is not necessary.
That is, when screening for drugs, it is usually preferable that the target be disease specific, to minimize possible side effects.
In a preferred embodiment, angiogenesis sequences are those that are up-regulated in angiogenesis disorders; that is, the expression of these genes is higher in the disease tissue as compared to normal tissue. "Up-regulation" as used herein means at least about a two-fold change, preferably at least about a three fold change, with at least about five-fold or higher being preferred. All accession numbers herein are for the GenBank sequence database and the sequences of the accession numbers are hereby expressly incorporated by reference. GenBanlc is known in the art, see, e.g., Benson, DA, et al., Nucleic Acids Research 26:1-7 (1998) and http://www.ncbi.nlm.nih.gov/.
Sequences are also avialable in other databases, e.g., European Molecular Biology Laboratory (EMBL) and DNA Database of Japan (DDBJ). In addition, most preferred genes were found to be expressed in a limited amount or not at all in heart, brain, lung, liver, breast, kidney, prostate, small intestine and spleen.

In another preferred embodiment, angiogenesis sequences are those that are down-regulated in the angiogenesis disorder; that is, the expression of these genes is lower in angiogenic tissue as compared to normal tissue. "Down-regulation" as used herein means at least about a two-fold change, preferably at least about a three fold change, with at least about five-fold or higher being preferred.
Angiogenesis sequences according to the invention may be classified into discrete clusters of sequences based on common expression profiles of the sequences.
Expression levels of angiogenesis sequences may increase or decrease as a function of time in a manner that correlates with the induction of angiogenesis. Alternatively, expression levels of angiogenesis sequences may both increase and decrease as a function of time. For example, expression levels of some angiogenesis sequences are temporarily induced or diminished during the switch to the angiogenesis phenotype, followed by a return to baseline expression levels. Tables 1-8 provides genes, the mRNA expression of which varies as a function of time in angiogenesis tissue when compared to normal tissue.
In a particularly preferred embodiment, angiogenesis sequences are those that are induced for a period of time, typically by positive angiogenic factors, followed by a return to the baseline levels. Sequences that are temporarily induced provide a means to target angiogenesis tissue, for example neovascularized tumors, at a particular stage of angiogenesis, while avoiding rapidly growing tissue that require perpetual vascularization.
Such positive angiogenic factors include aFGF, (3FGF, VEGF, angiogenin and the like.
Induced angiogenesis sequences also are further categorized with respect to the timing of induction. For example, some angiogenesis genes may be induced at an early time period, such as within 10 minutes of the induction of angiogenesis.
Others may be induced later, such as between 5 and 60 minutes, while yet others may be induced for a time period of about two hours or more followed by a return to baseline expression levels.
In another preferred embodiment axe angiogenesis sequences that are inhibited or reduced as a function of time followed by a return to "normal" expression levels.
Inhibitors of angiogenesis are examples of molecules that have this expression profile. These sequences also can be further divided into groups depending on the timing of diminished expression. For example, some molecules may display reduced expression within 10 minutes of the induction of angiogenesis. Others may be diminished later, such as between 5 and 60 minutes, while others may be diminished for a time period of about two hours or more followed by a return to baseline. Examples of such negative angiogenic factors include thrombospondin and endostatin to name a few.
In yet another preferred embodiment are angiogenesis sequences that are induced for prolonged periods. These sequences are typically associated with induction of angiogenesis and may participate in induction and/or maintenance of the angiogenesis phenotype.
In another preferred embodiment are angiogenesis sequences, the expression of which is reduced or diminished for prolonged periods in angiogenic tissue.
These sequences are typically angiogenesis inhibitors and their diminution is correlated with an increase in angiogenesis.
Informatics The ability to identify genes that undergo changes in expression with time during angiogenesis can additionally provide high-resolution, high-sensitivity datasets which can be used in the areas of diagnostics, therapeutics, drug development, biosensor development, and other related areas. For example, the expression profiles can be used in diagnostic or prognostic evaluation of patients with angiogenesis-associated disease. Or as another example, subcellular toxicological information can be generated to better direct drug structure and activity correlation (see, Anderson, L., "Pharmaceutical Proteomics: Targets, Mechanism, and Function," paper presented at the IBC Proteomics conference, Coronado, CA (June 11-12, 1998)). Subcellular toxicological information can also be utilized in a biological sensor device to predict the likely toxicological effect of chemical exposures and likely tolerable exposure thresholds (see, U.S. Patent No. 5,811,231). Similar advantages accrue from datasets relevant to other biomolecules and bioactive agents (e.g., nucleic acids, saccharides, lipids, drugs, and the like).
Thus, in another embodiment, the present invention provides a database that includes at least one set of data assay data. The data contained in the database is acquired , e.g., using array analysis either singly or in a library format. The database can be in substantially any form in which data can be maintained and transmitted, but is preferably an electronic database. The electronic database of the invention can be maintained on any electronic device allowing for the storage of and access to the database, such as a personal computer, but is preferably distributed on a wide area network, such as the World Wide Web.

The focus of the present section on databases that include peptide sequence data is for clarity of illustration only. It will be apparent to those of skill in the art that similar databases can be assembled for any assay data acquired using an assay of the invention.
The compositions and methods for identifying and/or quantitating the relative and/or absolute abundance of a variety of molecular and macromolecular species from a biological sample undergoing angiogenesis, i.e., the identification of angiogenesis-associated sequences described herein, provide an abundance of information, which can be correlated with pathological conditions, predisposition to disease, drug testing, therapeutic monitoring, gene-disease causal linkages, identification of correlates of immunity and physiological status, among others. Although the data generated from the assays of the invention is suited for manual review and analysis, in a preferred embodiment, prior data processing using high-speed computers is utilized.
An array of methods fox indexing and retrieving biomolecular information is known in the art. For example, U.S. Patents 6,023,659 and 5,966,712 disclose a relational database system for storing biomolecular sequence information in a manner that allows sequences to be catalogued and searched according to one or more protein function hierarchies. U.S. Patent 5,953,727 discloses a relational database having sequence records containing information in a format that allows a collection of partial-length DNA sequences to be catalogued and searched according to association with one or more sequencing projects for obtaining full-length sequences from the collection of partial length sequences. U.S.
Patent 5,706,498 discloses a gene database retrieval system for making a retrieval of a gene sequence similar to a sequence data item in a gene database based on the degree of similarity between a key sequence and a target sequence. U.S. Patent 5,538,897 discloses a method using mass spectroscopy fragmentation patterns of peptides to identify amino acid sequences 2S in computer databases by comparison of predicted mass spectra with experimentally-derived mass spectra using a closeness-of fit measure. U.S. Patent 5,926,818 discloses a multi-dimensional database comprising a functionality for mufti-dimensional data analysis described as on-line analytical processing (OLAP), which entails the consolidation of projected and actual data according to more than one consolidation path or dimension. U.S.
Patent 5,295,261 reports a hybrid database structure in which the fields of each database record are divided into two classes, navigational and informational data, with navigational fields stored in a hierarchical topological map which can be viewed as a tree structure or as the merger of tvvo or more such tree structures.

The present invention provides a computer database comprising a computer and software for storing in computer-retrievable form assay data records cross-tabulated, e.g., with data specifying the source of the target-containing sample from which each sequence specificity record was obtained.
In an exemplary embodiment, at least one of the sources of target-containing sample is from a control tissue sample known to be free of pathological disorders. In a variation, at least one of the sources is a known pathological tissue specimen, e.g., a neoplastic lesion or another tissue specimen to be analyzed for angiogenesis.
In another variation, the assay records cross-tabulate one or more of the following parameters for each target species in a sample: (1) a unique identification code, which can include, e.g., a target molecular structure and/or characteristic separation coordinate (e.g., electrophoretic coordinates); (2) sample source; and (3) absolute and/or relative quantity of the target species present in the sample.
The invention also provides for the storage and retrieval of a collection of target data in a computer data storage apparatus, which can include magnetic disks, optical disks, magneto-optical disks, DRAM, SRAM, SGRAM, SDRAM, RDRAM, DDR RAM, magnetic bubble memory devices, and other data storage devices, including CPU
registers and on-CPU data storage arrays. Typically, the target data records are stored as a bit pattern in an array of magnetic domains on a magnetizable medium or as an array of charge states or transistor gate states, such as an array of cells in a DRAM device (e.g., each cell comprised of a transistor and a charge storage area, which may be on the transistor). In one embodiment, the invention provides such storage devices, and computer systems built therewith, comprising a bit pattern encoding a protein expression fingerprint record comprising unique identifiers for at least 10 target data records cross-tabulated with target source.
When the target is a peptide or nucleic acid, the invention preferably provides a method for identifying related peptide or nucleic acid sequences, comprising performing a computerized comparison between a peptide or nucleic acid sequence assay record stored in or retrieved from a computer storage device or database and at least one other sequence. The comparison can include a sequence analysis or comparison algorithm or computer program embodiment thereof (e.g., FASTA, TFASTA, GAP, BESTFIT) and/or the comparison may be of the relative amount of a peptide or nucleic acid sequence in a pool of sequences determined from a polypeptide or nucleic acid sample of a specimen.
The invention also preferably provides a magnetic disk, such as an IBM-compatible (DOS, Windows, Windows95/98/2000, Windows NT, OS/2) or other format (e.g., Linux, SunOS, Solaris, AIX, SCO Unix, VMS, MV, Macintosh, etc.). floppy diskette or hard (fixed, Winchester) disk drive, comprising a bit pattern encoding data from an assay of the invention in a file format suitable for retrieval and processing in a computerized sequence analysis, comparison, or relative quantitation method.
The invention also provides a network, comprising a plurality of computing devices linked via a data link, such as an Ethernet cable (coax or lOBaseT), telephone line, ISDN line, wireless network, optical fiber, or other suitable signal trarunission medium, whereby at least one network device (e.g., computer, disk array, etc.) comprises a pattern of magnetic domains (e.g., magnetic disk) andlor charge domains (e.g., an array of DRAM
cells) composing a bit pattern encoding data acquired from an assay of the invention.
The invention also provides a method for transmitting assay data that includes generating an electronic signal on an electronic communications device, such as a modem, ISDN terminal adapter, DSL, cable modem, ATM switch, or the like, wherein the signal includes (in native or encrypted format) a bit pattern encoding data from an assay or a database comprising a plurality of assay results obtained by the method of the invention.
In a preferred embodiment, the invention provides a computer system for comparing a query target to a database containing an array of data structures, such as an assay result obtained by the method of the invention, and ranking database targets based on the degree of identity and gap weight to the target data. A central processor is preferably initialized to load and execute the computer program for alignment and/or comparison of the assay results. Data for a query target is entered into the central processor via an I/O device.
Execution of the computer program results in the central processor retrieving the assay data from the data file, which comprises a binary description of an assay result.
The target data or record and the computer program can be transferred to secondary memory, which is typically random access memory (e.g., DRAM, SRAM, SGRAM, or SDRAM). Targets are ranked according to the degree of correspondence between a selected assay characteristic (e.g., binding to a selected affinity moiety) and the same characteristic of the query target and results are output via an I/O
device. For example, a central processor can be a conventional computer (e.g., Intel Pentium, PowerPC, Alpha, PA-8000, SPARC, MIPS 4400, MIPS 10000, VAX, etc.); a program can be a commercial or public domain molecular biology software package (e.g., UWGCG Sequence Analysis Software, Darwin); a data file can be an optical or magnetic disk, a data server, a memory device (e.g., DRAM, SRAM, SGRAM, SDRAM, EPROM, bubble memory, flash memory, etc.); an I/O device can be a terminal comprising a video display and a keyboard, a modem, an ISDN terminal adapter, an Ethernet port, a punched card reader, a magnetic strip reader, or other suitable Il0 device.
The invention also preferably provides the use of a computer system, such as that described above, which comprises: (1) a computer; (2) a stored bit pattern encoding a collection of peptide sequence specificity records obtained by the methods of the invention, which may be stored in the computer; (3) a comparison target, such as a query target; and (4) a program for alignment and comparison, typically with rank-ordering of comparison results on the basis of computed similarity values.
Afzgiogehesis-associated sequences Angiogenesis proteins of the present invention may be classified as secreted proteins, trmsmembrane proteins or intracellular proteins. In one embodiment,the angiogenesis protein is an intracellular protein. Intracellular proteins may be found in the cytoplasm and/or in the nucleus or associated with the intracellular side of the plasma membrane. Intracellular proteins are involved in all aspects of cellular function and replication (including, e.g., signaling pathways); aberrant expression of such proteins often results in unregulated or disregulated cellular processes (see, e.g., Molecular Biology of the Cell, 3rd Edition, Alberts, Ed., Garland Pub., 1994). For example, many intracellular proteins have enzymatic activity such as protein kinase activity, protein phosphatase activity, protease activity, nucleotide cyclase activity, polymerase activity and the like. Intracellular proteins also serve as docking proteins that are involved in organizing complexes of proteins, or targeting proteins to various subcellular localizations, and are involved in maintaining the structural integrity of organelles.
An increasingly appreciated concept in characterizing proteins is the presence in the proteins of one or more motifs for which defined functions have been attributed. In addition to the highly conserved sequences found in the enzymatic domain of proteins, highly conserved sequences have been identified in proteins that are involved in protein-protein interaction. For example, Src-homology-2 (SH2) domains bind tyrosine-phosphorylated targets in a sequence dependent manner. PTB domains, which are distinct from domains, also bind tyrosine phosphorylated targets. SH3 domains bind to proline-rich targets. In addition, PH domains, tetratricopeptide repeats and WD domains to name only a few, have been shown to mediate protein-protein interactions. Some of these may also be involved in binding to phospholipids or other second messengers. As will be appreciated by one of ordinary skill in the art, these motifs can be identified on.the basis of primaxy sequence; thus, an analysis of the sequence of proteins may provide insight into both the enzymatic potential of the molecule and/or molecules with which the protein may associate.
In another embodiment, the angiogenesis sequences are transmembrane proteins. Transmembrane proteins are molecules that span a phospholipid bilayer of a cell.
They may have an intracellular domain, an extracellular domain, or both. The intracellular domains of such proteins may have a number of functions including those already described for intracellular proteins. For example, the intracellular domain may have enzymatic activity and/or may serve as a binding site for additional proteins. Frequently the intracellular domain of transmembrane proteins serves both roles. For example certain receptor tyrosine kinases have both protein kinase activity and SH2 domains. In addition, autophosphorylation of tyrosines on the receptor molecule itself, creates binding sites for additional SH2 domain containing proteins.
Transmembrane proteins may contain from one to many transmembrane domains. For example, receptor tyrosine kinases, certain cytokine receptors, receptor guanylyl cyclases and receptor serine/threonine protein kinases contain a single transmembrane domain. However, various other proteins including channels and adenylyl cyclases contain numerous transmembrane domains. Many important cell surface receptors such as G protein coupled receptors (GPCRs) are classified as "seven transmembrane domain" proteins, as they contain 7 membrane spanning regions. Characteristics of transmembrane domains include approximately 20 consecutive hydrophobic amino acids that may be followed or flanked by charged amino acids. Therefore, upon analysis of the amino acid sequence of a particular protein, the localization and number of transmembrane domains within the protein may be predicted (see, e.g. PSORT web site http://psort.nibb.ac.jp/).
The extracellular domains of transmembrane proteins are diverse; however, conserved motifs are found repeatedly among various extracellular domains.
Conserved structure and/or functions have been ascribed to different extracellular motifs. Many extracellular domains are involved in binding to other molecules. In one aspect, extracellular domains are found on receptors. Factors that bind the receptor domain include circulating ligands, which may be peptides, proteins, or small molecules such as adenosine and the like.
For example, growth factors such as EGF, FGF and PDGF are circulating growth factors that bind to their cognate receptors to initiate a variety of cellular responses.
Other factors include cytokines, mitogenic factors, neurotrophic factors and the like. Extracellular domains also bind to cell-associated molecules. In this respect, they mediate cell-cell interactions. Cell-associated ligands can be tethered to the cell for example via a glycosylphosphatidylinositol (GPI) anchor, or may themselves be transmembrane proteins. Extracellular domains also associate with the extracellular matrix and contribute to the maintenance of the cell structure.
Angiogenesis proteins that are transmembrane are particularly preferred in the present invention as they are readily accessible targets for immunotherapeutics, as are described herein. In addition, as outlined below, transmembrane proteins can be also useful in imaging modalities. Antibodies may be used to label such readily accessible proteins ifa situ. Alternatively, antibodies can also label intracellular proteins, in which case samples are typically permeablized to provide acess to intracellular proteins.
It will also be appreciated by those in the art that a transmembrane protein can be made soluble by removing transmembrane sequences, for example through recombinant methods. Furthermore, transmembrane proteins that have been made soluble can be made to be secreted through recombinant means by adding an appropriate signal sequence.
In another embodiment, the angiogenesis proteins are secreted proteins; the secretion of which can be either constitutive or regulated. These proteins have a signal peptide or signal sequence that targets the molecule to the secretory pathway.
Secreted proteins are involved in numerous physiological events; by virtue of their circulating nature, they serve to transmit signals to various other cell types. The secreted protein may function in an autocrine manner (acting on the cell that secreted the factor), a paracrine manner (acting on cells in close proximity to the cell that secreted the factor) or an endocrine manner (acting on cells at a distance). Thus secreted molecules find use in modulating or altering numerous aspects of physiology. Angiogenesis proteins that are secreted proteins are particularly preferred in the present invention as they serve as good targets for diagnostic markers, e.g., for blood or serum tests.
An angiogenesis sequence is typically initially identified by substantial nucleic acid aald/or amino acid sequence homology or linkage to the angiogenesis sequences outlined herein. Such homology can be based upon the overall nucleic acid or amino acid sequence, and is generally determined as outlined below, using either homology programs or hybridization conditions. Typically, linked sequences on a mRNA are found on the same molecule.
As detailed in the defiutions, percent identity can be determined using an algorithm such as BLAST. A preferred method utilizes the BLASTN module of WU-BLAST-2 set to the default parameters, with overlap span and overlap fraction set to 1 and 0.125, respectively. The alignment may include the introduction of gaps in the sequences to be aligned. In addition, for sequences which contain either more or fewer nucleotides than those of the nucleic acids of the figures, it is understood that the percentage of homology will be determined based on the number of homologous nucleosides in relation to the total number of nucleosides. Thus, for example, homology of sequences shorter than those of the sequences identified herein and as discussed below, will be determined using the number of .nucleosides in the shorter sequence.
In one embodiment, the nucleic acid homology is determined through hybridization studies. Thus, e.g., nucleic acids which hybridize under high stringency to a nucleic acid of Tables 1-8 , or its complement, or is also found on naturally occurnng mRNAs is considered an angiogenesis sequence. In another embodiment, less stringent hybridization conditions are used; for example, moderate or low stringency conditions may be used, as are known in the art; see Ausubel, supra, and Tij ssen, supra.
In addition, the angiogenesis nucleic acid sequences of the invention, e.g, the sequence in Tables 1-8 , are fragments of larger genes, i. e. they are nucleic acid segments.
"Genes" in this context includes coding regions, non-coding regions, and mixtures of coding and non-coding regions. Accordingly, as will be appreciated by those in the art, using the sequences provided herein, extended sequences, in either direction, of the angiogenesis genes can be obtained, using techniques well known in the art for cloning either longer sequences or the full length sequences; see Ausubel, et al., supra. Much can be done by informatics and many sequences can be clustered to include multiple sequences, e.g., systems such as UniGene (see, http://www.ncbi.nlm.nih.gov/LTniGene/).
Once the angiogenesis nucleic acid is identified, it can be cloned and, if necessary, its constituent parts recombined to form the entire angiogenesis nucleic acid coding regions or the entire mRNA sequence. Once isolated from its natural source, e.g., contained within a plasmid or other vector or excised therefrom as a linear nucleic acid segment, the recombinant angiogenesis nucleic acid can be further-used as a probe to identify and isolate other angiogenesis nucleic acids, for example extended coding regions. It can also be used as a "precursor" nucleic acid to make modified or variant angiogenesis nucleic acids and proteins.
The angiogenesis nucleic acids of the present invention are used in several ways. In a first embodiment, nucleic acid probes to the angiogenesis nucleic acids are made and attached to biochips to be used in screening and diagnostic methods, as outlined below, or for administration, for example for gene therapy, vaccine, and/or antisense applications.
Alternatively, the angiogenesis nucleic acids that include coding regions of angiogenesis proteins can be put into expression vectors for the expression of angiogenesis proteins, again for screening purposes or for administration to a patient.
In a preferred embodiment, nucleic acid probes to angiogenesis nucleic acids (both the nucleic acid sequences outlined in the figures andlor the complements thereof) are made. The nucleic acid probes attached to the biochip are designed to be substantially complementary to the angiogenesis nucleic acids, i.e. the target sequence (either the target sequence of the sample or to other probe sequences, for example in sandwich assays), such that hybridization of the target sequence and the probes of the present invention occurs. As outlined below, this complementarity need not be perfect; there may be any number of base pair mismatches which will interfere with hybridization between the target sequence and the single stranded nucleic acids of the present invention. However, if the number of mutations is so great that no hybridization can occur under even the least stringent of hybridization conditions, the sequence is not a complementary target sequence. Thus, by "substantially complementary" herein is meant that the probes are sufficiently complementary to the target sequences to hybridize under normal reaction conditions, particularly high stringency conditions, as outlined herein.
A nucleic acid probe is generally single stranded but can be partially single and partially double stranded. The strandedness of the probe is dictated by the structure, composition, and properties of the target sequence. In general, the nucleic acid probes range from about 8 to about 100 bases long, with from about 10 to about 80 bases being preferred, and from about 30 to about 50 bases being particularly preferred. That is, generally whole genes are not used. In some embodiments, much longer nucleic acids can be used, up to hundreds of bases.
In a preferred embodiment, more than one probe per sequence is used, with either overlapping probes or probes to different sections of the target being used. That is, two, three, four or more probes, with three being preferred, are used to build in a redundancy for a particular target. The probes can be overlapping (i.e. have some sequence in common), or separate. In some cases, PCR primers may be used to amplify signal for higher sensitivity.
As will be appreciated by those in the art, nucleic acids can be attached or immobilized to a solid support in a wide variety of ways. By "immobilized" and grammatical equivalents herein is meant the association or binding between the nucleic acid probe and the solid support is sufficient to be stable under the conditions of binding, washing, analysis, and removal as outlined below. The binding can typically be covalent or non-covalent. By "non-covalent binding" and grammatical equivalents herein is meant one or more of electrostatic, hydrophilic, and hydrophobic interactions. Included in non-covalent binding is the covalent attachment of a molecule, such as, streptavidin to the support and the non-covalent binding of the biotinylated probe to the streptavidin. By "covalent binding" and gra~atical equivalents herein is meant that the two moieties, the solid support and the probe, are attached by at least one bond, including sigma bonds, pi bonds and coordination bonds.
Covalent bonds can be formed directly between the probe and the solid support or can be formed by a cross linker or by inclusion of a specific reactive group on either the solid support or the probe or both molecules. Immobilization may also involve a combination of covalent and non-covalent interactions.
In general, the probes are attached to the biochip in a wide variety of ways, as will be appreciated by those in the art. As described herein, the nucleic acids can either be synthesized first, with subsequent attachment to the biochip, or can be directly synthesized on the biochip.
The biochip comprises a suitable solid substrate. By "substrate" or "solid support" or other grammatical equivalents herein is meant a material that can be modified to contain discrete individual sites appropriate for the attachment or association of the nucleic acid probes and is amenable to at least one detection method. As will be appreciated by those in the art, the number of possible substrates are very large, and include, but are not limited to, glass and modified or functionalized glass, plastics (including acrylics, polystyrene and copolymers of styrene and other materials, polypropylene, polyethylene, polybutylene, polyurethanes, TeflonJ, etc.), polysaccharides, nylon or nitrocellulose, resins, silica or silica-based materials including silicon and modified silicon, carbon, metals, inorganic glasses, plastics, etc. In general, the substrates allow optical detection and do not appreciably fluorescese. A preferred substrate is described in copending application entitled Reusable Low Fluorescent Plastic Biochip, U.S. Application Serial No. 09/270,214, filed March 15, 1999, herein incorporated by reference in its entirety.
Generally the substrate is planar, although as will be appreciated by those in the art, other configurations of substrates may be used as well. For example, the probes may be placed on the inside surface of a tube, for flow-through sample analysis to minimize sample volume. Similarly, the substrate may be flexible, such as a flexible foam, including closed cell foams made of particular plastics.
In a preferred embodiment, the surface of the biochip and the probe may be derivatized with chemical functional groups fox subsequent attachment of the two. Thus, for example, the biochip is derivatized with a chemical functional group including, but not limited to, amino groups, carboxy groups, oxo groups and thiol groups, with amino groups being particularly preferred. Using these functional groups, the probes can be attached using functional groups on the probes. For example, nucleic acids containing amino groups can be attached to surfaces comprising amino groups, for example using linkers as are known in the art; for example, homo-or hetero-bifunctional linkers as are well known (see 1994 Pierce Chemical Company catalog, technical section on cross-linkers, pages 155-200, incorporated herein by reference). In addition, in some cases, additional linkers, such as alkyl groups (including substituted and heteroalkyl groups) may be used.
In this embodiment, oligonucleotides are synthesized as is known in the art, and then attached to the surface of the solid support. As will be appreciated by those skilled in the art, either the 5' or 3' terminus may be attached to the solid support, or attachment may be via an internal nucleoside.
In another embodiment, the immobilization to the solid support may be very strong, yet non-covalent. For example, biotinylated oligonucleotides can be made, which bind to surfaces covalently coated with streptavidin, resulting in attachment.
Alternatively, the oligonucleotides may be synthesized on the surface, as is known in the art. For example, photoactivation techniques utilizing photopolymerization compounds and techniques are used. In a preferred embodiment, the nucleic acids can be synthesized in situ, using well known photolithographic techniques, such as those described in WO 95/25116; WO 95/35505; U.S. Patent Nos. 5,700,637 and 5,445,934; and references cited within, all of which are expressly incorporated by reference; these methods of attachment form the basis of the Affimetrix GeneChipTM technology.
Often, amplification-based assays are performed to measure the expression level of angiogenesis-associated sequences. These assays are typically performed in conjunction with reverse transcription. In such assays, an angiogenesis-associated nucleic acid sequence acts as a template in an amplification reaction (e.g., Polymerase Chain Reaction, or PCR). In a quantitative amplification, the amount of amplification product will be proportional to the amount of template in the original sample. Comparison to appropriate controls provides a measure of the amount of angiogenesis-associated RNA.
Methods of quantitative amplification are well known to those of skill in the axt.
Detailed protocols for quantitative PCR are provided, e.g., in Innis et al. (1990) PCR Protocols, A
Guide to Methods and Applications, Academic Press, Inc. N.Y.).
In some embodiments, a TaqMan based assay is used to measure expression.
TaqMan based assays use a fluorogenic oligonucleotide probe that contains a 5' fluorescent dye and a 3' quenching agent. The probe hybridizes to a PCR product, but cannot itself be extended due to a blocking agent at the 3' end. When the PCR product is amplified in subsequent cycles, the 5' nuclease activity of the polymerase, e.g., AmpliTaq, results in the cleavage of the TaqMan probe. This cleavage separates the 5' fluorescent dye and the 3' quenching agent, thereby resulting in an increase in fluorescence as a function of amplification (see, for example, literature provided by Perkin-Elmer, e.g., www2.perkin-elmer.com).
Other suitable amplification methods include, but are not limited to, ligase chain reaction (LCR) (see, Wu and Wallace (1989) Genomics 4: 560, Landegren et al. (1988) Science 241: 1077, and Barringer et al. (1990) Gene 89: 117), transcription amplification (Kwoh et al. (1989) Pf-oc. Natl. Acad. Sci. USA 86: 1173), self sustained sequence replication (Guatelli et al. (1990) P~oc. Nat. Acad. Sci. USA 87: 1874), dot PCR, and linker adapter PCR, etc.
In a preferred embodiment, angiogenesis nucleic acids, e.g., encoding angiogenesis proteins are used to make a variety of expression vectors to express angiogenesis proteins which can then be used in screening assays, as described below.
Expression vectors and recombinant DNA technology are well known to those of skill in the art (see, e.g., Ausubel, supra, and Gene Expression Systems, Fernandez &
Hoeffler, Eds, Academic Press, 1999) and are used to express proteins. The expression vectors may be either self replicating extrachromosomal vectors or vectors which integrate into a host genome. Generally, these expression vectors include transcriptional and translational regulatory nucleic acid operably linked to the nucleic acid encoding the angiogenesis protein.
The term "control sequences" refers to DNA sequences used for the expression of an operably linked coding sequence in a particular host organism. Control sequences that are suitable for prokaryotes, for example, include a promoter, optionally an operator sequence, and a ribosome binding site. Eukaryotic cells are known to utilize promoters, polyadenylation signals, and enhancers.
Nucleic acid is "operably linked" when it is placed into a functional relationship with another nucleic acid sequence. For example, DNA for a presequence or secretory leader is operably linked to DNA for a polypeptide if it is expressed as a preprotein that participates in the secretion of the polypeptide; a promoter or enhancer is operably linked to a coding sequence if it affects the transcription of the sequence; or a ribosome binding site is operably linked to a coding sequence if it is positioned so as to facilitate translation.
Generally, "operably linked" means that the DNA sequences being linked are contiguous, and, in the case of a secretory leader, contiguous and in reading phase.
However, enhancers do not have to be contiguous. Linking is typically accomplished by ligation at convenient restriction sites. If such sites do not exist, synthetic oligonucleotide adaptors or linkers are used in accordance with conventional practice. Transcriptional and translational regulatory nucleic acid will generally be appropriate to the host cell used to express the angiogenesis protein; for example, transcriptional and translational regulatory nucleic acid sequences from Bacillus are preferably used to express the angiogenesis protein in Bacillus.
Numerous types of appropriate expression vectors, and suitable regulatory sequences are known in the art for a variety of host cells.
In general, transcriptional and translational regulatory sequences may include, but are not limited to, promoter sequences, ribosomal binding sites, transcriptional start and stop sequences, translational start and stop sequences, and enhancer or activator sequences.
In a preferred embodiment, the regulatory sequences include a promoter and transcriptional start and stop sequences.
Promoter sequences encode either constitutive or inducible promoters. The promoters may be either naturally occurring promoters or hybrid promoters.
Hybrid promoters, which combine elements of more than one promoter, are also known in the art, and are useful in the present invention.
In addition, an expression vector may comprise additional elements. For example, the expression vector may have two replication systems, thus allowing it to be maintained in two organisms, for example in mammalian or insect cells for expression and in a procaryotic host for cloning and amplification. Furthermore, for integrating expression vectors, the expression vector contains at least one sequence homologous to the host cell genome, and preferably two homologous sequences which flank the expression construct.
The integrating vector may be directed to a specific locus in the host cell by selecting the appropriate homologous sequence for inclusion in the vector. Constructs for integrating vectors are well known in the art (e.g., Fernandez & Hoeffler, supy~a). See also Kitamura, et al. (1995) PNAS 92:9146-9150.
In addition, in a preferred embodiment, the expression vector contains a selectable marker gene to allow the selection of transformed host cells.
Selection genes are well known in the art and will vary with the host cell used.
The angiogenesis proteins of the present invention are produced by culturing a host cell transformed with an expression vector containing nucleic acid encoding an angiogenesis protein, under the appropriate conditions to induce or cause expression of the angiogenesis protein. Conditions appropriate for angiogenesis protein expression will vary with the choice of the expression vector and the host cell, and will be easily ascertained by one skilled in the art through routine experimentation or optimization. For example, the use of constitutive promoters in the expression vector will require optimizing the growth and proliferation of the host cell, while the use of an inducible promoter requires the appropriate growth conditions for induction. In addition, in some embodiments, the timing of the harvest is important. For example, the baculoviral systems used in insect cell expression are lytic viruses, and thus harvest time selection can be crucial for product yield.
Appropriate host cells include yeast, bacteria, archaebacteria, fungi, and insect and animal cells, including mammalian cells. Of particular interest are Saccharomyces cerevisiae and other yeasts, E. coli, Bacillus subtilis, S~ cells, C129 cells, 293 cells, Neu~ospora, BHK, CHO, COS, HeLa cells, HUVEC (human umbilical vein endothelial cells), THP1 cells (a macrophage cell line) and various other human cells and cell lines.
In a preferred embodiment, the angiogenesis proteins are expressed in mammalian cells. Mammalian expression systems are also known in the art, and include retroviral and adenoviral systems. Of particular use as mammalian promoters are the promoters from mammalian viral genes, since the viral genes are often highly expressed and have a broad host range. Examples include the SV40 early promoter, mouse mammary tumor virus LTR promoter, adenovirus major late promoter, herpes simplex virus promoter, and the CMV promoter (see, e.g., Fernandez & Hoeffler, supra). Typically, transcription termination and polyadenylation sequences recognized by mammalian cells are regulatory regions located 3' to the translation stop codon and thus, together with the promoter elements, flank the coding sequence. Examples of transcription terminator and polyadenlytion signals include those derived form SV40.
The methods of introducing exogenous nucleic acid into mammalian hosts, as well as other hosts, is well known in the art, and will vary with the host cell used.
Techniques include dextran-mediated transfection, calcium phosphate precipitation, polybrene mediated transfection, protoplast fusion, electroporation, viral infection, encapsulation ~of the polynucleotide(s) in liposomes, and direct microinjection of the DNA
into nuclei.
In a preferred embodiment, angiogenesis proteins are expressed in bacterial systems. Bacterial expression systems are well known in the art. Promoters from bacteriophage may also be used and are known in the art. In addition, synthetic promoters and hybrid promoters are also useful; for example, the tac promoter is a hybrid of the trp and lac promoter sequences. Furthermore, a bacterial promoter can include naturally occurring promoters of non-bacterial origin that have the ability to bind bacterial RNA
polymerase and initiate transcription. In addition to a functioning promoter sequence, an efficient ribosome binding site is desirable. The expression vector may also include a signal peptide sequence that provides for secretion of the angiogenesis protein in bacteria. The protein is either secreted into the growth media (gram-positive bacteria) or into the periplasmic space, located between the inner and outer membrane of the cell (gram-negative bacteria). The bacterial expression vector may also include a selectable marker gene to allow for the selection of bacterial strains that have been transformed. Suitable selection genes include genes which render the bacteria resistant to drugs such as ampicillin, chloramphenicol, erythromycin, kanamycin, neomycin and tetracycline. Selectable markers also include biosynthetic genes, such as those in the histidine, tryptophan and leucine biosynthetic pathways.
These components are assembled into expression vectors. Expression vectors for bacteria are well known in the art, and include vectors for Bacillus subtilis, E. coli, Streptococcus cremoris, and Streptococcus livida~cs, among others (e.g.; Fernandez & Hoeffler, supra).
The bacterial expression vectors are transformed into bacterial host cells using techniques well known in the art, such as calcium chloride treatment, electroporation, and others.
In one embodiment, angiogenesis proteins are produced in insect cells.
Expression vectors for the transformation of insect cells, and in particular, baculovirus-based expression vectors, are well known in the art.
In a preferred embodiment, angiogenesis protein is produced in yeast cells.
Yeast expression systems are well known in the art, and include expression vectors for SacchaYOmyces cerevisiae, Cahdida albicans and C. maltosa, Hahsehula polymorpha, Kluyve~omyces fragilis and K. lactis, Pichia guillerimondii and P. pastoris, SchizosacchaYOmyces pombe, and Yaf-rowia lipolytica.
The angiogenesis protein may also be made as a fusion protein, using techniques well known in the art. Thus, for example, for the creation of monoclonal antibodies, if the desired epitope is small, the angiogenesis protein may be fused to a carrier protein to form an immunogen. Alternatively, the angiogenesis protein may be made as a fusion protein to increase expression, or for other reasons. For example, when the angiogenesis protein is an angiogenesis peptide, the nucleic acid encoding the peptide may be linked to another nucleic acid for expression purposes. Fusion with detection epitope tags can be made, e.g., with FLAG, His 6, myc, HA, etc.

In one embodiment, the angiogenesis nucleic acids, proteins and antibodies of the invention are labeled. By "labeled" herein is meant that a compound has at least one element, isotope or chemical compound attached to enable the detection of the compound. In general, labels fall into three classes: a) isotopic labels, which may be radioactive or heavy isotopes; b) immune labels, which may be antibodies, antigens, or epitope tags and c) colored or fluorescent dyes. The labels may be incorporated into the angiogenesis nucleic acids, proteins and antibodies at any position. For example, the label should be capable of producing, either directly or indirectly, a detectable signal. The detectable moiety may be a radioisotope, such as 3H, 14C, 32P, 3sS, or la$I, a fluorescent or chemiluminescent compound, such as fluorescein isothiocyanate, rhodamine, or luciferin, or an enzyme, such as alkaline phosphatase, beta-galactosidase or horseradish peroxidase. Any method known in the art for conjugating the antibody to the label may be employed, including those methods described by Hunter et al., Nature, 144:945 (1962); David et al., Biochemistry, 13:1014 (1974); Pain et al., J. Immunol. Meth., 40:219 (1981); and Nygren, J. Histochem. and Cytochem., 30:407 (1982).
Accordingly, the present invention also provides angiogenesis protein sequences. An angiogenesis protein of the present invention may be identified in several ways. "Protein" in this sense includes proteins, polypeptides, and peptides.
As will be appreciated by those in the art, the nucleic acid sequences of the invention can be used to generate protein sequences. There are a variety of ways to do this, including cloning the entire gene and verifying its frame and amino acid sequence, or by comparing it to known sequences to search for homology to provide a frame, assuming the angiogenesis protein has an identifiable motif or homology to some protein in the database being used.
Generally, the nucleic acid sequences are input into a program that will search all three frames for homology. This is done in a preferred embodiment using the following NCBI
Advanced BLAST parameters. The program is blastx or blastn. The database is nr. The input data is as "Sequence in FASTA format". The organism list is "none". The "expect" is 10;
the filter is default. The "descriptions" is 500, the "alignments" is 500, and the "alignment view" is pairwise. The "Query Genetic Codes" is standard (1). The matrix is BLOSUM62;
gap existence cost is 11, per residue gap cost is l; and the lambda ratio is .85 default. This results in the generation of a putative protein sequence.
Also included within one embodiment of angiogenesis proteins are amino acid variants of the naturally occurring sequences, as determined herein.
Preferably, the variants are preferably greater than about 75% homologous to the wild-type sequence, more preferably greater than about 80%, even more preferably greater than about 85%
and most preferably greater than 90%. In some embodiments the homology will be as high as about 93 to 95 or 98%. As for nucleic acids, homology in this context means sequence similarity or identity, with identity being preferred. This homology will be determined using standard techniques well known in the art as are outlined above for the nucleic acid homologies.
Angiogenesis proteins of the present invention may be shorter or longer than the wild type amino acid sequences. Thus, in a preferred embodiment, included within the definition of angiogenesis proteins are portions or'fragments of the wild type sequences.
herein. In addition, as outlined above, the angiogenesis nucleic acids of the invention may be used to obtain additional coding regions, and thus additional protein sequence, using techniques known in the art.
In a preferred embodiment, the angiogenesis proteins are derivative or variant angiogenesis proteins as compared to the wild-type sequence. That is, as outlined more fully below, the derivative angiogenesis peptide will often contain at least one amino acid substitution, deletion or insertion, with amino acid substitutions being particularly preferred.
The amino acid substitution, insertion or deletion may occur at any residue within the angiogenesis peptide.
Also included within one embodiment of angiogenesis proteins of the present invention are amino acid sequence variants. These variants typically fall into one or more of three classes: substitutional, insertional or deletional variants. These variants ordinarily are prepared by site specific mutagenesis of nucleotides in the DNA encoding the angiogenesis protein, using cassette or PCR mutagenesis or other techniques well known in the art, to produce DNA encoding the variant, and thereafter expressing the DNA in recombinant cell culture as outlined above. However, variant angiogenesis protein fragments having up to about 100-150 residues may be prepared by in vitro synthesis using established techniques.
Amino acid sequence variants are characterized by the predetermined nature of the variation, a feature that sets them apart from naturally occurring allelic or interspecies variation of the angiogenesis protein amino acid sequence. The variants typically exhibit the same qualitative biological activity as the naturally occurnng analogue, although variants can also be selected which have modified characteristics as will be more fully outlined below.
While the site or region for introducing an amino acid sequence variation is predetermined, the mutation per se need not be predetermined. For example, in order to optimize the performance of a mutation at a given site, random mutagenesis may be conducted at the target codon or region and the expressed angiogenesis variants screened for the optimal combination of desired activity. Techniques for making substitution mutations at predetermined sites in DNA having a known sequence are well known, for example, M13 primer mutagenesis and PCR mutagenesis. Screening of the mutants is done using assays of angiogenesis protein activities.
Amino acid substitutions are typically of single residues; insertions usually will be on the order of from about 1 to 20 amino acids, although considerably larger insertions may be tolerated. Deletions range from about 1 to about 20 residues, although in some cases deletions may be much larger.
Substitutions, deletions, insertions or any combination thereof may be used to arrive at a final derivative. Generally these changes are done on a few amino acids to minimize the alteration of the molecule. However, larger changes may be tolerated in certain circumstances. When small alterations in the characteristics of the angiogenesis protein are desired, substitutions are generally made in accordance with the amino acid substitution chart provided in the definition section.
Substantial changes in function or immunological identity are made by selecting substitutions that are less conservative than those provided in the definition of "conservative substitution". For example, substitutions may be made which more significantly affect: the structure of the polypeptide backbone in the area of the alteration, for example the alpha-helical or beta-sheet structure; the charge or hydrophobicity of the molecule at the target site; or the bulk of the side chain. The substitutions which in general are expected to produce the greatest changes in the polypeptide's properties are those in which (a) a hydrophilic residue, e.g. Beryl or threonyl, is substituted for (or by) a hydrophobic residue, e.g. leucyl, isoleucyl, phenylalanyl, valyl or alanyl; (b) a cysteine or proline is substituted for (or by) any other residue; (c) a residue having an electropositive side chain, e.g. lysyl, arginyl, or histidyl, is substituted for (or by) an electronegative residue, e.g.
glutamyl or aspartyl; or (d) a residue having a bulky side chain, e.g.
phenylalanine, is substituted for (or by) one not having a side chain, e.g. glycine.
The variants typically exhibit the same qualitative biological activity and will elicit the same immune response as the naturally-occurring analog, although variants also are selected to modify the characteristics of the angiogenesis proteins as needed.
Alternatively, the variant may be designed such that the biological activity of the angiogenesis protein is altered. For example, glycosylation sites may be altered or removed.
Covalent modifications of angiogenesis polypeptides are included within the scope of this invention. One type of covalent modification includes reacting targeted amino acid residues of an angiogenesis polypeptide with an organic derivatizing agent that is capable of reacting with selected side chains or the N-or C-terminal residues of an angiogenesis.polypeptide. Derivatization with bifunctional agents is useful, for instance, for crosslinking angiogenesis polypeptides to a water-insoluble support matrix or surface for use in the method for purifying anti-angiogenesis polypeptide antibodies or screening assays, as is more fully described below. Commonly used crosslinking agents include, e.g., l,l-bis(diazoacetyl)-2-phenylethane, glutaraldehyde, N-hydroxysuccinimide esters, for example, esters with 4-azidosalicylic acid, homobifunctional imidoesters, including disuccinimidyl esters such as 3,3'-dithiobis(succinimidylpropionate), bifunctional maleimides such as bis-N-maleimido-1,8-octane and agents such as methyl-3-[(p-azidophenyl)dithio]propioimidate.
Other modifications include deamidation of glutaminyl and asparaginyl residues to the corresponding glutamyl and aspartyl residues, respectively, hydroxylation of proline and lysine, phosphorylation of hydroxyl groups of seryl, threonyl or tyrosyl residues, methylation of the y-amino groups of lysine, arginine, and histidine side chains [T.E.
Creighton, Proteins: Structure and Molecular Properties, W.H. Freeman ~ Co., San Francisco, pp. 79-86 (1983)], acetylation of the N-terminal amine, and amidation of any C-terminal carboxyl group.
Another type of covalent modification of the angiogenesis polypeptide included within the scope of this invention comprises altering the native glycosylation pattern of the polypeptide. "Altering the native glycosylation pattern" is intended for purposes herein to mean deleting one or more carbohydrate moieties found in native sequence angiogenesis polypeptide, and/or adding one or more glycosylation sites that are not present in the.native sequence angiogenesis polypeptide. Glycosylation patterns can be altered in many ways. For example the use of different cell types to express angiogenesis-associated sequences can result in different glycosylation patterns.
Addition of glycosylation sites to angiogenesis polypeptides may also be accomplished by altering the amino acid sequence thereof. The alteration may be made, for example, by the addition of, or substitution by, one or more serine or threonine residues to the native sequence angiogenesis polypeptide (for O-linked glycosylation sites).
The angiogenesis amino acid sequence may optionally be altered through changes at the DNA
level, particularly by mutating the DNA encoding the angiogenesis polypeptide at preselected bases such that codons are generated that will translate into the desired amino acids.

Another means of increasing the number of carbohydrate moieties on the angiogenesis polypeptide is by chemical or enzymatic coupling of glycosides to the polypeptide. Such methods are described in the art, e.g., in WO 87/05330 published 11 September 1987, and in Aplin and Wriston, CRC Crit. Rev. Biochem., pp. 259-306 (1981).
Removal of carbohydrate moieties present on the angiogenesis polypeptide may be accomplished chemically or enzymatically or by mutational substitution of codons encoding for amino acid residues that serve as targets for glycosylation.
Chemical deglycosylation techniques are known in the art and described, for instance, by Hakimuddin, et al., Arch. Biochem. Biophys., 259:52 (1987) and by Edge et al., Anal.
Biochem., 118:131 (1981). Enzymatic cleavage of carbohydrate moieties on polypeptides can be achieved by the use of a variety of endo-and exo-glycosidases as described by Thotakura et al., Meth.
Enzymol., 138:350 (1987).
Another type of covalent modification of angiogenesis comprises linking the angiogenesis polypeptide to one of a variety of nonproteinaceous polymers, e.g., polyethylene glycol, polypropylene glycol, or polyoxyalkylenes, in the manner set forth in U.S. Patent Nos. 4,640,835; 4,496,689; 4,301,144; 4,670,417; 4,791,192 or 4,179,337.
Angiogenesis polypeptides of the present invention may also be modified in a way to form chimeric molecules comprising an angiogenesis polypeptide fused to another, heterologous polypeptide or amino acid sequence. In one embodiment, such a chimeric molecule comprises a fusion of an angiogenesis polypeptide with a tag polypeptide which provides an epitope to which an anti-tag antibody can selectively bind. The epitope tag is generally placed at the amino-or carboxyl-terminus of the angiogenesis polypeptide. The presence of such epitope-tagged forms of an angiogenesis polypeptide can be detected using an antibody against the tag polypeptide. Also, provision of the epitope tag enables the augiogenesis polypeptide to be readily purified by affinity purification using an anti-tag antibody or another type of affinity matrix that binds to the epitope tag. In an alternative embodiment, the chimeric molecule may comprise a fusion of an angiogenesis polypeptide with an immunoglobulin or a particular region of an immunoglobulin. For a bivalent form of the chimeric molecule, such a fusion could be to the Fc region of an IgG
molecule.
Various tag polypeptides and their respective antibodies are well known in the art. Examples include poly-histidine (poly-his) or poly-histidine-glycine (poly-his-gly) tags;
HIS6 and metal chelation tags, the flu HA tag polypeptide and its antibody 12CA5 [Field et al., Mol. Cell. Biol., 8:2159-2165 (1988)]; the c-myc tag and the 8F9, 3C7, 6E10, G4, B7 and 9E10 antibodies thereto [Evan et al., Molecular' and Cellular' Biology, 5:3610-3616 (1985)];

and the Herpes Simplex virus glycoprotein D (gD) tag and its antibody [Paborsky et al., Protein Engineering, 3(6):547-553 (1990)]. Other tag polypeptides include the Flag-peptide [Hopp et al., BioTechnology, 6:1204-1210 (1988)]; the KT3 epitope peptide [Martin et al., Science, 255:192-194 (1992)]; tubulin epitope peptide [Skinner et al., J.
Biol. Claern., 266:15163-15166 (1991)]; and the T7 gene 10 protein peptide tag [Lutz-Freyermuth et al., Proc. Natl. Acad. Sci. USA, 87:6393-6397 (1990)].
Also included with an embodiment of angiogenesis protein are other angiogenesis proteins of the angiogenesis family, and angiogenesis proteins from other organisms, which are cloned and expressed as outlined below. Thus, probe or degenerate polymerase chain reaction (PCR) primer sequences may be used to find other related angiogenesis proteins from humans or other organisms. As will be appreciated by those in the art, particularly useful probe and/or PCR primer sequences include the unique areas of the angiogenesis nucleic acid sequence. As is generally known in the art, preferred PCR primers are from about 15 to about 35 nucleotides in length, with from about 20 to about 30 being preferred, and may contain inosine as needed. The conditions for the PCR
reaction are well known in the art (e.g., Innis, PCR Protocols, supra).
In addition, as is outlined herein, angiogenesis proteins can be made that are longer than those encoded by the nucleic acids of the figures, e.g., by the elucidation of extended sequences, the addition of epitope or purification tags, the addition of other fusion sequences, etc.
Angiogenesis proteins may also be identified as being encoded by angiogenesis nucleic acids. Thus, angiogenesis proteins are encoded by nucleic acids that will hybridize to the sequences of the sequence listings, or their complements, as outlined herein.
In a preferred embodiment, when the angiogenesis protein is to be used to generate antibodies, e.g., for immunotherapy or immunodiagnosis, the angiogenesis protein should share at least one epitope or determinant with the full length protein.
By "epitope" or "determinant" herein is typically meant a portion of a protein which will generate and/or bind an antibody or T-cell receptor in the context of MHC. Thus, in most instances, antibodies made to a smaller angiogenesis protein will be able to bind to the full-length protein, particularly linear epitopes. In a preferred embodiment, the epitope is unique; that is, antibodies generated to a unique epitope show little or no cross-reactivity.
In a preferred embodiment, the epitope is selected from a protein sequence set out in Table 8.

Methods of preparing polyclonal antibodies are known to the skilled artisan (e.g., Coligan, supra; and Harlow & Lane, supra). Polyclonal antibodies can be raised in a mammal, e.g., by one or more injections of an immunizing agent and, if desired, an adjuvant.
Typically, the immunizing agent and/or adjuvant will be injected in the mammal by multiple subcutaneous or intraperitoneal injections. The immunizing agent may include a protein encoded by a nucleic acid of the figures or fragment thereof or a fusion protein thereof. It may be useful to conjugate the immunizing agent to a protein known to be immunogenic in the mammal being immunized. Examples of such immunogenic proteins include but are not limited to keyhole limpet hemocyanin, serum albumin, bovine thyroglobulin, and soybean trypsin inhibitor. Examples of adjuvants which may be employed include Freund's complete adjuvant and MPL-TDM adjuvant (monophosphoryl Lipid A, synthetic trehalose dicorynomycolate). The immunization protocol may be selected by one skilled in the art without undue experimentation.
The antibodies may, alternatively, be monoclonal antibodies. Monoclonal antibodies may be prepared using hybridoma methods, such as those described by Kohler and Milstein, Nature, 256:495 (1975). In a hybridoma method, a mouse, hamster, or other appropriate host animal, is typically immunized with an immunizing agent to elicit lymphocytes that produce or are capable of producing antibodies that will specifically bind to the immunizing agent. Alternatively, the lymphocytes may be immunized in vitro. The immunizing agent will typically include a polypeptide encoded by a nucleic acid of Tables 1-8 , or fragment thereof, or a fusion protein thereof. Generally, either peripheral blood lymphocytes ("PBLs") are used if cells of human origin are desired, or spleen cells or lymph node cells are used if non-human mammalian sources are desired. The lymphocytes are then fused with an immortalized cell line using a suitable fusing agent, such as polyethylene glycol, to form a hybridoma cell [Goding, Monoclonal Antibodies: Principles and Practice, Academic Press, (1986) pp. 59-103]. Immortalized cell lines are usually transformed mammalian cells, particularly myeloma cells of rodent, bovine and human origin. Usually, rat or mouse myeloma cell lines are employed. The hybridoma cells may be cultured in a suitable culture medium that preferably contains one or more substances that inhibit the growth or survival of the unfused, immortalized cells. Far example, if the parental cells lack the enzyme hypoxanthine guanine phosphoribosyl transferase (HGPRT or HPRT), the culture medium for the hybridomas typically will include hypoxanthine, aminopterin, and thymidine ("HAT medium"), which substances prevent the growth of HGPRT-deficient cells.

In one embodiment, the antibodies are bispecific antibodies. Bispecific antibodies are monoclonal, preferably human or humanized, antibodies that have binding specificities for at least two different antigens or that have binding specificities for two epitopes on the same antigen. In one embodiment, one of the binding specificities is for a protein encoded by a nucleic acid Tables 1-8 or a fragment thereof, the other one is for any other antigen, and preferably for a cell-surface protein or receptor or receptor subunit, preferably one that is tumor specific. Alternatively, tetramer-type technology may create multivalent reagents.
In a preferred embodiment, the antibodies to angiogenesis protein are capable of reducing or eliminating a biological function of an angiogenesis protein, as is described below. That is, the addition of anti-angiogenesis protein antibodies (either polyclonal or preferably monoclonal) to angiogenic tissue (or cells containing angiogenesis) may reduce or eliminate the angiogenesis activity. Generally, at least a 25% decrease in activity is preferred, with at least about 50% being particularly preferred and about a 95-100% decrease being especially preferred.
In a preferred embodiment the antibodies to the angiogenesis proteins are humanized antibodies (e.g., Xenerex Biosciences, lVIederex, Inc., Abgenix, Inc., Protein Design Labs,Inc.) Humanized forms of non-human (e.g., marine) antibodies are chimeric molecules of immunoglobulins, immunoglobulin chains or fragments thereof (such as Fv, Fab, Fab', F(ab')2 or other antigen-binding subsequences of antibodies) which contain minimal sequence derived from non-human immunoglobulin. Humanized antibodies include human immunoglobulins (recipient antibody) in which residues form a complementary determining region (CDR) of the recipient are replaced by residues from a CDR
of a non-human species (donor antibody) such as mouse, rat or rabbit having the desired specificity, affinity and capacity. In some instances, Fv framework residues of the human immunoglobulin are replaced by corresponding non-human residues. Humanized antibodies may also comprise residues which are found neither in the recipient antibody nor in the imported CDR or framework sequences. In general, a humanized antibody will comprise substantially all of at least one, and typically two, variable domains, in which all or substantially all of the CDR regions correspond to those of a non-human immunoglobulin and all or substantially all of the framework (FR) regions are those of a human immunoglobulin consensus sequence. The humanized antibody optimally also will comprise at least a portion of an immunoglobulin constant region (Fc), typically that of a human immunoglobulin [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-329 (1988); and Presta, Curr. Op. Struct. Biol., 2:593-596 (1992)].
Methods for humanizing non-human antibodies are well known in the art.
Generally, a humanized antibody has one or more amino acid residues introduced into it from a source which is non-human. These non-human amino acid residues are often referred to as import residues, which are typically taken from an import variable domain.
Humanization can be essentially performed following the method of Winter and co-workers [Jones et al., Nature, 321:522-525 (1986); Riechmann et al., Nature, 332:323-327 (1988);
Verhoeyen et al., Science, 239:1534-1536 (1988)], by substituting rodent CDRs or CDR
sequences for the corresponding sequences of a human antibody. Accordingly, such humanized antibodies are chimeric antibodies (U.5. Patent No. 4,816,567), wherein substantially less than an intact human variable domain has been substituted by the corresponding sequence from a non-human species. In practice, humanized antibodies are typically human antibodies in which some CDR residues and possibly some FR residues are substituted by residues from analogous sites in rodent antibodies.
Human antibodies can also be produced using various techniques known in the art, including phage display libraries [Hoogenboom and Winter, J. Mol. Biol., 227:381 (1991); Marks et al., J. Mol. Biol., 222:581 (1991)]. The techniques of Cole et al. and Boerner et al. are also available for the preparation of human monoclonal antibodies (Cole et al., Monoclonal Antibodies and Cancer Therapy, Alan R. Liss, p. 77 (1985) and Boerner et al., J. Immunol., 147(1):86-95 (1991)]. Similarly, human antibodies can be made by introducing of human immunoglobulin loci into transgenic animals, e.g., mice in which the endogenous immunoglobulin genes have been partially or completely inactivated.
Upon challenge, human antibody production is observed, which closely resembles that seen in humans in all respects, including gene rearrangement, assembly, and antibody repertoire.
This approach is described, for example, in U.S. Patent Nos. 5,545,807;
5,545,806;
5,569,825; 5,625,126; 5,633,425; 5,661,016, and in the following scientific publications:
Marks et al., Bio/Technology 10, 779-783 (1992); Lonberg et al., Nature 368 856-859 (1994);
Morrison, Nature 368, 812-13 (1994); Fishwild et al., Nature Biotechnology 14, (1996); Neuberger, Nature Biotechnology 14, 826 (1996); Lonberg and Huszar, Intern. Rev.
Ixnmunol. 13 65-93 (1995).
By immunotherapy is meant treatment of angiogenesis with an antibody raised against angiogenesis proteins. As used herein, immunotherapy can be passive or active.
Passive immunotherapy as defined herein is the passive transfer of antibody to a recipient (patient). Active immunization is the induction of antibody and/or T-cell responses in a recipient (patient). Induction of an immune response is the result of providing the recipient with an antigen to which antibodies are raised. As appreciated by one of ordinary skill in the art, the antigen may be provided by injecting a polypeptide against which antibodies are desired to be raised into a recipient, or contacting the recipient with a nucleic acid capable of expressing the antigen and under conditions for expression of the antigen, leading to an immune response.
In a preferred embodiment the angiogenesis proteins against which antibodies are raised are secreted proteins as described above. Without being bound by theory, antibodies used for treatment, bind and prevent the secreted protein from binding to its receptor, thereby inactivating the secreted angiogenesis protein.
In another preferred embodiment, the angiogenesis protein to which antibodies are raised is a transmembrane protein. Without being bound by theory, antibodies used for treatment, bind the extracellular domain of the angiogenesis protein and prevent it from binding to other proteins, such as circulating ligands or cell-associated molecules. The antibody may cause down-regulation of the transmembrane angiogenesis protein.
As will be appreciated by one of ordinary skill in the art, the antibody may be a competitive, non-competitive or uncompetitive inhibitor of protein binding to the extracellulax domain of the angiogenesis protein. The antibody is also an antagonist of the angiogenesis protein.
Further, the antibody prevents activation of the transmembrane angiogenesis protein. In one aspect, when the antibody prevents the binding of other molecules to the angiogenesis protein, the antibody prevents growth of the cell. The antibody may also be used to target or sensitize the cell to cytotoxic agents, including, but not limited to TNF-a, TNF-(3, IL-1, INF-y and IL-2, or chemotherapeutic agents including SFU, vinblastine, actinomycin D, cisplatin, methotrexate, and the like. In some instances the antibody belongs to a sub-type that activates senun complement when complexed with the transmembrane protein thereby mediating cytotoxicity or antigen-dependent cytotoxicity (ADCC). Thus, angiogenesis is treated by administering to a patient antibodies directed against the transmembrane angiogenesis protein. Antibody-labeling may activate a co-toxin, localize a toxin payload, or otherwise provide means to locally ablate cells.
In another preferred embodiment, the antibody is conjugated or fused to an effector moiety. The effector moiety can be any number of molecules, including labelling moieties such as radioactive labels or fluorescent labels, or can be a therapeutic moiety. In one aspect the therapeutic moiety is a small molecule that modulates the activity of the angiogenesis protein. In another aspect the therapeutic moiety modulates the activity of molecules associated with or in close proximity to the angiogenesis protein.
The therapeutic moiety may inhibit enzymatic activity such as protease or collagenase activity associated with angiogenesis, or be an attractant of other cells, such as NK cells.
In a preferred embodiment, the therapeutic moiety can also be a cytotoxic agent. In this method, targeting the cytotoxic agent to angiogenesis tissue or cells, results in a reduction in the number of afflicted cells, thereby reducing symptoms associated with angiogenesis. Cytotoxic agents are numerous and varied and include, but are not limited to, cytotoxic drugs or toxins or active fragments of such toxins. Suitable toxins and their corresponding fragments include diphtheria A chain, exotoxin A chain, ricin A
chain, abrin A
chain, curcin, crotin, phenomycin, enomycin and the like. Cytotoxic agents also include radiochemicals made by conjugating radioisotopes to antibodies raised against angiogenesis proteins, or binding of a radionuclide to a chelating agent that has been covalently attached to the antibody. Targeting the therapeutic moiety to transmembrane angiogenesis proteins not only serves to increase the local concentration of therapeutic moiety in the angiogenesis afflicted area, but also serves to reduce deleterious side effects that may be associated with the therapeutic moiety.
In another preferred embodiment, the angiogenesis protein against which the antibodies are raised is an intracellular protein. In this case, the antibody may be conjugated or fused to a protein which facilitates entry into the cell. In one case, the antibody enters the cell by endocytosis. In another embodiment, a nucleic acid encoding the antibody is administered to the individual or cell. Moreover, wherein the angiogenesis protein can be targeted within a cell, i.e., the nucleus, an antibody thereto contains a signal for that target localization, i.e., a nuclear localization signal.
The angiogenesis antibodies of the invention specifically bind to angiogenesis proteins. By "specifically bind" herein is meant that the antibodies bind to the protein with a I~ of at least about 0.1 mM, more usually at least about 1 ~,M, preferably at least about 0.1 ~.M or better, and most preferably, 0.01 wM or better. Selectivity of binding is also important.
In a preferred embodiment, the angiogenesis protein is purified or isolated after expression. Angiogenesis proteins may be isolated or purified in a variety of ways known to those skilled in the art depending on what other components are present in the sample. Standard purification methods include electrophoretic, molecular, immunological and chromatographic techniques, including ion exchange, hydrophobic, affinity, and reverse-phase HPLC chromatography, and chromatofocusing. For example, the angiogenesis protein may be purified using a standard anti-angiogenesis protein antibody column.
Ultrafiltration and diafiltration techniques, in conjunction with protein concentration, are also useful. For general guidance in suitable purification techniques, see Scopes, R., Protein Purification, Springer-Verlag, NY (1982). The degree of purification necessary will vary depending on the use of the angiogenesis protein. In some instances no purification will be necessary.
Once expressed and purified if necessary, the angiogenesis proteins and nucleic acids are useful in a number of applications. They may be used as immunoselection reagents, as vaccine reagents, as screening agents, etc.
Detection of atagiogenesis sequence for diagnostic and therapeutic applications In one aspect, the RNAexpression levels of genes are determined for different cellular states in the angiogenesis phenotype. Expression levels of genes in normal tissue (i.e., not undergoing angiogenesis) and in angiogenesis tissue (and in some cases, for varying severities of angiogenesis that relate to prognosis, as outlined below) are evaluated to provide expression profiles. An expression profile of a particular cell state or point of development is essentially a "fingerprint" of the state. While two states may have any particular gene similarly expressed, the evaluation of a number of genes simultaneously allows the generation of a gene expression profile that is reflective of the state of the cell. By comparing expression profiles of cells in different states, information regarding which genes are important (including both up- and down-regulation of genes) in each of these states is obtained. Then, diagnosis may be performed or confirmed to determine whether a tissue sample has the gene expression profile of normal or angiogenesic tissue. This will provide for molecular diagnosis of related conditions.
"Differential expression," or grammatical equivalents as used herein, refers to qualitative or quantitative differences in the temporal and/or cellular gene expression patterns within and among cells and tissue. Thus, a differentially expressed gene can qualitatively have its expression altered, including an activation or inactivation, in, e.g., normal versus angiogenic tissue. Genes may be turned on or turned off in a particular state, relative to another state thus permitting comparison of two or more statese. A
qualitatively regulated gene will exhibit an expression pattern within a state or cell type which is detectable by standard techniques. Some genes will be expressed in one state or cell type, but not in both. Alternatively, the difference in expression may be quantitative, e.g., in that expression is increased or decreased; i.e., gene expression is either upregulated, resulting in an increased amount of transcript, or downregulated, resulting in a decreased amount of transcript. The degree to which expression differs need only be large enough to quantify via standard characterization techniques as outlined below, such as by use of Affymetrix GeneChipTM expression arrays, Lockhart, Nature Biotechnology, 14:1675-1680 (1996), hereby expressly incorporated by reference. Other techniques include, but are not limited to, quantitative reverse transcriptase PCR, Northern analysis and RNase protection. As outlined above, preferably the change in expression (i.e., upregulation or downregulation) is at least about 50%, more preferably at least about 100%, more preferably at least about 150%, more preferably at least about 200%, with from 300 to at least 1000% being especially preferred.
Evaluation may be at the gene transcript, or the protein level. The amount of gene expression may be monitored using nucleic acid probes to the DNA or RNA
equivalent of the gene transcript, and the quantification of gene expression levels, or, alternatively, the final gene product itself (protein) can be monitored, e.g., with antibodies to the angiogenesis protein and standard immunoassays (ELISAs, etc.) or other techniques, including mass spectroscopy assays, 2D gel electrophoresis assays, etc. Proteins corresponding to angiogenesis genes, i.e., those identified as being important in an angiogenesis phenotype, can be evaluated in an angiogenesis diagnostic test.
In a preferred embodiment, gene expression monitoring is performed simultaneously on a number of genes. Multiple protein expression monitoring can be performed as well. Similarly, these assays may be performed on an individual basis as well.
In this embodiment, the angiogenesis nucleic acid probes are attached to biochips as outlined herein for the detection and quantification of angiogenesis sequences in a particular cell. The assays are further described below in the example. PCR
techniques can be used to provide greater sensitivity.
Tn a preferred embodiment nucleic acids encoding the angiogenesis protein are detected. Although DNA or RNA encoding the angiogenesis protein may be detected, of particular interest are methods wherein an mRNA encoding an angiogenesis protein is detected. Probes to detect mRNA can be a nucleotide/deoxynucleotide probe that is complementary to and hybridizes with the mRNA and includes, but is not limited to, oligonucleotides, cDNA or RNA. Probes also should contain a detectablelabel, as defined herein. In one method the mRNA is detected after immobilizing the nucleic acid to be examined on a solid support such as nylon membranes and hybridizing the probe with the sample. Following washing to remove the non-specifically bound probe, the label is detected. In another method detection of the mRNA is performed in situ. In this method permeabilized cells or tissue samples are contacted with a detectably labeled nucleic acid probe for sufficient time to allow the probe to hybridize with the target mRNA. Following washing to remove the non-specifically bound probe, the label is detected. For example a S digoxygenin labeled riboprobe (RNA probe) that is complementary to the mRNA
encoding an angiogenesis protein is detected by binding the digoxygenin with an anti-digoxygenin secondary antibody and developed with nitro blue tetrazolium and 5-bromo-4-chloro-3-indoyl phosphate.
In a preferred embodiment, various proteins from the three classes of proteins as described herein (secreted, transmembrane or intracellular proteins) are used in diagnostic assays. The angiogenesis proteins, antibodies, nucleic acids, modified proteins and cells containing angiogenesis sequences are used in diagnostic assays. This can be performed on an individual gene or corresponding polypeptide level. In a preferred embodiment, the expression profiles are used, preferably in conjunction with high throughput screening techniques to allow monitoring for expression profile genes and/or corresponding polypeptides.
As described and defined herein, angiogenesis proteins, including intracellular, transmembrane or secreted proteins, find use as markers of angiogenesis.
Detection of these proteins in putative angiogenesis tissue allows for detection or diagnosis of angiogenesis. In one embodiment, antibodies are used to detect angiogenesis proteins. A
preferred method separates proteins from a sample by electrophoresis on a gel (typically a denaturing and reducing protein gel, but may be another type of gel, including isoelectric focusing gels and the like). Following separation of proteins, the angiogenesis protein is detected, e.g., by immunoblotting with antibodies raised against the angiogenesis protein.
Methods of immunoblotting are well known to those of ordinary skill in the art.
In another preferred method, antibodies to the angiogenesis protein find use in in situ imaging techniques, e.g., in histology (e.g., Methods in Cell Biology:
Antibodies iya Cell Biology, volume 37 (Asai, ed. 1993)). In this method cells are contacted with from one to many antibodies to the angiogenesis protein(s). Following washing to remove non-specific antibody binding, the presence of the antibody or antibodies is detected. In one embodiment the antibody is detected by incubating with a secondary antibody that contains a detectable label. In another method the primary antibody to the angiogenesis proteins) contains a detectable label, for example an enzyme marker that can act on a substrate. In another preferred embodiment each one of multiple primary antibodies contains a distinct and detectable label. This method finds particular use in simultaneous screening for a plurality of angiogenesis proteins. As will be appreciated by one of ordinary skill in the art, many other histological imaging techniques are alsoprovided by the invention.
In a preferred embodiment the label is detected in a fluorometer which has the ability to detect and distinguish emissions of different wavelengths. In addition, a fluorescence activated cell sorter (FACS) can be used in the method.
In another preferred embodiment, antibodies find use in diagnosing angiogenesis from biological samples, such as blood, urine, sputum, or other bodily fluids.
As previously described, certain angiogenesis proteins are secreted/circulating molecules.
Blood samples, therefore, are useful as samples to be probed or tested for the presence of secreted angiogenesis proteins. Antibodies can be used to detect an angiogenesis protein by previously described immunoassay techniques including ELISA, immunoblotting (Western blotting), immunoprecipitation, BIACORE technology and the like. Conversely, the presence of antibodies may indicate an immune response against an endogenous angiogenesis protein.
In a preferred embodiment, in situ hybridization of labeled angiogenesis nucleic acid probes to tissue arrays is done. For example, arrays of tissue samples, including angiogenesis tissue and/or normal tissue, are made. In situ hybridization (see, e.g., Ausubel, supra) is then performed. When comparing the fingerprints between an individual and a standard, the skilled artisan can make a diagnosis, a prognosis, or a prediction based on the findings. It is further understood that the genes which indicate the diagnosis may differ from those which indicate the prognosis and molecular profiling of the condition of the cells may lead to distinctions between responsive or refractory conditions or may be predictive of outcomes.
In a preferred embodiment, the angiogenesis proteins, antibodies, nucleic acids, modified proteins and cells containing angiogenesis sequences are used in prognosis assays. As above, gene expression profiles can be generated that correlate to angiogenesis severity, in terms of long term prognosis. Again, this may be done on either a protein or gene level, with the use of genes being preferred. As above, angiogenesis probes may be attached to biochips for the detection and quantification of angiogenesis sequences in a tissue or patient. The assays proceed as outlined above for diagnosis. PCR method may provide more sensitive and accurate quantification.
In a preferred embodiment members of the three classes of proteins as described herein are used in drug screening assays. The angiogenesis proteins, antibodies, nucleic acids, modified proteins and cells containing angiogenesis sequences are used in drug screening assays or by evaluating the effect of drug candidates on a "gene expression profile"
or expression profile of polypeptides. In a preferred embodiment, the expression profiles axe used, preferably in conjunction with high throughput screening techniques to allow monitoring for expression profile genes after treatment with a candidate agent (e.g., Zlokarnik, et al., Science 279, 84-8 (1998); Heid, Gefaome Res 6:986-94, 1996).
In a preferred embodiment, the angiogenesis proteins, antibodies, nucleic acids, modified proteins and cells containing the native or modified angiogenesis proteins are used in screening assays. That is, the present invention provides novel methods for screening for compositions which modulate the angiogenesis phenotype or an identified physiological function of an angiogenesis protein. As above, this can be done on an individual gene level or by evaluating the effect of drug candidates on a "gene expression profile".
In a preferred embodiment, the expression profiles are used, preferably in conjunction with high throughput screening techniques to allow monitoring for expression profile genes after treatment with a candidate agent, see Zlokarnik, supra.
Having identified the differentially expressed genes herein, a variety of assays may be executed. In a preferred embodiment, assays may be run on an individual gene or protein level. That is, having identified a particular gene as up regulated in angiogenesis, test compounds can be screened for the ability to modulate gene expression or for binding to the angiogenic protein. "Modulation" thus includes both an increase and a decrease in gene expression. The preferred amount of modulation will depend on the original change of the gene expression in normal versus tissue undergoing angiogenesis, with changes of at least 10%, preferably 50%, more preferably 100-300%, and in some embodiments 300-1000% or greater. Thus, if a gene exhibits a 4-fold increase in angiogenic tissue compared to normal tissue, a decrease of about four-fold is often desired; similarly, a 10-fold decrease in angiogenic tissue compared to normal tissue often provides a target value of a 10-fold increase in expression to be induced by the test compound.
The amount of gene expression may be monitored using nucleic acid probes and the quantification of gene expression levels, or, alternatively, the gene product itself can be monitored, e.g., through the use of antibodies to the angiogenesis protein and standard immunoassays. Proteomics and separation techniques may also allow quantification of expression.
In a preferred embodiment, gene expression or protein monitoring of a number of entitites, i.e., an expression profile, is monitored simultaneously. Such profiles will typically invove a plurality of those entitites described herein..

In this embodiment, the angiogenesis nucleic acid probes are attached to biochips as outlined herein for the detection and quantif cation of angiogenesis sequences in a particular cell. Alternatively, PCR may be used. Thus, a series, e.g., of microtiter plate, may be used with dispensed primers in desired wells. A PCR reaction can then be performed and analyzed for each well.
Modulators of ahgiogeraesis Expression monitoring can be performed to identify compounds that modify the expression of one or more angiogenesis-associated sequences, e.g., a polynucleotide sequence set out in Tables 1-8 . Generally, in a preferred embodiment, a test modulator is added to the cells prior to analysis. Moreover, screens are also provided to identify agents that modulate angiogenesis, modulate angiogenesis proteins, bind to an angiogenesis protein, or interfere with the binding of an angiogenesis protein and an antibody or other binding partner.
The term "test compound" or "drug candidate" or "modulator" or grammatical equivalents as used herein describes any molecule, e.g., protein, oligopeptide, small organic molecule, polysaccharide, polynucleotide, etc., to be tested for the capacity to directly or indirectly alter the angiogenesis phenotype or the expression of an angiogenesis sequence, e.g., a nucleic acid or protein sequence. In preferred embodiments, modulators alter expression profiles, or expression profile nucleic acids or proteins provided herein. In one embodiment, the modulator suppresses an angiogenesis phenotype, for example to a normal tissue fingerprint. In another embodiment, a modulator induced an angiogenesis phenotype.
Generally, a plurality of assay mixtures are run in parallel with different agent concentrations to obtain a differential response to the various concentrations. Typically, one of these 2S concentrations serves as a negative control, i.e., at zero concentration or below the level of detection.
In one aspect, a modulator will neutralize the effect of an angiogenesis protein.
By "neutralize" is meant that activity of a protein is inhibited or blocked and thereby has substantially no effect on a cell.
In certain embodiments, combinatorial libraries of potential modulators will be screened for an ability to bind to an angiogenesis polypeptide or to modulate activity.
Conventionally, new chemical entities with useful properties are generated by identifying a chemical compound (called a "lead compound") with some desirable property or activity, e.g., inhibiting activity, creating variants of the lead compound, and evaluating the property and activity of those variant compounds. Often, high throughput screening (HTS) methods are employed for such an analysis.
In one preferred embodiment, high throughput screening methods involve providing a library containing a large number of potential therapeutic compounds (candidate compounds). Such "combinatorial chemical libraries" are then screened in one or more assays to identify those library members (particular chemical species or subclasses) that display a desired characteristic activity. The compounds thus identified can serve as conventional "lead compounds" or can themselves be used as potential or actual therapeutics.
A combinatorial chemical library is a collection of diverse chemical compounds generated by either chemical synthesis or biological synthesis by combining a number of chemical "building blocks" such as reagents. For example, a linear combinatorial chemical library, such as a polypeptide (e.g., mutein) library, is formed by combining a set of chemical building blocks called amino acids in every possible way for a given compound length (i. e., the number of amino acids in a polypeptide compound). Millions of chemical compounds can be synthesized through such combinatorial mixing of chemical building blocks (Gallop et al. (1994) J. Med. Chem. 37(9): 1233-1251).
Preparation and screening of combinatorial chemical libraries is well known to those of skill in the art. Such combinatorial chemical libraries include, but are not limited to, peptide libraries (see, e.g., U.S. Patent No. 5,010,175, Furka (1991) Int. J.
Pept. Pot. Res., 37: 487-493, Houghton et al. (1991) Nature, 354: 84-88), peptoids (PCT
Publication No WO
91/19735, 26 Dec. 1991), encoded peptides (PCT Publication WO 93/20242, 14 Oct. 1993), random bio-oligomers (PCT Publication WO 92/00091, 9 Jan. 1992), benzodiazepines (U.5.
Pat. No. 5,288,514), diversomers such as hydantoins, benzodiazepines and dipeptides (Hobbs et al., (1993) Proe. Nat. Acael. Sci. USA 90: 6909-6913), vinylogous polypeptides (Hagihara et al. (1992) J. AnZef°. Chem. Soc. 114: 6568), nonpeptidal peptidomimetics with a Beta-D-Glucose scaffolding (Hirschmann et al., (1992) J. Amer. Chem. Soc. 114: 9217-9218), analogous organic syntheses of small compound libraries (Chen et al. (1994) J.
Amer. Chena.
Soc. 116: 2661), oligocarbamates (Cho, et al., (1993) Science 261:1303), and/or peptidyl phosphonates (Campbell et al., (1994) J. Org. Chem. 59: 658). See, generally, Gordon et al., (1994) J. Mecl. Chem. 37:1385, nucleic acid libraries (see, e.g., Strategene, Corp.), peptide nucleic acid libraries (see, e.g., U.S. Patent 5,539,083), antibody libraries (see, e.g., Vaughn et al. (1996) Nature Biotechnology, 14(3): 309-314), and PCT/LTS96/10287), carbohydrate libraries (see, e.g., Liang et al., (1996) Science, 274: 1520-1522, and U.S.
Patent No.
5,593,853), and small organic molecule libraries (see, e.g., benzodiazepines, Baum (1993) C&EN, Jan 18, page 33; isoprenoids, U.S. Patent No. 5,569,588; thiazolidinones and metathiazanones, U.S. Patent No. 5,549,974; pyrrolidines, U.S. Patent Nos.
5,525,735 and 5,519,134; morpholino compounds, U.S. Patent No. 5,506,337; benzodiazepines, U.S. Patent No. 5,288,514; and the like).
Devices for the preparation of combinatorial libraries are commercially available (see, e.g., 357 MPS, 390 MPS, Advanced Chem Tech, Louisville KY, Symphony, Rainin, Woburn, MA, 433A Applied Biosystems, Foster City, CA, 9050 Plus, Millipore, Bedford, MA).
A number of well known robotic systems have also been developed for solution phase chemistries. These systems include automated workstations like the automated synthesis apparatus developed by Takeda Chemical Industries, LTD.
(Osaka, Japan) and many robotic systems utilizing robotic arms (Zymate II, Zymark Corporation, Hopkinton, Mass.; Orca, Hewlett-Packard, Palo Alto, Calif.), which mimic the manual synthetic operations performed by a chemist. Any of the above devices are suitable for use with the present invention. The nature and implementation of modifications to these devices (if any) so that they can operate as discussed herein will be apparent to persons skilled in the relevant art. In addition, numerous combinatorial libraries are themselves commercially available (see, e.g., ComGenex, Princeton, N.J., Asinex, Moscow, Ru, Tripos, Inc., St. Louis, MO, ChemStar, Ltd, Moscow, RU, 3D Pharmaceuticals, Exton, PA, Martek Biosciences, Columbia, MD, etc.).
The assays to identify modulators are amenable to high throughput screening.
Preferred assays thus detect enhancement or inhibition of angiogenesis gene transcription, inhibition or enhancement of polypeptide expression, and inhibition or enhancement of polypeptide activity.
High throughput assays for the presence, absence, quantification, or other properties of particular nucleic acids or protein products are well known to those of skill in the art. Similarly, binding assays and reporter gene assays are similarly well known. Thus, for example, U.S. Patent No. 5,559,410 discloses high throughput screening methods for proteins, U.S. Patent No. 5,585,639 discloses high throughput screening methods for nucleic acid binding (i.e., in arrays), while U.S. Patent Nos. 5,576,220 and 5,541,061 disclose high throughput methods of screening for ligand/antibody binding.
In addition, high throughput screening systems are commercially available (see, e.g., Zymark Corp., Hopkinton, MA; Air Technical Industries, Mentor, OH;
Beckman Instruments, Inc. Fullerton, CA; Precision Systems, Inc., Natick, MA, etc.).
These systems typically automate entire procedures, including all sample and reagent pipetting, liquid dispensing, timed incubations, and f nal readings of the microplate in detectors) appropriate for the assay. These configurable systems provide high throughput and rapid start up as well as a high degree of flexibility and customization. The manufacturers of such systems provide detailed protocols for various high throughput systems. Thus, for example, Zymark Corp.
provides technical bulletins describing screening systems for detecting the modulation of gene transcription, ligand binding, and the like.
In one embodiment, modulators are proteins, often naturally occurnng proteins or fragments of naturally occurring proteins. Thus, e.g., cellular extracts containing proteins, or random or directed digests of proteinaceous cellular extracts, may be used. In this way libraries of proteins may be made for screening in the methods of the invention.
Particularly preferred in this embodiment are libraries of bacterial, fungal, viral, and mammalian proteins, with the latter being preferred, and human proteins being especially preferred. Paticularly useful test compound will be directed to the class of proteins to which the target belongs, e.g., substrates for enzymes or ligands and receptors.
In a preferred embodiment, modulators are peptides of from about 5 to about 30 amino acids, with from about 5 to about 20 amino acids being preferred, and from about 7 to about 15 being particularly preferred. The peptides may be digests of naturally occurnng proteins as is outlined above, random peptides, or "biased" random peptides.
By "randomized" or grammatical equivalents herein is meant that each nucleic acid and peptide consists of essentially random nucleotides and amino acids, respectively.
Since generally these random peptides (or nucleic acids, discussed below) are chemically synthesized, they may incorporate any nucleotide or amino acid at any position. The synthetic process can be designed to generate randomized proteins or nucleic acids, to allow the formation of all or most of the possible combinations over the length of the sequence, thus forming a library of randomized candidate bioactive proteinaceous agents.
In one embodiment, the library is fully randomized, with no sequence preferences or constants at any position. In a preferred embodiment, the library is biased.
That is, some positions within the sequence are either held constant, or are selected from a limited number of possibilities. For example, in a preferred embodiment, the nucleotides or amino acid residues are randomized within a defined class, for example, of hydrophobic amino acids, hydrophilic residues, sterically biased (either small or large) residues, towards the creation of nucleic acid binding domains, the creation of cysteines, for cross-linking, prolines for SH-3 domains, serines, threonines, tyrosines or histidines for phosphorylation sites, etc., or to purines, etc.
Modulators of angiogenesis can also be nucleic acids, as defined above.
As described above generally for proteins, nucleic acid modulating agents may S be naturally occurring nucleic acids, random nucleic acids, or "biased"
random nucleic acids.
For example, digests of procaryotic or eucaryotic genomes may be used as is outlined above for proteins.
In a preferred embodiment, the candidate compounds are organic chemical moieties, a wide variety of which are available in the literature.
After the candidate agent has been added and the cells allowed to incubate for some period of time, the sample containing a target sequence to be analyzed is added to the biochip. If required, the target sequence is prepared using known techniques.
For example, the sample may be treated to lyse the cells, using known lysis buffers, electroporation, etc., with purification andlor amplification such as PCR performed as appropriate.
For example, 1 S an in vitro transcription with labels covalently attached to the nucleotides is performed.
Generally, the nucleic acids are labeled with biotin-FITC or PE, or with cy3 or cyS.
In a preferred embodiment, the target sequence is labeled with, for example, a fluorescent, a chemiluminescent, a chemical, or a radioactive signal, to provide a means of detecting the target sequence's specific binding to a probe. The label also can be an enzyme, such as, alkaline phosphatase or horseradish peroxidase, which when provided with an appropriate substrate produces a product that can be detected. Alternatively, the label can be a labeled compound or small molecule, such as an enzyme inhibitor, that binds but is not catalyzed or altered by the enzyme. The label also can be a moiety or compound, such as, an epitope tag or biotin which specifically binds to streptavidin. For the example of biotin, the 2S streptavidin is labeled as described above, thereby, providing a detectable signal for the bound target sequence. Unbound labeled streptavidin is typically removed prior to analysis.
As will be appreciated by those in the art, these assays can be direct hybridization assays or can comprise "sandwich assays", which include the use of multiple probes, as is generally outlined in U.S. Patent Nos. 5,681,702, S,S97,909, S,S4S,730, S,S94,117, S,S91,S84, S,S71,670, S,S80,731, S,S71,670, S,S91,S84, 5,624,802, S,63S,3S2, S,S94,118, S,3S9,100, 5,124,246 and 5,681,697, all of which are hereby incorporated by reference. In this embodiment, in general, the target nucleic acid is prepared as outlined above, and then added to the biochip comprising a plurality of nucleic acid probes, under conditions that allow the formation of a hybridization complex.

A variety of hybridization conditions may he used in the present invention, including high, moderate and low stringency conditions as outlined above. The assays are generally run under stringency conditions which allows formation of the label probe hybridization complex only in the presence of target. Stringency can be controlled by altering a step parameter that is a thermodynamic variable, including, but not limited to, temperature, formamide concentration, salt concentration, chaotropic salt concentration pH, organic solvent concentration, etc.
These parameters may also be used to control non-specific binding, as is generally outlined in U.S. Patent No. 5,681,697. Thus it may be desirable to perform certain steps at higher stringency conditions to reduce non-specific binding.
The reactions outlined herein may be accomplished in a variety of ways.
Components of the reaction may be added simultaneously, or sequentially, in different orders, with preferred embodiments outlined below. In addition, the reaction may include a variety of other reagents. These include salts, buffers, neutral proteins, e.g.
albumin, detergents, etc.
which may be used to facilitate optimal hybridization and detection, and/or reduce non-specific or background interactions. Reagents that otherwise improve the efficiency of the assay, such as protease inhibitors, nuclease inhibitors, anti-microbial agents, etc., may also be used as appropriate, depending on the sample preparation methods and purity of the target.
The assay data are analyzed to determine the expression levels, and changes in expression levels as between states, of individual genes, forming a gene expression profile.
Screens are performed to identify modulators of the angiogenesis phenotype.
In one embodiment, screening is performed to identify modulators that can induce or suppress a particular expression profile, thus preferably generating the associated phenotype.
In another embodiment, e.g., for diagnostic applications, having identified differentially expressed genes important in a particular state, screens can be performed to identify modulators that alter expression of individual genes. In an another embodiment, screening is performed to identify modulators that alter a biological function of the expression product of a differentially expressed gene. Again, having identified the importance of a gene in a particular state, screens are performed to identify agents that bind and/or modulate the biological activity of the gene product.
In addition screens can be done for genes that are induced in response to a candidate agent. After identifying a modulator based upon its ability to suppress an angiogenesis expression pattern leading to a normal expression pattern, or to modulate a single angiogenesis gene expression profile so as to mimic the expression of the gene from normal tissue, a screen as described above can be performed to identify genes that are specifically modulated in response to the agent. Comparing expression profiles between normal tissue and agent treated angiogenesis tissue reveals genes that are not expressed in normal tissue or angiogenesis tissue, but axe expressed in agent treated tissue. These agent-s specific sequences can be identified and used by methods described herein for angiogenesis genes or proteins. In particular these sequences and the proteins they encode find use in marling or identifying agent treated cells. In addition, antibodies can be raised against the agent induced proteins and used to target novel therapeutics to the treated angiogenesis tissue sample.
Thus, in one embodiment, a test compound is administered to a population of angiogenic cells, that have an associated angiogenesis expression profile. By "administration" or "contacting" herein is meant that the candidate agent is added to the cells in such a manner as to allow the agent to act upon the cell, whether by uptake and intracellular action, or by action at the cell surface. In some embodiments, nucleic acid encoding a proteinaceous candidate agent (i. e., a peptide) may be put into a viral construct such as an adenoviral or retroviral construct, and added to the cell, such that expression of the peptide agent is accomplished, e.g., PCT US97/01019. Regulatable gene therapy systems can also be used.
Once the test compound has been administered to the cells, the cells can be washed if desired and axe allowed to incubate under preferably physiological conditions for some period of time. The cells are then harvested and a new gene expression profile is generated, as outlined herein.
Thus, for example, angiogenesis tissue may be screened for agents that modulate, e.g., induce or suppress the angiogenesis phenotype. A change in at least one gene, preferably many, of the expression profile indicates that the agent has an effect on angiogenesis activity. By defining such a signature for the angiogenesis phenotype, screens for new drugs that alter the phenotype can be devised. With this approach, the drug target need not be known and need not be represented in the original expression screening platform, nor does the level of transcript for the target protein need to change.
Measure of angiogenesis polypeptide activity, or of angiogenesis or the angiogenic phenotype can be performed using a variety of assays. For example, the effects of the test compounds upon the function of the anagiogenesis polypeptides can be measured by examining parameters described above. A suitable physiological change that affects activity can be used to assess the influence of a test compound on the polypeptides of this invention.

When the functional consequences are determined using intact cells or animals, one can also measure a variety of effects such as, in the case of angiogenesis associated with tumors, tumor growth, neovascularization, hormone release, transcriptional changes to both known and uncharacterized genetic markers (e.g., northern blots), changes in cell metabolism such as cell growth or pH changes, and changes in intracellular second messengers such as cGMP. In the assays of the invention, mammalian angiogenesis polypeptide is typically used, e.g., mouse, preferably human.
A variety of angiogenesis assays are known to those of skill in the art.
Various models have been employed to evaluate angiogenesis (e.g., Croix et al., Science 289:1197-1202, 2000 and Kahn et al., Afner. J. Pathol. 156:1887-1900). Assessement of angiogenesis in the presence of a potential modulator of angiogenesis can be performed using cell-cultre-based angiogenesis assays, e.g., endothelial cell tube formation assays, as well as other bioassays such as the chick CAM assay, the mouse corneal assay, and assays measuring the effect of administering potential modulators on implanted tumors. The chick CAM assay is described by O'Reilly, et al. Cell 79: 315-328, 1994. Briefly, 3 day old chicken embryos with intact yolks are separated from the egg and placed in a petri dish. After 3 days of incubation, a methylcellulose disc containing the protein to be tested is applied to the CAM of individual embryos. After about 48 hours of incubation, the embryos and CAMS are observed to determine whether endothelial growth has been inhibited. The mouse corneal assay involves implanting a growth factor-containing pellet, along with another pellet containing the suspected endothelial growth inhibitor, in the cornea of a mouse and observing the pattern of capillaries that are elaborated in the cornea. Angiogenesis can also be measured by determining the extent of neovascularization of a tumor. For example, carcinoma cells can be subcutaneously inoculated into athymic nude mice and tumor growth then monitored. The cancer cells are treated with an angiogenesis inhibitor, such as an antibody, or other compound that is exogenously administered, or can be transfected prior to inoculation with a polynucleotide inhibitor of angiogenesis. Immunoassays using endothelial cell-specific antibodies are typically used to stain for vascularization of tumor and the number of vessels in the tumor.
Assays to identify compounds with modulating activity can be performed ira vitro. For example, an angiogenesis polypeptide is first contacted with a potential modulator and incubated for a suitable amount of time, e.g., from 0.5 to 48 hours. In one embodiment, the angiogenesis polypeptide levels are determined in vitro by measuring the level of protein or mRNA. The level of protein is measured using immunoassays such as western blotting, ELISA and the like with an antibody that selectively binds to the angiogenesis polypeptide or a fragment thereof. For measurement of mRNA, amplification, e.g., using PCR, LCR, or hybridization assays, e.g., northern hybridization, RNAse protection, dot blotting, are preferred. The level of protein or mRNA is detected using directly or indirectly labeled detection agents, e.g., fluorescently or radioactively labeled nucleic acids, radioactively or enzymatically labeled antibodies, and the like, as described herein.
Alternatively, a reporter gene system can be devised using the angiogenesis protein promoter operably linked to a reporter gene such as luciferase, green fluorescent protein, CAT, or (3-gal. The reporter construct is typically transfected into a cell. After treatment with a potential modulator, the amount of reporter gene transcription, translation, or activity is measured according to standard techniques known to those of skill in the art.
In a preferred embodiment, as outlined above, screens may be done on individual genes and gene products (proteins). That is, having identified a particular differentially expressed gene as important in a particular state, screening of modulators of the expression of the gene or the gene product itself can be done. The gene products of differentially expressed genes are sometimes referred to herein as "angiogenesis proteins". In preferred embodiments the angiogenesis protein comprises a sequence shown in Table 8.
The angiogenesis protein may be a fragment, or alternatively, be the full length protein to a fragment shown herein.
Preferably, the angiogenesis protein is a fragment of approximately 14 to 24 amino acids long. More preferably the fragment is a soluble fragment. In one embodiment an angiogenesis protein is conjugated or fused to an immunogenic agent or BSA.
In one embodiment, screening for modulators of expression of specific genes is performed. Typically, the expression of only one or a few genes are evaluated. In another embodiment, screens are designed to first find compounds that bind to differentially expressed proteins. These compounds are then evaluated for the ability to modulate differentially expressed activity. Moreover, once initial candidate compounds are identified, variants can be further screened to better evaluate strucutre activity relationships.
In a preferred embodiment, binding assays are done. In general, purified or isolated gene product is used; that is, the gene products of one or more differentially expressed nucleic acids are made. For example, antibodies are generated to the protein gene products, and standard immunoassays are run to determine the amount of protein present.
Alternatively, cells comprising the angiogenesis proteins can be used in the assays.

Thus, in a preferred embodiment, the methods comprise combining an angiogenesis protein and a candidate compound, and determining the binding of the compound to the angiogenesis protein. Preferred embodiments utilize the human angiogenesis protein, although other mammalian proteins may also be used, for example for the development of animal models of human disease. In some embodiments, as outlined herein, variant or derivative angiogenesis proteins may be used.
Generally, in a preferred embodiment of the methods herein, the angiogenesis protein or the candidate agent is non-diffusably bound to an insoluble support having isolated sample receiving areas (e.g. a microtiter plate, an array, etc.). The insoluble supports may be made of any composition to which the compositions can be bound, is readily separated from soluble material, and is otherwise compatible with the overall method of screening. The surface of such supports may be solid or porous and of any convenient shape.
Examples of suitable insoluble supports include microtiter plates, arrays, membranes and beads. These are typically made of glass, plastic (e.g., polystyrene), polysaccharides, nylon or nitrocellulose, teflonTM, etc. Microtiter plates and arrays are especially convenient because a large number of assays can be carried out simultaneously, using small amounts of reagents and samples.
The particular manner of binding of the composition is not crucial so long as it is compatible with the reagents and overall methods of the invention, maintains the activity of the composition and is nondiffusable. Preferred methods of binding include the use of antibodies (which do not sterically block either the ligand binding site or activation sequence when the protein is bound to the support), direct binding to "sticky" or ionic supports, chemical crosslinking, the synthesis of the protein or agent on the surface, etc.
Following binding of the protein or agent, excess unbound material is removed by washing. The sample receiving areas may then be blocked through incubation with bovine serum albumin (BSA), casein or other innocuous protein or other moiety.
In a preferred embodiment, the angiogenesis protein is bound to the support, and a test compound is added to the assay. Alternatively, the candidate agent is bound to the support and the angiogenesis protein is added. Novel binding agents include specific antibodies, non-natural binding agents identified in screens of chemical libraries, peptide analogs, etc. Of particular interest are screening assays for agents that have a low toxicity for human cells. A wide variety of assays may be used for this purpose, including labeled in vitro protein-protein binding assays, electrophoretic mobility shift assays, immunoassays for protein binding, functional assays (phosphorylation assays, etc.) and the like.

The determination of the binding of the test modulating compound to the angiogenesis protein may be done in a number of ways. In a preferred embodiment, the compound is labelled, and binding determined directly, e.g., by attaching all or a portion of the angiogenesis protein to a solid support, adding a labelled candidate agent (e.g., a fluorescent label), washing off excess reagent, and determining whether the label is present on the solid support. Various blocking and washing steps may be utilized as appropriate.
By "labeled" herein is meant that the compound is either directly or indirectly labeled with a label which provides a detectable signal, e.g. radioisotope, fluorescers, enzyme, mtibodies, particles such as magnetic particles, chemiluminescers, or specific binding molecules, etc. Specific binding molecules include pairs, such as biotin and streptavidin, digoxin and antidigoxin, etc. For the specific binding members, the complementary member would normally be labeled with a molecule which provides for detection, in accordance with known procedures, as outlined above. The label can directly or indirectly provide a detectable signal.
In some embodiments, only one of the components is labeled, e.g., the proteins (or proteinaceous candidate compounds) can be labeled. Alternatively, more than one component can be labeled with different labels, e.g., lzsl for the proteinsand a fluorophor for the compound. Proximity reagents, e.g., quenching or energy transfer reagents are also useful.
In one embodiment, the binding of the test compound is determined by competitive binding assay. The competitor is a binding moiety known to bind to the target molecule (i.e. an angiogenesis protein), such as an antibody, peptide, binding partner, ligand, etc. Under certain circumstances, there may be competitive binding between the compound and the binding moiety, with the binding moiety displacing the compound. In one embodiment, the test compound is labeled. Either the compound, or the competitor, or both, is added first to the protein for a time sufficient to allow binding, if present. Incubations may be performed at a temperature which facilitates optimal activity, typically between 4 and 40°C. Incubation periods are typically optimized, e.g., to facilitate rapid high throughput screening. Typically between 0.1 and 1 hour will be sufficient. Excess reagent is generally removed or washed away. The second component is then added, and the presence or absence of the labeled component is followed, to indicate binding.
In a preferred embodiment, the competitor is added first, followed by the test compound. Displacement of the competitor is an indication that the test compound is binding to the angiogenesis protein and thus is capable of binding to, and potentially modulating, the activity of the angiogenesis protein. In this embodiment, either component can be labeled.
Thus, for example, if the competitor is labeled, the presence of label in the wash solution indicates displacement by the agent. Alternatively, if the test compound is labeled, the presence of the label on the support indicates displacement.
In an alternative embodiment, the test compound is added first, with incubation and washing, followed by the competitor. The absence of binding by the competitor may indicate that the test compound is bound to the angiogenesis protein with a higher affinity. Thus, if the test compound is labeled, the presence of the label on the support, coupled with a lack of competitor binding, may indicate that the test compound is capable of binding to the angiogenesis protein.
In a preferred embodiment, the methods comprise differential screening to identity agents that are capable of modulating the activitity of the angiogenesis proteins. In this embodiment, the methods comprise combining an angiogenesis protein and a competitor in a first sample. A second sample comprises a test compound, an angiogenesis protein, and a competitor. The binding of the competitor is determined for both samples, and a change, or difference in binding between the two samples indicates the presence of an agent capable of binding to the angiogenesis protein and potentially modulating its activity.
That is, if the binding of the competitor is different in the second sample relative to the first sample, the agent is capable of binding to the angiogenesis protein.
Alternatively, differential screening is used to identify drug candidates that bind to the native angiogenesis protein, but cannot bind to modified angiogenesis proteins.
The structure of the angiogenesis protein may be modeled, and used in rational drug design to synthesize agents that interact with that site. Drug candidates that affect the activity of an angiogenesis protein are also identified by screening drugs for the ability to either enhance or reduce the activity of the protein.
Positive controls and negative controls may be used in the assays. Preferably control and test samples are performed in at least triplicate to obtain statistically significant results. Incubation of all samples is for a time sufficient for the binding of the agent to the protein. Following incubation, samples are washed free of non-specifically bound material and the amount of bound, generally labeled agent determined. For example, where a radiolabel is employed, the samples may be counted in a scintillation counter to determine the amount of bound compound.
A variety of other reagents may be included in the screening assays. These include reagents like salts, neutral proteins, e.g. albumin, detergents, etc.
which may be used to facilitate optimal protein-protein binding and/or reduce non-specific or background interactions. Also reagents that otherwise improve the efficiency of the assay, such as protease inhibitors, nuclease inhibitors, anti-microbial agents, etc., may be used. The mixture of components may be added in an order that provides for the requisite binding.
In a preferred embodiment, the invention provides methods for screening for a compound capable of modulating the activity of an angio~enesis protein. The methods comprise adding a test compound, as defined above, to a cell comprising angiogenesis proteins. Preferred cell types include almost any cell. The cells contain a recombinant nucleic acid that encodes an angiogenesis protein. In a preferred embodiment, a library of candidate agents are tested on a plurality of cells.
In one aspect, the assays are evaluated in the presence or absence or previous or subsequent exposure of physiological signals, for example hormones, antibodies, peptides, antigens, cytokines, growth factors, action potentials, pharmacological agents including chemotherapeutics, radiation, carcinogenics, or other cells (i.e. cell-cell contacts). In another example, the determinations are determined at different stages of the cell cycle process.
In this way, compounds that modulate angiogenesis agents are identified.
Compounds with pharmacological activity axe able to enhance or interfere with the activity of the angiogenesis protein. Once identified, similar structures are evaluated to identify critical structural feature of the compound.
In one embodiment, a method of inhibiting angiogenic cell division is provided. The method comprises administration of an angiogenesis inhibitor. In another embodiment, a method of inhibiting angiogenesis is provided. The method comprises administration of an angiogenesis inhibitor. In a further embodiment, methods of treating cells or individuals with angiogenesis are provided. The method comprises administration of an angiogenesis inhibitor.
In one embodiment, an angiogenesis inhibitor is an antibody as discussed above. In another embodiment, the angiogenesis inhibitor is an antisense molecule.
Polynucleotide modulators of angio eg nesis Afztisense Polynucleotides In certain embodiments, the activity of an angiogenesis-associated protein is downregulated, or entirely inhibited, by the use of antisense polynucleotide, i.e., a nucleic acid complementary to, and which can preferably hybridize specifically to, a coding mRNA
nucleic acid sequence, e.g., an angiogenesis protein mRNA, or a subsequence thereof.

Binding of the antisense polynucleotide to the mRNA reduces the translation and/or stability of the mRNA.
In the context of this invention, antisense polynucleotides can comprise naturally-occurring nucleotides, or synthetic species formed from naturally-occurnng subunits or their close homologs. Antisense polynucleotides may also have altered sugar moieties or inter-sugar linkages. Exemplary among these are the phosphorothioate and other sulfur containing species which are known for use in the art. Analogs are comprehended by this invention so long as they function effectively to hybridize with the angiogenesis protein mRNA. See, e.g., Isis Pharmaceuticals, Carlsbad, CA; Sequitor, Inc., Natick, MA.
Such antisense polynucleotides can readily be synthesized using recombinant means, or can be synthesized in vitf°o. Equipment for such synthesis is sold by several vendors, including Applied Biosystems. The preparation of other oligonucleotides such as phosphorothioates and alkylated derivatives is also well known to those of skill in the art.
Antisense molecules as used herein include antisense or sense oligonucleotides. Sense oligonucleotides can, e.g., be employed to block trancription by binding to the anti-sense strand. The antisense and sense oligonucleotide comprise a single-stranded nucleic acid sequence (either RNA or DNA) capable of binding to target mRNA
(sense) or DNA (antisense) sequences for angiogenesis molecules. A preferred antisense molecule is for an angiogenesis sequences in Tables 1-8 , or for a ligand or activator thereof.
Antisense or sense oligonucleotides, according to the present invention, comprise a fragment generally at least about 14 nucleotides, preferably from about 14 to 30 nucleotides. The ability to derive an antisense or a sense oligonucleotide, based upon a cDNA
sequence encoding a given protein is described in, for example, Stein and Cohen (Cancer Res. 48:2659, 1988) and van der Krol et al. (BioTechniques 6:958, 1988).
Ribozymes In addition to antisense polynucleotides, ribozymes can be used to target and inhibit transcription of angiogenesis-associated nucleotide sequences. A
ribozyme is an RNA
molecule that catalytically cleaves other RNA molecules. Different kinds of ribozymes have been described, including group I ribozymes, hammerhead ribozymes, hairpin ribozymes, RNase P, and axhead ribozymes (see, e.g., Castanotto et al. (1994) Adv. ih Phaf macology 25:
289-317 for a general review of the properties of different ribozymes).
The general features of hairpin ribozymes are described, e.g., in Hampel et al.
(1990) Nucl. Acids Res. 18: 299-304; Hampel et al. (1990) European Patent Publication No. 0 360 257; U.S. Patent No. 5,254,678. Methods of preparing are well known to those of skill in the art (see, e.g., Wong-Steal et al., WO 94126877; Ojwang et al. (1993) Proc.
Natl. Aced.
Sci. USA 90: 6340-6344; Yamada et al. (1994) Humara Gene Therapy 1: 39-45;
Leavitt et al.
(1995) Proc. Natl. Aced. Sci. USA 92: 699-703; Leavitt et al. (1994) Human Gene Therapy 5:
1151-120; and Yamada et al. (1994) Virology 205: 121-126).
Polynucleotide modulators of angiogenesis may be introduced into a cell containing the target nucleotide sequence by formation of a conjugate with a ligand binding molecule, as described in WO 91/04753. Suitable ligand binding molecules include, but are not limited to, cell surface receptors, growth factors, other cytokines, or other ligands that bind to cell surface receptors. Preferably, conjugation of the ligand binding molecule does not substantially interfere with the ability of the ligand binding molecule to bind to its corresponding molecule or receptor, or block entry of the sense or antisense oligonucleotide or its conjugated version into the cell. Alternatively, a polynucleotide modulator of angiogenesis may be introduced into a cell containing the target nucleic acid sequence, e.g., by formation of an polynucleotide-lipid complex, as described in WO 90/10448.
It is understood that the use of antisense molecules or knock out and knock in models may also be used in screening assays as discussed above, in addition to methods of treatment.
Thus, in one embodiment, methods of modulating angiogenesis in cells or organisms are provided. In one embodiment, the methods comprise administering to a cell an anti-angiogenesis antibody that reduces or eliminates the biological activity of an endogeneous angiogenesis protein. Alternatively, the methods comprise, administering to a cell or organism a recombinant nucleic acid encoding an angiogenesis protein.
This may be accomplished in any number of ways. In a preferred embodiment, for example when the angiogenesis sequence is dovcnl-regulated in angiogenesis, such state may be reversed by increasing the amount of angiogenesis gene product in the cell. This can be accomplished, e.g., by overexpressing the endogeneous angiogenesis gene or administering a gene encoding the angiogenesis sequence, using known gene-therapy techniques, for example.
In a preferred embodiment, the gene therapy techniques include the incorporation of the exogenous gene using enhanced homologous recombination (EHR), for example as described in PCT/US93/03868, hereby incorporated by reference in its entireity.
Alternatively, for exarnple when the angiogenesis sequence is up-regulated in angiogenesis, the activity of the endogeneous angiogenesis gene is decreased, for example by the administration of a angiogenesis antisense nucleic acid or other inhibitor, such as RNAi.

In one embodiment, the angiogenesis eproteins of the present invention may be used to generate polyclonal and monoclonal antibodies to angiogenesis proteins.
Similarly, the angiogenesis proteins can be coupled, using standard technology, to affinity chromatography columns. These columns may then be used to purify angiogenesis i antibodies useful for production, diagnostic, or therapeutic purposes. In a preferred embodiment, the antibodies are generated to epitopes unique to a angiogenesis protein; that is, the antibodies show little or no cross-reactivity to other proteins. The angiogenesis antibodies may be coupled to standard affinity chromatography columns and used to purify angiogenesis proteins. The antibodies may also be used as blockitng polypeptides, as outlined above, since they will specifically bind to the angiogenesis protein.
Methods of identifyifag va~iahZ afagiogenesis-associated sequeraces Without being bound by theory, expression of various angiogenesis sequences is correlated with angiogenesis. Accordingly, disorders based on mutant or variant angiogenesis genes may be determined. In one embodiment, the invention provides methods for identifying cells containing variant angiogenesis genes, e.g., determining all or part of the sequence of at least one endogeneous angiogenesis genes in a cell. This may be accomplished using any number of sequencing techniques. In a preferred embodiment, the invention provides methods of identifying the angiogenesis genotype of an individual, e.g., determining all or part of the sequence of at least one angiogenesis gene of the individual.
This is generally done in at least one tissue of the individual, and may include the evaluation of a number of tissues or different samples of the same tissue. The method may include comparing the sequence of the sequenced angiogenesis gene to a known angiogenesis gene, i.e., a wild-type gene.
The sequence of all or part of the angiogenesis gene can then be compared to the sequence of a known angiogenesis gene to determine if any differences exist. This can be done using any number of known homology programs, such as Bestfit, etc. In a preferred embodiment, the presence of a a difference in the sequence between the angiogenesis gene of the patient and the known angiogenesis gene correlates with a disease state or a propensity for a disease state, as outlined herein.
In a preferred embodiment, the angiogenesis genes are used as probes to determine the number of copies of the angiogenesis gene in the genome.
In another preferred embodiment, the angiogenesis genes are used as probes to determine the chromosomal localization of the angiogenesis genes. Information such as chromosomal localization finds use in providing a diagnosis or prognosis in particular when chromosomal abnormalities such as translocations, and the like are identified in the angiogenesis gene locus.
Administration of pharmaceutical arad vaccirae cofnpositioras In one embodiment, a therapeutically effective dose of an angiogenesis protein or modulator thereof, is administered to a patient. By "therapeutically effective dose" herein is meant a dose that produces effects for which it is administered. The exact dose will depend on the purpose of the treatment, and will be ascertainable by one skilled in the art using known techniques (e.g., Ansel et al., Pharmaceuitcal Dosage Forms and Drug Delivery, Lippincott, Williams & Wilkins Publishers, ISBN:0683305727; Lieberman (1992) Pharmaceutical Dosage Forms (vols. 1-3), Dekker, ISBN 0824770846, 082476918X, 0824712692, 0824716981; Lloyd (1999) The Art, Science and Technology of Pharmaceutical Compounding, Amer. Pharmacutical Assn, ISBN 0917330889; and Pickar (1999) Dosage Calculations, Delmar Pub, ISBN 0766805042). As is known in the art, adjustments for angiogenesis degradation, systemic versus localized delivery, and rate of new protease synthesis, as well as the age, body weight, general health, sex, diet, time of administration, drug interaction and the severity of the condition may be necessary, and will be ascertainable with routine experimentation by those skilled in the art.
A "patient" for the purposes of the present invention includes both humans and other animals, particularly mammals. Thus the methods are applicable to both human therapy and veterinary applications. In the preferred embodiment the patient is a mammal, preferably a primate, and in the most preferred embodiment the patient is human.
The administration of the angiogenesis proteins and modulators thereof of the present invention can be done in a variety of ways as discussed above, including, but not limited to, orally, subcutaneously, intravenously, intranasally, transdermally, intraperitoneally, intramuscularly, intrapulmonary, vaginally, rectally, or intraocularly. In some instances, for example, in the treatment of wounds and inflammation, the angiogenesis proteins and modulators may be directly applied as a solution or spray.
The pharmaceutical compositions of the present invention comprise an angiogenesis protein in a form suitable for administration to a patient. In the preferred embodiment, the pharmaceutical compositions are in a water soluble form, such as being present as pharmaceutically acceptable salts, which is meant to include both acid and base addition salts. "Pharmaceutically acceptable acid addition salt" refers to those salts that retain the biological effectiveness of the free bases and that are not biologically or otherwise undesirable, formed with inorganic acids such as hydrochloric acid, hydrobromic acid, sulfuric acid, nitric acid, phosphoric acid and the like, and organic acids such as acetic acid, propionic acid, glycolic acid, pyruvic acid, oxalic acid, malefic acid, malonic acid, succinic acid, fumaric acid, tartaric acid, citric acid, benzoic acid, cinnamic acid, mandelic acid, methanesulfonic acid, ethanesulfonic acid, p-toluenesulfonic acid, salicylic acid and the like.
"Pharmaceutically acceptable base addition salts" include those derived from inorganic bases such as sodium, potassium, lithium, ammonium, calcium, magnesium, iron, zinc, copper, manganese, aluminum salts and the like. Particularly preferred are the ammonium, potassium, sodium, calcium, and magnesium salts. Salts derived from pharmaceutically acceptable organic non-toxic bases include salts of primary, secondary, and tertiary amines, substituted amines including naturally occurring substituted amines, cyclic amines and basic ion exchange resins, such as isopropylamine, trimethylamine, diethylamine, triethylamine, tripropylamine, and ethanolamine.
The pharmaceutical compositions may also include one or more of the following: Garner proteins such as serum albumin; buffers; fillers such as microcrystalline cellulose, lactose, corn and other starches; binding agents; sweeteners and other flavoring agents; coloring agents; and polyethylene glycol.
The pharmaceutical compositions can be administered in a variety of unit dosage forms depending upon the method of administration. For example, unit dosage forms suitable for oral administration include, but are not limited to, powder, tablets, pills, capsules and lozenges. It is recognized that angiogenesis protein modulators (e.g., antibodies, antisense constructs, ribozymes, small organic molecules, etc.) when administered orally, should be protected from digestion. This is typically accomplished either by complexing the molecules) with a composition to render it resistant to acidic and enzymatic hydrolysis, or by packaging the molecules) in an appropriately resistant carrier, such as a liposome or a protection barner. Means of protecting agents from digestion are well known in the art.
The compositions for administration will commonly comprise an angiogenesis protein modulator dissolved in a pharmaceutically acceptable carrier, preferably an aqueous carrier. A variety of aqueous carriers can be used, e.g., buffered saline and the like. These solutions are sterile and generally free of undesirable matter. These compositions may be sterilized by conventional, well known sterilization techniques. The compositions may contain pharmaceutically acceptable auxiliary substances as required to approximate physiological conditions such as pH adjusting and buffering agents, toxicity adjusting agents and the like, for example, sodium acetate, sodium chloride, potassium chloride, calcium chloride, sodium lactate and the like. The concentration of active agent in these formulations can vary widely, and will be selected primarily based on fluid volumes, viscosities, body weight and the like in accordance with the particular mode of administration selected and the patient's needs (e.g., Renairrgton's Pharmaceutical Science, 15th ed., Mack Publishing Company, Easton, Pennsylvania (1980) and Goodman and Gillman, The Pharrnacologial Basis of Therapeutics,(Hardman, J.G, Limbird, L.E, Molinoff, P.B., Ruddon, R.W, and Gilman, A.G.,eds) TheMcGraw-Hill Companies, Inc.,1996).
Thus, a typical pharmaceutical composition for intravenous administration would be about 0.1 to 10 mg per patient per day. Dosages from 0.1 up to about 100 mg per patient per day may be used, particularly when the drug is administered to a secluded site and not into the blood stream, such as into a body cavity or into a lumen of an organ.
Substantially higher dosages are possible in topical administration. Actual methods for preparing parenterally administrable compositions will be known or apparent to those skilled in the art, e.g., Remirrgton s Plaarmaceutical Science and Goodman and Gillman, The Pharmacologial Basis of Therapeutics, supra.
The compositions containing modulators of angiogenesis proteins can be administered for therapeutic or prophylactic treatments. In therapeutic applications, compositions are administered to a patient suffering from a disease (e.g., a cancer) in an amount sufficient to cure or at least partially arrest the disease and its complications. An amount adequate to accomplish this is defined as a "therapeutically effective dose." Amounts effective for this use will depend upon the severity of the disease and the general state of the patient's health. Single or multiple administrations of the compositions may be administered depending on the dosage and frequency as required and tolerated by the patient. In any event, the composition should provide a sufficient quantity of the agents of this invention to effectively treat the patient. An amount of modulator that is capable of preventing or slowing the development of cancer in a mammal is referred to as a "prophylactically effective dose."
The particular dose required for a prophylactic treatment will depend upon the medical condition and history of the mammal, the particular cancer being prevented, as well as other factors such as age, weight, gender, administration route, efficiency, etc.
Such prophylactic treatments may be used, e.g., in a mammal who has previously had cancer to prevent a recurrence of the cancer, or in a mammal who is suspected of having a significant likelihood of developing cancer.

It will be appreciated that the present angiogenesis protein-modulating compounds can be administered alone or in combination with additional angiogenesis modulating compounds or with other therapeutic agent, e.g., other anti-cancer agents or treatments.
In numerous embodiments, one or more nucleic acids, e.g., polynucleotides comprising nucleic acid sequences set forth in Tables 1-8 , such as antisense polynucleotides or ribozymes, will be introduced into cells, in vitro or in vivo. The present invention provides methods, reagents, vectors, and cells useful for expression of angiogenesis-associated polypeptides and nucleic acids using in vitro (cell-free), ex vivo or in vivo (cell or organism-based) recombinant expression systems.
The particular procedure used to introduce the nucleic acids into a host cell for expression of a protein or nucleic acid is application specific. Many procedures for introducing foreign nucleotide sequences into host cells may be used. These include the use of calcium phosphate transfection, spheroplasts, electroporation, liposomes, microinjection, plasma vectors, viral vectors and any of the other well known methods for introducing cloned genomic DNA, cDNA, synthetic DNA or other foreign genetic material into a host cell (see, e.g., Berger and Kimmel, Guide to Molecular' Cloning Techniques, Methods in Enzymology volume 152 Academic Press, Inc., San Diego, CA (Berger), F.M. Ausubel et al., eds., Current Protocols, a j oint venture between Greene Publishing Associates, Inc. and John Wiley &
Sons, Inc., (supplemented through 1999), and Sambrook et al., Molecular Cloning - A
Laboratory Manual (2nd Ed.), Vol. 1-3, Cold Spring Harbor Laboratory, Cold Spring Harbor, New York, 1989.
In a preferred embodiment, angiogenesis proteins and modulators are administered as therapeutic agents, and can be formulated as outlined above.
Similarly, angiogenesis genes (including both the full-length sequence, partial.sequences, or regulatory sequences of the angiogenesis coding regions) can be administered in a gene therapy application. These ang'iogenesis genes can include antisense applications, either as gene therapy (i.e. for incorporation into the genome) or as antisense compositions, as will be appreciated by those in the art.
Angiogenesis polypeptides and polynucleotides can also be administered as vaccine compositions to stimulate HTL, CTL and antibody responses.. Such vaccine compositions can include, for example, lipidated peptides (e.g.,Vitiello, A, et al., J. Clin.
Invest. 95:341, 1995), peptide compositions encapsulated in poly(DL-lactide-co-glycolide) ("PLG") microspheres (see, e.g., Eldridge, et al., Molec. Irrzrnunol. 28:287-294, 1991: Alonso et al., Vaccine 12:299-306, 1994; Jones et al., Vaccine 13:675-681, 1995), peptide compositions contained in immune stimulating complexes (ISCOMS) (see, e.g., Takahashi et al., Nature 344:873-875, 1990; Hu et al., Clin Exp Immuraol. 113:235-243, 1998), multiple antigen peptide systems (MAPS) (see e.g., Tam, J. P., Proc. Natl. Acad. Sci.
U.S.A. 85:5409-5413, 1988; Tam, J.P., J. Immunol. Methods 196:17-32, 1996), peptides formulated as multivalent peptides; peptides for use in ballistic delivery systems, typically crystallized peptides, viral delivery vectors (Perkus, M. E. et al., In: Concepts in vaccine developrnent, Kaufinann, S. H. E., ed., p. 379, 1996; Chakrabarti, S. et al., Nature 320:535, 1986; Hu, S. L.
et al., Nature 320:537, 1986; Kieny, M.-P. et al., AIDS BiolTechnology 4:790, 1986; Top, F.
H. et al., J. Infect. Dis. 124:148, 1971; Chanda, P. K. et al., Virology 175:535, 1990), particles of viral or synthetic origin (e.g., Kofler, N. et al., J. Immunol.
Methods. 192:25, 1996; Eldridge, J. H. et al., Sem. Ilematol. 30:16, 1993; Falo, L. D., Jr. et al., Nature Med.
7:649, 1995), adjuvants (Warren, H. S., Vogel, F. R., and Chedid, L. A. Anrau.
Rev. Immunol.
4:369, 1986; Gupta, R. K. et al., vaccine 11:293, 1993), liposomes (Reddy, R.
et al., J.
Inamunol. 148:1585, 1992; Rock, K. L., Imnaunol. Today 17:131, 1996), or, naked or particle absorbed cDNA (Ulmer, J. B. et al., Science 259:1745, 1993; Robinson, H. L., Hunt, L. A., and Webster, R. G., Vaccine 11:957, 1993; Shiver, J. W. et al., In: Concepts ira vaccine development, Kaufinann, S. H. E., ed., p. 423, 1996; Cease, K. B., and Berzofsky, J. A., Annu. Rev. Immunol. 12:923, 1994 and Eldridge, J. H. et al., Sem. Xenaatol.
30:16, 1993).
Toxin-targeted delivery technologies, also known as receptor mediated targeting, such as those of Avant Immunotherapeutics, Inc. (Needham, Massachusetts) may also be used.
Vaccine compositions often include adjuvants. Many adjuvants contain a substance designed to protect the antigen from rapid catabolism, such as aluminum hydroxide or mineral oil, and a stimulator of immune responses, such as lipid A, Bortadella pertussis or Mycobacterium tuberculosis derived proteins. Certain adjuvants are commercially available as, for example, Freund's Incomplete Adjuvant and Complete Adjuvant (Difco Laboratories, Detroit, MI); Merck Adjuvant 65 (Merck and Company, Inc., Rahway, NJ); AS-2 (SmithKline Beecham, Philadelphia, PA); aluminum salts such as aluminum hydroxide gel (alum) or aluminum phosphate; salts of calcium, iron or zinc; an insoluble suspension of acylated tyrosine; acylated sugars; canonically or anionically derivatized polysaccharides;
polyphosphazenes; biodegradable microspheres; monophosphoryl lipid A and quil A.
Cytokines, such as GM-CSF, interleukin-2, -7, -12, and other like growth factors, may also be used as adjuvants.

Vaccines can be administered as nucleic acid compositions wherein DNA or RNA encoding one or more of the polypeptides, or a fragment thereof, is administered to a patient. This approach is described, for instance, in Wolff et. al., Science 247:1465 (1990) as well as U.S. Patent Nos. 5,580,859; 5,589,466; 5,804,566; 5,739,118;
5,736,524; 5,679,647;
WO 98/04720; and in more detail below. Examples of DNA-based delivery technologies include "naked DNA", facilitated (bupivicaine, polymers, peptide-mediated) delivery, cationic lipid complexes, and particle-mediated ("gene gun") or pressure-mediated delivery (see, e.g., U.S. Patent No. 5,922,687).
For therapeutic or prophylactic immunization purposes, the peptides of the invention can be expressed by viral or bacterial vectors. Examples of expression vectors include attenuated viral hosts, such as vaccinia or fowlpox. This approach involves the use of vaccinia virus, for example, as a vector to express nucleotide sequences that encode angiogenic polypeptides or polypeptide fragments. Upon introduction into a host, the recombinant vaccinia virus expresses the immunogenic peptide, and thereby elicits an immune response. Vaccinia vectors and methods useful in immunization protocols are described in, e.g., U.S. Patent No. 4,722,848. Another vector is BCG (Bacille Calmette Guerin). BCG vectors are described in Stover et al., Nature 351:456-460 (1991). A wide variety of other vectors useful for therapeutic administration or immunization e.g. adeno and adeno-associated virus vectors, retroviral vectors, Salmonella typhi vectors, detoxified anthrax toxin vectors, and the Iike, will be apparent to those skilled in the art from the description herein (see, e.g., Shata et al. (2000) Mol Med Today, 6: 66-71;
Shedlock et al., J
Leukoc Biol 68,:793-806, 2000; Hipp et al., In Yivo 14:571-85, 2000).
Methods for the use of genes as DNA vaccines are well known, and include placing an angiogenesis gene or portion of an angiogenesis gene under the control of a regulatable promoter or a tissue-specific promoter for expression in an angiogenesis patient.
The angiogenesis gene used for DNA vaccines can encode full-length angiogenesis proteins, but more preferably encodes portions of the angiogenesis proteins including peptides derived from the angiogenesis protein. In one embodiment, a patient is immunized with a DNA
vaccine comprising a plurality of nucleotide sequences derived from an angiogenesis gene.
For example, angiogenesis-associated genes or sequence encoding subfragments of an angiogenesis protein are introduced into expression vectors and tested for their immunogenicity in the context of Class I MHC and an ability to generate cytotoxic T cell responses. This procedure provides for production of cytotoxic T cell responses against cells which present antigen, including intracellular epitopes.

In a preferred embodiment, the DNA vaccines include a gene encoding an adjuvant molecule with the DNA vaccine. Such adjuvant molecules include cytokines that increase the immunogenic response to the angiogenesis polypeptide encoded by the DNA
vaccine. Additional or alternative adjuvants are available.
In another preferred embodiment angiogenesis genes find use in generating animal models of angiogenesis. When the angiogenesis gene identified is repressed or diminished in angiogenesic tissue, gene therapy technology, e.g., wherein antisense RNA
directed to the angiogenesis gene will also diminish or repress expression of the gene.
Animal models of angiogenesis find use in screening for modulators of an angiogenesis-associated sequence or modulators of angiogenesis. Similarly, transgenic animal technology including gene knockout technology, for example as a result of homologous recombination with an appropriate gene targeting vector, will result in the absence or increased expression of the angiogenesis protein. When desired, tissue-specific expression or knockout of the angiogenesis protein may be necessary.
It is also possible that the angiogenesis protein is overexpressed in angiogenesis. As such, transgenic animals can be generated that overexpress the angiogenesis protein. Depending on the desired expression level, promoters of various strengths can be employed to express the transgene. Also, the number of copies of the integrated transgene can be determined and compared for a determination of the expression level of the transgene. Animals generated by such methods find use as animal models of angiogenesis and are additionally useful in screening for modulators to treat angiogenesis or to evaluate a therapeutic entity.
Kits fog Use ifa Diagnostic and/or Prognostic Applications For use in diagnostic, research, and therapeutic applications suggested above, kits are also provided by the invention. In the diagnostic and research applications such kits may include any or all of the following: assay reagents, buffers, angiogenesis-specific nucleic acids or antibodies, hybridization probes and/or primers, antisense polynucleotides, ribozymes, dominant negative angiogenesis polypeptides or polynucleotides, small molecules inhibitors of angiogenesis-associated sequences etc. A therapeutic product may include sterile saline or another pharmaceutically acceptable emulsion and suspension base.
In addition, the kits may include instructional materials containing directions (i. e., protocols) for the practice of the methods of this invention. While the instructional materials typically comprise written or printed materials they are not limited to such. Any medium capable of storing such instructions and communicating them to an end user is contemplated by this invention. Such media include, but are not limited to electronic storage media (e.g., magnetic discs, tapes, cartridges, chips), optical media (e.g., CD ROM), and the like. Such media may include addresses to Internet sites that provide such instructional materials.
The present invention also provides for kits for screening for modulators of angiogenesis-associated sequences. Such kits can be prepared from readily available materials and reagents. For example, such kits can comprise one or more of the following materials: an angiogenesis-associated polypeptide or polynucleotide, reaction tubes, and instructions for testing angiogenic-associated activity. Optionally, the kit contains biologically active angiogenesis protein. A wide variety of kits and components can be prepared according to the present invention, depending upon the intended user of the kit and the particular needs of the user. Diagnosis would typically involve evaluation of a plurality of genes or products. The genes will be selected based on correlations with important parameters in disease which may be identified in historical or outcome data.
It is understood that the examples described above in no way serve to limit the true scope of this invention, but rather are presented for illustrative purposes. All publications, sequences of accession numbers, and patent applications cited in this specification are herein incorporated by reference as if each individual publication or patent application were specifically and individually indicated to be incorporated by reference.
EXAMPLES
Example 1: Tissue Preparation, Labeling Chips, and Fingerprints Purify total RNA fYOm tissue using TRlz~l Reageht Homogenize tissue samples in lml of TRIzol per SOmg of tissue using a Polytron 3100 homogenizer. The generator/probe used depends upon the tissue size. A
generator that is too large for the amount of tissue to be homogenized will cause a loss of sample and lower RNA yield. TRIzo1 is added directly to frozen tissue, which is then homogenize. Following homogenization, insoluble material is removed by centrifugation at 7500 x g for 15 min in a Sorvall superspeed or 12,000 x g for 10 min. in an Eppendorf centrifuge at 4°C. The clear homogenate is transferred to a new tube for use. The samples may be frozen now at -60° to -70°C (and kept for at Ieast one month). The homogenate is mixed with 0.2m1 of chloroform per lml of TRIzoI reagent used in the original homogenization and incubated at room temp. for 2-3 minutes. The aqueous phase is then separated by centrifugation and transferred to a fresh tube and the RNA
precipitated using isopropyl alcohol. The pellet is isolated by centrifugation, washed, air-dried, resuspended in an appropriate volume of DEPC H20, and the absorbance measured.
Purification of poly A+ mRNA from total RNA is performed as follows. Heat an oligotex suspension to 37°C and mixing immediately before adding to RNA. The Elution Buffer is heated at 70°C. Warm up 2 x Binding Buffer at 65°C if there is precipitate in the buffer. Mix total RNA with DEPC-treated water, 2 x Binding Buffer, and Oligotex according to Table 2 on page 16 of the Oligotex Handbook. Incubate for 3 minutes at 65°C.
Incubate for 10 minutes at room temperature. Centrifuge for 2 minutes at 14,000 to 18,000 g.
Remove supernatant without disturbing Oligotex pellet. A little bit of solution can be left behind to reduce the loss of Oligotex. Gently resuspend in Wash Buffer OW2 and pipet onto spin column. Centrifuge the spin column at full speed for 1 minute. Transfer spin column to a new collection tube and gently resuspend in Wash Buffer OW2 and centrifuge as describe herein. Transfer spin column to a new tube and elute with 20 to 100 u1 of preheated (70oC) Elution Buffer. Gently resuspend Oligotex resin by pipetting up and down.
Centrifuge as above. Repeat elution with fresh elution buffer or use first eluate to keep the elution volume low. Read absorbance, using diluted Elution Buffer as the blank. Before proceeding with cDNA synthesis, precipitate the mRNA as follows: add 0.4 vol. of 7.5 M NH40Ac + 2.5 vol of cold 100% ethanol. Precipitate at -20oC 1 hour to overnight (or 20-30 min.
at -70oC).
Centrifuge at 14,000-16,000 x g for 30 minutes at 4oC. Wash pellet with O.SmI
of 80%ethanol (-20oC) then centrifuge at 14,000-16,000 x g for 5 minutes at room temperature..
Repeat 80% ethanol wash. Aix dry the ethanol from the pellet in the hood..
Suspend pellet in DEPC Ha0 at lug/ul concentration.
To further Clean up total RNA using Qiagen's RNeasy kit, add no more than 100ug to an RNeasy column. Adjust sample to a volume of 100u1 with RNase-free water.
Add 350u1 Buffer RLT then 250u1 ethanol (100%) to the sample. Mix by pipetting (do not centrifuge) then apply sample to an RNeasy mini spin column. Centrifuge for 15 sec at >10,000rpm. Transfer column to a new 2-ml collection tube. Add SOOuI Buffer RPE and centrifuge for 15 sec at >10,000rpm. Discard flowthrough. Add SOOuI Buffer RPE
and centrifuge for 15 sec at >10,000rpm. Discard flowthrough then centrifuge for 2 min at maximum speed to dry column membrane. Transfer column to a new 1.5-ml collection tube and apply 30-50u1 of RNase-free water directly onto column membrane.
Centrifuge 1 min at >10,000rpm. Repeat elution. and read absorbance.
cDNA synthesis using Gibco's "Superscript Choice System for cDNA Synthesis"
kit First Strand cDNA synthesis is performed as follows. Use 5ug of total RNA
or lug of polyA+ mRNA as starting material. For total RNA, use 2u1 of Superscript RT. For polyA+ mRNA, use lul of Superscript RT. Final volume of first strand synthesis mix is 20u1. RNA must be in a volume no greater than 10u1. Incubate RNA with lul of 100pmo1 T7-T24 oligo for 10 min at 70C. On ice, add 7 u1 of 4u15X 1st Strand Buffer, 2u1 of 0.1M
DTT, and 1 u1 of lOmM dNTP mix. Incubate at 37C for 2 min then add Superscript RT.
Incubate at 37C for 1 hour.
For the second strand synthesis, place 1st strand reactions on ice and add:
91u1 DEPC H20; 30u15X 2nd Strand Buffer; 3u1 lOmM dNTP mix; lul l0U/ul E.coli DNA
Ligase; 4u1 l0U/ul E.coli DNA Polymerase; and lul 2U/ul RNase H. Mix and incubate 2 hours at 16C. Add 2u1 T4 DNA Polymerase. Tncubate 5 min at 16C. Add 10u1 of 0.5M
EDTA. A further clean-up of DNA is performed using phenol:chloroform:isoamyl Alcohol (25:24:1) purification.
In vitro Transcription (IVT) and labeling with biotin is performed as follows:
Pipet 1.5u1 of cDNA into a thin-wall PCR tube. Make NTP labeling rnix by combining 2u1 T7 lOxATP (75mM) (Ambion); 2u1 T7 lOxGTP (75mM) (Ambion); 1.5u1 T7 lOxCTP (75mM) (Ambion); l.Sul T7 lOxUTP (75mM) (Ambion); 3.75u1 lOmM Bio-11-UTP (Boehringer-Mannheim/Roche or Enzo); 3.75u1 lOmM Bio-16-CTP (Enzo); 2u1 lOx T7 transcription buffer (Ambion); and 2u1 lOx T7 enzyme mix (Ambion). The final volume is 20u1.
Incubate 6 hours at 37°C in a PCR machine. The RNA can be furthered cleaned.
Fragmentation is performed as follows. 15 ug of labeled RNA is usually fragmented. Try to minimize the fragmentation reaction volume; a 10 u1 volume is recommended but 20 u1 is all right. Do not go higher than 20 u1 because the magnesium in the fragmentation buffer contributes to precipitation in the hybridization buffer. Fragment RNA by incubation at 94 C for 35 minutes in 1 x Fragmentation buffer (5 x Fragmentation buffer is 200 mM Tris-acetate, pH 8.1; 500 mM KOAc; 150 mM MgOAc). The labeled RNA transcript can be analyzed before and after fragmentation. Samples can be heated to 65°C for 15 minutes and electrophoresed on 1% agarose/TBE gels to get an approximate idea of the transcript size range For hybridization, 200 u1 (l0ug cRNA) of a hybridization mix is put on the chip. If multiple hybridizations are to be done (such as cycling through a 5 chip set), then it is recommended that an initial hybridization mix of 300 u1 or more be made.
The hybridization mix is: fragment labeled RNA (50ng/uI final cone); 50 pM 948-b control oligo; 1.5 pM BioB; 5 pM BioC; 25 pM BioD; 100 pM CRE; O.lmg/ml hernng sperm DNA;
0.5mg/ml acetylated BSA; and 300 u1 with lxMES hyb buffer.
Labeling is performed as follows: The hybridization reaction includes non-biotinylated IVT (purified by RNeasy columns); IVT antisense RNA 4 p.g:p,l;
random Hexamers (1 p,g/p.l) 4 p,1 and water to 14 u1. The reaciton is incubated at 70°C, 10 min.
Reverse transcriptionis performed in the following reaction: 5X First Strand (BRL) buffer, 6 ~,1; 0.1 M DTT, 3 p.1; 50X dNTP mix, 0.6 p,1; H2O, 2.4 ,u1; Cy3 or Cy5 dUTP
(1mM), 3 p1; SS
RT II (BRL), 1 p1 in a final volume of 16 ~.1. Add to hybridization reaction.
Incubate 30 min., 42°C. Add 1 p,1 SSII and incubate another hour. Put on ice. SOX
dNTP mix (25mM of cold dATP, dCTP, and dGTP, lOmM of dTTP: 25 p,1 each of 100mM dATP, dCTP, and dGTP; 10 ~1 of 100mM dTTP to 15 p,1 H20. dNTPs from Pharmacia) RNA degradation is performed as follows. Add 86 p,1 H20, 1.5 ~.11M NaOH/
2mM EDTA and incubate at 65°C, 10 min.. For U-Con 30, 500 p,1 TE/sample spin at 7000g for 10 min, save flow through for purification. Fox Qiagen purification, suspend u-con recovered material in 500.1 buffer PB and proceed using Qiagen protocol. For DNAse digestion, add 1 u1 of 1/100 dil of DNAse/30u1 Rx and incubate at 37°C
for 15 min. Incubate at 5 min 95°C to denature the DNAse/
For sample preparation, add Cot-1 DNA, 10 ~.1; 50X dNTPs, 1 p,1; 20X SSC, 2.3 p,1; Na gyro phosphate, 7.5 p1; lOmg/ml Hernng sperm DNA; lul of 1/10 dilution to 21.8 final vol. Dry in speed vac. Resuspend in 15 p,1 H20. Add 0.38 p,1 10% SDS.
Heat 95°C, 2 min and slow cool at room temp. for 20 min. Put on slide and hybridize overnight at 64°C.
Washing after the hybridization: 3X SSC10.03% SDS: 2 min., 37.5 mls 20X
SSC+0.75m1s 10% SDS in 250m1s H20; 1X SSC: 5 min., 12.5 mls 20X SSC in 250m1s H20; 0.2X
SSC: 5 min., 2.5 mls 20X SSC in 250m1s H2O. Dry slides and scan at appropiate PMT's and channels.
Example 2. A model of angiogenesis is used to determine expression in angiogenesis In the model of angiogenesis used to determine expression of angiogenesis-associated sequences, human umbilical vein endothelial cells (HUVEC) were obtained, e.g., as passage 1 (p1) frozen cells from Cascade Biologics (Oregon) and grown in maintenance medium: Medium 199 (Life Technologies) supplemented with 20% pooled human serum, 100 mg/ml heparin and 75 mg/ml endothelial cell growth supplements (Sigma) and gentamicin (Life Technologies). An in vitro cell system model was used in which 2x105 HLTVECs were cultured in 0.5 ml 3 mgs/ml plasminogen-depleted fibrinogen (Calbiochem, San Diego, CA) that was polymerized by the addition of 1 unit of maintenance medium supplemented with 100 ng/ml VEGF and HGF and 10 ng/ml TGF-a (R&D Systems, Minneapolis,MN) added (growth medium). The growth medium was replaced every 2 days.
Samples for RNA were collected, e.g., at 0, 2, 6, 15, 24, 48, and 96 hours of culture. The fibrin clots were placed in Trizol (Life Technologies) and disrupted using a Tissuemizer.
Thereafter standard procedures were used for extracting the RNA (e.g., Example 1).
Angiogenesis associated sequences thus identified axe shown in Tables 1-8 .
As indicated, some of the Accession numbers include expression sequence tags (ESTs).
Thus, in one embodiment herein, genes within an expression profile, also termed expression profile genes, include ESTs and are not necessarily full length.

TABLE 1:
Pkey: Unique Eos probeset identifier number Accession: Accession number used for previous patent filings ExAccn: ExempIarAccession number, Genbankaccession number UnigenelD: Unigene number Unigene Title: Unigene gene title Pkey Accession ExAccn UnigenelD UnigeneTitle 134404AB000450AB000450Hs.82771vaccinia related kinase 2 121443AB002380AF180681Hs.6582Rho guanine exchange factor (GEF) 12 1$ 100082AB003103AA130080Hs.4295proteasome (prosome, macropain) 26S subunit, non-ATPase,12 132817AB004884N27852Hs.57553tousled-like kinase 2 130150AF000573BE094848Hs.15113homogentisate 1,2-dioxygenase (homogentisate mat oxidase) 100104AF008937AF008937Hs.102178syntaxin 16 130839AF009301AB011169Hs.20141similar to S. cerevisiae SSM4 427064AF009368AF029674Hs.173422KIAA1605 protein 100113D00591 NM-001269Hs.84746chromosome condensation 1 133980D00760 AA294921Hs.250811v-ral simian leukemia viral oncogene homolog B (ras related; GTP binding protein) 100129D11139 AA469369Hs.5831tissue inhibitor of metalloproteinase 1 (erythroid potentiating activity, collagenase inhibitor) 100154D14657 H60720Hs.81892KIAA0101 gene product 100169D14878 AL037228Hs.82043D123 gene product 101956D17716 NM Hs.121502mannosyl (alpha-1,6-)-glycoprotein beta-1,6-N-acetyl-glucosaminyltransferase 100190D21090 M91401Hs.178658RAD23 (S. cerevisiae) homolog B

134742D26135 NM Hs.89462diacylglycerol kinase, gamma (90kD) 100211D26528 D26528Hs.123058DEADIH (Asp-Glu-Ala-AspIHis) box polypeptide 7 (RNA helicase, 52kD) 100238D30742 L24959Hs.348calciumicalmodulin-dependent protein kinase IV

130283D31762 NM Hs.153954TRAM-like protein 134237D31765 D31765Hs.170114KIAA0061 protein 100248D31888 NM Hs.78398KIAA0071 protein 100256D38128 D25418Hs.393prostaglandin 12 (prostacyclin) receptor (1P) 3 100262D38500 D38500Hs.278468postmeiotic segregation increased 2-like $ 4 134329D38551 N92036Hs.81848RAD21 (S. pombe) homolog 100281D42087 AF091035Hs.184627KIAA0118 protein 100294D49396 AA331881Hs.75454peroxiredoxin 3 100327D55640 D55640 gb:Human monocyte PABL (pseudoautosomal boundary-like sequence) mRNA, clone Mo2.

100335D63391 AW247529Hs.6793platelet-activating factor acetylhydrolase, isoform Ib, gamma subunit (29kD) 134495D63477 D63477Hs.84087KIAA0143 protein 100338D63483 D86864Hs.57735acetyl LDL receptor; SREC

135152D64015 M96954Hs.182741TIA1 cytotoxic granule-associated RNA-binding protein-like 1 134269D79990 NM-014737Hs.80905Ras association (RaIGDSIAF-6) domain family 2 4$ 100372D79997 NM Hs.184339KIAA0175 gene product 134304D80010 BE613486Hs.81412lipin 1 100394D84276 D84284Hs.66052CD38 antigen (p45) 100405D86425 AW291587Hs.82733nidogen 2 100418D86978 D86978Hs.84790KIAA0225 protein $0 133154D87012 D87012Hs.194685topoisomerase (DNA) III beta 134347D87075 AF164142Hs.82042solute carrier family 23 (nucleobase transporters), member 1 128653D87432 D87432Hs.10315solute comer family 7 (cationic amino acid transporter, y+sysfem), member 100438D87448 AA013051Hs.91417topoisomerase (DNA) II binding protein 134593D87845 NM_000437Hs.234392platelet-activating factor acetylhydrolase 2 (40kD) $$ 100481HG1098-HT1098X70377Hs.121489cystatin D

100552HG2167-HT2237AA019521Hs.301946lysosomal 100591HG2415-HT2511NM Hs.231444Homo sapiens, Similar to hypothetical 004091 protein PR01722, clone MGC:15692, mRNA, complete cds 100652HG2825-HT2949BE613608Hs.142653ret finger protein 60 100662HG2887-HT3031r AI368680Hs.816 SRY (sex determining region Y)-box 100899HG4660-HT5073AL039123Hs.103042microtubule-associated protein 1B

100905HG4704-HT5146L12260Hs.172816neuregulin 1 100945HG884-HT884AF002225Hs.180686ubiquitin protein ligase E3A (human papilloma virus E6-associated protein, Angelman syndrome) 100950HG919-HT919AF128542Hs.166846polymerase (DNA directedj, epsilon 6$ 100964J00212 J00212 Empirically selected from AFFX single f probeset 135407J04029 J04029Hs.99936keratin 10 (epidermolytic hyperkeratosis;
keratosis palmaris et plantaris) 130149J04031 AW067805Hs.172665methylenetetrahydrofolate dehydrogenase (NADP+dependent), methenyltetrahydrofolate 131877J04088 J04088Hs.156346topoisomerase (DNA) II alpha (170kD) 101016J04543 J04543Hs.78637annexin A7 134786L06139 T29618Hs.89640TEK tyrosine kinase, endothelial (venous malformations, multiple cutaneous and mucosal) 134100L07540 AA460085Hs.171075replication factor C (activator 1) 5 (36.5kD) 134078L08895 L08895Hs.78995MADS box transcription enhancer factor 2, polypeptide C (myocyte enhancer factor 2C) 101132L11239 L11239Hs.36993gasUulation brain homeo box 1 134849L11353 BE409525Hs.902neurofibromin 2 (bilateral acoustic neuroma) 106432L13773 AK000310Hs.17138hypothetical protein FLJ20303 101152 L13800AI984625Hs.9884spindle pole body protein ' 135397 L14922L14922Hs,166563replication factor C (activator 1) 1 (145kD) 131687 L15189BE297635Hs.3069heat shock 70kD protein 9B (morfalin-2) 101168 L15388NM_005308Hs.211569G protein-coupled receptor kinase 5 $ 421155 L16895H87879Hs.102267lysyl oxidase 101226 L27476AF083B92Hs.75608tightjunction protein 2 (zona occludens 2) 133975 L27624C18356Hs.295944tissue factor pathway inhibitor 2 134739 L32976NM_002419Hs.89449mitogen-activated protein kinase kinase kinase 11 130155 L33404AA101043Hs.151254kallikrein 7 (chymotryptic, stratum corneum) 1 440538 L35263W76332Hs.79107mitogen-activated protein kinase 14 ~

132813 L37347BE313625Hs.57435solute carver family 11 (proton-coupled divalent metal ion transporfers), member 101294 L40371AF168418Hs.116784thyroid hormone receptor interactor 101300 L40391BE535511Hs.74137transmembrane trafficking protein 101310 L41607L41607Hs,934glucosaminyl (N-acetyl) transferase 2, I-branching enzyme 1 130344 L77566AW250122Hs.154879DiGeorge syndrome critical region gene S DGSI; likely ortholog of mouse expressed sequence 2 embryonic lethal 101381 M13928AW675039Hs.1227aminolevulinate, delta-, dehydratase 101668 M14016AW005903Hs.78601uroporphyrinogen decarboxylase 133780 M14219AA557660Hs.76152decorin 101396 M15796BE267931Hs.78996proliferating cell nuclear antigen 101447 M21305M21305 gb:Human alpha satellite and satellite 3 junction DNA sequence.

101458 M22092M22092 gb:Human neural cell adhesion molecule (N-CAM) gene, exon SEC and partial cds.

101470 M22898NM-000546Hs.1846tumor protein p53 (Li-Fraumeni syndrome) 134604 M22995NM Hs.865RAP1A, member of RAS oncogene family 101478 M23379NM-002890Hs.758RAS p21 profein activator (GTPase activating protein) 1 406698 M24364X03068Hs.73931major histocompatibility complex, class II, DQ beta 1 133519 M24400AW583062Hs.74502chymotrypsinogen B1 131185 M25753BE280074Hs.23960cyclin 81 134116 M27691884694Hs.79194CAMP responsive element binding protein 133999 M28213AA535244Hs.78305RAB2, member RAS oncogene family 130174 M29550M29551Hs.151531protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (calcineurin A beta) 129963 M29971M29971Hs.13840-6-methylguanine-DNA methyltransferase 132983 M30269M30269Hs.62041nidogen (enactin) 133900 M31158M31158Hs.77439protein kinase, cAMP-dependent, regulatory, type II, beta 3 101543 M31166M31166Hs.2050pentaxin-related gene, rapidly induced $ by IL-1 beta 101545 M31210BE246154Hs.154210endothelial differentiation, sphingolipid G-protein-coupled receptor, 1 101620 M55420S55271Hs.247930Epsilon , IgE

134691 M59979AW382987Hs.88474prostaglandin-endoperoxide synthase 1 (prostaglandin GIH synthase and cyclooxygenase) 133595 M62810AA393273Hs.75133transcription factor 6-like 1 (mitochondrial transcription factor 1-like) 130425 M63838AA243383Hs.155530interferon, gamma-inducible protein 101700 M64710D90337Hs.247916natriuretic peptide precursor C

101714 M68874M68874Hs.211587phospholipase A2, group IVA (cytosolic, calcium-dependent) 134246 M74524D28459Hs.80612ubiquitin-conjugating enzyme E2A (RAD6 homology 101760 M80254M80254Hs,173125peptidylprolyl isomerase F (cyclophilin F) 45 133948 M81780_cds3X59960Hs.77813sphingomyelin phosphodiesterase 1, acid lysosomal (acid sphingomyelinase) 101791 M83822M83822Hs.62354cell division cycle 4-like 101812 M86934BE439894Hs.78991DNA segment, numerous copies, expressed probes (GS1 gene) 101813 M87338NM-002914Hs.139226replication factor C (activator 1) 2 (40kD) 133396 M96326M96326Hs.72885azurocidin 1 (cationic antimicrobial rna1 protein 37) 135152 M96954M96954Hs.182741TIA1 cytotoxic granule-associated RNA-binding protein-like 1 129026 M98833AL120297Hs.108043Friend leukemia virus integration 1 ~

101901 S66793H38026Hs.308arrestin 3, retinal (X-arrestin) 134831 S72370AA853479Hs.89890pyruvate carboxylase 134039 S78569NM-002290Hs.78672laminin, alpha 4 5$ 134395 S79873AA456539Hs.8262lysosomal 101975 S83325AA079117Hs.283664aspartate beta-hydroxylase 101977 S83364AF112213Hs.184062putative Rab5-interacting protein 101978 S83365BE561610Hs.5809putative transmembrane protein; homolog of yeast Golgi membrane protein Yiflp (Yip1 p-interacting factor) 60 101998 001212001212Hs.248153olfactory marker protein 102003 001922001922Hs.125565translocase of inner mitochonddal membrane 8 (yeast) homolog A

102007 002556002556Hs.75307t-complex-associated-testis-expressed 1-like 102009 002680BE245149Hs.82643protein tyrosine kinase 9 416658 003272003272Hs.79432fibrillin 2 (congenital contractural arachnodactyly) 65 132951 004209AW821182Hs.61418microfibdllar-associated protein 1 135389 005237005237Hs.99872fetalAlzheimerantigen 102048 007225007225Hs.339purinergic receptor P2Y, G-protein coupled, 130145 007620034820Hs.151051mitogen-activated protein kinase 10 303153 009759009759Hs.246857mitogen-activated protein kinase 9 420269 009820072937Hs.96264alpha thalassemialmental retardation syndrome X-linked (RAD54 (S. cerevisiae) homolog)~

102095 011313011313Hs.75760sterol comer protein 2 102123 014518NM_001809Hs.1594centramere protein A (17kD) 102126 014575AW950870Hs.78961protein phosphatase 1, regulatory (inhibitor) subunit 8 102133 015173AU076845Hs.155596BCL2ladenovirus E1 B 19kD-interacting protein 2 7$ 102139 015932NM Hs.2128dual specificity phosphatase 5 102162 018291AA450274Hs.1592CDC16 (cell division cycle 16, S. cerevisiae, homology ~3 102164 018300NM 000107Hs.77602damage-specific DNA binding protein 2 (48kD) 427653 018383AA159001Hs.180069nuclear respiratory factor 1 131817 020536020536 Hs,3280caspase 6, apoptosis-related cysteine protease 102200 021551AA232362Hs.157205branched chain aminotransferase 1, cytosolic $ 102210 023028BE619413Hs.2437eukaryotic translation initiation factor 2B, subunit 5 (epsilon, 82kD) 102214 023752023752 Hs.32964SRY (sex determining region Y)-box 11 132811 025435025435 Hs.57419CCCTC-binding factor (zinc finger protein) 131319 025997NM_003155Hs,25590stanniocalcin 1 102256 U28251028251 Hs.53237ESTs, Highly similar to Z169_HUMAN ZINC
cds2 FINGER PROTEIN 169 [H.sapiens]

1 _ 028831 Hs.44566ICIAA1641 protein ~ 132316 028831 102269 030245030245 gb:Human myelomonocytic specific protein (MNDA) gene, 5' flanking sequence and complete exon 1.

134365 032315AA568906Hs.82240syntaxin 3A

102293 032439AF090116Hs,79348regulator of G-protein signalling 7 1$102298 032849AA382169Hs.54483N-myc (and STAT) interactor 102325 035139AI815867Hs.50130necdin (mouse) homolog 302344 036764BE303044Hs.192023eukaryotic translation initiation factor 3, subunit 2 (beta, 36kD) 102361 039400AA223616Hs.75859chromosome 11 open reading frame 4 102367 039657039656 Hs.118825mitogen-activated protein kinase kinase 102388 041344AA362907Hs.76494proline arginine-rich end leucine-rich repeat protein 102394 041766NM_003816Hs.2442a disintegrin and metalloproteinase domain 9 (meltrin gamma) 129829 041813AF010258Hs.127428homeo box A9 102251 041815NM-004398Hs.41706DEADIH (Asp-Glu-Ala-AspIHis) box polypeptide 10 (RNA helicase) 102409 043286BE300330Hs.118725selenophosphate synthetase 2 2$133746 044378AW410035Hs.75862MAD (mothers against decapentaplegic, Drosophila) homolog 4 102423 044754247542 Hs.179312small nuclear RNA activafing complex, polypeptide 1, 43kD

132828 047011AB014615Hs.57710fibroblastgrowthfactor8(androgen-induced) cds1 130441 047077063630 Hs.155637protein kinase, DNA-activated, catalytic polypeptide 102450 048251048251 Hs.75871protein kinase C binding protein 1 129350 050535050535 Hs.110630Human BRCA2 region, mRNA sequence CG006 102534 056833096759 Hs.198307von Hippel-Lindau binding protein 1 130457 058091AB014595Hs.155976cullin 4B

135065 058837AA019401Hs.93909cyclic nucleotide gated channel beta 102560 059289897457 Hs.63984cadherin 13, H-cadherin (heart) 3 102567 059863063830 Hs.146847TRAF family member-associated NFfCB
$ activator 134305 067122061397 Hs.81424ubiquitin-like 1 (senUin) 102638 067319067319 Hs.9216caspase 7, apoptosis-related cysteine protease 132736 068019AW081883Hs.288261Homo sapiens cDNA: FLJ23037 fis, clone LNG02036, highly similar to HSU68019 Homo sapiens mad protein homolog (hMAD-3) mRNA

4~133070 069611092649 Hs.64311a disintegrin and mefalloproteinase domain 17 (tumor necrosis factor, alpha, converting enzyme) 102663 070322NM 002270Hs.168075karyopherin (importin) beta 2 134660 073524073524 Hs.87465ATPIGTP-binding protein 102735 079267AF111106Hs.3382protein phosphatase 4, regulatory subunit 102741 079291AW959829Hs.83572hypothetical protein MGC14433 4$101175 082671082671 Hs.36980melanoma antigen, family A, 2 cds2 132164 084573AI752235Hs.41270procollagen-lysine, 2-oxoglutarate 5-dioxygenase (lysine hydroxylase) 2 102823 090914D85390 Hs.5057carboxypeptidase D

102826 091316NM_007274Hs.8679oytosolic acyl coenzyme A thioester hydrolase 102831 091932AA262170Hs.80917adaptor-related protein complex 3, sigma 1 subunit $ 102846 096131BE264974Hs.6566thyroid hormone receptor interactor ~ 13 129777 097018097018 Hs.12451echinoderm microtubule-associated protein-like 134161 097188AA634543Hs.79440IGF-II mRNA-binding protein 3 134854 V00503J03464 Hs.179573collagen, type I, alpha 2 302363 X04327AW163799Hs.1983652,3-bisphosphoglycerate mutase $$133708 X06389A1018666Hs.75667synaptophysin 125701 X07496T72104 Hs.93194apolipoprotein A-I

102915 X07820X07820 Hs.2258matrix metalloproteinase 10 (stromelysin 2) 134656 X14787AI750878Hs.87409thrombospondin 1 413858 X15525_rna1NIV~001610Hs.75589acid phosphatase 2, lysosomal 102968 X16396AU076611Hs.154672methylene tetrahydrofolate dehydrogenase (NAD+dependent), methenyltetrahydrofolate cyclohydrolase 102971 X16609X16609 Hs.183805ankyrin 1, erythrocytic 134037 X53586AI808780Hs.227730integrin, alpha 6 rna1 103023 X53793AW500470Hs.117950multifunctional polypeptide similar to SAICAR synthetase and AIR carboxylase 6$103037 X54936BE018302Hs.2894placental growth factor, vascular endothelial growth factor-related protein 130282 X55740BE245380Hs.1539525' nucleotidase (CD73) 134542 X57025M14156 Hs.85112insulin-like growth factor 1 (somatomedin C) 128568 X60673H12912 Hs.274691adenylate kinase 3 rna1 103093 X60708S79876 Hs.44926dipeptidylpeptidase (V (CD26, adenosine deaminase complexing protein 2) 133606 X62048010564 Hs.75188wee1+(S. pombe) homolog 129063 X63097X63094 Hs.283822Rhesus blood group, D antigen 424460 X63563BE275979Hs.296014polymerase (RNA) II (DNA directed) polypeptide B (140kD) 133227 X64037AW977263Hs.68257general transcription factor IIF, polypeptide 1 (74kD subunit) 103181 X69636X69636 Hs.334731Homo sapiens, clone IMAGE:3448306, mRNA, partial cds 75103184 X69878043143 Hs.74049fms-related tyrosine kinase 4 103194 X70649NM-004939Hs.78580DEADIH (Asp-Glu-Ala-AspIHis) box polypeptide 103208 X72841AW411340Hs.31314retinoblastoma-binding protein 7 129698 X74987BE242144Hs.12013ATP-binding cassette, sub-family E
(OABP), member 1 131486 X83107F06972Hs.27372BMX non-receptor tyrosine kinase 130729 X84194AI963747Hs.18573acylphosphatase 1, erythrocyte (common) type $ 103334 X85753NM_001260Hs.25283cyclin-dependent kinase 8 132645 X87870AI654712Hs.54424hepatocyte nuclearfactor4, alpha 135094 X89066NM Hs.250687transient receptor potential channel 103352 X89398H09366Hs.78853uracil-DNA glycosylase cds2 _ X89399Hs.119274RAS p21 protein activator (GTPase 103353 X89399 activating protein) 3 (Ins(1,3,4,5)P4-binding protein) 132173 X89426X89426Hs.41716endothelial cell-specific molecule 103371 X91247X91247Hs.13046thioredoxin reductase 1 131584 X91648AA598509Hs.29117purine-rich element binding protein A

103376 X92098AL036166Hs.323378coated vesicle membrane protein 103378 X92110AL119690Hs.153618HCGVIII-1 protein 1$ 128510 X94703X94703Hs.296371RAB28, member RAS oncogene family 103410 X96506AA158294Hs.334879DR1-associated protein 1 (negative cofactor 2 alpha) 133490 X97230AF022044Hs.274601killer cell immunoglobulin-like receptor, f three domains, long cytoplasmic tail,1 103438 X98263AW175781Hs.152720M-phase phosphoprotein 6 103440 X98296X98296Hs.77578ubiquitin specific protease 9, X chromosome (Drosophila fat facets related) 2~ 103452 X99584NM Hs.85119SMT3 (suppressor of mif two 3, yeast) 006936 homolog 1 133536 Y00264W25797.comp amyloid beta (A4) precursor protein Hs.177486 (protease nexin-ll, Alzheimer disease) 135185 Y07566AW404908Hs.96038Ric (Drosophila)-like, expressed in many tissues 118523 Y07759Y07759Hs.170157myosin VA (heavy polypeptide 12, myoxin) 134662 Y07827NM_007048Hs.284283butyrophilin, subfamily 3, memberA1 .

~$ 132083 Y07867BE386490Hs.279663Pirin 103500 Y09443AW408009Hs.22580alkylglycerone phosphate synthase 134389 Y09858Y09858Hs.82577spindlin-like 132084 Y12394NM Hs.3886karyopherin alpha 3 (importin alpha 002267 4) 103540 211559NM Hs.154721aconitase 1, soluble 3 133152 211695211695Hs.324473mitogen-activated protein kinase 1 Q

103548 215005215005Hs.75573centromere protein E (312kD) 103612 246261BE336654Hs.70937H3 histone family, memberA

129092 AA011243D56365Hs.63525poly(rC)-binding protein 2 s 103692 AA018418AW137912Hs.227583Homo Sapiens chromosome X map Xp11.23 L-type calcium channel alpha-1 subunit 3$ (CACNA1F) pseudogene, gene, complete complete cds; HSP27 sequence;
and protein, protein, and Hb2E
genes, complete cds 103695 AA018758AW207152Hs.186600ESTs 129796 AA018804BE218319Hs.5807GTPase Rab14 132258 AA031993AA306325Hs.4311SUMO-1 activating enzyme subunit 2 132683 AA044217BE264633Hs.143638WD repeat domain 4 4~ 131887 AA046548W17064Hs.332848SWIISNF related, matrix associated, actin dependent regulator of chromatin, subfamily e, member 1 103723 AA057447-sBE274312Hs.214783Homo Sapiens cDNA FLJ14041 fis, clone 453368 AA058376W20296Hs.288178Homo Sapiens cDNA FLJ11968 fis, clone 133260 AA083572AA403045Hs.6906Homo Sapiens cDNA: FLJ23197 fis, clone 4$ 103765 AA085696AA085696Hs.169600KIAA0826 protein 103766 AA088744AI920783Hs.191435ESTs 103767 AA089688BE244667Hs.296155CGI-100 protein 132051 AA091284AA393968Hs.180145HSPC030 protein 103773 AA092700AI219323Hs.101077ESTs, Weakly similar to T22363 hypothetical protein F47G9.4 - Caenorhabditis elegans $0 [C.elegans]

135289 AA092968AW372569Hs.9788hypothetical protein MGC10924 similar to Nedd4 WW-binding protein 5 132729 AA094800AW970843Hs.55682eukaryotic translation initiation factor 3, subunit 7 (zeta, 66167kD) 103794 AA100219AF244135Hs.30670hepatocellular carcinoma-associated antigen 66 131471 AA114885AA164842Hs.192619KIAA1600 protein $$ 134319 AA129547BE304999Hs.75653fumaratehydratase 103807 AA133016AW958264Hs.103832similar to yeast Upf3, variant B

119159 AA149507AF142419Hs.15020homolog of mouse quaking QKI (KH domain RNA binding protein) 129863 AA151005BE379765Hs.129872sperm associated antigen 9 .

103850 AA187101AA187101Hs.213194hypothetical protein MGC10895 103855 AA195179W02363Hs.302267hypothetical protein FLJ10330 s 322026 AA203138AW024973Hs.283675NPD009 protein 135300 AA203645AA142922Hs.278626ArgIAbl-interacting protein ArgBP2 103861 AA206236AA206236Hs.4944hypothetical protein FLJ12783 130634 AA227621AI769067Hs.127824ESTs, Weakly similar to T28770 hypothetical protein W03D2.1- Caenorhabditis elegans 6$ [C.elegans]

447735 AA248283AA775268Hs.6127Homo Sapiens cDNA: FLJ23020 fis, clone 103909 AA249611AA249611Hs.47438SH3 domain binding glutamic acid-rich protein 131236 AA282640AF043117Hs.24594ubiquitination factor E4B (homologous to yeast UFD2) 134060 AA287199D42039Hs.78871mesoderm development candidate 2 129013 AA313990AA371156Hs.107942DKFZP564M112 protein 129435 AA314256AF151852Hs.111449CGI-94 protein 103988 AA314389' AA314389Hs.42500ADP-ribosylation factor like 5 104000 AA324364AI146527Hs.80475polymerase (RNA) II (DNA directed) polypeptide J (13.3kD) 425284 AA329211AF155568Hs.155489NS1-associated protein 1 s ~$ 128629 AA399187AL096748Hs.102708DKFZP434A043 protein 133281 AA421079AK001601Hs.69594high-mobility group 20A

~$

104104 AA422029AA422029Hs.143640ESTs, Weakly similar to hyperpolarization-activated cyclic nucleotide-gated channel hHCN2 [H.sapiens]

108154 AA425230NM Hs.220689Ras-GTPase-activating protein SH3-domain-binding 005754 protein 132091 AA447052AW954243Hs.170218KIAA0251 protein $ 135073 AA452000W55956Hs.94030Homo sapiens mRNA; cDNA DKFZp586E1624 (from clone DKFZp586E1624) 131367 AA456687AI750575Hs.173933nuclear factor 1!A

129593 AA487015AI338247Hs.98314Homo Sapiens mRNA; cDNA DKFZp586L0120 s (from clone DKFZp586L0120) 135266 AB002326841179Hs.973~3KIAA0328 protein 133505 C01527Ai630124Hs.324504Homo Sapiens mRNA; cDNA DKFZp586J0720 (from clone DKFZp586J0720) 1 132064 C01714AA121098Hs.3838serum-inducible kinase ~

134393 C01811W52642Hs.8261hypothetical protein FLJ22393 f 131427 C02352AF151879Hs.26706CGI-121 protein s 133435 C02375AI929357Hs.323966Homo sapiens clone H63 unknown mRNA

104282 C14448C14448Hs.332338EST

1$ 134827 D16611BE314037Hs.89866coproporphyrinogen oxidase (coproporphyria, s harderoporphyria) 130443 D25216D25216Hs.155650KIAA0014 gene product 131742 D31352AA961420Hs.31433ESTs 132837 D58024AA370362Hs.57958EGF-TM7-latrophilin-related protein s 130377 D80897NM Hs.155182KIAA1036 protein 104334 D82614D82614Hs.78771phosphogiycerate kinase 1 134593 D87845NM-000437Hs.234392platelet-activating factor acetylhydrolase 2 (40kD) 134731 D89377D89377Hs.89404msh (Drosophila) homeo box homolog 2 l 129913 H06583NM-001310Hs.13313cAMP responsive element binding protein-like 131670 H40732H03514Hs.10130ESTs ~,$104394 H46617AA129551Hs.172129Homo sapiens cDNA: FLJ21409 fis, clone 104402 H56731H56731Hs.132956ESTs 129781 H75570AA306090Hs.124707ESTs 129077 H78886N74724Hs.108479ESTs 104417 H81241A1819448Hs.320861Kruppel-likefactor8 134927 L36531L36531Hs.91296integrin, alpha 8 129280 M63154M63154Hs.110014gastric intrinsic factor (vitamin B
synthesis) 134498 M63180AW246273Hs.84131threonyl-tRNA synthetase 104460 M91504AW955705Hs.62604Homo sapiens, clone IMAGE:4299322, mRNA, partial cds 104488 N56191N56191Hs.106511protocadherin 17 35 131248 N78483A1038989Hs.332633Bardet-Biedl syndrome 2 129214 N79268AL044335Hs.109526zinc finger protein 198 130017 814652AK000096Hs.143198inhibitor of growth family, member 3 104530 820459AK001676Hs.12457hypothetical protein FLJ10814 104534 822303822303 gb:yh26b09.r1 Soares placenta Nb2HP
Homo Sapiens cDNA clone IMAGE:1308415', mRNA

40 sequence.

104544 833779A1091173Hs.222362ESTs, Weakly similar to p40 [H.sapiens]

133328 836553AW452738Hs.265327hypothetical protein DKFZp7611141 104567 864534AA040620Hs.5672hypothetical protein AF140225 128562 866475AA923382Hs.101490ESTs 129575 870621F08282Hs.278428progestin induced protein 130776 879356AF167706Hs.19280cysteine-rich motor neuron 1 104599 884933AW815036Hs.151251ESTs 104660 RC_AA007160BE298665Hs.14846Homo Sapiens mRNA; cDNA DKFZp564D016 (from clone DKFZp564D016) 104667 RC-AA007234 Hs.30098ESTs s A1239923 $ 104718 RC-AA018409AI143020Hs.36250ESTs, Weakly similar to 138022 hypothetical 0 protein [H.sapiens]

104764 RC-AA025351A1039243Hs.278585ESTs 104786 RC AA027167Hs.10031KIAA0955 protein 104787 RC-AA027317AA027317 gb:ze97d11.s1 Soares feta~heark...NbHH19W
Homo Sapiens cDNA clone IMAGE:366933 3' similar to ;, contains mRNA
Alu repetitive sequence.
element $5 134079 RC-AA029423AK001751Hs.171835hypothetical protein FLJ10889 104804 RC_AA031357AI858702Hs.31803ESTs, Weakly similar to N-WASP [H.sapiens]

104865 RC T79340Hs.22575B-cell CLLllymphoma 6, member B (zinc AA045136 finger protein) 130828 RC-AA053400AW631469Hs.203213ESTs 104907 RC-AA055829AA055829Hs.196701ESTs, Weakly similar to ALU1 HUMAN ALU
SUBFAMILY J SEQUENCE CONTAMINATION

WARNING ENTRY
[H.sapiens]

104943 RC_AA065217AF072873Hs.114218frizzled (Drosophila) homolog 6 105013 RC_AA116054H63789Hs.296288ESTs, Weakly similar to KIAA0638 protein [H.sapiens]

105024 RC_AA126311AA126311Hs.9879ESTs 132592 RC-AA129390AW803564Hs.288850Homo Sapiens cDNA: FLJ22528 fis, clone 65 105038 RC-AA130273AW503733Hs.9414KIAA1488 protein 105077 RC_AA142919W55946Hs.234863Homo Sapiens cDNA FLJ12082 fis, clone 105096 RC_AA150205AL042506Hs.21599Kruppel-like factor 7 (ubiquitous) 129215 RC-AA176867AB040930Hs.126085KIAA1497 protein 105169 RC_AA180321BE245294Hs.180789S164 protein 132796 RC_AA180487NM_006283Hs.173159transforming, acidic coiled-coil containing protein 1 130401 RC_AA187634BE396283Hs.173987eukaryo6c translation initiation factor 3, subunit 1 (alpha, 35kD) 105200 RC_AA195399AA328102Hs.24641cytoskeleton associated protein 2 130114 RC-AA234717AA233393Hs.14992hypothetical protein FLJ11151 0 105330 RC-AA234743AW338625Hs.22120ESTs ~$ 105337 RC_AA234957AI468789Hs.23200myotubularin related protein 1 129385 RC_AA235604AA172106Hs.110950Rag C protein 105376RC-AA236559AW994032Hs.8768hypothetical protein FLJ10849 105397RC AA242868AA814807Hs.7395hypothetical protein FLJ23182 131962RC_AA251776AK000046Hs.267448hypothetical protein FLJ20039 131991AA251909AF053306Hs.36708budding uninhibited by benzimidazoles RC 1 (yeast homclog), beta $ 128658- BE397354Hs.324830diptheria toxin resistance protein required RC_AA252672 for diphthamide biosynthesis (Saccharomyces)-like s 2 105489RC_AA256157AA256157Hs.24115Homo Sapiens cDNA FLJ14178 fis, clone 105508RC AA256680AA173942Hs.326416Homo Sapiens mRNA; cDNA DKFZp564H1916 (from clone DKFZp564H1916) 105539RC_AA258873AB040884Hs.109694KIAA1451 protein 135172RC AA262727AB028956Hs.12144KIAA1033 protein 1 131569RC AL389951Hs.271623nucleoporin 50kD
~ AA281451 132542_ AL137751Hs.263671Homo Sapiens mRNA; cDNA DKFZp43410812 RC-AA281545 (from clone DKFZp43410812); partial cds 105643RC-AA282069BE621719Hs.173802KIAA0603 gene product 105659RC-AA283044AA283044Hs.25625hypothetical protein FLJ11323 105666AA283930AA426234Hs.34906ESTs, Weakly similar to T17210 hypothetical RC protein DKFZp434N041.1 [H.sapiens]

15105674_ AI609530Hs.279789histone deacetylase 3 105709RC_AA291268AI928962Hs.26761DKFZP586L0724 protein 105722RC AA291927AI922821Hs.32433ESTs 105765RC AA343514AA299688Hs.24183ESTs 115951AA398109BE546245Hs.301048sec13-like protein RC

2~105962_ AW880358Hs.339808hypothetical protein FLJ10120 105985RC_AA406610AA406610 gb:zv15b10.s1 Soares_NhHMPu-S1 Homo Sapiens cDNA clone IMAGE:753691 3' similar to gb:X02067 106008RC-AA411465AB033888Hs.8619SRY (sex determining region Y)-box 18 131216AA416886AI815486Hs.243901Homo sapiens cDNA FLJ20738 fis, clone ~5134222_ AW855861Hs.8025Homo Sapiens clone 23767 and 23782 mRNA
AA424013 sequences RC

113689_ AB037850Hs.16621DKFZP4341116 protein 106141RC-AA424558AF031463Hs.9302phosducin-like 130839RC_AA424961AB011169Hs.20141similar to S. cerevisiae SSM4 s 106157AA425367W37943Hs.34892KIAA1323 protein RC

3 130777_ AW135049Hs.285418Homo Sapiens cDNA FLJ10643 fis, clone 0 RC-AA425921 NT2RP2005753, highly similar to Homo Sapiens i-1 receptor 130561RC-AA426220AB011095Hs.16032KIAA0523 protein 106196RC-AA427735AA525993Hs.173699ESTs, Weakly similar to ALU1 HUMAN ALU
SUBFAMILY J SEQUENCE CONTAMINATION

WARNING

35131878RC-AA430673AA083764Hs.6101hypothetical protein MGC3178 133200RC-AA432248AB037715Hs.183639hypothetical protein FLJ10210 106302RC-AA435896AA398859Hs.18397hypothetical protein FLJ23221 106328RC-AA436705AL079559Hs.28020KIAA0766 gene product 450534RC-AA446561AI570189Hs.25132KIAA0470 gene product 106423RC-AA448238AB020722Hs.16714Rho guanine exchange factor (GEF) 15 133442RC-AA448688AL137663Hs.7378Homo Sapiens mRNA; cDNA DKFZp434G227 (from clone DKFZp434G227) 439608RC-AA449756AW864696Hs.301732hypothetical protein MGC5306 106477RC-AA450303823324Hs.41693DnaJ (Hsp40) homolog, subfamily B, member 106503RC-AA452411AB033042Hs.29679cofactor required for Sp1 transcriptional activation, subunit 3 (130kD) 4S446999RC-AA454566AA151520Hs.334822hypothetical protein MGC4485 106543RC_AA454667AA676939Hs.69285neuropilin 1 130010RC-AA456437AA301116Hs.142838nucleolarphosphoproteinNopp34 106589RC-AA456646AK000933Hs.28661Homo sapiens cDNA FLJ10071 fis, clone 106593RC-AA456826AW296451Hs.24605ESTs 106596RC AA456981AA452379Hs.293552ESTs, Moderately similar to ALU7_HUMAN
ALU SUBFAMILY SQ SEQUENCE

CONTAMINATION

134655RC-AA458959AF265208Hs.123090SWIISNF related, matrix associated, actin dependent regulator of chromatin, subfamily f, member1 106636RC-AA459950AW958037Hs.286ribosomal protein L4 -$$106654RC-AA460449AW075485Hs.286049phosphoserineaminotransferase 131353RC-AA463910AW754182 gb:RC2-CT0321-131199-011-c01 CT0321 Homo Sapiens cDNA, mRNA sequence 106707RC_AA464603AK000566Hs.98135hypothetical protein FLJ20559 131710RC-AA464606NM Hs.30985pannexin 1 106717RC-AA465093AA600357Hs.239489TIA1 cytotoxic granule-associated RNA-binding protein 131775RC-AA465692AB014548Hs.31921KIAA0648 protein 106747RC-AA476473NM-007118Hs.171957triple functional domain (PTPRF
interacting) 106773RC-AA478109AA478109Hs.188833ESTs 106781RC-AA478474AA330310Hs.24181ESTs 106817RC-AA480889D61216Hs.18672ESTs 6$106846RC-AA485223AB037744Hs.34892KIAA1323 protein 106848RC-AA485254AA449014Hs.121025chromosome 11 open reading frame 5 106856RC-AA486183W58353Hs.285123Homo sapiens mRNA full length insert cDNA clone EUROIMAGE 2005779 418699RC-AA496936BE539639Hs.173030ESTs, Weakly similar to ALUB-HUMAN ALU
SUBFAMILY SX SEQUENCE CONTAMINATION

WARNING

107001RC-AA598589AI926520Hs.31016putative DNA binding protein 130638RC-AA598831AW021276Hs.17121ESTs f 107054RC_AA600150A1076459Hs.15978KIAA1272 protein 107059RC_AA608545BE614410Hs.23044RAD51 (S. cerevisiaej homolog {E coli RecA homology 107080RC-AA609210AL122043Hs.19221hypothetical protein DKFZp566G1424 107115RC-AA610108BE379623Hs.27693peptidylprolyl isomerase (cyclophilin)-like 107130RC-AA620582AB033106Hs.12913KIAA1280 protein 107156RC-AA621239AA137043Hs.9663programmed cell death 6-interacting protein 107174RC AA621714BE122762Hs.25338ESTs 130621RC AA621718AW513087Hs.16803LUC7 (S. cerevisiae)-like 107190RC-D19673AA836401Hs.5103ESTs 132626RC D25755AW504732Hs.21275hypothetical protein FLJ11011 s 107217RC D51095AL080235Hs.35861DKFZP586E1621 protein 131610RC D60272_iAA357879Hs.29423scavenger receptor with C-type lectin 129604T08879 AF088886Hs.11590cathepsin F

107295T34527 AA186629Hs.80120UDP-N-acetyl-alpha-D-galactosamine:polypeptide N-acetylgalactosaminyltransferase 1 (GaINAc-T1) 107299T40327 BE277457Hs.30661hypothetical protein MGC4606 s 107315T62771 AA316241Hs.90691nucleophosmininucleoplasmin 3 s 107316T63174 T63174Hs.193700Homo Sapiens mRNA; cDNA DKFZp58610324 s ' (from clone DKFZp58610324) 107328T83444 AW959891Hs.76591KIAA0887 protein 1 107334T93641 T93597Hs.187429ESTs S

134715048263 048263Hs.89040prepronociceptin 128636049065 049065Hs.102865interleukin 1 receptor-like 2 129938079300 AW003668Hs.135587Human clone 23629 mRNA sequence 107375088573 BE011845Hs.251064high-mobility group (nonhistone chromosomal) protein 14 130074093867 AL038596Hs.250745polymerase (RNA) III (DNA directed) (62kD) 107387W01094 D86983Hs.118893Melanoma associated gene 132036W01568 AL157433Hs.37706hypothetical protein DKFZp434E2220 107426W26853 W26853Hs.291003hypothetical protein MGC4707 113857W27179 AW243158Hs.5297DKFZP564A2416 protein 25 135388W27965 W27965Hs.99865epimorphin 130419W36280 AF037448Hs.155489NS1-associated protein 1 s 107469W47063 W47063Hs.94668ESTs 132616W79060 BE262677Hs.283558hypothetical protein PR01855 107506W88550 AB028981Hs.8021KIAA1058 protein 30 132358X60486 NM_003542Hs.46423H4 histone family, memberG

107522X78931 X78931Hs.99971zinc finger protein 272 s 125827214077 NM-003403Hs.97496YY1 transcription factor s 107582RC AA002147AA002147Hs.59952EST

107609RC_AA004711875654Hs.164797hypothetical protein FLJ13693 3S 107661RC-AA010383AA010383Hs.60389ESTs 107714RC_AA015761AA015761Hs.60642ESTs 107775RC AA018772AW008846Hs.60857ESTs 107832RC_AA021473-r AA021473 gb:ze66c11.s1 Soares retina N2b4HR Homo Sapiens cDNA clone IMAGE:363956 3', mRNA

sequence.

107859RC_AA024835AW732573Hs.47584potassium voltage-gafed channel, delayed-rectifier, subfamily S, member 3 124337RC-AA025858N23541Hs.281561Homo Sapiens cDNA: FLJ23582 fis, clone 107914RC_AA027229AA027229Hs.61329ESTs, Weakly similar to T16370 hypothetical protein F45E12.5 - Caenorhabditis elegans [C.elegans]

107935RC_AA029428AA029428Hs.61555ESTs 4$ 116262RC_AA035143AI936442Hs.59838hypothetical protein FLJ10808 131461RC-AA035237AA992841Hs.27263KIAA1458 protein 108007RC AA039347AA039347Hs.61916EST

108029RC,~4A040740AA040740Hs.62007ESTs 108040RC_AA041551AL121031Hs.159971SWIISNF related, matrix associated, actin dependent regulator of chromatin, subfamily b, 5~ member1 108084RC_AA045513AA058944Hs.116602Homo Sapiens, clone IMAGE:4154008, mRNA, partial cds 108088RC-AA045745AA045745Hs.62886ESTs 108168RC-AA055348AI453137Hs.63176ESTs 130719RC-AA056582-s AA679262Hs.14235hypothetical protein FLJ20008; KIAA1839 protein $ 108189RC-AA056697AW376061Hs.63335ESTs, Moderately similar to A46010 X-linked 5 retinopathy protein [H.sapiens]

108190RC-AA056746AA056746Hs.63338EST

108203RC_AA057678AW847814Hs.289005Homo Sapiens cDNA: FLJ21532 fis, clone 108216RC-AA058681AA524743Hs.44883ESTs 108217RC-AA058686AA058686Hs.62588ESTs 108245AA062840BE410285Hs.89545proteasome (prosome, macropain) subunit, RC beta type, 4 108277_ AA064859 gb:zm50f03.s1 Stratagene fibroblast (937212) RC_AA064859 Homo Sapiens cDNA clone IMAGE:529085 3', mRNA

108280RC-AA065069AA065069 gb:zm12e11.s1 SUatagene pancreas (937208) Homo Sapiens cDNA clone 3', mRNA sequence 108309RC_AA069923AA069818 gb:zm67e03.r1 Stratagene neuroepithelium (937231) Homo sapiens cDNA clone 5' similar to 6$ 133739RC-AA070799s BE536554Hs.278270unactive progesterone receptor, 23 kD

108340RC AA070815AA069820Hs.180909peroxiredoxin 1 108403RC_AA075374AA075374 gb:zm87a01.s1 Stratagene ovarian cancer (937219) Homo sapiens cDNA clone IMAGE:544872 3', A sequence.
mRN

108427RC-AA076382AA076382 gb:zm91g08.s1 Stratagene ovarian cancer (937219) Homo Sapiens cDNA clone IMAGE:545342 3', A sequence.
mRN

108435RC_AA078787T82427Hs.194101Homo sapiens cDNA: FLJ20869 fis, clone 108439RC_AA078986AA078986 gb:zm92h01.s1 Stratagene ovarian cancer (937219) Homo sapiens cDNA clone IMAGE:545425 3', mRNA
sequence.

108465RC-AA079393AA079393Hs.3462cytochrome c oxidase subunit Vllc 108469RC-AA079487AA079487 gb:zm97f08.s1 Stratagene colon HT29 (937221) Homo Sapiens cDNA clone 3', mRNA

sequence 108500RC_AA083207AA083207Hs.68270EST

108501RC_AA083256AA083256 gb:zn08g12.s1 Stratagene hNT neuron (937233) Homo Sapiens cDNA clone 3' similar to gb:M33308 108533RC_AA0B4415AA084415 gb:zn06g09.s1 Stratagene hNT neuron (937233) Homo Sapiens cDNA clone IMAGE:546688 3', $ mRNA

108562RC_AA085274AA100796 gb:zm26c06.s1 Stratagene pancreas (937208) Homo sapiens cDNA clone 3' similar to gb:X15341 108589RC AA088678A1732404Hs.68846ESTs 130890RC_AA100925A1907537Hs.76698stress-associated endoplasmic reticulum protein 1; ribosome associated membrane protein 4 1 134585RC_AA101255D14041Hs.278573H-2K binding factor-2 ~

130385RC AA126474AW067800Ns.155223stanniocalcin 2 108749RC_AA127017AA127017Hs.71052ESTs 108807RC_AA129968A1652236Hs.49376hypothetical protein FLJ20644 108808RC AA130240AA045088Hs.62738ESTs I 108833RC AA131866AF188527Hs.61661ESTs, Weakly similar to AF1746051 F-box S protein Fbx25 [H.sapiens]

107290RC AA132039W27740Hs.323780ESTs 108846RC_AA132983AL117452Hs.44155DKFZP586G1517 protein 108857RC_AA133250AK001468Hs.62180anillin (Drosophila Scraps homology, actin binding protein 131474RC_AA133583L46353Hs.2726high-mobility group (nonhistone chromosomal) s protein isoform I-C

108894AA135941AK001431Hs.5105hypothetical protein FLJ10569 RC

108941_ AA148650 gb:zo09e06.s1 Stratagene neuroepithelium RC_AA148650 NT2RAMI 937234 Homo sapiens cDNA clone IMAGE:567202 3', 108968RC AA151110AI304870Hs.188680ESTs 108996RC AA155754AW995610Hs.332436EST

2$ 109001RC-AA156125A1056548Hs.72116hypothetical protein FLJ20992 similar to hedgehog-interacting protein 131183RC_AA156289AI611807Hs.285107~ hypothetical protein FLJ13397 109019RC_AA156997AA156755Hs.72150ESTs 109022RC AA157291AA157291Hs.21479ubinuclein 1 109023RC AA157293AA157293Hs.72168ESTs 109068RC_AA164293AA164293Hs.72545ESTs f 109072RC-AA164676AI732585Hs.22394hypothetical protein FLJ10893 129021RC_AA167375AL044675Hs.173081KIAA0530 protein 130346RC-AA167550H05769Hs.188757Homo Sapiens, clone MGC:5564, mRNA, complete cds 109146RC AA176589AA176589Hs.142078EST

3$ 109172RC-AA180448AA180448Hs.144300EST

131080RC-AA187144NM-001955Hs.2271endothelin 1 s 129208RC-AA189170AI587376Hs.109441MSTP033 protein f 109222RC-AA192757AA192833Hs.333512similar to rat myomegalin 109300RC AA205650AA418276Hs.170142ESTs 109481RC-AA233342AA878923Hs.289069hypothetical protein FLJ21016 109485RC_AA233472BE619092Hs.28465Homo sapiens cDNA: FLJ21869 fis, clone 109516RC-AA234110A1471639Hs.71913ESTs 109537RC D80981A1858695Hs.34898ESTs 109556RC F01660A1925294Hs.87385ESTs 45 109577RC F02206F02206Hs.296639Homo Sapiens potassium channel subunit (HERG-3) mRNA, complete cds 109578RC F02208F02208Hs.27214ESTs 109595RC-F02544AA078629Hs.27301ESTs 109625RC F03918H29490Hs.22697ESTs 131983RC F04258-sAF119665Hs.184011pyrophosphatase (inorganic) 109648RC F04600H17800Hs.7154ESTs 109671RC F08998859210Hs.26634ESTs 109699RC F09605H18013Hs.167483ESTs 109820RC F11115AW016809Hs.323795ESTs 109933RC-H06371852417Hs.20945Homo sapiens clone 24993 mRNA sequence $ 110014RC H10995AL109666Hs.7242Homo sapiens mRNA full length insert $ cDNA clone EUROIMAGE 35907 110039RC H11938H11938Hs.21907histone acefylfransferase 110099RC H16568844557Hs.23748ESTs 110107RC H16772AW151660Hs.31444ESTs 110155RC H18951AI559626Hs.93522Homo sapiens mRNA for KIAA1647 protein, partial cds 110197RC H20859AW090386Hs.112278arrestin, beta 1 110223RC H23747H19836Hs.31697ESTs 110306RC H38087H38087Hs.105509CTL2 gene 110335RC H40331H65490Hs.18845ESTs 110342RC H40567H40961Hs.33008ESTs 6$ 110395RC H46966AA025116Hs.33333ESTs 110511RC-H56640_iH56640Hs.221460ESTs 110523RC H57154A1040384Hs.19102ESTs, Weakly similar to organic anion transporter 1 [H.sapiens]

110715RC H96712H96712Hs.269029ESTs 110754RC_N20814AW302200Hs.6336KIAA0672 gene product .

130132RC N25249U55936Hs.184376synaptosomal-associated protein, 23kD

131135RC-N27100NM Hs.267182TBX3-iso protein 134263RC N39616AW973443Hs.8086RNA (guanine-7-) methyltransferase 110938RC_N48982N48982Hs.38034Homo Sapiens cDNA FLJ12924 fis, clone 110983RC N51957NM_015367Hs.10267MIL1 protein ~$ 115062RC N52271AA253314Hs.154103LIM protein (similar to rat protein kinase C-binding enigma) 111081RC_N59435AI146349Hs.271614CGI-112 protein ~9 111128RC N64139AW505364Hs.19074LATS (large tumor suppressor, Drosophila) homolog 2 135244RC_N66981AI834273Hs.9711novel protein 111216RC-N68640AW139408Hs.152940ESTs 437562RC N69352AB001636Hs.5683DEADIH (Asp-Glu-Ala-AspIHis) box polypeptide $ 131002RC_N95226AL050295Hs.22039KIAA0758 protein 111399RC_800138AW270776Hs.18857ESTs 111514RC_R07998807998 gb:yf16g11.s1 Soares fetal liver spleen 1 NFLS Homo sapiens cDNA clone IMAGE:127076 3' similarto 130182RC-808929BE267033Hs.192853ubiquitin-conjugating enzyme E2G 2 (homologous to yeast UBC7) 10111574RC-R103D7A1024145Hs.188526ESTs 111804RC 833354AA482478Hs.181785ESTs 111831RC 836083836095Hs.268695ESTs 129675RC_R37938NM-015556Hs.172180KIAA0440 protein f 111904RC 241572 gb:HSCZYB122 normalized infant brain R39330 cDNA Homo Sapiens cDNA clone c-zyb12, mRNA

15_ sequence 133868RC_R40816_sAB012193Hs.183874cullin 4A

112033RC 843162-s849031Hs.22627ESTs 130987RC_R45698BE613269Hs.21893hypothetical protein DKFZp761N0624 112300RC_R54554H24334Hs.26125ESTs 112513RC_R68425868425Hs.13809hypothetical protein FLJ10648 112514RC_R68568868568Hs.183373src homology 3 domain-containing protein 112522RC_R68763868857Hs.265499ESTs 112540RC-870467869751 gb:yi40a10.s1 Soares placenta Nb2HP
Homo Sapiens cDNA clone 3', mRNA sequence 130346RC_R73565H05769Hs.188757Homo Sapiens, clone MGC:5564, mRNA, complete cds 2S129534RC_R73640AK002126Ns.11260hypothetical protein FLJ11264 112597RC_R78376878376Hs.29733EST

112732RC 892453892453Hs.34590ESTs 131458RC T03865BE297567Hs.27047hypothetical protein FLJ20392 112888RC T03872AW195317Hs.107716hypothetical protein FLJ22344 30131863RC T10072AI656378Hs.33461ESTs 112911RC T10080AW732747Hs.13493like mouse brain protein E46 132215RC T10132AL035703Hs.4236KIAA0478 gene product 112931RC T15343T02966Hs.167428ESTs 112984RC T23457T16971Hs.289014ESTs, Weakly similar to A43932 mucin 2 precursor, intestinal [H.sapiens]

3 112998RC T23555H11257Hs.22968Homo Sapiens clone IMAGE:451939, mRNA
$ sequence 133376RC T23670BE618768Hs.7232acetyl-Coenzyme A carboxylase alpha 113026RC_T23948AA376654Hs.183684eukaryotic translation initiation factor 4 gamma, 2 113070RC T33464AB032977Hs.6298KIAA1151 protein 128970RC T34413AI375672Hs.165028ESTs 40113074RC T34611AK001335Hs.31137protein tyrosine phosphatase, receptor type, E

113095RC T40920AA828380Hs.126733ESTs 113179RC T55182BE622021Hs.152571ESTs, Highly similar to IGF-II mRNA-binding protein 2 [H.sapiens]

113337RC-T77453T77453Hs.302234ESTs 113421RC T84039A1769400Hs.189729ESTs 4$113454RC T86458A1022166Hs.16188ESTs 113481RC T87693T87693Hs.204327EST

131441RC T89350AA302862Hs.90063neurocalcin delta s 113557RC T90945H66470Hs.16004ESTs 113559RC_T90987T79763Hs.14514ESTs S0113589RC T91863A1078554Hs.15682ESTs 113591RC_T91881T91881Hs.200597KIAA0563 gene product 113619RC T93783_s808665Hs.17244hypothetical protein FLJ13605 113683RC_T96687AB035335Hs.144519T-cell leukemiallymphoma 6 113692RC T96944AL360143Hs.17936DKFZP434H132 protein 5$113702RC T97307T97307 gb:ye53h05.s1 Soares fetal liver spleen 1NFLS Homo Sapiens cDNA clone IMAGE:121497 3', mRNA

113717RC_T97764T99513Hs.187447ESTs 113824RC W48817A1631964Hs.34447ESTs 113840RC_W58343872137Hs.7949DKFZP586B2420 protein 60113844RC_W59949AI369275Hs.243010Homo sapiens cDNA FLJ14445 fis, clone HEMBB1001294, highly similar to GTP-BINDING

113902RC_W74644AA340111Hs.100009acyl-CoenzymeA oxidase 1, palmitoyl 113904RC_W74761AF125044Hs.19196ubiqui6n-conjugating enzyme HBUCE1 113905RC_W74802881733Hs.33106ESTs 6$113931RC_W81205BE255499Hs.3496hypothetical protein MGC15749 113932RC W81237AA256444Hs.126485hypothetical protein FLJ12604; KIAA1692 protein 131965RC_W90146_fW79283Hs.35962ESTs 114035RC_W92798W92798Hs.269181ESTs 114106RC 238412AW602528 gb:RC5-BT0562-260100-011-A02 BT0562 Homo Sapiens cDNA, mRNA sequence 133593RC_Z38709AI416988Hs.238272inositol 1,4,5-triphosphate receptor, type 2 114161RC 238904BE548222Hs.299883hypothetical protein FLJ23399 424949RC_Z39103AF052212Hs.153934core-binding factor, runt domain, alpha subunit 2; translocated to, 2 129059RC Z39930_fAW069534Hs.279583CGI-81 protein 128937RC_Z39939AA251380Hs.10726ESTs, Weakly similar to ALU1_HUMAN
ALU SUBFAMILY J SEQUENCE CONTAMINATION

~SWARNING

130983RC_Z40012-iAI479813Hs.278411NCK-associated protein 1 114277 RC A1052229Hs,25373ESTs, Weakly similar to T20410 hypothetical 240377 s protein E02A10.2 - Caenorhabditis elegans [C.elegans]

114304 RC AI934204Hs.16129ESTs 114364 RC AL117427Hs.172778Homo sapiens mRNA; cDNA DKFZp566P013 241680 (from clone DKFZp566P013) $ - AA777749Hs.5978LIM domain only 7 132900 RC_AA005112 129034 RC_AA005432AA481157Hs.108110DKFZP547E2110 protein 131881 RC AW361018Hs.3383upstream regulatory element binding AA010163 protein 1 452461 RC-AA026356N78223 Hs.108106transcription factor 114465 RC BE621056Hs.131731hypothetical protein FLJ11099 1 - AK001644Hs.26156hypothetical protein FLJ10782 ~ 131376 RC_AA036867 101567 RC_AA044644M33552 Hs.56729lysosomal 431555 RC-AA046426AI815470Hs,260024Cdc42 effector protein 3 132944 RC_AA054515T96641 Hs.6127Homo Sapiens cDNA: FLJ23020 fis, clone 114618 RC AW979261Hs.291993ESTs 1$ 130274 RC AA128376Hs.153884ATP binding protein associated with AA085749 cell differentiation 110330 RC-AA098874AI288666Hs.16621DKFZP4341116 protein 114648 RC_AA101056AA101056 gb:zn25b03.s1 Stratagene neuroepithelium NT2RAMI 937234 Homo Sapiens cDNA clone IMAGE:548429 3' 114658 RC-AA102746AA102383Hs.249190tumor necrosis factor receptor superfamily, member 10a 132456 RC-AA114250 Hs.48924KIAA0512 gene product; ALEX2 s AB011084 131319 RC-AA126561 Hs.25590stanniocalcin 1 s NM 003155 132225 RC-AA128980_iAA128980 gb:zo09a11,s1 Stratagene neuroepithelium NT2RAMI 937234 Homo sapiens cDNA clone IMAGE:567164 3' 132669 RC-AA129757W38586 Hs.293981guanine nucleotide binding protein (G
protein), gamma 3, linked 114709 RC-AA129921AA397651Hs.301959proline synthetase co-transcribed (bacterial homology 131973 RC_AA133331AB018284Hs.158688KIAA0741 gene product 114750 RC-AA135958AA887211Hs.129467ESTs 115714 RC_AA136524 Hs.172572hypothetical protein FLJ20093 s T19228 114763 RC-AA147044AA810755Hs.88977hypothetical protein dJ511 E16.2 114767 RC-AA148885AI859865Hs.154443minichromosome maintenance deficient (S, cerevisiae) 4 114774 RC-AA150043AV656017Hs.184325CGI-76 protein 129388 RC_AA151621AA662477Hs.110964hypothetical protein FLJ23471 129183 RC-AA155743BE561824Hs.273369uncharacterized hematopoietic stemlprogenitor cells protein MDS027 128869 RC-AA156335AA768242Hs.80618hypothetical protein 3 130207 RC-AA156336AF044209Hs.144904nuclear receptor co-repressor 1 114798 RC-AA159181AA159181Hs.54900serologically defined colon cancer antigen 114800 RC-AA159825219448 Hs.131887ESTs, Weakly similar to T24396 hypothetical protein T03F6.2 - Caenorhabditis elegans [C.elegans]

114828 RC-AA234185AA252937Hs.283522Homo sapiens mRNA; cDNA DKFZp434J1912 (from clone DKFZp434J1912) 114846 RC-AA234929BE018682Hs.166196ATPase, Ciass I, type 8B, member 1 ' 114848 RC-AA234935BE614347Hs.169615hypothetical protein FLJ20989 114902 RC-AA236359AW275480Hs.39504hypothetical protein MGC4308 132271 RC-AA236466AB030034Hs.115175sterile-alpha motif and leucine zipper containing kinase AZK

114907 RC-AA236535N29390 Hs.13804hypothetical protein dJ462023.2 4S 135159 RC-AA236935 Hs.95631Human normal keratinocyte mRNA
s U43374 132204 RC_AA236942AA235827Hs,42265ESTs 114928 RC-AA237018AA237018Hs.94869ESTs 132481 RC W93378 Hs.49614ESTs 114932 RC-AA242751AA971436Hs.16218KIAA0903 protein $ 314162 RC-AA242760BE041820Hs.38516Homo Sapiens, clone MGC:15887, mRNA, ~ complete cds 131006 RC-AA242763AF064104Hs.22116CDC14 (cell division cycle 14, S.
cerevisiae) homolog B

114935 RC-AA242809H23329 Hs.290880ESTs, Weakly similar to ALU1 HUMAN ALU
SUBFAMILY J SEQUENCE CONTAMINATION

WARNING

132454 RC-AA243133BE296227Hs.250822serinelthreonine kinase 15 $ 437754 RC-AA243495860366 Hs.5822Homo sapiens cDNA: FLJ22120 fis, clone 114957 RC-AA243706AW170425Hs.87680ESTs 114974 RC-AA250848AW966931Hs.179662nucleosome assembly protein 1-like 1 114977 RC-AA250868AW296978Hs,87787ESTs 114995 RC-AA251152AA769266Hs.193657ESTs 60 115005 RC_AA251544 Hs.111339ESTs s A1760825 417177 RC-AA251792NM-004458Hs.81452fatty-acid-Coenzyme A ligase, long-chain 131889 RC_AA252063NM-002589Hs.34073BH-protocadherin (brain-heart) 115026 RC-AA252144AA251972Hs.188718ESTs 115045 RC AW014549Hs.58373ESTs f 115068 RC_AA253461AW512260Hs,87767ESTs $

133138 RC-AA255522AV657594Hs.181161Homo Sapiens cDNA,FLJ14643 fis, clone NT2RP2001597, weakly similar to RYANODINE

RECEPTOR, 115114 RC_AA256468AA527548Hs.7527small fragment nuclease 129584 RC-AA256528AV656017Hs.184325CGI-76 protein 115137 RC-AA257976AW968304Hs,56156ESTs 134312 RC_AA258296AB011151Hs.334659hypothetical protein MGC14139 115166 RC AF095727Hs.287832myelin protein zero-like 1 115167 RC-AA258421AA749209Hs.43728hypothetical protein 129807 RC-AA262077Y11192 Hs.5299aldehyde dehydrogenase 5 family, memberA1 (succinate-semialdehyde dehydrogenase) 115239 RC-AA278650BE251328Hs.73291hypothetical protein FLJ10881 115243 RC-AA278766AA806600Hs.116665KIAA1842 protein 100850RC_AA279667 Hs.297939cathepsin B
s AA836472 126884RC_AA280791U49436Hs.286236KIAA1856 protein 115322RC-AA280819L08895Hs.78995MADS box transcription enhancer factor 2, potypeptide C (myocyte enhancer factor 2Cj 133626RC_AA280828AW836130Hs.75277hypothetical protein FLJ13910 $ 115372RC_AA282195AW014385Hs.88678ESTs, Weakly similar to Unknown [H.sapiens]

132825RC-AA283127_sU82671Hs.57698Emplricaliy selected from AFFX single probeset 130269RC-AA284694F05422Hs.168352nucleopodn-like protein 1 129192RC AA291137AA286914Hs.183299ESTs 452598AA291708AI831594Hs.68647ESTs, Weakly similar to ALU7_HUMAN ALU
RC SUBFAMILY SO SEQUENCE CONTAMINATION

IO -WARNING

132131RC-AA293495AF069291Hs.40539chromosome 8 open reading frame 1 115536RC AA347193AK001468Hs.62180anillin (Drosophila Scraps homology, actin binding protein 132411RC-AA398474AA059412Hs.47986hypothetical protein MGC10940 s 115575RC AA398512AA393254Hs.43619ESTs 1$ 115601RC_AA400277AA148984Hs.48849ESTs, Weakly similar to ALU4_HUMAN ALU

WARNING

103928RC-AA400896D14540Hs.199160myeloidllymphoid or mixed-lineage leukemia (trithorax (Drosophila) homology 125819RC AA404494AA044840Hs.251871CTP synthase 115683RC-AA410345AF255910Hs.54650functional adhesion molecule 2 20 115715RC_AA416733BE395161Hs.1390proteasome (prosome, macropain) subunit, beta type, 2 132952RC_AA425154AI658580Hs.61426Homo sapiens mesenchymal stem cell protein DSC96 mRNA, partial cds 115819RC AA426573AA486620Hs.41135endomucin-2 132525RC_AA431418AW292809Hs.50727N-acetylglucosaminidase, alpha- (Sanfilippo disease IIIB) 115895RC AA436182AB033035Hs.51965KIAA1209 protein 2$ 132333RC-AA437099AA192869Hs.45032ESTs 115962RC-AA446585AI636361Hs.179520hypothetical protein MGC10702 115967RC_AA446887AI745379Hs.42911ESTs 115974RC_AA447224BE513442Hs.238944hypothetical protein FLJ10631 115985RC-AA447709AA447709Hs.268115ESTs, Weakly similar to T08599 probable transcription factor CA150 [H.sapiens]

30 129254RC_AA453624AA252468Hs.1098DKFZp434J1813 protein 133071RC_AA455044BE384932Hs.64313ESTs, Weakly similar to AF2571821 G-protein-coupled receptor 48 (H.sapiens]

116095RC AA456045AA043429Hs.62618ESTs 122691RC-AA460454-s819768Hs.172788ALEX3 protein 116210RC_AA476494BE622792Hs.172788ALEX3 protein 3 116213RC-AA476738AA292105Hs.326740hypothetical protein MGC10947 $

134585RC_AA481422D14041Hs.278573H-2K binding factor-2 134790RC-AA482269BE002798Hs.287850integral membrane protein 1 116265RC-AA482595BE297412Hs.55189hypothetical protein 129334RC-AA485084-sAW157022Hs.4947hypothetical protein FLJ22584 116274RC_AA485431AI129767Hs.182874guanine nucleotide binding protein (G
s protein) alpha 12 303150RC-AA489057AA887146Hs.8217stromal antigen 2 129945RC AA489638BE514376Hs.165998PAI-1 mRNA-binding protein 116331RC-AA491000N41300Hs.71616Homo sapiens mRNA; cDNA DKFZp586N1720 (from clone DKFZp586N1720) 116333RC_AA491250AF155827Hs.203963hypothetical protein FLJ10339 4$ 132994RC_AA505133AA112748Hs.279905clone H00310 PR00310p1 134577RC-AA598447BE244323Hs.85951exportin, tRNA (nuclear export receptor for tRNAs) 116391RC-AA599243T86558Hs.75113general transcription factor IIIA

116394RC AA599574-iNM Hs.65370lipase, endothelial 134531RC-AA600153AI742845Hs.110713DEK oncogene (DNA binding) $0 116417RC-AA609309AW499664Hs.12484Human clone 23826 mRNA sequence 116429RC-AA609710AF191018Hs.279923putative nucleotide binding protein, estradiol-induced 116439RC_AA610068AA251594Hs.43913PIBF1 gene product 116459RC_AA621399880137Hs.302738Homo sapiens cDNA: FLJ21425 fis, clone 427505RC-AA621752AA361562Hs.17876126S proteasome-associated pad1 homolog $$ 132699RC-C21523AW449822Hs.55200ESTs 116541RC D12160D12160Hs.249212polymerase (RNA) III (DNA directed) (155kD) 132557RC D19708AA114926Hs.5122ESTs 112259RC-D25801AA337548Hs.333402hypothetical protein MGC12760 116571RC-D45652D45652 gb:HUMGS02848 Human adult lung 3' directed Mbol cDNA Homo Sapiens cDNA 3', mRNA

60 sequence.

129815RC D60208BE565817Hs.26498hypothetical protein FLJ21657 f 421919RC_D80504_sAJ224901Hs.109526zinc finger protein 198 116643RC_F03010AI367044Hs.153638myeloidllymphoid or mixed-lineage leukemia 116661RC_F04247861504 gb:yh16a03.s1 Soares infant brain 1NIB
Homo Sapiens cDNA clone 3' similar to contains Alu 6$ repetitive 116715RC_F10966AL117440Hs.170263tumor protein p53-binding protein,1 116729RC_F13700BE549407Hs.115823ribonuclease P, 40kD subunit 318709RC-H05063852576Hs.285280Homo sapiens cDNA: FLJ22096 fis, clone 134760RC_H16758NIUL000121Hs.89548erythrapoietin receptor 116773RC_H17315AI823410Hs.169149karyopherin alpha 1 (importin alpha 5) s 106425RC_H22556H24201Hs.247423adducin 2 (beta) 116780RC_H22566H22566Hs.30098ESTs 131978RC_H48459AA355925Hs.36232KIAA0186 gene product s 116819RC_H53073H53073Hs.93698EST

~$ 111428RC_H56559AL031428Hs.174174KIAA0601 protein s 133175RC 1i57957_sAW955632Hs.66666ESTs, Weakly similar to S19560 proline-rich protein MP4 - mouse [M,musculus]

116844 RC-H64938H64938Hs.337434ESTs, Weakly similarto A46010 X-linked s retinopathy protein [H.sapiens]

116845 RC_H64973AA649530 gb:ns44f05.s1 NCI_CGAP_AIv1 Homo sapiens cDNA clone, mRNA sequence 116892 RC-H69535AI573283Hs.38458ESTs 116925 RC H73110Hs.260603ESTs, Moderately similar to A47582 B-cell H73110 growth factor precursor [H.sapiens]

$ 116981 RC-H81783N29218Hs.40290ESTs 131768 RC_H86259AC005757Hs.31809hypothetical protein 117031 RC_H88353H88353 gb:yw21a02.s1 Morton Fefal Cochlea Homo Sapiens cDNA clone IMAGE:252842 3'similarto contains L1 117034 RC-H88639U72209Hs.180324YY1-associated factor 2 1 132542 RC_H88675AL137751Hs.263671Homo sapiens mRNA; cDNA DKFZp43410812 ~ (from clone DKFZp43410812); partial cds 134403 RC_H93708_sAA334551Hs.82767sperm specific antigen 2 117280 RC-N22107M18217Hs.172129Homo sapiens cDNA: FLJ21409 fis, clone 117344 RC 819085Hs.210706Homo Sapiens cDNA FLJ13182 fis, clone 117422 RC AI355562Hs.43880ESTs, Weakly similar to A46010 X-linked N27028 retinopathy protein (H,sapiens]

1$117475 RC N30205Hs.93740ESTs, Weakly similar to 138022 hypothetical N30205 protein [H.sapiensj 117487 RC N30621Hs.44203ESTs 130207 RC-N33258AF044209Hs.144904nuclear receptor co-repressor 1 117549 RC N33390Hs.44483EST

117683 RC N40180 gb:yy44d02.s1 Soares_multiple-sclerosis-2NbHMSP
N40180 Homo sapiens cDNA clone IMAGE:276387 3' similar to 117710 RC N45198Hs.47248ESTs, Highly similar to similar to Cdc14B1 N45198 phosphatase [H.sapiens]

104514 RC-N45979AF164622Hs.182982golgin-67 s 117791 RC N48325Hs.93956EST

117822 RC AA706282Hs.93963ESTs ~,$129647 RC AB018259Hs.118140KIAA0716 gene product 117895 RC_N50656AW450348Hs.93996ESTs, Highly similar to SORL-HUMAN SORTILIN-RELATED
RECEPTOR PRECURSOR

[H.sapiensj 131557 RC AA317439Hs.28707signal sequence receptor, gamma (translocon-associated N50721 protein gamma) 133057 RC AA465131Hs.64001Homo sapiens clone 25218 mRNA sequence 3 118103 RC AA401733Hs.184134ESTs ~ N55326 118111 RC-N55493N55493' gb:yv50c02,s1 Soares fetal liver spleen 1 NFLS Homo Sapiens cDNA clone IMAGE:246146 3', mRNA

118129 RC-N57493N57493 gb:yy54c08.s1 Soares multiple-sclerosis_2NbHMSP
Homo Sapiens cDNA clone IMAGE:277358 3', mRNA

3$118278 RC N62955Hs.316433Homo Sapiens cDNA FLJ11375 fis, clone N62955 HEMBA1000411, weakly similar to ANKYRIN

118329 RC-N63520N63520 gb:yy62f01.s1 Soares_multiple_sclerosis_2NbHMSP
Homo Sapiens cDNA clone IMAGE:278137 3', mRNA

118336 RC_N63604BE327311Hs.47166HT021 132457 RC_N64166A8017365Hs.173859frizzled (Drosophila) homolog 7 40118363 RC AI183838Hs.48938hypothetical protein FLJ21802 118364 RC N46114Hs.29169hypothetical protein FLJ22623 118475 RC-N66845N66845 gb:za46c11.s1 Soares fetal liver spleen 1 NFLS Homo sapiens cDNA clone IMAGE:295604 3' similar to 118491 RC AV647908Hs.90424Homo Sapiens cDNA; FLJ23285 fis, clone 45118500 RC W32889Hs.154329ESTs 101663 RC-N68399NM_003528Hs.2178H2B histone family, member Q

118584 RC_N68963AW136928 gb:Ul-H-Bl1-adp-d-08-0-Ul.s1 NCI_CGAP_Sub3 Homo Sapiens cDNA clone 3', mRNA

sequence 421983 RC A1252640Hs.110364peptidylprolyl isomerase C (cyclophilin N69331 C) $~118661 RC AL137554Hs.49927protein kinase NYD-SP15 118684 RC N71313Hs.163986Homo sapiens cDNA: FLJ22765 fis, clone N71364 s KAIA1180 118689 RC-N71545_sAW390601Hs.184544Homo sapiens, clone IMAGE:3355383, mRNA, partial cds 118690 RC-N71571N71571Hs.269142ESTs N74456 N74456Hs.50499EST

$ - N75594Hs.285921ESTs, Moderately similar to T47135 hypothetical $ 118793 RC protein DKFZp761L0812.1 [H.sapiens]

118817 RC AI668658Hs.50797ESTs 118844 RC AL035364Hs.50891hypothetical protein 118919 RC_N91797AW452696Hs.130760myosin phosphatase, target subunit 2 129558 RC_N92454AW580922Hs.180446karyopherin (importin) beta 1 60132692 RC AW191962Hs.249239collagen, type VIII, alpha 2 118996 RC N94746Hs.274248hypothetical protein FLJ20758 119021 RC-N98238N98238Hs.55185ESTs 119039 RC-802384A1160570Hs.252097pregnancy specific beta-1-glycoprotein 119063 RC 816833Hs.53106ESTs, Moderately similar to ALU1 HUMAN

CSWARNING

118523 RC_R41828Y07759Hs.170157myosin VA (heavy polypeptide 12, myoxinj s 119111 RC T02865Hs.328321EST

133970 RC AA214228Hs.127751hypothetical protein 119146 RC_858863858863Hs.91815ESTs 120296 RC-878248AW995911Hs.299883hypothetical protein FLJ23399 119239 RC T11483 gb:CHR90049 Chromosome 9 exon Homo sapiens T11483 cDNA clone 111-15' and 3', mRNA

sequence.

119281 RC A1692322Hs.65373ESTs, Weakly similar to T02345 hypothetical T16896 protein KIAA0324 [H.sapiens]

119298 RC NM Hs.155478cyclin T2 7$126502 RC T10077Hs.13453hypothetical protein FLJ14753 135073 RC_W15275W55956Hs.94030Homo sapiens mRNA; cDNA DKFZp586E1624 s (from clone DKFZp586E1624) 119558RC_W38194W38194 Empirically selected from AFFX single probeset 132736RC-W42414_sAW081883Hs.288261Homo Sapiens cDNA: FLJ23037 fis, clone LNG02036, highly sim!lar to HSU68019 Homo sapiens mad protein 132173RC-W46577X89426 Hs.41716endothelial cell-spec!fic molecule 1 s $ 134873RC-W49632-sAA884471Hs.90449Human clone 23908 mRNA sequence 119650W57613882342 Hs.79856ESTs, Weakly similar to S65657 alpha-1 RC C-adrenergic receptor splice form 2 [H.sapiens]

119654- W57759 gb:zd20g11.s1 Soares feta~hear~NbHH19W
RC-W57759 Homo sap!ens cDNA clone IMAGE:341252 3' similar to 119683RC-W61118W65379 Hs.57835ESTs 1 119694RC_W65344AA041350Hs.57847ESTs, Moderately similar to ICE4-HUMAN
~ CASPASE-4 PRECURSOR [H.sapiens]

119718RC-W69216W69216 Hs.92848ESTs 133010RC-W69379AI287518Hs.62669Homo sapiens mRNA; cDNA DKFZp586D0923 (from clone DKFZp586D0923) 119938RC AW014862Hs.58885ESTs 120128RC BE379320Hs.91448MKP-1 like protein tyrosine phosphatase 1$ 120130RC AA045767Hs.5300bladder cancer associated protein 120148RC F02806 Hs.65765ESTs 120155RC 239623 Hs.65783ESTs 131486RC F06972 Hs.27372BMX non-receptor tyrosine kinase s 120183RC AW082866Hs.65882ESTs 120184RC 240182 Hs.65885EST

120211RC 240904 Hs.66012EST

120245RC AW959615Hs.111045ESTs 120247RC AA167500Hs.103939EST

120254RC-AA169599s W90403Hs.111054ESTs ~$ 120259RC_AA171724AW014786Hs.192742hypothetical protein FLJ12785 120260RC AK000061Hs.101590hypothetical prote!n 120275RC_AA177105AA177105Hs.78457solute carrier family 25 (mitochondrial carrier, ornith!ne transporter) member 120284RC_AA182626AA179656 gb:zp54e11.s1 Stratagene NT2 neuronal precursor 937230 Homo Sapiens cDNA clone 3' similar to conta!ns 114056RC-AA186324AA188175Hs.82506KIAA1254 protein 129507RC-AA192099AJ236885Hs.112180zinc finger protein 148 (pHZ-52) 120302RC-AA192173AA837098Hs.269933ESTs 120303RC_AA192415AI216292Hs.96184ESTs 120305RC-AA192553AW295096Hs.101337uncoupling protein 3 (mitochondrial, proton carrier) 3$ 120319RC-AA194851T57776 Hs.191094ESTs 133389RC-AA195520s AA195764Hs.72639ESTs 120326RC-AA196300AA196300Hs.21145hypothetical protein RG083M05.2 134272RC_AA196517X76040 Hs.278614protease, sedne,15 133145RC-AA196549H94227 Hs.6592Homo Sapiens, clone IMAGE:2961368, mRNA, partial cds 4~ 120327RC_AA196721AK000292Hs.278732hypothetical protein FLJ20285 106686RC-AA196729-i N66397Hs.334825Homo sapiens cDNA FLJ14752 fls, clone 120328RC AA923278Hs.290905ESTs, Weakly similar to protease [H.sapiens]

120340RC-AA206828AA206828 gb:zq80b08.s1 Stratagene hNT neuron (937233) Homo sapiens cDNA clone IMAGE:647895 3' similar to 4$ 134292RC_AA207123AI906291Hs.81234immunoglobulin superfamily, member3 131522RC-AA214539i AI380040Hs.239489T!A1 cytotoxic granule-associafed RNA-binding protein 129051RC-AA226914s AA227068Hs.108301nuclear receptor subfamily 2, group C, member 1 120375RC AF028706Hs.111227Zic family member 3 (odd-paired Drosophila AA227260 homolog, heterotaxy 1) 120376RC AA227469 gb:zr18a07.s1 Stratagene NT2 neuronal AA227469 precursor 937230 Homo Sapiens cDNA clone $o IMAGE:6637323',mRNAsequence.

120390RC-AA233122AA837093Hs.111460ca!c!umlcalmodulin-dependent prote!n kinase (CaM kinase) II delta 303876RC_AA233334-s U64820Hs.66521Machado-Joseph disease (sp!nocerebellar ataxia 3, olivopontocerebellar ataxia 3, autosomal dominant, ataxin 3) 132038RC-AA233347AI825842Hs.3776zinc finger prote!n 216 $ 104463RC_AA233519T85825 Hs.246885hypothetical protein FLJ20783 $

125750RC AA018515Hs.264482Homo Sapiens mRNA; cDNA DKFZp761A0411 AA233714 (from clone DKFZp761A0411) 120396RC_AA233796AA134006Hs.79306eukaryotic translation initiation factor4E

120409RC-AA235050f AA235050 gb:zs38e04.s1 Soares_NhHMPu-S1 Homo sap!ens cDNA clone IMAGE:687486 3' similar to gb:L07077 120414RC_AA235704AW137156Hs.181202hypothetical prote!n FLJ10038 120420RC_AA236031A!128114Hs.112885spinal cord-derived growth factor-B

120422RC AL133097Hs.301717hypothetical protein DKFZp434N1928 132221RC_AA236390s W94915Hs.42419ESTs 120423RC-AA236453AA236453Hs.18978Homo Sapiens cDNA: FLJ22822 fis, clone 6$ 120435RC_AA243370AA243370Hs.96450EST

120453RC-AA250947AA250947Hs.170263tumor prote!n p53-binding protein,1 120455RC-AA251083AA251720Hs.104347ESTs, Weakly similar to ALUC-HUMAN !!!!
ALU CLASS C WARNING ENTRY !!! [H.sapiens]

120456RC_AA251113AA488750Hs.88414BTB and CNC homology 1, basic leuc!ne zipper transcription factor 2 120473RC-AA251973AA251973Hs.269988ESTs 128922RC_AA252023AI244901Hs.9589ub!quilin 1 120477RC_AA252414AA252414Hs.43141DKFZP727C091 protein 120479RC AF006689Hs.110299mitogen-activated protein kinase kinase 120488RC AW952916Hs.63510KIAA0141 gene product 120510RC-AA258128AI796395Hs.111377ESTs ~$ 120527RC-AA262105AA262105Hs.4094Homo Sapiens cDNA FLJ14208 fis, clone 120528RC_AA262107AI923511Hs.104413ESTs 120529 RC AI434823Hs.104415ESTs 120541 RC-AA278298W07318Hs.240M-phase phosphoprotein 1 131445 RC_AA278529_iNM Hs.172052serinelthreonine k!nase 18 120544 RC BE548277Hs.103104ESTs $ 120562 RC BE244580Hs.302267hypothetical protein FLJ10330 120569 RC AA807544Hs.24970ESTs, Weakly s!milar to 834323 GTP-binding AA280648 protein Rab2 (H.sapiens]

120571 RC AB037744Hs.34892KIAA1323 protein 120572 RC H39599Hs.294008ESTs 129434 RC AW967495Hs.186644ESTs 130529 RC-AA280886AA178953 gb:zp39e03.s1 Stratagene muscle 937209 Homo Sapiens cDNA clone 3' similar to conta!ns Alu repetitive 120575 RC AW978022Hs.238911hypotheflcal prote!n DKFZp762E1511; KIAA1816 AA280934 protein 132635 RC-AA281535A8020686Hs.54037ectonucleotide pyrophosphataselphosphodiesterase 4 (putative function) 120591 RC-AA281797AF078847Hs.191356general transcription factor IIH, polypeptide s 2 (44kD subunit) 1$ 120593 RC_AA282047AA748355Hs.193522ESTs 430275 RC-AA283002211773Hs.237786zinc finger protein 187 117729 RC-AA283709AA306166Hs.7145calpain 7 120609 RC-AA283902AW978721Hs.266076ESTs, Weakly s!milar to A46010 X-linked retinopathy protein [H.sapiensj 132754 RC-AA284108AI752244Hs.75309eukaryotic translaflon elongation factor 130315 RC_AA284109AI241084Hs.154353nonselective sodium potassiumiproton exchanger 132614 RC-AA284371AA284371Hs.118064s!m!lar to rat nuclear ubiquitous casein kinase 2 447503 RC_AA284744_fAA115496Hs.336898Homo Sapiens, Sim!lar to RIKEN cDNA

gene, clone MGC:9890, mRNA, complete cds 135376 RC BE617856Hs.99756mitochondria) ribosome recycling factor , 2$ 120621 RC-AA284840AW961294Hs.143818hypotheflcal prote!n FLJ23459 107868 RC_AA286844AA286844Hs.61260hypothetical protein FLJ13164 129868 RC AW172431Hs.13012ESTs 120644 RC AI869129Hs.96616ESTs 120660 RC-AA287546AA286785Hs.99677ESTs 135370 RC_AA287553 Hs.99670ESTs, Weakly similar to 138022 hypothetical s BE622187 prote!n [H.sap!ens]

120661 RC AA287556Hs.263412ESTs, Weakly similar to ALUB_HUMAN !!!!
AA287556 ALU CLASS B WARNING ENTRY !!! [H.sap!ens]

129116 RC AB019494Hs.225767IDN3 protein 131567 RC-AA291015 Hs.28853CDC7 (cell division cycle 7, S. cerevisiae, s AF015592 homology-like 1 120699 RC-AA291716AI683243Hs.97258ESTs, Moderately sim!lar to S29539 ribosomal protein L13a, cytosolic [H.sapiens]

3 100690 RC-AA291749 Hs.1657estrogen receptor 1 $ s AA383256 120726 RC AA293655Hs.97293ESTs 120737 RC_AA302430AL049176Hs.82223chordin-like 120745 RC-AA302809AA302809 gb:EST10426 Adipose tissue, wh!te I Homo Sapiens cDNA 3' end, mRNA sequence.

AA302820 Hs.321709pudnergic receptor P2X, ligand-gated s U83993 ion channel, 4 - AI191410Hs.96693ESTs, Moderately similar to 2109260A
120750 RC-AA310499 B cell growth factor [H.sapiens]

120761 RC-AA321890AA321890Hs.1265branched chain keto acid dehydrogenase E1, beta polypeptide (maple syrup urine disease) 120768 RC-AA340589AA340589Hs.104560EST

120769 RC-AA340622A1769467Hs.96769ESTs 135232 RC-AA342457-iAL038812Hs.96800ESTs, Moderately similar to ALU7-HUMAN
ALU SUBFAMILY SO SEQUENCE

133439 RC-AA342828 Hs.73734glycoprotein V (platelet) s 223091 120793 RC_AA342864AA342864Hs.96812ESTs 120796 RC-AA342973A1247356Hs.96820ESTs 120809 RC_AA346495AA346495 gb:EST52657 Fetal heart II Homo Sapiens cDNA 3' end similar to EST containing 0 family $~ repeat, mRNA
sequence.

132459 RC-AA347573AL120071Hs.48998fibronecfln leucine rich transmembrane protein 2 120825 RC AI280215Hs.96885ESTs 120827 RC_AA347717AA382525Hs.132967Human EST clone 122887 mariner transposon Hsmarl sequence 120839 RC-AA348913AA348913 gb:EST55442 Infant adrenal gland II Homo sapiens cDNA 3' end similar to EST containing Alu 55 repeat, mRNA
sequence.

120850 RC-AA349647AA349647Hs.96927Homo sap!ens cDNA FLJ12573 fis, clone 120852 RC-AA349773AA349773Hs.191564ESTs 128852 RC-AA350541 Hs.106601ESTs s 840622 135240 RC AA357159Hs.96986EST

i 120870 RC-AA357172-iAA357172Hs.292581ESTs, Moderately similar to ALU1 HUMAN
ALU SUBFAMILY J SEQUENCE CONTAMINATION

WARNING

134637 RC-AA369856 Hs.180941vacuolar protein sorting 41 (yeast homology s U87309 120894 RC_AA370132AA370132Hs.97063ESTs 131854 RC-AA370472 Hs.173202I-kappa-B-interacting Ras-like protein s AF229839 1 6$ 120897 RC-AA370867AA370867Hs.97079ESTs, Moderately similar to AF1746051 F-box protein Fbx25 [H.sapiens]

AA377296 AL135556Hs.97104ESTs _ AL048409Hs.97177ESTs, Weakly similar to ALU1 HUMAN ALU
120935 RC_AA383902 SUBFAMILY J SEQUENCE CONTAMINATION

WARNING

120936 RC-AA385934AA385934Hs.97184EST, Highly similar to (defline not available 7499603) [C.elegans]

120937 RC-AA386255AA386255Hs.97186EST

120938 RC_AA386260AA386260Hs.104632EST

129722 RC-AA386266820855Hs.5422glycoprote!n M6B

120960 RC-AA398014AA398014Hs.104684EST

120985 RC_AA398222A1219896Hs.97592ESTs ~$ 120988 RC-AA398235AA398235Hs.97631ESTs 121008 RC-AA398348AA398348Hs.301720Human DNA sequence from clone RPi 1-251J8 on chromosome 13 Contains ESTs, STSs, GSSs and a CpG

121029 RC_AA398482AA398482Hs.97641EST

121032 RC AA393037Hs.161798ESTs $ 121033 RC AA398505Hs.97360ESTs 121034 RC AL389951Hs.271623nucleoporin 50kD

121035 RC AA398523Hs.210579ESTs 121058 RC AA398625Hs.97391ESTs 121060 RC AA398632Hs.97395ESTs 1 121061 RC AA393288Hs.97396ESTs ~ AA398633 121091 RC_AA398894AA398894Hs.97657ESTs, Moderately similar to ALUB_HUMAN
ALU SUBFAMILY SX SEQUENCE

CONTAMINATION

121092 RC AA398895Hs.97658EST

121094 RC-AA398900AA402505 gb:zt62h10.r1 Snares testis_NHT Homo Sapiens cDNA clone 5', mRNA sequence 1 121096 RC-AA398904AA398904Hs.332690ESTs $

121115 RC_AA399122AA398187Hs.104682ESTs, Weakly similar to mitochondrial citrate transport protein [H.sapiens]

121121 RC AA399371Hs.189095similar to SALL1 (sal (Drosophila)-like 121122 RC AI126713Hs.192233ESTs, Highly similar to T00337 hypothetical AA399373 protein KIAA0568 [H.sapiens]

121125 RC-AA399441AL042981Hs.251278KIAA1201 protein 121151 RC-AA399636AA399636Hs.143629ESTs 121153 RC AA399640Hs.97694ESTs 121163 RC A1676062Hs.111902ESTs 121176 RC AL121523Hs.97774ESTs 121192 RC AA400262Hs.190093ESTs ~5 121223 RC-AA400725A1002110Hs.97169ESTs,WeaklysimilartodJ667H12.2.1[H.sapiens]

121227 RC-AA400748AA400748Hs.97823Homo sapiens mRNA; cDNA DKFZp434D024 (from clone DKFZp434D024) 121231 RC-AA400780AA814948Hs.96343ESTs, Weakly similarto ALUC_HUMAN !!!!
ALU CLASS C WARNING ENTRY 111 [H.sapiens]

121278 RC-AA401631AA037121Hs.98518Homo Sapiens cDNA FLJ11490 fis, clone 121279 RC-AA401688AA292873Hs.177996ESTs 3 121282 RC-AA401695AA401695Hs.97334ESTs 121299 RC-AA402227AA402227Hs.22826tropomodulin 3 (ubiquitous) 121301 RC_AA402329NM-006202Hs.89901phosphodiesterase 4A, CAMP-specific (dunce (Drosophila)-homolog phosphodiesterase E2) 121302 RC-AA402398AA402587Hs.325520LAT1-3TM protein 121304 RC-AA402449AA293863Hs.97316EST

121305 RC-AA402468AA402468Hs.291557ESTs 134721 RC-AA403268 Hs.89306hypothetical protein FLJ20105 s AK000112 121323 RC_AA403314AA291411Hs.97247ESTs 121324 RC AA404229Hs.97842EST

129047 RC AI768623Hs.108264ESTs 131074 RC_AA404271016125Hs.181581glutamate receptor, ionotropic, kainate 121344 RC-AA405026AA405026Hs.193754ESTs 121348 RC_AA405182AA405182Hs.97973ESTs 121350 RC-AA405237AA405237 gb:zt06e10.s1 NCI-CGAP_GCB1 Homo sapiens cDNA clone IMAGE:712362 3' similar to contains Alu 45 121400 RC-AA406061AA406061Hs.98001EST

121402 RC-AA406063AA406063Hs.98003ESTs 121403 RC_AA406070AA406070Hs.98004EST

121408 RC-AA406137AA406137Hs.98019EST

121431 RC_AA406335AA035279Hs.176731ESTs 132936 RC-AA411801AL120659Hs.6111aryl-hydrocarbon receptor nuclear translocator ~ 2 121471 RC_AA411804AA411804Hs.261575ESTs ' 121474 RC-AA411833AA402335Hs.188760ESTs, Highly similar to Trad [H.sapiens]

121526 RC_AA412219AW665325Hs.98120ESTs 121530 RC-AA412259AA778658Hs.98122ESTs $ 121558 RC AA412497 gb:zt95g12.s1 Snares-testis-NHT Homo 5 AA412497 Sapiens cDNA clone IMAGE:730150 3' similar to contains L1.t3 L1 121559 RC-AA412498A1192044Hs.104778ESTs 121584 RC-AA416586A1024471Hs.98232ESTs 121609 RC-AA416867AA416867Hs.98185EST

121612 RC_AA416874AA416874Hs.98168ESTs 121737 RC_AA421133AA421133Hs.104671erythrocyte transmembrane protein 121740 RC-AA421138AA421138Hs.98334EST

129194 RC_AA422079, AA150797Hs.109276latexin protein 121784 RC-AA423837T90789Hs.94308RAB35, member RAS oncogene family 6$ 121802 RC-AA424328AI251870Hs.188898ESTs 121803 RC_AA424339AI338371Hs.157173ESTs 135286 RC_AA424469 Hs.97849ESTs s AW023482 121806 RC-AA424502AA424313Hs.98402ESTs 129517 RC AW972853Hs.112237ESTs 121845 RC-AA425734AI732692Hs.165066ESTs, Moderately similar to ALU2-HUMAN
ALU SUBFAMILY SB SEQUENCE

CONTAMINATION

121853 RC-AA425887AA425887Hs.98502hypothetical protein FLJ14303 121891 RC-AA426456AA426456Hs.98469ESTs 121895 RC-AA427396AA427396, gb:zw33a02.s1 Snares ovary tumor NbHOT
Homo sapiens cDNA clone IMAGE:771050 3' 75 similartocontains 121899 RC_AA427555855341Hs.50421KIAA0203 gene product 121917 RC AA406397Hs.98038ESTs 121918 RC-AA428242BE274689Hs.184175chromosome 2 open reading frame 3 121919 RC AA428281Hs,98560EST

121941 RC AA428865Hs.98563ESTs 121942 RC-AA428994AW452701Hs.293237ESTs 121970 RC AA429666Hs,98617EST

121993 RC AW297880Hs.98661ESTs 134660 RC-AA430184 Hs,87465ATPIGTP-binding protein s U73524 126753 RC-AA431288 Hs.95327CD3D antigen, delta polypeptide (TiT3 s AA306478 complex) 1 122022 RC-AA431293AA431293Hs.98716ESTs, Moderately similar to T42650 hypothetical ~ protein DKFZp434D0215.1 [H.sapiens]

122050 RC-AA431478AI453076Hs.166109ELAV (embryonic lethal, abnormal vision, Drosophila)-like 2 122051 RC AA431492Hs.98742EST

122055 RC-AA431732AA431732Hs,98747EST

122105 RC AW241685Hs.98699ESTs I 122125 RC_AA434411AK000492Hs.98806hypothetical protein 135235 RC-AA435512AW298244Hs.293507ESTs i 122162' RC_AA435698AA628233Hs.79946cytochrome P450, subfamily XIX
(aromatization of androgens) 129406 RC-AA435711AB018255Hs.111138KIAA0712 gene product 318801 RC-AA435815 Hs.77965peptidyl-prolyl isomerase G (cyclophilin s U40763 G) 122186 RC-AA435842AA398811Hs.104673ESTs 122235 RC-AA436475AA436475Hs.112227membrane-associated nucleic acid binding protein 129131 RC-AA436489A8026436Hs.177534dual specificity phosphatase 10 134664 RC-AA442060AA256106Hs.87507ESTs 122310 RC-AA442079AW192803Hs.98974ESTs, Weakly similar to S65824 reverse transcriptase homolog [H.sapiens]

25 122334 RC_AA443151BE465894Hs.98365ESTs, Weakly similar to LB4D_HUMAN NADP-DEPENDENT

122382 RC-AA446133AA446440Hs.98643ESTs 122425 RC_AA447145AB007859Hs.100955KIAA0399 protein 122431 RC AA447398Hs.99104ESTs 122450 RC-AA447643AA447643Hs.112095hypothetical protein DKFZp434F1819 302653 RC_AA447742-s Hs.284259dynein, axonemal, heavy polypeptide 122477 RC_AA448226AA448226Hs.324123ESTs 122500 RC-AA448825AA448825Hs.99190ESTs 122522 RC AA299607Hs.98969ESTs 122536 RC-AA450087AF060877Hs,99236regulator of G-protein signalling 20 122538 RC-AA450211AA450211Hs.99239ESTs 122540 RC_AA450244AA476741Hs.98279ESTs, Weakly similar to A43932 mucin 2 precursor, intestinal [H.sapiens]

122560 RC-AA452123AW392342Hs.283077centrosomal P4.1-associated protein;
uncharacterized bone marrow protein 421919 RC-AA452155AJ224901Hs.109526zinc finger protein 198 122562 RC-AA452156AA452156 gb:zx29c03.s1 Soares totaLfetus-Nb2HF8_9w Homo sapiens cDNA clone IMAGE:787876 3', mRNA

122585 RC-AA453036AI681654Hs.170737hypothetical protein FLJ23251 122608 RC-AA453526AA453525Hs.143077ESTs 122635 RC-AA454085AA454085 gb:zx33a08.s1 Soares total-fetus-Nb2HF8 9w Homo sapiens cDNA clone IMAGE:788246 3' similar to 4S 122636 RC-AA454103AW651706Hs.99519hypothetical protein FLJ14007 122653 RC_AA454642AW009166Hs.99376ESTs 122660 RC-AA454935AI816827Hs.180069nuclear respiratory factor 1 122703 RC_AA456323AA456323Hs.269369ESTs 122724 RC-AA457395AA457395Hs.99457ESTs $ 122749 RC-AA458850AA458850Hs.293372ESTs, Weakly similar to B34087 hypothetical 0 protein [H.sapiens]

122772 RC-AA459662AW117452Hs.99489ESTs 131098 RC-AA459668U66669Hs.2366423-hydroxyisobutyryl-Coenzyme A hydrolase 129045 RC_AA459679-s Hs.30732hypothetical protein FLJ13409; KIAA1711 A1082883 protein 122777 RC-AA459702AK001022Hs.214397hypothetical protein FLJ10160 similar to insulin related protein 2 $ 135362 RC-AA460017_f Hs.99513ESTs, Weakly similar to T17454 diaphanous-related 5 AA978128 formin - mouse [M.musculus]

122798 RC AW366286Hs.145696splicing factor (CC1.3) 122837 RC-AA461509AA461509Hs.293565ESTs, Weakly similar to putative p150 [H.sapiens]

122860 RC-AA464414_i gb:zx78g01.s1 Soares ovary tumor NbHOT
AA464414 Homo Sapiens cDNA clone IMAGE:809904 3', mRNA sequence.

122861 RCJ~A464428AA335721Hs.119394ESTs 122910 RC~,4470084AA470084Hs.98358ESTs 132899 RC_AA476606_s Hs.59666SMAD in the antisense orientation 122967 RC AA806187Hs.289101glucose regulated protein, 58kD

129560 RC_AA478523AA317841Hs.7845hypothetical protein MGC2752 65 123009 RC-AA479949AA535244Hs.78305RAB2, member RAS oncogene family 128917 RC_AA481252AI365215Hs.206097oncogene TC21 123081 RC-AA485351AI815486Hs.243901Homo Sapiens cDNA FLJ20738 fis, clone 123133 RC_AA487264AA487264Hs.154974Homo Sapiens mRNA; cDNA DKFZp667N064 (from clone DKFZp667N064) 123184 RC_AA489072BE247767Hs.18166KIAA0870 protein 70 129671 RC_AA489630NM-014700Hs.119004KIAA0665 gene product 123233 RC_AA490225AW974175Hs.188751ESTs, Weakly similar to MAPB_HUMAN
MICROTUBULE-ASSOCIATED

[H.sapiens] ' 123234 RC_AA490227NM_001938Hs.16697down-regulator of transcription 1, TBP-binding (negative cofactor 2) 123236 RC_AA490255AW968504Hs.123073CDC2-related protein kinase 7 7$ 123255 RC_AA490890AA830335Hs.105273ESTs 129503 RC_AA490916_s Hs.112157ESTs 131043 RC_AA490925AF084535Hs.22464epilepsy, progressive myoclonus type 2, Lafora disease (laforin) 123259 RC_AA490955AI744152Hs.283374ESTs, Weakly similar fo CA15_HUMAN COLLAGEN
ALPHA 1(V) CHAIN PRECURSOR

[H.sapiens]

123284 RC AA488988Hs.293796ESTs $ 123286 RC_AA495824AA495824Hs.188822ESTs, Weakly similar to A46010 X-linked retinopathy protein [H.sapiens]

123315 RC_AA496369AA496369 gb:zv37d10.s1 Soares ovary tumor NbHOT
Homo Sapiens cDNA clone IMAGE:755827 3' similar to contains 129179 RC-AA504125_s Hs.109154ESTs 131612 RC AU076668Hs.334884SEC10 (S. cerevisiae)-like 1 1 - AA598440Hs.291154EST, Weakly similar to 138022 hypothetical ~ 123421 RC_AA598440 protein [H.sapiens]

123449 RC Hs.112493Homo Sapiens mRNA; cDNA DKFZp564D036 AA598899_i (from clone DKFZp564D036) 129021 RC_AA599244AL044675Hs.173081KIAA0530 protein 132830 RC-AA599694 Hs.57730KIAA0133 gene product s NM 014777 123497 RC AA765256Hs.135191ESTs, Weakly similar to unnamed protein AA600037 product [N.sapiens]

1$ _ AA609135Hs.293076ESTs 129539 RC_AA609582T47614Hs.323022ESTs, Highly similar to p60 katanin [H.sapiens]

123712 RC AA609684Hs.112748Homo Sapiens cDNA: FLJ21543 fis, clone 123731 RC-AA609839AA609839 gb:ae62f01.s1 Stratagene lung carcinoma 937218 Homo sapiens cDNA clone IMAGE:951481 3' similar to 20 130725 RC-AA609862T98807Hs.80248RNA-binding protein gene with multiple splicing 123800 RC AA620423Hs.112862EST

123841 RC AA620747Hs.112896ESTs 123929 RC AA621364Hs.112981ESTs 123978 RC T89832Hs.170278ESTs 2$ 133184 RC AA001021Hs.6685thyroid hormone receptor interactor 8 132835 RC 283844Hs.5790hypothetical protein dJ37E16.5 132406 RC AL133731Hs.4774Homo sapiens mRNA; cDNA DKFZp761C1712 D51285 s ~ (from clone DKFZp761C1712) 128695 RC NM_003478Hs.101299cullin 5 D59972_i 124028 RC-F04112F04112 gb:HSC2JH062 normalized infant brain f cDNA Homo sapiens cDNA clone c-2jh06 3', mRNA

30 sequence.

124057 RC_F13604AA902384Hs.73853bone morphogenetic protein 2 134899 RC AI609045Hs.321775hypothetical protein DKFZp434D1428 130973 RC AI638418Hs.78580DEADIH (Asp-Glu-Ala-AspIHis) box polypeptide H05135 i 1 124106 RC H12245 gb:ym17a12.r1 Soares infant brain 1NIB
H12245 Homo Sapiens cDNA clone 3', mRNA sequence 3 124136 RC_H22842H22842Hs.101770EST
$

124165 RC H30039Hs.107674ESTs 131229 RC NM_015340Hs.2450leucyl-tRNA synthetase, mitochondria) H43442_s 124178 RC_H45996BE463721Hs.97101putative G protein-coupled receptor 129948 RC AI537162Hs.263988ESTs H69281 i 134374 RC N22687Hs.8236ESTs H69485 f 124254 RC_H69899H69899 gb:yu70c12.s1 Weizmann Olfactory Epithelium Homo Sapiens cDNA clone IMAGE:239158 3' similar to 129056 RC AI769958Hs.108336ESTs, Weakly similar to ALUE HUMAN !!!!
H70627_s ALU CLASS E WARNING ENTRY !!! [H.sapiens]

100919 RC X54534Hs.278994Rhesus blood group, CcEe antigens H73050 s 4$ 130724 RC_H73260AK001507Hs.306084Homo sapiens clone FLB6914 PR01821 mRNA, complete cds 100716 RC_H77531X89887Hs.172350HIR (histone cell cycle regulation defective, s S. cerevisiae) homolog A

124274 RC_H80552H80552Hs.102249EST

129078 RC A1351010Hs.102267lysosomal H80737_s 124828 RC AW952124Hs.13094presenilins associated rhomboid-like H93412 protein $ 124315 RC-H94892_sNM_005402Hs.288757v-ral simian leukemia viral oncogene ~ homolog A (ras related) 100747 RC X04588Hs.85844neurotrophic tyrosine kinase, receptor, H95643 s type 1 124324 RC H96552Hs.159472Homo Sapiens cDNA: FLJ22224 fis, clone 452933 RC AW391423Hs.288555Homo Sapiens cDNA: FLJ22425 fis, clone 132231 RC AA662910Hs.42635hypothetical protein DKFZp434K2435 H99131 s $ 129170 RC_H99462_sAW250380Hs.109059mitochondria) ribosomal protein L12 $

133143 RC AA094538Hs.272808putative transcription regulation nuclear H99837_s protein; KIAA1689 protein 132963 RC AA099693Hs.34851epsilon-tubulin 135297 RC AL118782Hs.300208Sec23-interacting protein p125 134347 RC AF164142Hs.82042solute carrier family 23 (nucleobase N23756 s transporters), member 1 60 130365 RC_N24134W56119Hs.155103eukaryotic translation initiation factor 1A, Y chromosome 421642 RC_N24195AF172066Hs.106346retinoic acid repressible protein 439311 RC_N26739BE270668Hs.151945mitochondria) ribosomal protein L43 124383 RC_N27098N27098Hs.102463EST

124387 RC_N27637N27637Hs.109019ESTs 6$ 129341 RC_N33090AI193519Hs.226396hypothetical protein FLJ11126 129081 RC AI364933Hs.168913serinelthreonine kinase 24 (Ste20, yeast N35967 homology 102827 RC-N38959BE244588Hs.6456chaperonin containing TCP1, subunit 2 f (beta) 124433 RC_N39069AA280319Hs.288840PR01575 protein 124441 RC_N46441AW450481Hs.161333ESTs 132338 RC_N48270AA353868Hs.182982golgin-67 f 131403 RC_N48365AI473114Hs.26455ESTs s 124466 RC-N51316810084Hs.113319kinesin heavy chain member 2 132210 RC-N51499NM Hs.42322A kinase (PRKA) anchor protein 2 s 007203 124483 RC_N53976AI821780Hs.179864ESTs ~$ 124484 RC_N54157H66118Hs.285520ESTs, Weakly similar to 2109260A B cell growth factor [H.sapiens]

124485 RC_N54300AB040933Hs.15420KIAA1500 protein 124494 RC_N54831N54831Hs.271381ESTs, Weakly similar to 138022 hypothetical protein [H.sapiens]

129200 RC N59849Hs.13565Sam68-tike phosphotyrosine protein, T-STAR

124527 RC N79264Hs.269104ESTs 124532 RC N62375Hs.102731EST

$ 133213 RC_N63138AA903424Hs.6786ESTs 124539 RC_N63172D54120Hs.146409cell division cycle 42 (GTP-binding protein, 25kD) 133651 RC_N63772AI301740Hs.173381dihydropyrimidinase-like 2 129196 RC BE296313Hs.265592ESTs, Weakly similar to 138Q22 hypothetical N63787 protein [H.sapiens]

124575 RC N68168 gb:za11c01.s1 Soares fetal liver spleen N68168 1 NFLS Homo Sapiens cDNA clone 3', mRNA
sequence 124576 RC N68201Hs.269124ESTs, Weakly similar to 138022 hypothetical N68201 protein [H.sapiens]

124577 RC_N68300N68300 gb:za12g07.s1 Soares fetal liver spleen 1NFLS Homo Sapiens cDNA clone IMAGE:292380 3', mRNA

124578 RC N68321Hs.231500EST

124593 RC N69575Hs.102788ESTs 128501 RC_N75007AL133572Hs.199009protein containing CXXC domain 2 105691 RC AI680737Ns.289068Homo sapiens cDNA FLJ 11918 fis, clone 128473 RC_N90066T78277Hs.100293O-linked N-acetylglucosamine (GIcNAc) transferase (UDP-N-acetylglucosamine:polypeptide-N-128639 RC AW582962Hs.102897CGI-47 protein 124652 RC W19407Hs.3862regulator of nonsense transcripts 2;
N92751 DKFZP434D222 protein _ AB002316Hs.65746KIAA0318 protein 133137 RC_N93214 s 124671 RC-N99148AK001357Hs.102951Homo Sapiens cDNA FLJ10495 fis, clone NT2RP2000297, moderately similarto ZINC
FINGER

PROTEIN

133054 RC_R07876AA464836Hs.291079ESTs, Weakly similar to T27173 hypothetical protein Y54G11A.9 - Caenorhabditis elegans [C.elegans]

25 130410 RC J00077Hs.155421alpha-fetoprotein 810865 f 124720 RC_R11056805283 gb:ye91c08.s1 Soares fetal liver spleen 1NFLS Homo sapiens cDNA clone IMAGE:125102 3' similar to 124722 RC T97733Hs.185685ESTs 129961 RC_R22947823053 gb:yh31a05.r1 Soares placenta Nb2NP Homo sapiens cDNA clone 5' similar to contains 3 repetitive RC Hs.52763 anaphase-promoting complex subunit ~ element R23930_s 7 132965 RC AI248173Hs.191460hypothetical protein MGC12936 826589 f 133740 RC AW162919Hs.170160RAB2, member RAS oncogene family-like 837588 s 133074 RC_R37613AL134275Hs.6434hypothetical protein DKFZp761F2014 124757 RC H11368Hs.141055Homo Sapiens clone 23758 mRNA sequence 3 124762 RC_R39179AA553722Hs.92096ESTs, Moderately similar to A46010 X-linked $ f retinopathy protein [H.sapiens]

124773 RC_R40923845154Hs.106604ESTs 135266 RC_841179841179Hs.97393KIAA0328 protein 131375 RC AW293165Hs.143134ESTs 841294 s 133753 RC_R42307_fNM-004427Hs.165263early development regulator 2 (homolog of polyhomeotic 2) 40 128540 RC AW297929Hs.328317EST
843189 f 124785 RC W38537Hs.280740hypothetical protein MGC3040 124792 RC_844357844357Hs.48712hypothetical protein FLJ20736 124793 RC_844519844519 gb:yg24h04.s1 Soares infant brain 1N18 Homo sapiens cDNA clone IMAGE:33350 3', mRNA

sequence.

45 124799 RC_R45088845088 gb:yg38g04.s1 Soares infant brain 1NIB
Homo sapiens cDNA clone IMAGE:34896 3', mRNA

sequence.

124812 RC_R47948_i847948Hs.188732ESTs 124821 RC_R51524H87832Hs.7388ketch (Drosophilaj-tike 3 127274 RC_R54950AW966158Hs.58582Homo Sapiens cDNA FLJ12789 fis, clone 124835 RC 855241Hs.101214EST

124845 RC 859585Hs.101255ESTs 124847 RC-860044W07701Hs.304177Homo sapiens clone FLB8503 PR02286 mRNA, complete cds 440630 RC_R60872BE561430Hs.239388Human DNA sequence from clone RP1-304814 on chromosome 6. Contains a gene for a novel protein and a part of a gene for a novel protein with two isoforms.
Contains ESTs, STSs, GSSs and a CpG island $S 124861 RC 867567Hs.107110ESTs 130141 RC NM_004455Hs.150956exostoses (multiple)-like 1 867266 s 124879 RC_R73588873588Hs.101533ESTs 124892 RC_R79403A1970003Hs.23756hypothetical protein similar to swine acylneuraminate lyase 124906 RC_R87647H75964Hs.107815ESTs 60 124922 RC_R93622893622Hs.12163eukaryotic translation initiation factor 2, subunit 2 (beta, 38kD ) 124940 RC_R99599AF068846Hs.103804heterogeneous nuclear ribonucleoprotein s U (scaffold attachment factorA) 124941 RC_R99612AI766661Hs.27774ESTs, Highly similar to AF1613491 HSPC086 [H.sapiens]

124943 RC AW963279Hs.123373ESTs, Weakly similar to ALU1HUMAN ALU

WARNING ENTRY
[H.sapiens]

65 124947 RC_T03170T03170Hs.100165ESTs 124954 RC AW964237Hs.6728KIAA1548 protein 132924 RC U55184Hs.154145hypothetical protein FLJ11585 T15418 f 133113 RC_T155978E383768Hs.6523895 kDa retinoblastoma protein binding f protein; KIAA0661 gene product 132975 RC 843504Hs.6181ESTs T15652_i 133235 RC AW960782Hs.6856ash2 (absent, small, or homeotic, Drosophila, T16898 s homology-like 131082 RC A1091121Hs.246218Homo Sapiens cDNA: FLJ21781 fis, clone T26644 i HEP00223 124980 RC T40841Hs.98681ESTs 124984 RC BE313210Hs.223241eukaryotic translation elongation factor T47566 i 1 delta (guanine nucleotide exchange protein) 124991 RC_T50116T50116 gb:yb77c10.s1 Stratagene ovary (937217) Homo sapiens cDNA clone IMAGE:77202 3' similar to similar to SP:VE22_LAMBD

GENE , mRNA
sequence.

129475 RC NM_004477Hs.203772FSHD region gene 1 T50145 s 125000 RC T58615Hs.110640ESTs 132932 RC AW118826Hs.6093Homo Sapiens cDNA: FLJ22783 fis, clone T59940_f KAIA1993 129534 RC_T63595AK002126Hs.11260hypothetical protein FLJ11264 125008 RC T91251 gb:yd60a10.s1 Soares fetal liver spleen T64891 1NFLS Homo sapiens cDNA clone 3', mRNA
sequence $ 125009 RC_T64924T64924Hs.303046ESTs 132940 RC T79136Hs.127243Homo sapiens mRNA for KIAA1724 protein, T64933_r partial cds 125017 RC T68875 gb:yc30f05.s1 Stratagene liver (937224) 1'68875 Homo Sapiens cDNA clone IMAGE:82209 3', mRNA

sequence.

125018 RC T69027Hs.57475sex comb on midleg homolog 1 125020 RC T69981 gb:yc19d03.r1 Stratagene lung (937210) T69924 Homo sapiens cDNA clone 5', mRNA sequence 129891 RC_T70353A1084813Hs.13197ESTs 134204 RC_T79780AI873257Hs.7994hypothetical protein FLJ20551 s 125050 RC_T79951AW970209Hs.111805ESTs 125052 RC_T80174T85104Hs.222779ESTs, Moderately similar to similar to s NEDD-4 [H.sapiens]

125054 RC_T80622T80622Hs.268601ESTs, Weakly similar to envelope [H.sapiens]

125063 RC T85352 gb:yd82d01.s1 Soares fetal liverspleen T85352 1NFLS Homo sapiens cDNA clone IMAGE:114721 3' similar to contains Alu repetitive element;contains L1 repetitive element;, mRNA sequence.

125064 RC T85373 gb:yd82f07.s1 Soares fetal liver spleen T85373 1NFLS Homo Sapiens cDNA clone IMAGE:114757 3' similar to repetitive element;, mRNA sequence.
contains Alu repetitive element;contains 125066 RC T86284 gb:yd77b07.s1 Soares fetal liver spleen T86284 1 NFLS Homo Sapiens cDNA clone 3' similar to contains Alu repetitiveNA
element;, sequence m8 112264 RC AL045364Hs.79353transcription factor Dp-1 T89579 s 125080 RC_T90360T90360Hs.268620ESTs, Highly similar to ALU6-HUMAN ALU
SUBFAMILY SP SEQUENCE CONTAMINATION

WARNING ENTRY
[t~.sapiens]

2$ 125097 RC AW576389Hs.335774EST, Moderately similar to S65657 alpha-1C-adrenergic T94328_i receptor splice form 2 [H.sapiens]

125104 RC_T95590T95590 gb:ye40a03.s1 Soares fetal liver spleen 1NFLS Homo Sapiens cDNA clone 3' similarfo gb~M10817~IGURRAA rRNA
Iguana iguana );, 5S ( mRNA
sequence 135107 RC T97257Hs.337531ESTs, Moderately similar to 138022 hypothetical T97257 f protein [H.sapiens]

129550 RC_T97599-iAA845462Hs.124024deltex (Drosophila) homolog 1 125118 RC_T97620810606 gb:yf35f11.s1 Soares fetal liver spleen 1NFLS Homo Sapiens cDNA clone IMAGE:128877 3' similar to mRNA ce.
contains sequen Alu repetitive element;, 125120 RC_T97775T97775Hs.100717EST

134160 RC_T98152T98152Hs.79432fibrillin 2 (congenital contractural arachnodaciyly) 125136 RC_W31479AW962364Hs.129051ESTs 35 125144 RC_W37999AB037742Hs.24336KIAA1321 protein 125150 RC-W38240W38240 Empirically selected from AFFX single probeset 104180 RC-W40150AA247778Hs.119155Homo sapiens mRNA full lengfh insert cDNA clone EUROIMAGE 814975 131987 RC AW453069Hs.3657activity-dependent neuroprotective protein 125178 RC W93127Hs.31845ESTs 125180 RC W58469Hs.103120ESTs 125182 RC_W58650AA451755Hs.263560ESTs 130588 RC-W68736AL030996Hs.16411hypothetical protein LOC57187 125197 RC-W69106AF086270Hs.278554heterochromatin-like protein 1 133497 RC BE617303Hs.74266hypothetical protein MGC4251 4S 100562 RC NM_006185Hs.301512nuclear mitotic apparatus protein 1 W69385 s 125639 RC_W69399297630Hs.226117H1 histone family, member 0 s 129232 RC-W69459898881Hs.109655sex comb on midleg (Drosophila)-like 101495 RC-W72424W72424Hs.112405S100 calcium-binding protein A9 (calgranulin B) 125209 RC-W72724W72724Hs.103174ESTs, Weakly similar to TSP2_HUMAN
THROMBOSPONDIN
2 PRECURSOR [H.sapiens]

125212 RC AA746225Hs.103173ESTs 129132 RC-W73955BE383436Hs.108847hypothetical protein MGC2749 125223 RC-W74701AI916269Hs.109057ESTs, Weakly similar to ALU5-HUMAN ALU
SUBFAMILY SC SEQUENCE CONTAMINATION

WARNING ENTRYens]
[H.sapi 125225 RC-W76540W74169Hs.16492DKFZP564G2022 protein $ 125228 RC_W79397AA033982Hs.110059ESTs, Weakly similar to 138022 hypothetical $ protein [H.sapiens]

132393 RC-W85888AL135094Hs.47334hypothetical protein FLJ14495 125238 RC-W86038N99713Hs.109514ESTs 125247 RC-W86881AA694191Hs.163914ESTs 129296 RC-W87804A1051967Hs.110122ESTs 125263 RC-W88942AA098878 gb:zn45g10.r1 Stratagene HeLa cell s3 937216 Homo Sapiens cDNA clone 5', mRNA
sequence 125266 RC-W90022W90022Hs.186809ESTs, Highly similar fo LCT2_HUMAN LEUKOCYTE

PRECURSOR
[H.sapiens]

131321 RC-W92272U91543Hs.25601chromodomain helicase DNA binding protein 131601 RC-W92764_sNM-007115Hs.29352tumor necrosis factor, alpha-induced protein 6 65 131677 RC_W93040H05317Hs.283549ESTs 120837 RC-W93092BE149656Hs.306621Homo Sapiens cDNA FLJ11963 fis, clone 125277 RC-W93227W93227Hs.103245EST

125278 RC-W93523AI218439Hs.129998enhancer of polycomb 1 125280 RC-W93659A1123705Hs.106932ESTs 131856 RC_W94003_sW93949Hs.33245ESTs 131844 RC_W94401AI419294Hs.324342ESTs s 125284 RC NM_002666Hs.103253perilipin 313447 RC-W94787_sAW016321Hs.82306destrin (actin depolymerizing factor) 130799 RC AB028945Hs.12696cortactin SH3 domain-binding protein Z38294_s 125289 RC T34530Hs.4210Homo Sapiens cDNA FLJ13069 fis, clone 128874 RC H06245Hs.106801ESTs, Weakly similar to PC4259 femtin Z38465_s associated protein [H.sapiens]

1~~

130966 RC AW971018Hs.21659ESTs 238525 s 128875 RC_Z38538-fAB040923Hs.106808ketch (Drosophila)-like 1 133200 RC AB037715Hs.183639hypothetical protein FLJ10210 238551 s 130158 RC AB032947Hs.151301Ca2+-dependent activator protein for 238783 s secretion $ 125295 RC-239113AB022317Hs.25887sema domain, immunoglobulin domain (1g), transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) 125298 RC AW972542Hs.289008Homo sapiens cDNA: FLJ21814 fis, clone Z39255_f HEP01068 125300 RC-239591239591Hs.101376EST

323122 RC BE622770Hs.264915Homo Sapiens cDNA FLJ12908 fis, clone Z39783_s NT2RP2004399 1 311463 RC 855344Hs.22142cytochrome b5 reductase b58.2 ~ 239920 130882 RC_Z40166AA497044Hs.20887hypothetical protein FLJ10392 f 128888 RC-240388-sAI760853Hs.241558ariadne (Drosophila) homolog 2 125310 RC_Z40646859161Hs.124953ESTs 125315 RC-241697838110Hs.106296ESTs 1$ 125317 RC 299348Hs.112461ESTs, Weakly similar to 138022 hypothetical 299349 protein [H.sapiens]

135096 RC AA081258Hs.132390zinc finger protein 36 (KOX 18) 299394-s 104786 RC AA027167Hs.10031KIAA0955 protein 132837 D58024AA370362Hs.57958EGF-TM7-latrophilin-related protein s 120456 RC_AA251113AA488750Hs.88414BTB and CNC homology 1, basic leucine zipper transcription factor 2 132459 RC_AA347573AL120071Hs.48998fibronectin leucine rich transmembrane protein 2 101545 M31210BE246154Hs.154210endothelial differentiation, sphingolipid G-protein-coupled receptor,1 133505 C01527AI630124Hs.324504Homo sapiens mRNA; cDNA DKFZp586J0720 (from clone DKFZp586J0720) 132360 RC AW893660Hs.46440solute carrier family 21 (organic anion N62948 s transporter), member 3 132738 RC AK000738Hs.264636hypothetical protein FLJ20731 2$ 119586 RC-W43000AF088033Hs.159225ESTs s 129914 RC NM-012421Hs.13321rearranged L-myc fusion sequence N31750_s 130839 AF009301AB011169Hs.20141similar to S. cerevisiae SSM4 132813 L37347BE313625Hs.57435solute comer family 11 (proton-coupled divalent metal ion transporters), member 134342 M99564NM-000275Hs.82027oculocutaneous albinism II (pink-eye dilution (murine) homology 131878 RC AA083764Hs.6101hypothetical protein MGC3178 105426 RC-AA251297W20027Hs.23439ESTs 132968 RC_AA620722AF234532Hs.61638myosin X

132173 RC_W46577X89426Hs.41716endothelial cell-specific molecule 1 s 113932 RC_W81237AA256444Hs.126485hypothetical protein FLJ12604; KIAA1692 protein 3 114452 RC-AA020825AI369275Hs.243010Homo Sapiens cDNA FLJ14445 fis, clone $ HEMBB1001294, highly similar to GTP-BINDING

115243 RC-AA278766AA806600Hs.116665KIAA1842 protein 134403 RC-H93708AA334551Hs.82767sperm specific antigen 2 s 129647 RC_N49394AB018259Hs.118140KIAA0716 gene product 111428 RC-H56559-sAL031428Hs.174174KIAA0601 protein 115967 RC_AA446887AI745379Hs.42911ESTs 120726 RC_AA293656AA293655Hs.97293ESTs 114995 RC-AA251152AA769266Hs.193657ESTs 303876 RC-AA233334 Hs.66521Machado-Joseph disease (spinocerebellar s U64820 ataxia 3, olivopontocerebellar ataxia 3, autosomal 4$ dominant, ataxin 3) 311463 RC-239920855344Hs.22142cytochrome b5 reductase b58.2 120302 RC_AA192173AA837098Hs.269933ESTs 133071 RC-AA455044BE384932Hs.64313ESTs, Weakly similar to AF2571821 G-protein-coupled receptor 48 [H.sapiens]

121032 RC-AA398504AA393037Hs.161798ESTs $ 129829 U41813AF010258Hs.127428homeo box A9 ~

120245 RC-AA166965AW959615Hs.111045ESTs 120985 RC_AA398222AI219896Hs.97592ESTs 114184 RC 856434Hs.21062ESTs 447503 RC-AA284744 Hs.336898Homo sapiens, Similar to RIKEN cDNA

f AA115496 gene, clone MGC:9890, mRNA, complete $$ cds 132837 RC_AA428201AA370362Hs.57958EGF-TM7-latrophilin-related protein 121034 RC-AA398507AL389951Hs.271623nucleoporin 50kD

119718 RC W69216Hs.92848ESTs 120455 RC_AA251083AA251720Hs.104347ESTs, Weakly similar to ALUC HUMAN Ill!
ALU CLASS C WARNING ENTRY I!! [H.sapiens]

125280 RC-W93659AI123705Hs.106932ESTs 132155 RC-AA227903AK001607Hs.41127hypothetical protein FLJ13220 120609 RC-AA283902AW978721Hs.266076ESTs, Weakly similar to A46010 X-linked retinopathy protein [H.sapiens]

121278 RC AA037121Hs.98518Homo sapiens cDNA FLJ11490 fis, clone 109023 RC AA157293Hs.72168ESTs AP,157293 6$ 129815 RC_D60208BE565817Hs.26498hypothetical protein FLJ21657 f 108061 RC AA043979Hs.62651EST

113287 RC T66847Hs.194040ESTs, Weakly similar to 138022 hypothetical T66847 protein [H.sapiens]

114082 RC AK001612Hs.26962Homo sapiens cDNA FLJ10750 fis, clone 116334 RC_AA491457AL038450Hs.48948ESTs 70 131486 RC F06972Hs.27372BMX non-receptoriyrosine kinase 240071 s 107860 RC_AA024961AA024961Hs.50730ESTs 131263 RC_AA443826AU077002Hs.24950regulator of G-protein signalling 5 132207 RC_AA443294BE206939Hs.42287E2F transcription factor 6 129183 RC_AA155743BE561824Hs.273369uncharacterized hematopoietic stemlprogenitor cells protein MDS027 ~$ 408431 RC AI338631Hs.43266Homo Sapiens cDNA: FLJ22536 fis, clone 120575 RC_AA280934AW978022Hs.238911hypothetical protein DKFZp762E1511;

protein 132121 RC-AA443284_s NM-004529 Hs.404 ° myeloidllymphoid or mixed-lineage leukemia (trithorax (Drosophila) homology; translocated to, 3 117657RC N39074N39074Hs.44933ESTs 134922RC_W04507AI718295Hs.91161prefoldin 4 s 118523RC-841828-sY07759Hs.170157myosin VA (heavy polypeptide 12, myoxin) 116845RC-H64973AA649530 gb:ns44f05.s1 NCI_CGAP~,Iv1 Homo Sapiens cDNA clone, mRNA sequence 115291RC_AA279943BE545072Hs.122579hypothetical protein FLJ10461 120326RC AA196300AA196300Hs.21145hypothetical protein RG083M05.2 130174M29550 M29551Hs.151531protein phosphatase 3 (formerly 2B), catalytic subunit, beta isoform (calcineurin A beta) 129131RC_AA436489AB026436Hs.177534dual specificity phosphatase 10 129868RC_AA287032AW172431Hs.13012ESTs 118661RC_N70777AL137554Hs.49927protein kinase NYD-SP15 129829RC-AA496921AF010258Hs.127428homeo box A9 115985RC-AA447709AA447709Ns.268115ESTs, Weakly similar to T08599 probable transcription factor CA150 [H.sapiens]

134637RC_AA369856U87309Hs.180941vacuolar protein sorting 41 (yeast homology s 1$ 132714RC_AA252598W39388Hs.55336Homo Sapiens, clone MGC:17421, mRNA, complete cds 129771RC H73237AL096748Hs.102708DKFZP434A043 protein 123360RC AA504784AA532718Hs.178604ESTs 132902RC_AA490969A1936442Hs.59838hypothetical protein FLJ10808 113716RC T97750AA001356Hs.18159ESTs 113825RC_W48860AW014486Hs.22509ESTs 130367RC_Z38501AL135301Hs.8768hypothetical protein FLJ10849 120541RC AA278298W07318Hs.240M-phase phosphoprotein 1 116727RC F13684876472Hs.65646ESTs 118219RC N62231AA862391Hs.48494ESTs, Moderately similar to A46010 X-linked retinopathy protein [H.sapiens]

119767RC_W72562W72562Hs.58119ESTs 128917RC_AA481252AI365215Hs.206097oncogene TC21 451553RC AA020928AA018454Hs.269211ESTs ' 132716RC_AA251288BE379595Hs.283738casein kinase 1, alpha 1 118525RC-N67861N67861Hs.49390ESTs 114618RC_AA084162AW979261Hs.291993ESTs 119743RC W70242AA947552Hs.58086ESTs 108154RC_AA425151NM Hs.220689Ras-GTPase-activating protein SH3-domain-binding s 005754 protein 122798RC-AA460324AW366286Hs.145696splicing factor (CC1.3) 133746U44378 AW410035Hs.75862MAD (mothers against decapentaplegic, Drosophila) homolog 4 3$ 119822RC_W74471AF086409Hs.301327ESTs 122186RC-AA435842AA398811Hs.104673ESTs 114941RC-AA243017AA236512Hs.87331ESTs 118053RC-N53367N53391Hs.47629ESTs 123234RC AA490227NM Hs.16697down-regulator oftranscription1,TBP-binding 001938 (negativecofactor2) 129280M63154 M63154Hs.110014gastric intrinsic factor (vitamin B
synthesis) 118995RC_N94591N94591Hs.323056ESTs 116750RC H05960AA760689Hs.92418ESTs 129026M98833 AL120297Hs.108043Friend leukemia virus integration 1 105127RC-AA158132AA045648Hs.301957nudix (nucleoside diphosphate linked moiety X)-type motif 5 4S 114513RC_AA044825AA044873Hs.103446ESTs 411856RC-T35697H67899Hs.4190Homo Sapiens cDNA: FLJ23269 fis, clone 132036W01568 AL157433Hs.37706hypothetical protein DKFZp434E2220 130091RC-W88999W88999 gb:zh70h03.s1 Soares_fetaLliver_spleen-1 NFLS_S1 Homo sapiens cDNA clone 3', mRNA

sequence 414108U09564 A1267592Hs.75761SFRS protein kinase 1 119881RC-W81456W81486Hs.58648ESTs 117770RC N47953AW957372Hs.46791ESTs, Weakly similar to 138022 hypothetical protein [H.sapiens]

119850RC-W80447AI247568Hs.58452ESTs 115439RC-AA284561AI567972Hs.193090ESTs, Highly similar to AF1614371 HSPC319 [H.sapiensj 5$ 123107RC-AA486071AA225048Hs.104207ESTs 406698M24364 X03068Hs.73931major histocompatibility complex, class II, DQ beta 1 121231RC-AA400780AA814948Hs.96343ESTs, Weakly similar to ALUC_HUMAN 1111 ALU CLASS C WARNING ENTRY i!i [H.sapiens]

132074AB002366AA478486Hs.3852KIAA0368 protein 413670AB000115A8000115Hs.75470hypothetical protein, expressed in osteoblast 125277RC-W93227W93227Hs.103245EST

114056RC_AA186324AA188175Hs.82506KIAA1254 protein 121153RC_AA399640AA399640Hs.97694ESTs 121609RC_AA416867AA416867Hs.98185EST

120661RC-AA287556AA287556Hs.263412ESTs, Weakly similar to ALUB HUMAN !!!!
ALU CLASS B WARNfNG ENTRY !!! [H.sapiens]

120850RC-AA349647AA349647Hs.96927Homo Sapiens cDNA FLJ12573 fis, clone 124947RC T03170T03170Hs.100165ESTs 130529RC-AA280886AA178953 gb:zp39e03.s1 Stratagene muscle 937209 Homo Sapiens cDNA clone 3' similar to contains Alu repetitive sequence element;, mRNA

117683RC_N40180N40180 gb:yy44d02.s1 Soares-multiple sclerosis 2NbHMSP Homo Sapiens cDNA clone IMAGE:276387 L1 element ;, mRNA sequence.
3' repetitive similar to contains L1.t1 120745RC-AA302809AA302809 gb:EST10426 Adipose tissue, white I
Homo sapiens cDNA 3' end, mRNA sequence.

120936RC-AA385934AA385934Hs.97184EST, Highly similar to (defline not available 7499603) [C.elegans]

112597RC-878376878376Hs.29733EST

120183RC 240174AW082866Hs.65882ESTs 7$ 120644RC AA287038AI869129Hs.96616ESTs 119023 RC N98488 gb:zb82h01.s1 Soares_senescent fibroblasts_NbHSF
N98488 Homo Sapiens cDNA clone IMAGE:310129 3', mRNA
sequence.

107582 RC_AA002147AA002147Hs.59952EST

118249 RC-N62580N62580Hs.322925EST, Weakly similar to putative p150 [H.sapiens]

115022 RC-AA252029AA252029Hs.87935ESTs 117710 RC N45198Hs.47248ESTs, Highly similar to similar to Cdc14B1 N45198 phosphatase [H.sapiens]

115341 RC AA281452Hs.88840EST, Weakly similar to granule cell madcer AA281452 protein [M.musculus]

118896 RC-N90680N46213Hs.54642methionine adenosyltransferase II, beta 121121 RC AA399371Hs.189095similar fo SALL1 (sal (Drosophilaj-like - N63520 gb:yy62f01.s1 Soares multiple-sclerosis_2NbHMSP
118329 RC Homo Sapiens cDNA clone IMAGE:278137 3', mRNA
sequence.

119496 RC-W35416W35416Hs.156861ESTs, Moderately similarto A46010 X-linked retinopathy protein [H.sapiens]

118111 RC_N55493N55493 gb:yv50c02.s15oares fetal liver spleen 1NFLS Homo Sapiens cDNA clone IMAGE:246146 3', mRNA sequence.

119062 RC AW444881Hs.77829ESTs 116710 RC F10577Hs.306088v-crk avian sarcoma virus CT10 oncogene F10577 f homolog 119261 RC_T15956T15956Hs.65289EST

122723 RC AA457380 gb:aa86b10.s1 Stratagene fetal retina AA457380 937202 Homo Sapiens cDNA clone IMAGE:838171 3' similar to 1 repetitive contains element L1.b3 L ;, mRNA
sequence.

117732 RC N46452 gb:yy76h09.s1 Soares_multiple sclerosis-2NbHMSP
N46452 Homo sapiens cDNA clone IMAGE:2795213' L1 similar repetitive to contains element;, L1.t2 mRNA
sequence.

104787 RC_AA027317AA027317 gb:ze97d11.s1 Soares fetaLheart NbHH19W
Homo Sapiens cDNA clone IMAGE:366933 3' similar to mRNA
contains sequence.
Alu repetitive element;, 100071 A28102A28102 Human GABAa receptor alpha-3 subunit 115819 RC AA486620Hs.41135endomucin-2 130882 RC AA497044Hs.20887hypothetical protein FLJ10392 240166 f 125225 RC_W76540W74169Hs.16492DKFZP564G2022 protein 108339 RC_AA070801AW151340Hs.51615ESTs, Weakly similar fo ALU7-HUMAN ALU
SUBFAMILY SQ SEQUENCE CONTAMINATION

WARNING ENTRY
[H.sapiens]

3~ 100338 D63483D86864Hs.57735acetyl LDL receptor; SREC

121636 RC_AA417027AA379203Hs.306654Homo Sapiens cDNA FLJ13574 fis, clone 103875 RC_AA418387T26379Hs.48802Homo Sapiens clone 23632 mRNA sequence 118716 RC_N73460AI658908Hs.118722fucosyltransferase 8 (alpha (1,6) fucosyltransferase) 119763 RC 854146Hs.10450Homo sapiens cDNA: FLJ22063 fis, clone 121917 RC_AA428218AA406397Hs.98038ESTs 132806 M91488AI699432Hs.278619hypothetical protein FLJ10099 130949 Y10659AV656840Hs.285115interleukin 13 receptor, alpha 1 108806 RC_AA129933AF070578Hs.71168Homo sapiens clone 24674 mRNA sequence 133276 RC AW978439Hs.69504ESTs 134760 RC NM Hs.89548erythropoietin receptor 132867 AA121287AF226667Hs.58553CTP synthase II

132051 AA091284AA393968Hs.180145HSPC030 protein 114208 RC AL049466Hs.7859ESTs 104094 AA418187AA418187Hs.330515ESTs 4$ 128718 AA426361NM Hs.281706sortilin 1 302032 RC NM-001992Hs.128087coagulation factor II (thrombin) receptor 115501 RC AA291553Hs.190086ESTs 101997 001160AU076536Hs.50984sarcoma amplified sequence 103708 AA037206AA430591Hs.72071hypothetical protein FLJ20038 $0 101899 S59184S59184Hs.79350RYK receptor-like tyrosine kinase 115839 RC-AA429038BE300266Hs.28935transducin-like enhancer of split 1, homolog of Drosophila E(sp1) 409459 D50678D86407Hs.54481low density lipoprotein receptor-related protein 8, apolipoprotein a receptor 103563 222534L02911Hs.150402Ac6vin A receptor, type I (ACVR1) (ALK-2) 123233 RC_AA490225AW974175Hs.188751ESTs, Weakly similarto MAPB_HUMAN
MICROTUBULE-ASSOCIATED

55 [H.sapiens]

121305 RC AA402468Hs.291557ESTs 114798 RC_AA159181AA159181Hs.54900serologically defined colon cancer antigen 133145 RC-AA196549H94227Hs.6592Homo Sapiens, clone IMAGE:2961368, mRNA, partial cds AA291015_s Hs.28853CDC7 (cell division cycle 7, S. cerevisiae, AF015592 homology-like 1 60 - H24334Hs.26125ESTs 129507 RC_AA192099AJ236885Hs.112180zinc finger protein 148 (pHZ-52) 121033 RC_AA398505AA398505Hs.97360ESTs 121151 RC-AA399636AA399636Hs.143629ESTs 121402 RC-AA406063AA406063Hs.98003ESTs 65 123203 RC-AA489671AA352335Hs.65641hypothetical protein FLJ20073 132271 RC-AA236466AB030034Hs.115175sterile-alpha motif and leucine zipper containing kinase AZK

125197 RC_W69106AF086270Hs.278554heterochromatin-like protein 1 114935 RC-AA242809H23329Hs.290880ESTs, Weakly similar to ALU1 HUMAN ALU
SUBFAMILY J SEQUENCE CONTAMINATION

WARNING ENTRY
[H.sapiens]

70 125279 RC_W93640AW401809Hs.4779KIAA1150 protein 108778 RC-AA128548AF133123Hs.90847general transcription factor IIIC, polypeptide 3 (102kD) 108087 RC_AA045709AA045708Hs.40545ESTs 132466 RC A1597655Hs.49265ESTs N66810_s 133328 836553AW452738Hs.265327hypothetical protein DKFZp7611141 7$ 124057 RC AA902384Hs.73853bone morphogenetic protein 2 124800 RC_R45115AW864086Hs.138617thyroid hormone receptor interactor 12 121029 RC-AA398482AA398482Hs.97641EST

120663 RC AA827798Hs.105089ESTs 102133 015173AU076845Hs.155596BCL2/adenovirus E1B 19kD-interacting protein 2 108246 RC AI423132Hs.146343ESTs $ 125226 RC-W78134AA782536Hs.122647N-myristoyltransferase 2 , 120260 RC-AA171739AK000061Hs.101590hypothetical protein 124906 RC H75964Hs.107815ESTs 109406 RC AA199883Hs.67624ESTs 109271 RC AW137422Hs.86022ESTs 125052 RC T85104Hs.222779ESTs, Moderately similar to similar to T80174-s NEDD-4 [H.sapiens]

109101 RC-AA167708AW608930Hs.52184hypothetical protein FLJ20618 115241 RC AA648278Hs.193859ESTs 117163 RC N36861Hs.42344ESTs 113530 RC T90313Hs.16732ESTs 1$ 120375 RC_AA227260AF028706Hs.111227Zic family member 3 (odd-paired Drosophila homolog, heterotaxy 1 ) 129435 AA314256AF151852Hs.111449CGI-94 protein 114864 RC AA135332Hs.71608ESTs 103988 AA314389AA314389Hs.42500ADP-ribosylation factor-like 5 131006 RC-AA242763AF064104Hs.22116CDC14 (cell division cycle 14, S.
cerevisiae) homolog B

106781 RC-AA478474AA330310Hs.24181ESTs 106141 RC-AA424558AF031463Hs.9302phosducin-like 116213 RC_AA476738AA292105Hs.326740hypothetical protein MGC10947 135266 AB002326841179Hs.97393KIAA0328 protein 135058 RC-AA430152AI379720Hs.93814hypothetical protein 119908 RC-W85844AA524470Hs.58753ESTs 103695 AA018758AW207152Hs.186600ESTs 103978 AA307443NM Hs.34136chromosome 21 open reading frame 6 109485 RC-AA233472BE619092Hs.28465Homo Sapiens cDNA: FLJ21869 fis, clone 129574 AA458603AA026815Hs.11463UMP-CMP kinase 3~ AA281528 AA356792Hs.334824hypothetical protein FLJ14825 - AW961026Hs.96752ESTs, Weakly similar to ALU8_HUMAN ALU

WARNING ENTRY
[H.sapiens]

AA398628 AA393283 gb:zt74e03.r1 Soares testis NHT Homo 121059 RC Sapiens cDNA clone 5', mRNA sequence - W17064Hs.332848SWIISNF related, matrix associated, actin 131887 AA046548 dependent regulator of chromatin, subfamily e, 35 member 1 112064 RC AL049390Hs.22689Homo Sapiens mRNA; cDNA DKFZp58601318 843812 (from clone DKFZp58601318) AA400465 A1025829Hs.86320ESTs - NM-004349Hs.31551core-binding factor, runt domain, alpha 131750 RC-H94855-s subunit 2; translocated to,1; cyclin D-related 102123 014518NM-001809Hs.1594centromere protein A (17kD) 4~ 129847 RC_W46767N64025Hs.296178hypothetical protein FLJ22637 133809 RC AV649326Hs.76359catalase 132210 RC_N51499NM Hs.42322A kinase (PRKA) anchor protein 2 s 007203 122356 RC_AA443794AA443794Hs.98390ESTs 114958 RC-AA243708N20912Hs.42369ESTs 45 103951 AA287840AL353944Hs.50115Homo sapiens mRNA; cDNA DKFZp761J1112 (from clone DKFZp761J1112) 134703 RC-AA280704AF117065Hs.88764male-specific lethal-3 (Drosophila)-like 128727 AA287864AI223335Hs.50651Janus kinase 1 (a protein tyrosine kinase) 105743 RC_AA293300_s Hs.9598sema domain, immunoglobulin domain (1g), BE246502 transmembrane domain (TM) and short cytoplasmic domain, (semaphorin) $0 103744 AA076003AA079267 gb:zm97e10.s1 Stratagene colon HT29 (937221) Homo Sapiens cDNA clone 3', mRNA

sequence 114348 N80402AL050321Hs.301532CRP2 binding protein 114009 RC_W900~7AI248544Hs.103000KIAA0831 protein 134704 RC-AA280849AA837124Hs.88780ESTs $S 128629 AA399187AL096748Hs.102708DKFZP434A043protein 104410 H65925AI807519Hs.104520Homo sapiens cDNA FLJ13694 fis, clone 110200 RC H21075Hs.31802ESTs, Highly similar to A59266 unconventional H21075 myosin-15 [H.sapiens]

124483 RC AI821780Hs.179864ESTs 101391 M14648NM-002210Hs.295726integrin, alpha V (vitronectin receptor, alpha polypeptide, antigen CD51) 109657 RC 860900Hs.26814ESTs 117140 RC H96813Hs.42241ESTs 132937 RC-AA233706 Hs.300383hypothetical protein MGC3032 f AW952912 129799 836410AW967473Hs.239114mannosidase, alpha, class 1A, member 105077 RC_AA142919W55946Hs.234863Homo Sapiens cDNA FLJ12082 fis, clone 6S 100850 RC AA836472Hs.297939cathepsin B
N58561 s 131043 RC-AA490925AF084535Hs.22464epilepsy, progressive myoclonus type 2, Lafora disease (laforin) 118417 RC-N66048AF080229 gb:Human endogenous retrovirus K clone f 10.1 polymerase mRNA, partial cds 129254 RC-AA243695AA252468Hs.1098DKFZp434J1813 protein 119149 RC-858910BE304701Hs.65732ESTs 133996 AA091367AA380267Hs.78277DKFZP434F2021 protein 110223 RC H19836Hs.31697ESTs 117626 RC AK001757Hs.281348hypothetical protein FLJ10895 135286 RC_AA424469 Hs.97849ESTs s AW023482 AA478521 AA806187Hs.289101glucose regulated protein, 58kD

- AF043117Hs.24594ubiquitination factor E4B (homologous 131236 AA282640 to yeast UFD2) 128568 AA463380H12912Hs.274691adenylate kinase 3 112888RC T03872AW195317Hs.107716hypothetical protein FLJ22344 115192RC AA261920AA741024Hs.88378ESTs 118688RC N71484AK000708Hs.169764hypothetical protein FLJ20701 122264AA436837AA436837 gb:zv57g07.s1 Soares testis NHT Homo RC sapiens cDNA clone 3', mRNA sequence 128981- AA927177Hs.86041CGG triplet repeat binding protein 1 131042RC 842457AI826288Hs.171637hypothetical protein MGC2628 103704AA028171AA028171Hs.151258hypothetical protein FLJ21062 121341AA233107AF035528Hs.153863MAD (mothers against decapentaplegic, Drosophila) homolog 6 106593RC AA456826AW296451Hs,24605ESTs 1 115195RC-AA262156AW968619Hs.155849ESTs ~

115425RC_AA284071AAB11895Hs,180680ESTs, Weakly similar to 154374 gene NF2 protein [H.sapiens]

117258RC N21299AF086041Hs,42975ESTs 120209RC 240892F02951 gb:HSC1HB082 normalized infant brain cDNA Homo sapiens cDNA clone c-1hb08 3', mRNA

sequence 1$ 134082L16991 L16991Hs.79006deoxythymidylate kinase (thymidylate kinase) 104774RC AA026066AW959755Hs.288896Homo Sapiens cDNA FLJ12977 fis, clone 115625RC AA401630AA059459Hs.62592ESTs 104469N28707 N28707Hs.154304Homo sapiens chromosome 19, BAC 282485 (CIT-B-344H19) 107401W20054 N91453Hs.102987ESTs 111686RC 821510822039Hs.23217ESTs 115300RC AA280026AA280095Hs.88689ESTs 115378RC_AA282292AA282292Hs.279841hypothetical protein FLJ10335 132224RC H97819N41549Hs.285410ESTs 113791M95767 AI269096Hs.135578chitobiase, di-N-acetyl-2$ 129144AA004987AL137275Hs.20137hypothetical protein DKFZp434P0116 104448L44574 NM_007331Hs.110457Wolf-Hirschhorn syndrome candidate 1 132084RC T26981NM-002267Hs.3886karyopherin alpha 3 (importin alpha 4) s 111831RC-836083836095Hs.268695ESTs 114765RC_AA252163AA463550Hs.337532ESTs, Weakly similarto A47582 B-cell growth factor precursor [H.sapiens]

3 115029RC_AA252219AL137939Hs.40096ESTs 100457H81492 BE246400Hs.285176acetyl-Coenzyme A transporter 104536824011 824024Hs.158101Homo Sapiens cDNA FLJ14673 fis, clone NT2RP2003714, moderately similar to ZINC FINGER

116167RC_AA461562A1091731Hs.87293hypothetical protein FLJ20045 103889AA236771885350Hs.101368ESTs 131978RC H48459AA355925Hs.36232KIAA0186 gene product s 118843RC N80181N80181Hs.221498ESTs 120837RC W93092BE149656Hs.306621Homo Sapiens cDNA FLJ11963 fis, clone 133647D21852 NM-015361Hs.268053KIAA0029 protein 129521U41815 AF071076Hs.112255nucleoporin 98kD

103746AA081876AA075000 gb:zm83c07.s1 Stratagene ovarian cancer (937219) Homo sapiens cDNA clone 3', mRNA

sequence 132019 i H56995Hs.37372Homo sapiens DNA binding peptide mRNA, RC-AA134965 partial cds 132310RC-AA284107AA173223Hs.289044Homo Sapiens cDNA FLJ12048 fis, clone 45 117367RC N24954A1041793Hs.42502ESTs 103743AA075998AA075998 gb:zm89b09.r1 Stratagene ovarian cancer (937219) Homo Sapiens cDNA clone 5' similar to gb:M15887 INDING mRNA sequence ACYL-COA-B PROTEIN
(HUMAN);, 103761AA085138AA765163 gb:nz79b10.s1 NCI-CLAP-GCB1 Homo Sapiens cDNA clone 3' similar to gb;M34539 FK506-BINDING
PROTEIN
(HUMAN);, mRNA
sequence 50 130237L39060 AA913909Hs.153088TATA box binding protein (TBP)-associated factor, RNA poiymerase I, A, 48kD

128752RC N72879AA504428Hs.10487Homo sapiens, clone IMAGE:3954132, mRNA, partial cds 135162AA045930AI187925Hs.95667F-box protein 30 , 131386AA096412BE219898Hs.173135dual-specificity tyrosine-(Y)-phosphorylafion regulated kinase 2 129021RC_AA599244AL044675Hs.173081KIAA0530 protein $$ 424274AA293634W73933Hs.283738casein kinase 1, alpha 1 129913H06583 NM-001310Hs.13313CAMP responsive element binding protein-like 131888U79298 AW294659Hs.34054Homo sapiens cDNA: FLJ22488 fis, clone HRC10948, highly similar to HSU79298 Human clone mRNA

118612RC N69466AB037788Hs.224961cleavage and polyadenylation specific factor 2,100kD subunit 322026AA203138AW024973Hs.283675NPD009 protein 110892RC_N38882AL035301Hs.97375H.sapiens gene from PAC 106H8 111429RC 801245A1038052Hs.19162ESTs, Weakly similar to 154374 gene NF2 protein [H.sapiens]

113334RC_T76962AW974666Hs.293024ESTs 104091AA417310BE465093Hs.106101hypothetical protein FLJ22557 ~$ 105246RC_AA226879AA226879 gb:zr19c09.s1 Stratagene NT2 neuronal precursor 937230 Homo Sapiens cDNA clone IMAGE:663856 to 3' contains similar Alu repetitive element;, mRNA
sequence.

113300RC T67448T67448Hs.13101ESTs 117147RC H97225AW901347Hs.38592hypothetical protein FLJ23342 s 121349RC-AA405205AA405205Hs.97960ESTs, Weakly similar to T51146 ring-box protein 1 [H.sapiens]

100294D49396 AA331881Hs.75454peroxiredoxin 3 133999M28213 AA535244Hs.78305RA82, member RAS oncogene family 133259AA278548BE379646Hs.6904Homo sapiens mRNA full length insert cDNA clone EUROIMAGE 2004403 129423AA371418AA204686Hs.234149hypothetical protein FLJ20647 131098RC-AA459668U66669Hs.2366423-hydroxyisobutyryl-Coenzyme A hydrolase ~$ 135272AA399391AI828337Hs.97591ESTs 129155AA046865AI952677Hs.108972Homo Sapiens mRNA; cDNA DKFZp434P228 (from clone DKFZp434P228) 10$

311291 AA056319AA782601Hs.319817ESTs 120750 RC-AA310499AI191410Hs.96693ESTs, Moderately similar to 2109260A
B cell growth factor [H.sapiens]

101002 J04058AV655843Hs.169919electron-transfer-flavoprotein, alpha polypeptide (glutaric aciduria II) 133012 AA099241AA847843Hs.62711Homo sapiens, clone IMAGE:3351295, mRNA

$ 103879 AA228148BE543269Hs.50252mitochonddal ribosomal protein L32 s 131281 RC-AA443212AA251716Hs.25227ESTs 115109 RC_AA256383AJ249977Hs.88049protein kinase, AMP-activated, gamma 3 non-catalytic subunit 118502 RC_N67317AL157488Hs.50150Homo sapiens mRNA; cDNA DKFZp564B182 (from clone DKFZp564B182) 134100 L07540AA460085Hs.171075replication factor C (activator 1) 5 (36.5kD) 131869 AA484944AW968547Hs.33540ESTs, Weakly similar to dJ309K20.4 [H.sapiens]

115396 RC-AA282985AA810854Hs.89081ESTs 103860 AA203742AW976877Hs.38057ESTs 135089 N75611AI918035Hs.301198roundabout (axon guidance receptor, Drosophila) s homolog 1 129938 079300AW003668Hs.135587Human clone 23629 mRNA sequence 107508 W90095N74925Hs.38761Homo sapiens cDNA: FLJ21564 fis, clone 103685 AA005190AA158008Hs.292444ESTs 125170 AA203147AL020996Hs.8518selenoprotein N

129179 RC-AA504125_s Hs.109154ESTs 116262 AA477046AI936442Hs.59838hypothetical protein FLJ10808 2~ 123009 RC-AA479949AA535244Hs.78305RAB2, member RAS oncogene family 131004 D29833D29833Hs.2207salivary proline-rich protein 103317 X&3441X83441Hs.166091ligase IV, DNA, ATP-dependent 132814 RC_C15251D60730Hs.57471ESTs f 103992 077718BE018142Hs.300954Huntingtin interacting protein K

109258 X59710AL044818Hs.84928nuclear transcription factory, beta 110754 RC-N20814AW302200Hs.6336KIAA0672 gene product 132727 AA136382N27495Hs.5565hypothetical protein FLJ22626 s 100341 D63506AF032922Hs.8813syntaxin binding protein 3 134664 AA256106AA256106Hs.87507ESTs 30 103826 AA165564AW162998Hs.24684KIAA1376 protein 111678 RC_R20628838487Hs.169927ESTs 101341 L76159NM Hs.203772FSHD region gene 1 115455 RC_AA285068AA876002Hs.120551toll-like receptor 10 111192 RC_AA477748AW021968Hs.109438Homo sapiens clone 24775 mRNA sequence 3 129385 RC_AA235604AA172106Hs.110950Rag C protein $

125050 RC-T79951AW970209Hs.111805ESTs 122105 RC_AA432278AW241685Hs.98699ESTs 121324 RC-AA404229AA404229Hs.97842EST

120938 RC-AA386260AA386260Hs.104632EST

40 115001 RC-AA251376AA251376 gb:zs10a06.s1 NCI-CGAP_GCB1 Homo Sapiens cDNA clone IMAGE:684754 3', mRNA

sequence.
124799 RC-845088845088 gb:yg38g04.s1 Soares infant brain 1N18 Homo Sapiens cDNA clone IMAGE:34896 3', mRNA

sequence.

122724 RC_AA457395AA457395Hs.99457ESTs 4$ 117791 RC_N48325N48325Hs.93956EST

121895 RC-AA427396AA427396 gb:zw33a02.s1 Soares ovary tumor NbHOT
Homo Sapiens cDNA clone IMAGE:771050 3' similar to contains2.t2 MER12 repetitive element ;, mRNA
contains MER1 sequence.
Alu repetitive element;

108244 RC-AA062839AA062839 gb:zm05c09.s1 Stratagene corneal stroma (937222) Homo Sapiens cDNA clone IMAGE:513232 3', mRNA
sequence.

5~ 117852 RC_N49408AW877787Hs.136102KIAA0853 protein 109298 RC-AA205432877854Hs.250693Krueppel-related zinc finger protein 122432 RC-AA447400AA447400Hs.187684ESTs, Weakly similar to B34087 hypothetical protein [H.sapiens]

124627 RC-N74625N74625 gb:za55c03.s1 Soares fetal liver spleen 1NFLS Homo Sapiens cDNA clone IMAGE:296452 3' similar to N S PRECURSOR (HUMAN);contains OFR.b3 gb:M14338 OFR repetitive element;, mRNA sequence.
VITAMIN
K-DEPENDENT
PROTEI

$5 115141 RC AA465131Hs.64001Homo sapiens clone 25218 mRNA sequence 128636 049065049065Hs.102865~interleukin 1 receptor-like 2 115373 RC_AA282197AA664862Hs.181022CGI-07 protein 114651 RC-AA101400AA101400Hs.189960ESTs 132796 RC-AA180487NM Hs.173159transforming, acidic coiled-coil containing 006283 protein 1 60 103749 RC_N35583AL135301Hs.8768hypothetical protein FLJ10849 107328 T83444AW959891Hs.76591KIAA0887 protein 115349 RC-AA281563AF121176Hs.12797DEADIH (Asp-Glu-Ala-AspIHis) box polypeptide 111490 RC_R06862806862 gb:yf11e09.s1 Soares fetal liver spleen 1NFLS Homo Sapiens cDNA clone IMAGE;126568 3' similar to ;, contains mRNA
L1 repetitive sequence.
element 65.103763 AA085354AA085291 gb:zn01g06.s1 Stratagene colon HT29 (937221) Homo Sapiens cDNA clone 3' similar to contains ment;, Alu repetitivemRNA
ele sequence 118791 RC N75520Hs.261003ESTs, Moderately similar to 834087 hypothetical N75520 protein [H.sapiens]

116644 RC F03032Hs.290278ESTs, Weakly similar to 834087 hypothetical F03032 protein [H.sapiens]

116823 RC_H56485AW204742Hs.143542ESTs, Highly similar to CSA-HUMAN COCKAYNE
SYNDROME WD-REPEAT PROTEIN CSA

[H.sapiens]

108940 RC-AA148603AA148603 gb:zo09e04.s1 Stratagene neuroepithelium NT2RAMI 937234 Homo sapiens cDNA clone IMAGE:567198sequence.
3', mRNA

112218 RC 850057Hs.272251Homo sapiens mRNA; cDNA DKFZp586M1418 850057 (from clone DKFZp586M1418) 116557 RC_D20572_iD20572Hs.90171EST

133649 025849025849Hs.75393acid phosphatase 1, soluble 131745 RC_C20746AI828559Hs.31447ESTs, Moderately similar to A46010 X-linked retinopathy protein [H.sapiens]

116801 RC-H43879H43879 gb:yo69h09.s1 Soares breast 3NbHBst Homo Sapiens cDNA clone IMAGE:183233 3', mRNA

sequence.

115006 RC AA251548Hs.87886EST

123424 RC H29882Hs.162614ESTs 120831 RC AA347919Hs.96889EST

103691 AA018298AA018298Hs.103332ESTs 121555 RC-AA412491AF025771Hs.50123zinc finger protein 189 111193 RC N67946Hs.117569ESTs 132061 RC AB020700Hs.3830KIAA0893 protein _ AA194568Hs.85938EST
134575 RC_AA194568 i 115050 RC AA252794Hs.88009ESTs 420208 031799BE276055Hs.95972silver (mouse homology like 133735 AC002045866740Hs.110613KIAA0220 protein xpt1 128546 221305NM Hs.101299cullin 5 111946 RC 840697Hs.76666C9orf10 protein 124879 RC 873588Hs.101533ESTs 115683 AA410345AF255910Hs.54650functional adhesion molecule 2 103692 AA018418AW137912Hs.227583Homo Sapiens chromosome X map Xp11.23 L-type calcium channel alpha-1 subunit (CACNA1F) gene complete cds~ HSP27 pseudogene complete sequence;
and JM1 protein, JM2 protein, and Hb2E
genes, complete cds 103767 AA089688BE244667Hs.296155CGI-100 protein 125266 W90022W90022Hs.186809ESTs, Highly similar to LCT2-HUMAN LEUKOCYTE

PRECURSOR
[H.sapiens]

135235 AA435512AW298244Hs.293507ESTs 134497 RC BE258532Hs.251871CTP synthase _ NN~014264Hs.172052serinelthreonine kinase 18 i 412177 RC 223091Hs.73734glycoprotein V (platelet) s 132000 RC_AA044644AW247017Hs.36978melanoma antigen, family A, 3 124738 RC T07568Hs.137158ESTs 324000 RC AA604749Hs.190213ESTs i 106896 RC AW073202Hs.334825Homo sapiens cDNA FLJ14752 fis, clone i 132000 RC AW247017Hs.36978melanoma antigen, family A, 3 129577 RC-AA025858N75346Hs.82906CDC20 (cell division cycle 20, S. cerevisiae, homology 107091 RC-AA233519AI949109Hs.246885hypothetical protein FLJ20783 130296 RC D31139Hs.154103LIM protein (similar to rat protein kinase N52271 C-binding enigma) 35 102855 RC NM Hs.2178H2B histone family, member Q

113689 RC_AA098874A8037850Hs.16621DKFZP4341116 protein 100939 RC-AA279667_sL04288Hs.297939cathepsin B

130430 RC W27893Hs.150580putative translation initiation factor 106734 RC BE296690Hs.288173Homo Sapiens cDNA: FLJ21747 fis, clone N45979-s COLF5160, highly similar to AF182198 Homo Sapiens 40 intersectin TSN2) 2 long isoformmRNA
(I

135148 RC-AA431288AA306478Hs.95327CD3D antigen, delta polypeptide (TiT3 s complex) 134221 RC_AA609862BE280456Hs.80248RNA-binding protein gene with multiple splicing 105376 RC_N35583AW994032Hs.8768hypothetical protein FLJ10849 124541 077718AF112222Hs.44499pinin, desmosome associated protein 45 134546 AA203147AL020996Hs.8518selenoprotein N

134000 RC AW175787Hs.334841selenium binding protein 1 125656 RC-W93092AW516428Hs.78687neutral sphingomyelinase (N-SMase) activation associated factor 100939 RC L04288Hs.297939cathepsin B
N58561 s 125656 RC_W93092AW516428Hs.78687neutral sphingomyelinase (N-SMase) activation associated factor 50 101779 RC-W69385BE543412Hs.250505retinoic acid receptor, alpha s 332489 RC-822947823053NA Hu01 Chip Redos 133000 RC_N38959AL042444Hs.62402p21/Cdc421Rac1-activated kinase 1 (yeast f Ste20-related) 125905 RC AI678638Hs.6456chaperonin containing TCP1, subunit 2 N38959 f (beta) 129000 RC-H73050AA744902Hs.107767hypothetical protein PR01489 s 55 100920 RC-H73050_sX54534Hs.278994Rhesus blood group, CcEe antigens Table 1A shows the accession numbers for those pkeys lacking unigenelD's for Tables 1, The pkeys in Table 7 lacking unigenelD's are represented within Tables 1-6A. For each probeset we have listed the gene cluster number from which the oligonucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs. These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubIeTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession"
column.
1 ~ Pkey: Unique Eos probeset identifier number CAT number: Gene cluster number Accession: Genbank accession numbers IS Pkey CAT Number Accession ~$ 125104413347 1 T95590 AA703278 H62764 1245751666649_1 N68168 N69188 N90450 11841737186_1 AF080229 AF080231 AF080230 AF080232 AF080233 AF080234 AW003247 AW496808 A1080480 Ai631703 AI651023 AI867418 AW818140 103743112194_1 AA075998 AA075999 AA070986 AA070896 AA129207 AA078942 1202091531817_1 F02951 240892 F04711 4$ 1119041719336 1 241572 839330 122264296527_1 AA436837 AA442594 1299611706092_1 823053 879884 876271 S$ 107832genbanILAA021473 AA021473 123731genbank_AA609839 AA609839 116571genbank-D45652 D45652 132225genbank-AA128980 AA128980 125017genbank-T68875 T68875 125063genbank_T85352 T85352 125064genbank-T85373 T85373 100964entrez_J00212 J00212 102269entrez_U30245U30245 6S 125150NOT_FOUND-entrez_W38240 W38240 116801genbank-H43879 H43879 118111genbanhN55493 N55493 118129genbank-N57493 N57493 118329genbank N63520 N63520 118475genbank-N66845 N66845 111490genbank 806862 806862 111514genbanILR07998 807998 104534822303 at 822303 120340genbank_AA206828 AA206828 l08 120376genbank_AA227469AA227469 104787genbank-AA027317AA027317 120409genbanILAA235050AA235050 120745genbank~A302809AA302809 $ 120809genbank_AA346495AA346495 120839genbank-AA348913AA348913 113702genbanILT97307T97307 115001genbanILAA251376AA251376 122562genbank-AA452156AA452156 1 122635genbank_AA454085AA454085 108244genbank-AA062839AA062839 108277genbank-AA064859AA064859 122723genbank_AA457380AA457380 124028genbank-F04112F04112 1 108403genbank_AA075374AA075374 122860genbank_AA464414AA464414 108427genbank-AA076382AA076382 108439genbank-AA078986AA078986 108533genbank-AA084415AA084415 117031genbank-H88353H88353 124254genbanltH69899H69899 2$ 101447entrez_M21305M21305 101458entrez_M22092M22092 124577genbank-N68300N68300 108940genbank_AA148603AA148603 108941genbank-AA148650AA148650 124627genbank-N74625N74625 124793genbank_R44519844519 124799genbank-845088845088 117683genbank-N40180N40180 3 117732genbank-N46452N46452 S

124991genbanl~T50116T50116 119023genbank-,N98488N98488 entrez_W38194 40 119654genbank_W57759W57759 105246genbank-AA226879AA226879 121350genbank-AA405237AA405237 121558genbank_AA412497AA412497 105985genbank-AA406610AA406610 45 100071entrez-A28102A28102 114648genbank_AA101056AA101056 121895genbank-AA427396AA427396 100327entrez_D55640D55640 TABLE 2:
Pkey: Unique Eos probeset identifier number Accession: Accession number used for previous patent filings ExAccn; Exemplar Accession number, Genbank accession number UnigenelD: Unigene number Unigene Title: Unigene gene title l~ Pkey Accession ExAccn UnigenelD UnigeneTitle 100420100420D86983Hs.118893Melanoma associated gene 100484100484NM_005402Hs.288757v-ral simian leukemia viral oncogene hom 100991100991J03836Hs.82085swine (or cysteine) proteinase inhibito 15 101168101168NM Hs.211569G protein-coupled 005308 receptor kinase 5 101261101261D30857Hs.82353protein C receptor, endothelial (EPCR) 101447101447M21305 gb:Human alpha satellite and satellite 3 101543101543M31166Hs.2050pentaxin-related gene, rapidly induced b 101560101560AW958272Hs.347326intercellular adhesion molecule 2 101714101714M68874Hs.211587phospholipase A2, group IVA (cytosolic, 101838101838BE243845Hs.75511connective tissue growth factor 102012102012BE259035Hs.118400singed (Drosophila)-like (sea urchin fas 102164102164NM_000107Hs.77602damage-specific DNA
binding protein 2 (4 102283102283AW161552Hs.83381guanine nucleotide binding protein 11 ZS 102564102564059423Hs.79067MAD (mothers against decapentaplegic, Dr 102759102759NM Hs.788A kinase (PRKA) anchor 005100 protein (gravin) 102804102804NM Hs.83354lysyl oxidase-like 102898102898NM Hs.149609integrin, alpha 5 002205 (fibronectin receptor, 103036103036M13509Hs.83169matrix metalloproteinase 1 (interstitial 3 103095103095NM_005424Hs.78824tyrosine kinase with ~ immunoglobulin and 103166103166AA159248Hs.180909peroxiredoxin 1 103280103280084722Hs.76206cadherin 5, type 2, VE-cadherin (vascula 103850103850AA187101Hs.213194hypothetical protein 104592104592AW630488Hs.25338protease, serine, 3$ 104786104786AA027167Hs.10031KIAA0955 protein 104865104865T79340Hs.22575B-cell CLLllymphoma 6, member B (zinc fi 104952104952AW076098Hs.345588desmoplakin (DPI, DPII) 105178105178AA313825Hs.21941AD036 protein 105330105330AW338625Hs.22120ESTs 105729105729H46612Hs.293815Homo sapiens HSPC285 mRNA, partial cds 105977105977AK001972Hs.30822hypothetical protein 106031106031X64116Hs.171844Homo sapiens cDNA:
FLJ22296 fis, clone H

106155106155AA425414Hs.33287nuclear factorIIB

106423106423AB020722Hs.16714Rho guanine exchange factor (GEF) 15 4$ 107174107174BE122762Hs.25338ESTs 107295107295AA186629Hs.80120UDP-N-acetyl-alpha-D~alactosamine:polyp 108756108756AA127221Hs.117037ESTs 108888108888AA135606Hs.189384gb:z110a05.s1 Soares_pregnant uterus-NbH

109166109166AA219691Hs.73625RAB6 interacting, kinesin-like (rabkines 109768109768F06838Hs.14763ESTs 110906110906AA035211Hs.17404ESTs 111006111006BE387014Hs.166146Homer, neuronal immediate early gene, 3 111133111133AW580939Hs.97199complement component C1q receptor 113073113073N39342Hs.103042microtubule-associated protein 1B

SS 113923113923AW953484Hs.3849hypothetical protein FLJ22041 similar to 115061115061AI751438Hs.41271Homo Sapiens mRNA
full length insert cDN

115145115145AA740907Hs.88297ESTs 115947115947847479Hs.94761KIAA1691 protein 116339116339AK000290Hs.44033dipeptidyl peptidase 116589116589AI557212Hs.17132ESTs, Moderately similar to 154374 gene 117023117023AW070211Hs.102415Homo sapiens mRNA;
cDNA DKFZp586N0121 (f 117563117563AF055634Hs.44553unc5 (C.elegans homology c 118475118475N66845 gb:za46c11.s1Soaresfetalliverspleen 119073119073BE245360Hs.279477ESTs 6S 119174119174871234 gb:yi54c08.s1 Soares placenta Nb2HP Homo 119416119416T97186 gb:ye50h09.s1 Soaresfetalliverspleen 121335121335AA404418 gb:zw37e02.s1 Soares total-fetus Nb2HF8-123160123160AA488687Hs.284235ESTs, Weakly similar to 138022 hypotheti 123523123523AA608588 gb:ae54e06.s1 Stratagene lung carcinoma 123964123964C13961 gb:C13961 Clontech human aorta polyA+mR

124315124315NM-005402Hs.288757v-ral simian leukemia viral oncogene hom 124669124669AI571594Hs.102943hypothetical protein 124875124875AI887664Hs.285814sprouty (Drosophila) homolog 4 125103125103AA570056Hs.122730ESTs, Moderately similar to KIAA1215 pro ~$ 125565125565820840 gb:yg05c08.r1 Soares infant brain 1NIB
H

126511 T92143Hs.57958EGF-TM7-latrophilin-related 126511 protein 126649 AA001860Hs.279531ESTs 449602 AA001860Hs.279531ESTs 127402 AA358869Hs.227949SEC13 (S. cerevisiae)-like $ 128992 H04150Hs.107708ESTs 129188 NM_001078Hs.109225vascular cell adhesion 129188 molecule 1 129371 X06828Hs.110802von Willebrand factor 129765 M86933Hs.1238amelogenin (Y chromosome) 129884 AF055581Hs.13131lysosomal 1 130639 AI557212Hs.17132ESTs, Moderately similar ~ 130639 to 154374 gene 130828 AW631469Hs.203213ESTs 131080 NM-001955Hs.2271endothelin 1 131182 AIB24144Hs.23912ESTs 131573 AA040311Hs.28959ESTs 1 131756 AA443966Hs.31595ESTs $ 131756 131881 AW361018Hs.3383upstream regulatory 131881 element binding prot 132083 BE386490Hs.279663Pirin 132358 NNI-003542Hs.46423H4 histone family, 132358 member G

132456 AB011084Hs.48924KIAA0512 gene product;

132676 N92589Hs.261038ESTs, Weakly similar 132676 to 138022 hypotheti 132718 NM-004600Hs.554Sjogren syndrome antigen 132718 A2 (60kD, ribon 132760 AA125985Hs.56145thymosin, beta, identified 132760 in neuroblast 132968 AF234532Hs.61638myosin X

133061 AI186431Hs.296638prostate differentiation 133061 factor 2$ 133161 AW021103Hs.6631hypothetical protein 133260 AA403045Hs.6906Homo sapiens cDNA:
133260 FLJ23197 fis, clone R

133491 BE619053Hs.170001eukaryotic translation 133491 initiation factor 133550 AI129903Hs.74669vesicle-associated 133550 membrane protein 5 (m 133614 NM Hs.75232SEC14 (S. cerevisiae)-like 133691 M85289Hs.211573heparan sulfate proteoglycan 133691 2 (perlecan 133913 AU076964Hs.7753calumenin 133985 L34657Hs.78146plateletlendothelial 133985 cell adhesion molec 134088 AI379954Hs.79025KIAA0096 protein 134299 AW580939Hs.97199complement component 134299 C1q receptor 35 116470 Ai272141Hs.83484SRY (sex determining 116470 region Y)-box 4 134989 AW968058Hs.92381nudix (nucleoside 134989 diphosphate linked moi 135073 W55956Hs.94030Homo Sapiens mRNA;
135073 cDNA DKFZp586E1624 (f 100114 X02308Hs.82962thymidylate synthetase 100143 AU076465Hs.278441KIAA0015 gene product 100208 NM Hs.78224ribonuclease, RNase 100208 002933 A family,1 (pancrea 100405 AW291587Hs.82733nidogen 2 100455 AW888941Hs.75789N-myc downstream regulated 100618 AI752163Hs.114599collagen, type VIII, 100618 alpha 1 100658 U56725Hs.180414heat shock 70kD protein 45 100718 BE295928Hs.75424inhibitor of DNA binding 100718 1, dominant neg 100828 AL048753Hs.303649small inducible cytokine 100828 A2 (monocyte ch 100991 J03836Hs.82085serene (or cysteine) 100991 proteinase inhibito 101110 AI439011Hs.86386myeloid cell leukemia 101110 sequence 1 (BCL2-r 101156 AA340987Hs.75693prolylcarboxypeptidase 101156 (angiotensinase C

$~ 101184 NM-001674Hs.460activating transcription 101184 factor3 101317 L42176Hs.8302four and a half LIM
101317 domains 2 101345 NM Hs.152175calcitonin receptor-like 101475 BE410405Hs.76288calpain 2, (mill) 101475 large subunit 101496 X12784Hs.119129collagen, type IV, 101496 alpha 1 $ 101543 M31166Hs.2050pentaxin-related gene, $ 101543 rapidly induced b 101560 AW958272Hs.347326intercellular adhesion 101560 molecule 2 101592 AF064853Hs.91299guanine nucleotide 101592 binding protein (G
pr 101634 AV650262Hs.75765GR02 oncogene 101682 AF043045Hs.81008filamin B, beta (actin-binding 101682 protein-2 101720 M69043Hs.81328nuclear factor of 101720 kappa light polypeptid 101744 AI879352Hs.118625hexokinase 1 101837 M92843Hs.343586zinofinger protein 101837 homologous to Zfp-36 101840 AA236291Hs.183583serine (or cysteine) 101840 proteinase inhibito 101864 BE392588Hs.75777transgelin 6$ 101966 X96438Hs.76095immediate early response 102013 BE616287Hs.178452catenin (cadherin-associated 102013 protein), a 102059 AI752666Hs.76669nicotinamide N-methyltransferase 102283 AW161552Hs.83381guanine nucleotide 102283 binding protein 11 102378 AU076887Hs.28491spermidinelspermine 102378 N1-acetyltransferase 102460 U48959Hs.211582myosin, light polypeptide 102460 kinase 102499 BE243877Hs.76941ATPase, Na+IK+transporting, 102499 beta 3 poly 102560 897457Hs.63984cadherin 13, H-cadherin 102560 (heart) 102589 AU076728Hs.8867cysteine-rich, angiogenic 102589 inducer, 61 102645 AL119566Hs.6721lysosomal ~$ 102693 AA532780Hs.183684eukaryotictranslaGon 102693 initiation factor 102759 NM-005100Hs.788A kinase (PRKA) anchor 102759 protein (gravin) 102882 AI767736Hs.290070gelsolin (amyloidosis, 102882 Finnish type) 102915 X07820.Hs.2258matrix metalloproteinase 102915 10 (stromelysin 102960 AI904738Hs.76053DEADIH (Asp-Glu-Ala-AspIHis) 1D2960 box polypep 103020 X53416 Hs.195464filamin A, alpha (actin-binding 103020 protein-103036 M13509 Hs.83169matrix metalloproteinase 103036 1 (interstitial 103080 AU077231Hs.82932cyclin D1 (PRAD1:
103080 parathyroid adenomatos 103138 X65965 gb:H.sapiens SOD-2 103138 gene for manganese su 103195 AA351647Hs.2642eukaryotic translation 103195 elongation factor 103371 X91247 Hs.13046thioredoxin reductase 1 103471 Y00815 Hs.75216protein tyrosine phosphatase, ~ 103471 receptor t 104447 AW204145Hs.156044ESTs 104783 AA533513Hs.93659protein disulfide 104783 isomerase related prot 104865 T79340 Hs.22575B-cell CLUlymphoma 104865 6, member B (zinc fi 104894 AF065214Hs.18858phospholipase A2, 104894 group IVC (cytosolic, 1$ 105113 A8037816Hs.8982Homo sapiens, clone 105113 IMAGE:3506202, mRNA, 105196 W84893 Hs.9305angiotensin receptor-like 105263 AW388633Hs.6682solute carrierfamily 105263 7, (cationic amino 105330 AW338625Hs.22120ESTs 105492 AI805717Hs.289112CGI-43 protein 105594 AB024334Hs.25001tyrosine 3-monooxygenaseltryptophan 105594 5-mo 105732 AW504170Hs.274344hypothetical protein 105882 W46802 Hs.81988disabled (Drosophila) 105882 homolog 2 (mitogen 106031 X64116 Hs.171844Homo Sapiens cDNA:
106031 FLJ22296 fis, clone H

106222 AA356392Hs.21321Homo Sapiens clone 106222 FLB9213 PR02474 mRNA, 2S 106263 W21493 Hs.28329hypothetical protein 106366 AA186715Hs.336429RIKEN cDNA 9130422N19 106366 gene 106634 W25491 Hs.288909hypothetical protein 106793 H94997 Hs.16450ESTs 106842 AF124251Hs.26054novel SH2-containing 106842 protein 3 30 106890 AA489245Hs.88500mitogen-activated 106890 protein kinase 8 inter 106974 AI817130Hs.9195Homo Sapiens cDNA
106974 FLJ13698 fis, clone PL

107061 BE147611Hs.6354stromal cell derived 107061 factor receptor 1 107216 D51069 Hs.211579melanoma cell adhesion 107216 molecule 107444 W28391 Hs.343258proliferation-associated 107444 2G4, 38kD

3 108507 AI554545Hs.68301ESTs $ 108507 108931 AA147186 gb:zo38d01.s1 Stratagene 108931 endothelial cel 109195 AF047033Hs.132904solute carrier family 109195 4, sodium bicarbon 109456 AW956580Hs.42699ESTs 110411 AW001579Hs.9645Homo sapiens mRNA
110411 for KIAA1741 protein, 110906 AA035211Hs.17404ESTs 111091 AA300067Hs.33032hypothetical protein 111091 DKFZp434N185 111378 AW160993Hs.326292hypothetical gene 111378 DKFZp434A1114 111769 AW629414Hs.24230ESTs 112951 AA307634Hs.6650vacuolar protein sorting 112951 45B (yeast homo 4S 113195 H83265 Hs.8881ESTs, Weakly similar 113195 to S41044 chromosom 113542 H43374 Hs.7890Homo sapiens mRNA
113542 for KIAA1671 protein, 113847 NM 005032Hs.4114plastin 3 (T isoform) 113947 W84768 gb:zh53d03.s1 Soares-fetal 113947 liver_spleen_ 115061 AI751438Hs.41271Homo Sapiens mRNA
115061 full length.insert cDN

5~ ~ 115870 NM_005985Hs.48029snail 1 (drosophila 115870 homology, zinc finge 116228 AI767947Hs.50841ESTs 116314 AI799104Hs.178705Homo sapiens cDNA
116314 FLJ11333 fis, clone PL

117023 AW070211Hs.102415Homo sapiens mRNA;
117023 cDNA DKFZp586N0121 (f 117156 W73853 ESTs $ 117280 M18217 Hs.172129Homo Sapiens cDNA:
$ 117280 FLJ21409 fis, clone C

119866 AA496205Hs.193700Homo sapiens mRNA;
119866 cDNA DKFZp58610324 (f 121314 W07343 Hs.182538phospholipid scramblase 121822 AI743860 metallothionein 1E
121822 (functional) 122331 AL133437Hs.110771Homo Sapiens cDNA:
122331 FLJ21904 fis, clone H

123160 AA488687Hs.284235ESTs, Weakly similar 123160 to 138022 hypotheti 124059 BE387335Hs.283713ESTs, Weakly similar 124059 to S64054 hypotheti 124358 AW070211Hs.102415Homo sapiens mRNA;
124358 cDNA DKFZp586N0121 (f 124726 NM-003654Hs.104576carbohydrate (keratan 124726 sulfate Gal-6) sul 125167 AL137540Hs.102541netrin 4 65 125307125307AW580945Hs.330466ESTs 107985 T40064 Hs.71968Homo Sapiens mRNA;
107985 cDNA DKFZp564F053 (fr 125598 T40064 Hs.71968Homo sapiens mRNA;
125598 cDNA DKFZp564F053 (fr 413731 BE243845Hs.75511connective tissue 413731 growth factor 116024 AA088767Hs.83883transmembrane, prostate 116024 androgen induced 418000 AA932794Hs.83147guanine nucleotide 418000 binding protein-like 126399 AA088767Hs.83883transmembrane, prostate 126399 androgen induced 127566 A1051390Hs.116731ESTs 128453 X02761 Hs.287820fibronectin 1 128515 BE395085Hs.10086type I transmembrane 128515 protein Fn14 128623 BE076608Hs.105509CTL2 gene 128669 W28493 Hs.180414heatshock70kDprotein8 128914128914AW867491Hs.107125plasmalemma vesicle associated protein 129188129188NM_001078Hs.109225vascular cell adhesion molecule 1 129265129265AA530892Hs.171695dual specificity phosphatase 129468129468AW410538Hs.111779secreted protein, acidic, cysteine-rich $ 101838101838BE243845Hs.75511connective tissue growth factor 129619129619AA209534Hs.284243tetraspan NET-6 protein 129762129762AA453694Hs.12372tripartite motif protein 130018130018AA353093 metallothionein 1L

130178130178020982Hs.1516insulin-like growth factor-binding prote 1 130431130431AW505214Hs.155560calnexsn ~

130553130553AF062649Hs.252587pituitary tumor-transforming 130639130639AI557212Hs.17132ESTs, Moderately similar to 154374 gene 130686130686BE548267Hs.337986Homo Sapiens cDNA
FLJ10934 fis, clone OV

130818130818AW190920Hs.19928hypothetical protein 1$ 130899130899A1077288Hs.296323seromlglucocorticoid regulated ksnase 131080131080NM-001955Hs.2271endothelin 1 131091131091AJ271216Hs.22880dipeptidylpeptidase III

131182131182AI824144Hs.23912ESTs 131319131319NM-003155Hs.25590stanniocalcin 1 131328131328AW939251Hs.25647v-fos FBJ murine osteosarcoma viral onco 131328131328AW939251Hs.25647v-fos FBJ murine osteosarcoma viral onco 131555131555T47364Hs.278613interferon, alpha-inducible protein 27 131573131573AA040311Hs.28959ESTs 131756131756AA443966Hs.31595ESTs 2$ 131909131909NM_016558Hs.274411SCAN domain-containing 132046132046AI359214Hs.179260chromosome 14 open reading frame 4 132151132151BE379499Hs.173705Homo Sapiens cDNA:
FLJ22050 fis, clone H

132187132187AA235709Hs.4193DKFZP58601624 protein 132314132314AF112222Hs.323806pinsn, desmosome associated protein 3 132398132398AA876616Hs.16979ESTs, Weakly similar ~ to A43932 mucin 2 p 132490132490NM-001290Hs.4980LIM domain binding 132546132546M24283Hs.168383intercellular adhesion molecule 1 (CD54) 132716132716BE379595Hs.283738casein kinase 1, alpha 132883132883AA373314Hs.5897Homo Sapiens mRNA;
cDNA DKFZp586P1622 (f 3 132989132989AA480074Hs.331328hypothetical protein $ FLJ13213 133071133071BE384932Hs.64313ESTs, Weakly similar to AF2571821 G-pro 133099133099W16518Hs.279518amyloid beta (A4) precursor-like protein 133149133149AA370045Hs.6607AXIN1 up-regulated 133200133200AB037715Hs.183639hypothetical protein 133260133260AA403045Hs.6906Homo Sapiens cDNA:
FLJ23197 fis, clone R

133349133349AW631255Hs.8110L-3-hydroxyacyl-Coenryme A dehydrogenase 133398133398NM_000499Hs.72912cytochrome P450, subfamily I (aromatic c 133454133454BE547647Hs.177781hypothetical protein 133491133491BE619053Hs.170001eukaryotic translation initiation factor 4$ 133517133517NN~000165Hs.74471gap junction protein, alpha 1, 43kD (con 133538133538NM-003257Hs.74614tsghtjunctson protein 1 (zona occludens 133584133584D90209Hs.181243activating transcription factor 4 (tax-r 133617133617BE244334Hs.75249ADP-ribosylation factor-like 6 interacts 133671133671AW503116Hs.301819zinc finger protein $ 133681133681AI352558 tyrosine 3-monooxygenaseltryptophan ~ 5-mo 1337301337308E242779Hs.179526upregulated by 1,25-dihydroxyvitamin 133802133802AW239400Hs.76297G protein-coupled receptor kinase 6 133838133838BE222494Hs.180919inhibitor of DNA binding 2, dominant neg 133889133889048959Hs.211582myosin, light polypeptide kinase $ 133975133975C18356Hs.295944tissue factor pathway $ inhibitor 2 134039134039NN1-002290Hs.78672laminin, alpha 4 134081134081AL034349Hs.79005protein tyrosine phosphatase, receptor t 134203134203AA161219Hs.799diphtheria toxin receptor (heparin-binds 134299134299AW580939Hs.97199complement componentC1qreceptor 6Q 134339134339870429Hs.81988disabled (Drosophila) homolog 2 (mitogen 134381134381AI557280Hs.184270capping protein (actin filament) muscle 134416134416X68264Hs.211579melanoma cell adhesion molecule 134558134558NM-001773Hs.85289CD34 antigen 134983134983D28235Hs.196384prostaglandin-endoperoxide synthase 2 (p 6$ 135052135052AL136653Hs.93675decidual protein induced by progesterone 135069135069AA876372Hs.93961Homo sapiens mRNA;
cDNA DKFZp667D095 (fr 135073135073W55956Hs.94030Homo Sapiens mRNA;
cDNA DKFZp586E1624 (f 135196135196C03577Hs.9615myosin regulatory light chain 2, smooth 134404134404AB000450Hs.82771vaccsnia related kinase 100082100082AA130080Hs.4295proteasome (prosome, macropain) 268 subu 130150130150BE094848Hs.15113homogentisate 1,2-dioxygenase (homogenti 130839130839AB011169Hs.20141similar to S. cerevissae 100113100113NM_001269Hs.84746chromosome condensation 100129100129AA469369Hs.5831tissue inhibitor of metalloproteinase 7$ 100169100169AL037228Hs.82043D123geneproduct 100190100190M91401Hs.178658RAD23 (S. cerevisiae) homolog B

100211100211026528 Hs.123058DEADIH (Asp-Glu-Ala-AspIHis) box polypep 130283130283NM 012288Hs.153954TRAM-like protein 100248100248NM_015156Hs.78398KIAA0071 protein 100262100262038500 Hs.278468postmeiotic segregation increased 2-like $ 100281100281AF091035Hs.184627KIAA0118 protein 100327100327055640 gb:Human monocyte PABL (pseudoautosomal 134495134495063477 Hs.84087KIAA0143 protein 135152135152M96954 Hs.182741TIA1 cytotoxic granule-associated RNA-bi 100372100372NM 014791Hs.184339KIAA0175 gene product 1 100394100394084284 Hs.66052CD38 antigen (p45) ~

100418100418086978 Hs.84790KIAA0225 protein 134347134347AF164142Hs.82042solute camer family 23 (nucleobase tra 100438100438AA013051Hs,91417topoisomerase (DNA) II binding protein 100481100481X70377 Hs.121489cystatin D

1$ 100591100591NM-004091Hs.231444Homo sapiens, Similar to hypothetical pr 100662100662AI368680Hs.816SRY (sex determining region Y)-box 2 100905100905L12260 Hs.172816neuregulin 1 100950100950AF128542Hs.166846polymerase (DNA directed), epsilon 135407135407J04029 Hs.99936keratin 10 (epidermolytic hyperkeratosis 20 131877131877J04088 Hs.156346topoisomerase (DNA) II alpha (170k0) 134786134786T29618 Hs.89640TEK tyrosine kinase, endothelial (venous 134078134078L08895 Hs.78995MADS box transcription enhancer factor 134849134849BE409525Hs.902neurofibromin 2 (bilateral acoustic neur 101152101152AI984625Hs.9884spindle pole body protein ~$ 131687131687BE297635Hs.3069heat shock 70k0 protein 9B (mortalin-2) 421155421155H87879 Hs.102267lysyl oxidase 133975133975C18356 Hs.295944tissue factor pathway inhibitor 2 130155130155AA101043Hs.151254kallikrein 7 (chymotryptic, stratum com 132813132813BE313625Hs.57435solute carrier family 11 (proton-coupled 101300101300BE535511 transmembrane trafficking protein 130344130344AW250122Hs.154879DiGeorge syndrome critical region gene D

101381101381AW675039Hs.1227aminolevulinate, delta-, dehydratase 133780133780AA557660Hs.76152decorin 101447101447M21305 gb:Human alpha satellite and satellite 3 3 101470101470NM 000546Hs.1846tumor protein p53 $ (Li-Fraumeni syndrome) 101478101478NM 002890Hs.758RAS p21 protein activator (GTPase activa 133519133519AW583062Hs.74502chymotrypsinogen 134116134116884694 Hs.79194cAMP responsive element binding protein 130174130174M29551 Hs.151531protein phosphatase 3 (formerly 2B), cat 40 132983132983M30269 nidogen (enactin) 101543101543M31166 Hs.2050pentaxin-related gene, rapidly induced b 101620101620S55271 Hs.247930Epsilon , IgE

133595133595AA393273Hs.75133transcription factor 6-like 1 (mitochond 101700101700090337 Hs.247916natriuretic peptide precursor C

4$ 134246134246028459 Hs.80612ubiquitin-conjugating enzyme E2A (8A06 h 133948133948X59960 Hs.77813sphingomyefin phosphodiesterase 1, acid 133948133948X59960 Hs.77813sphingomyelin phosphodiesterase 1, acid 133948133948X59960 Hs.77813sphingomyelin phosphodiesterase 1, acid 101812101812BE439894Hs.78991DNA segment, numerous copies, expressed $0 133396133396M96326 Hs.72885azurocidin 1 (caticnic antimicrobial pro 129026129026AL120297Hs.108043Friend leukemia virus integration 1 134831134831AA853479Hs.89890pyruvate carboxylase 134395134395AA456539Hs.8262lysosomal 101977101977AF112213Hs.184062putative RabS-interacting protein $ 101998101998001212 Hs.248153olfactory marker $ protein 102007102007002556 Hs.75307t-complex-associated-testis-expressed 416658416658003272 Hs.79432fibrillin 2 (congenital contractural ara 135389135389005237 Hs.99872fetal Alzheimer antigen 130145130145034820 Hs.151051mitogen-activated, protein kinase 10 420269420269072937 Hs.96264alpha thalassemialmental retardation syn 102123102123NM_001809Hs.1594centromere protein A (17k0) 102133102133AU076845Hs.155596BCL2ladenovirus E1B
19kD-interacting pro 102162102162AA450274Hs.1592CDC16 (cell division cycle 16, S. cerevi 427653427653AA159001Hs.180069nuclear respiratory factor 1 6$ 102200102200AA232362Hs.157205branched chain aminotransferase 1, cytos 102214102214023752 Hs.32964SRY (sex determining region Y)-box 11 131319131319NM-003155Hs.25590stanniocalcin 1 132316132316028831 Hs.44566KIAA1641 protein 134365134365AA568906Hs.82240syntaxin 3A

102298102298AA382169Hs.54483N-myc (and STAT) interactor 302344302344BE303044Hs.192023eukaryotic translation initiation factor 102367102367039656 Hs.118825mitogen-activated protein kinase kinase 102394102394NM 003816Hs.2442a disintegrin and metalloproteinase doma 129521129521AF071076Hs.112255nucleoporin 98k0 ~$ 102251102251NIVL004398Hs.41706DEADIH (Asp-Glu-Ala-AspIHis) box polypep 133746133746AW410035Hs.75862MAD (mothers against decapentaplegic, Dr 132828132828AB014615Hs.57710fibroblast growth factor 8 (androgen-ind 132828132828AB014615Hs.57710fibroblast growth factor 8 (androgen-ind 130441130441063630 Hs.155637protein kinase, DNA-activated, catalytic 129350129350050535 Hs.110630Human BRCA2 region, mRNA sequence CG006 $ 130457130457AB014595Hs.155976cullin 4B

102560102560897457 Hs.63984cadherin 13, H-cadherin (heart) 134305134305061397 Hs.81424ubiquitin-like 1 (sentrin) 132736132736AW081883Hs.211578Homo sapiens cDNA:
FLJ23037 fis, clone L

102663102663NM_002270Hs.168075karyopherin (importin) beta 2 102735102735AF111106Hs.3382protein phosphatase 4, regulatory subuni 101175101175082671 Hs.36980melanoma antigen, family A, 2 132164132164AI752235Hs.41270procollagen-lysine, 2-oxoglutarate 5-die 102826102826NM-007274Hs.8679cytosolic acyl ccenryme A thioester hydr 102846102846BE264974Hs.6566thyroid hormone receptor interactor 13 134161134161AA634543Hs.79440IGF-II mRNA-binding protein 3 302363302363AW163799Hs.1983652,3-bisphosphoglycerate mutase 125701125701T72104 Hs.93194apolipoprotein A-I

134656134656AI750878Hs.87409thrombospondin 1 102968102968AU076611Hs.154672methylene tetrahydrofolate dehydrogenase 134037134037AI808780Hs.227730integrin, alpha 6 103023103023AW500470Hs.117950multifunctional polypeptide similar to S

130282130282BE245380Hs.1539525' nucleotidase (CD73) 128568128568H12912 Hs.274691adenylate kinase 3 103093103093S79876 Hs.44926dipeptidylpeptidase IV (CD26, adenosine 2$ 129063129063X63094 Hs.283822Rhesus blood group, D antigen 133227133227AW977263Hs.68257general transcription factor IIF; polype 103184103184043143 Hs.74049fms-related tyrosine kinase 4 103208103208AW411340Hs.31314retinoblastoma-binding protein 7 131486131486F06972 Hs.27372BMX non-receptor tyrosine kinase 103334103334NM 001260Hs.25283cyclin-dependent kinase 135094135094NM 003304Hs.250687transient receptor potential channel 103352103352H09366 Hs.78853uracil-DNA glycosylase 132173132173X89426 Hs.41716endothelial cell-specific molecule 1 131584131584AA598509Hs.29117purine-rich element binding protein A

3S 103378103378AL119690Hs.153618HCGVIII-1 protein 103410103410AA158294Hs.295362DR1-associated protein 1 (negative cofac 103438103438AW175781Hs.152720M-phase phosphoprotein 103452103452NM-006936Hs.85119SMT3 (suppresser of mif two 3, yeast) ho 135185135185AW404908Hs.96038Ric (Drosophila)-like, expressed in many 134662134662NM-007048Hs.284283butyrophilin, subfamily 3, memberA1 103500103500AW408009Hs.22580alkylglycerone phosphate synthase 132084132084NM-002267Hs.3886karyopherin alpha 3 (impor6n alpha 4) 133152133152211695 Hs.324473mitogen-activated protein kinase 1 103612103612BE336654Hs.70937H3 histone family, member A

4$ 103692103692AW137912Hs.227583Homo Sapiens chromosome X map Xp11.23 L-129796129796BE218319Hs.5807GTPase Rabl4 132683132683BE264633Hs.143638WD repeat domain 4 103723103723BE274312Hs.214783Homo sapiens cDNA
FLJ14041 fis, clone HE

133260133260AA403045Hs.6906Homo Sapiens cDNA:
FLJ23197 tis, clone R

S~ 103766103766AI920783Hs.191435ESTs 132051132051AA393968Hs.180145HSPC030 protein 135289135289AW372569Hs.9788hypothetical protein MGC10924 similar to 103794103794AF244135Hs.30670hepatocellular carcinoma-associated anti 134319134319BE304999Hs.285754fumarate hydratase 5 119159119159AF142419Hs.15020homolog of mouse quaking 5 QKI (KH domain 103850103850AA187101Hs.213194hypothetical protein 322026322026AW024973Hs.283675NPD009 protein 103861103861AA206236Hs.4944hypothetical protein 447735447735AA775268Hs.6127Homo Sapiens cDNA:
FLJ23020 fis, clone L

131236131236AF043117Hs.24594ubiquitination factor E4B (homologous to 129013129013AA371156Hs.107942DKFZP564M112 protein 103988103988AA314389Hs.342849ADP-ribosylation factor-like 425284425284AF155568Hs.348043NS1-associated protein 133281133281AK001601Hs.69594high-mobility group 65 108154108154NM_005754Hs.220689Ras-GTPase-activating protein SH3-domain 135073135073W55956 Hs.94030Homo Sapiens mRNA;
cDNA DKFZp586E1624 (f 129593129593AI338247Hs.98314Homo sapiens mRNA;
cDNA DKFZp586L0120 (f 132064132064AA121098Hs.3838serum-inducible kinase 131427131427AF151879Hs.26706CGI-121 protein 104282104282C14448 Hs.332338EST

130443130443D25216 Hs.155650KIAA0014 gene product 132837132837AA370362Hs.57958EGF-TM7-latrophilin-related protein 104334104334D82614 Hs.78771phosphoglycerate kinase 134731134731D89377 Hs.89404msh (Drosophila) homeo box homolog 2 7S 131670131670H03514 Hs.15589ESTs 104402104402H56731 Hs.132956ESTs 129077129077N74724 Hs.108479ESTs 134927134927L36531 Hs.91296integrin, alpha 8 134498134498AW246273Hs.84131threonyl-tRNA synthetase 104488104488N56191 Hs.106511protocadherin 17 $ 129214129214AL044335Hs.109526zinc finger protein 104530104530AK001676Hs.12457hypothetical protein 104544104544A1091173Hs.222362ESTs, Weakly similar to p40 [H.sapiens]

104567104567AA040620Hs.5672hypothetical protein 129575129575F08282 Hs.278428progestin induced protein 1 104599104599AW815036Hs.151251ESTs ~

104667104667AI239923Hs.63931ESTs 104764104764A1039243Hs.278585ESTs 104787104787AA027317 gb:ze97d11.s1 Soares feta~,hear~NbHH19W

104804104804AI858702Hs.31803ESTs, Weakly similar to N-WASP [H.sapien 1$ 130828130828AW631469Hs.203213ESTs 104943104943AF072873Hs.114218frizzled (Drosophila) homolog 6 105024105024AA126311Hs.9879ESTs 105038105038AW503733Hs.9414KIAA1488 protein 105096105096AL042506Hs.21599Kruppel-like factor 7 (ubiquitous) 2~ 105169105169BE245294Hs.180789S164 protein 130401130401BE396283Hs.173987eukaryotic translation initiation factor 130114130114AA233393Hs.14992hypothetical protein 105337105337AI468789Hs.347187myotubularin related protein 1 105376105376AW994032Hs.8768hypothetical protein 2$ 131962131962AK000046Hs.343877hypothetical protein 128658128658BE397354Hs.324830diptheria toxin resistance protein requi 105508105508AA173942Hs.326416Homo Sapiens mRNA;
cDNA DKFZp564H1916 (f 135172135172AB028956Hs.12144KIAA1033 protein 132542132542AL137751Hs.263671Homo Sapiens mRNA;
cDNA DKFZp43410812 (f 105659105659AA283044Hs.25625hypcthetical protein 105674105674AI609530Hs.279789histone deacetylase 105722105722AI922821Hs.32433ESTs 115951115951BE546245Hs.301048sec13-like protein 105985105985AA406610 gb:zv15b10.s1 Soares NhHMPu-S1 Homo sapi 3 131216131216AI815486Hs.243901Homo Sapiens cDNA
$ FLJ20738 fis, clone HE

113689113689AB037850Hs.16621DKFZP4341116 protein 130839130839A8011169Hs.20141similar to S. cerevisiae 130777130777AW135049Hs.26285Homo sapiens cDNA
FLJ10643 fis, clone NT

106196106196AA525993Hs.173699ESTs, Weakly similar to ALU1 HUMAN ALU
S

4~ 133200133200AB037715Hs.183639hypothetical protein 106328106328AL079559Hs.28020KIAA0766 gene product 106423106423A8020722Hs.16714Rho guanine exchange factor (GEF) 15 439608439608AW864696Hs.301732hypothetical protein 106503106503AB033042Hs.29679cofactor required for Sp1 transcriptiona 4$ 106543106543AA676939Hs.69285neuropilin 1 106589106589AK000933Hs.28661Homo sapiens cDNA
FLJ10071 fis, clone HE

106596106596AA452379 ESTs, Moderately similar to ALU7_HUMAN
A

106636106636AW958037Hs.286ribosomal protein 131353131353AW754182 gb:RC2-CT0321-131199-011-c01 CT0321 Homc $0 131710131710NM 015368Hs.30985pannexin 1 131775131775A8014548Hs.31921KIAA0648 protein 106773106773AA478109Hs.188833ESTs 106817106817D61216 Hs.18672ESTs 106848106848AA449014Hs.121025chromosome 11 open reading frame 5 $ 418699418699BE539639Hs.173030ESTs, Weakly similar $ to ALU8_HUMAN ALU
S

130638130638AW021276Hs.17121ESTs 107059107059BE614410Hs.23044RAD51 (S. cerevisiae) homolog (E coli Re 107115107115BE379623Hs.27693peptidylprolyl isomerase (cyclophilin)-I

107156107156AA137043Hs.9663programmed cell death 6-interacting prot 60 130621130621AW513087Hs.16803LUC7 (S. cerevisiae)-like 132626132626AW504732Hs.21275hypothetical protein 131610131610AA357879Hs.29423scavenger receptorwith C-type lec6n 107295107295AA186629Hs.80120UDP-N-acetyl-alpha-D-galactosamine:polyp 107315107315AA316241Hs.90691nucleophosminlnucleoplasmin 6$ 107328107328AW959891Hs.76591KIAA0887 protein 134715134715U48263 Hs.89040prepronociceptin 129938129938AW003668Hs.135587Human clone 23629 mRNA sequence 130074130074AL038596Hs.250745polymerase (RNA) III (DNA directed) (62k 132036132036AL157433Hs.37706hypothetical protein DKFZp434E2220 113857113857AW243158Hs.5297DKFZP564A2416 protein 130419130419AF037448Hs.155489NS1-associated protein 132616132616BE262677Hs.283558hypothetical protein 132358132358NM-003542Hs.46423H4 histone family, member G

125827125827NM-003403Hs.97496YY1 transcription factor 107609107609875654 Hs.164797hypothetical protein 107714107714AA015761Hs.60642ESTs 107832 AA021473 gb:ze66c11.s1 Soares 107832 retina N2b4HR Homo 124337 N23541 Hs.281561Homo sapiens cDNA:
124337 FLJ23582 fis, clone L

129577 N75346 Hs.306121CDC20 (cell division 129577 cycle 20, S. cerevi 132000 AW247017Hs.36978melanoma antigen, 132000 family A, 3 $ 107935 AA029428Hs.61555ESTs 131461 AA992841Hs.27263KIAA1458 protein 108029 AA040740Hs.62007ESTs 108084 AA058944Hs.116602Homo sapiens, clone 108084 IMAGE:4154008, mRNA, 108168 AI453137Hs.63176ESTs 108189 AW376061Hs.63335ESTs, Moderately 108189 similar to A46010 X-lin 108203 AW847814Hs.289005Homo sapiens cDNA:
108203 FLJ21532 fis, clone C

108217 AA058686Hs.62588ESTs 108277 AA064859 gb:zm50f03.s1 Stratagene 108277 fibroblast (937 108309 AA069818 gb:zm67e03.r1 Stratagene 108309 neuroepithelium 108340 AA069820Hs.180909peroxiredoxin 1 108427 AA076382 gb:zm91gO8.s1 Stratagene 108427 ovarian cancer 108439 AA078986 gb:zm92h01.s1 Stratagene 108439 ovarian cancer 108469 AA079487 gb:zm97f08.s1 Stratagene 108469 colon HT29 (937 108501 AA083256 gb:zn08g12.s1 Stratagene 108501 hNT neuron (937 108562 AA100796 gb:zm26c06.s1 Stratagene 108562 pancreas (93720 130890 AI907537Hs.76698stress-associated 130890 endoplasmic reticulum 130385 AW067800Hs.155223stanniocalcin 2 108807 AI652236Hs.49376hypothetical protein 108833 AF188527Hs.61661ESTs, Weakly similar 108833 to AF1746051 F-box 108846 AL117452Hs.44155DKFZP586G1517 protein 131474 L46353 Hs.2726high-mobility group 131474 (nonhistone chromoso 108941 AA148650 gb:zo09e06.s1 Stratagene 108941 neuroepithelium 108996 AW995610Hs.332436EST

131183 AI611807Hs.285107hypothetical protein 109022 AA157291Hs.21479ubinuclein 1 109068 AA164293Hs.72545ESTs 129021 AL044675Hs.173081KIAA0530 protein 109146 AA176589Hs.142078EST

131080 NM 001955Hs.2271endothelin 1 35 109222109222AA192833Hs.333512similar to ratmyomegalin 109481 AA878923Hs.289069hypothetical protein 109516 AI471639Hs.71913ESTs 109556 A1925294Hs.87385ESTs 109578 F02208 Hs.27214ESTs 109625 H29490 Hs.22697ESTs 109648 H17800 Hs.7154ESTs 109699 H18013 Hs.167483ESTs 109933 852417 Hs.20945Homo Sapiens clone 109933 24993 mRNA sequence 110039 H11938 Hs.21907histone acetyltransferase Table 2A shows the accession numbers for those pkeys lacking unigenelD's forTable 2. The pkeys in Table 7 lacking unigenelD's are represented within Tables 1-6A. For each probeset we have listed the gene cluster number from which the oligonucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs. These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubIeTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession"
column.
1 o Pkey: Unique Eos probeset identifier number CAT number; Gene cluster number Accession: Genbank accession numbers 1$ Pkey CAT Number Accession 101300 4669_1 BE535511 M62098 AA306787 AW891766 AA348998 AA338869 AA344013 AW118940 AA121666 AI832409 AA683475 AI140901 AI623576 AW51906d AW474125 125565 1704098_1 820840 820839 133681 13893_1 AI352558 282248 X78138 NM 003405 AU077248 AA223125 S80794 $ ~ AI205606 AA720684 AI872093 AW150042 AL120538 AA219627 AA988608 C21397 $ S AA491520 AW028427 AA171496 AI469689 AW664539 AI811102 AI811116 BE464590 T68873 .

107832 genbank-AA021473 AA021473 123523 genbank-AA608588 AA608588 123964 genbank_C13961 C13961 118475 genbank N66845 N66845 104787 genbanILAA027317 AA027317 106596 304084_1 A1583948 AA578212 AW303715 AA653450 AA456981 A1400385 W88533 113947 genbanILW84768W84768 75 108277 genbanILAA064859 AA064859 108427 genbank_AA076382 AA076382 108439 genbank-AA078986 AA078986 $ 101447 entrez_M21305 M21305 108931 genbanILAA147186 AA147186 108941 genbank AA148650 AA148650 103138 entrez X65965 X65965 119174 genbank_871234 871234 1 ~ 119416 genbank_T97186 T97186 105985 genbanILAA406610 AA406610 100327 entrez D55640 D55640 TABLE 3:
Pkey: Unique Eos probeset identifier number Accession: Accession number used for previous patent filings ExAccn; Exemplar Accession number, Genbank accession number UnigenelD: Unigene number Unigene Title: Unigene gene title Pkey Accession ExAccn UniGene UnigeneTitle 100405 AW291587 nidogen 2 D86425 Hs.82733 100420 D86983 Hs.118893Melanoma associated D86983 gene 100481 cystatin D

Hs.121489 100484 v-ral simian leukemia HG1103-HT1103 viral oncogene NM 005402Hs.288757 hom 100718 inhibitor of DNA
HG3342-HT3519 binding 1, dominant BE295928 neg Hs.75424 100991 J03836 Hs.82085serine (or cysteine) J03764 proteinase inhibito 101097 BE245301 chemokine (C-X-C
L06797 Hs.89414 motif), receptor 4 (fus 101168 NM 005308Hs.211569G protein-coupled L15388 receptor kinase 101194 L20971 Hs.188phosphodiesterase L20971 4B, cAMP-specific (dun 101261 D30857 Hs.82353protein C receptor, L35545 endothelial (EPCR) 101345 NM 005795Hs.152175calcitonin receptor-like 101447 M21305 gb:Human alpha satellite M21305 and satellite 3 2S 101485 AA296520 selectin E (endothelial M24736 Hs.89546 adhesion molecul 101543 M31166 Hs.2050pentaxin-related M31166 gene, rapidly induced b 101550 Y00630 Hs.75716serine (or cysteine) M31551 proteinase inhibito 101560 AW958272 intercellular adhesion M32334 Hs.347326 molecule 2 101674 NM 002291Hs.82124laminin, beta 1 101714 M68874 Hs.211587phospholipase A2, M68874 group IVA (cytosolic, 101741 NM_003199Hs.326198transcriptionfactor4 101838 BE243845 connective tissue M92934 Hs.75511 growth factor 101857 BE550723 fatty acid binding M94856 Hs.153179 protein 5 (psoriasis-102012 BE259035 singed (Drosophila)-like 003057 Hs.118400 (sea urchin fas 3 102024 AA301867 EGF-containing fibulin-like $ 003877 Hs.76224 extracellula 102164 NM 000107Hs.77602damage-specific 018300 DNA binding protein 2 (4 102241 NM-007351Hs.268107multimerin 102283 AW161552 guanine nucleotide 031384 Hs.83381 binding protein 102303 033053 Hs.2499protein kinase C-like 102564 059423 Hs.79067MAD (mothers against 059423 decapentaplegic, Dr 102663 NM_002270Hs.168075karyopherin (importin) 070322 beta 2 102759 NM 005100Hs.788A kinase (PRKA) 081607 anchor protein (gravin) 102778 AF000652 syndecan binding 083463 Hs.8180 protein (syntenin) 102804 NM 002318Hs.83354lysyl oxidase-like 102887 J03836 Hs.82085serine (or cysteine) X04729 proteinase inhibito 102898 NM 002205Hs.149609integrin, alpha X06256 5 (fibronectin receptor, 102915 X07820 Hs.2258matrix metalloproteinase X07820 10 (stromelysin 103036 M13509 Hs.83169matrix metalloproteinase X54925 1 (interstitial 103037 BE018302 placental growth X54936 Hs.2894 factor, vascular endoth $0 103095 NM 005424Hs.78824tyrosinekinasewithimmunoglobulinand 103158 BE242587 hematopoietically X67235 Hs.118651 expressed homeobox 103166 AA159248 peroxiredoxin 1 X67951 Hs.180909 103185 NM 006825Hs.74368transmembrane protein X69910 (63kD), endoplasmi 103280 084722 Hs.76206cadherin 5, type X79981 2, VE-cadherin (vascula SS 103554 AI878826 caveolin 1, caveolae 218951 Hs.74034 protein, 22kD

103850 AA187101 hypothetical protein AA187101 Hs.213194 MGC10895 104465 244203 Hs.26418ESTs 104592 AW630488 protease, serine, 881003 Hs.25338 23 104764 A1039243 ESTs AA025351 Hs.278585 60 104786 AA027167 KIAA0955 protein AA027168 Hs.10031 104850 AL133035 hypothetical protein AA040465 Hs.8728 DKFZp434G171 104865 T79340 Hs.22575B-cell CLLllymphoma AA045136 6, member B (zinc fi 104894 AF065214 phospholipase A2, AA054087 Hs.18858 group IVC (cytosolic, 104952 AW076098 desmoplakin (DPI, AA071089 Hs.345588 DPII) 65 104974 Y12059 Hs.278675bromodomain-containing 105178 AA313825 AD036 protein AA187490 Hs.21941 105263 AW388633 solute carrier family AA227926 Hs.6682 7, (cationic amino 105330 AW338625 ESTs AA234743 Hs.22120 105376 AW994032 hypothetical protein AA236559 Hs.8768 FLJ10849 70 105729 H46612 Hs.293815Homo sapiens HSPC285 AA292694 mRNA, partial cds 105826 AA478756 E3 ubiquitin ligase AA398243 Hs.194477 SMURF2 105977 AK001972 hypothetical protein AA406363 Hs.30822 FLJ11110 106008 A8033888 SRY (sex determining AA411465 Hs.8619 region Y)-box 18 106031 X64116 Hs.171844Homo sapiens cDNA:
AA412284 FLJ22296 fis, clone H

~5 106124 H93366 Hs.7567Homo Sapiens cDNA:
AA423987 FLJ21962 fis, clone H

106155 AA425309AA425414 nuclear factorIIB
Hs.33287 106302 AA435896AA398859 hypothetical protein Hs.18397 FLJ23221 106423 AA448238AB020722 Rho guanine exchange Hs.16714 factor (GEF) 15 106793 AA478778H94997 Hs.16450ESTs $ 107174 AA621714BE122762 ESTs Hs.25338 107216 D51069D51069 Hs.211579melanoma cell adhesion molecule 107295 T34527AA186629 UDP-N-acetyl-a:pha-D-galactosamine:polyp Hs.80120 107385 U97519NIv>_,005397Hs,16426podocalyxin-like 108756 AA127221AA127221 ESTs Hs.117037 108846 AA132983AL117452 DKFZP586G1517 protein Hs.44155 108888 AA135606AA135606 gb:z110a05.s1 Soares_pregnant_uterus Hs.189384 NbH

109001 AA156125A1056548 hypothetical protein Hs.72116 FLJ20992 similar to 109166 AA179845AA219691 RAB6 interacting, Hs.73625 kinesin-like (rabkines 109456 AA232645AW956580 ESTs Hs.42699 1$ 109768 F10399F06838 Hs.14763ESTs 110107 H16772AW151660 ESTs Hs.31444 110906 N39584AA035211 ESTs Hs.17404 110984 N52006AW613287 UDP-N-acetyl-alpha-D-galactosamine:polyp Hs.80120 111006 N53375BE387014 Homer, neuronal immediate Hs.166146 early gene, 3 111018 N54067AI287912 mitogen-activated Hs.3628 protein kinase kinase 111133 N64436AW580939 complement component Hs.97199 C1q receptor .

111760 826892BE551929 Homo sapiens cDNA
Hs.268754 FLJ11949 fis, clone HE

113073 T33637N39342 Hs.103042microtubule-associated protein 1B

113195 T57112H83265 Hs.8881ESTs, Weakly similar to S41044 chromosom 2$ 113923 W80763AW953484 hypothetical protein Hs.3849 FLJ22041 similar to 114521 AA046808AW139036 40S ribosomal protein Hs.108957 S27 isoform 115061 AA253217AI751438 Homo Sapiens mRNA
Hs.41271 full length insert cDN

115096 AA255991AI683069 ESTs Hs.175319 115145 AA258138AA740907 ESTs Hs.88297 115819 AA426573AA486620 endomucin-2 Hs.41135 115947 AA443793847479 Hs.94761KIAA1691 protein 116314 AA490588AI799104 Homo Sapiens cDNA
Hs.178705 FLJ11333 fis, clone PL

116339 AA496257AK000290 dipeptidyl peptidase Hs.44033 8 116430 AA609717AK001531 hypothetical protein Hs.66048 FLJ10669 3 116589 D59570AI557212 ESTs, Moderately $ Hs.17132 similar to 154374 gene 116733 F13787AL157424 synaptojanin 2 Hs.61289 117023 H88157AW070211 Homo Sapiens mRNA;
Hs.102415 cDNA DKFZp586N0121 (f 117186 H98988H98988 Hs.42612ESTs,WeaklysimilartoALU1HUMANALUS

117563 N34287AF055634 unc5 (C.elegans homology Hs.44553 c 117997 N52090N52090 Hs.47420EST

118475 N66845N66845 gb:za46c11.s1Soaresfetalliverspleen 118581 N68905N68905 gb:za69b09.s1 Soares fetal_lung-NbHL19W

119073 832894BE245360 ESTs Hs.279477 119155 861715861715 Hs.310598ESTs, Moderately similar to ALU1 HUMAN A

4$ 119174 871234871234 gb:yi54c08.s1 Soares placenta Nb2HP Homo 119221 898105C14322 Hs.250700tryptase beta 1 119416 T97186T97186 gb:ye50h09.s1 Soares fetal liver spleen 119866 W80814AA496205 Homo Sapiens mRNA;
Hs.193700 cDNA DKFZp58610324 (f 121335 AA404418AA404418 gb:zw37e02.s1 Soares total-fetus-Nb2HF8-$~ 121381 AA405747AW088642 hypothetical protein Hs.97984 FLJ22252 similar to 123160 AA488687AA488687 ESTs, Weakly similar Hs.284235 to 138022 hypotheti 123473 AA599143AA599143 gb:ae52d04.s1 Stratagene lung carcinoma 123523 AA608588AA608588 gb:ae54e06.s1 Stratagene lung carcinoma 123533 AA608751AA608751 gb:ae56h07.s1 Stratagene lung carcinoma $$ 123964 C13961C13961 gb:C13961 Clontech human aorta polyA+mR

124006 D60302AI147155 ESTs Hs.270016 124315 H94892NM_005402Hs.288757v-ral simian leukemia viral oncogene hom 124659 N93521AI680737 Homo Sapiens cDNA
Hs.289068 FLJ11918 fis, clone HE

124669 N95477AI571594 hypothetical protein Hs.102943 MGC12916 60 124847 860044W07701 Hs.304177Homo Sapiens clone mRNA, 124875 870506AIS87664 sprouty (Drosophila) Hs.285814 homolog 4 125091 T91518T91518 gb:ye20f05.s1 Stratagene lung (937210) H

125103 T95333AA570056 ESTs, Moderately Hs.122730 similarto KIAA1215 pro 125355 845630860547 Hs.170098KIAA0372 gene product 6$ 125565 820839820840 gb:yg05c08.r1 Soares infant brain 1NIB
H

125590 . 823858 Hs.143375Homo sapiens, clone 823858 IMAGE:3840937, mRNA, 126511 A1024874T92143 Hs.57958EGF-TM7-latrophilin-related protein 126563 W26247AA516391 U5 snRNP-specific Hs.181368 protein (220 kD), orth 126649 AA856990AA001860 ESTs Hs.279531 70 126872 AA136653AW450979 gb:Ul-H-B13-ala-a-12-0-ULs1 NCI_CGAP Su 127402 AA358869AA358869 SEC13 (S. cerevisiae)-like Hs.227949 1 127651 AI123976AA382523 MSTP031 protein Hs.105689 127759 AI369384AI369384 ESTs Hs.292441 128062 AA379500AA379621 neural proliferation, Hs.105547 differentiation an ~$ 128992 849693H04150 Hs.107708ESTs 129046 AA195678AB029290 actin binding protein;
Hs.108258 macrophin (microf 129188M30257 NM-001078Hs.109225 vascular cell adhesion molecule 1 129314AA028131BE622768Hs.290356mesoderm development candidate 1 129371M10321 X06828Hs.110802von Willebrand factor 129468J03040 AW410538Hs.111779secreted protein, acidic, cysteine-rich $ 129765M86933 M86933Hs.1238amelogenin (Y chromosome) 129805AA012933AA012848Hs.12570tubulin-specific chaperone d 129884AA286710AF055581Hs.13131lysosomal 130495AA243278AW250380Hs.109059mitochondria) ribosomal protein L12 130639D59711 A1557212Hs.17132ESTs, Moderately similar to 154374 gene 1 130657T94452 AW337575Hs.201591ESTs ~

130828AA053400AW631469Hs.203213ESTs 130972AA370302D81866Hs.21739Homo sapiens mRNA;
cDNA DKFZp58611518 (f 131080J05008 NM endothelin 1 001955Hs.2271 131137085193 W27392Hs.33287nuclear factor IIB

1 131182AA256153AI824144Hs.23912ESTs $

131486X83107 F06972Hs.27372BMX non-receptor tyrosine kinase 131573AA046593AA040311Hs.28959ESTs 131647AA410480AA359615Hs.30089ESTs 131756D45304 AA443966Hs.31595ESTs 20 131859M90657 AW960564 transmembrane 4 superfamily member 1 131881AA010163AW361018Hs.3383upstream regulatory element binding prot 132050AA136353AI267615Hs.38022ESTs 132083Y07867 BE386490Hs.279663Pirin 132164084573 AI752235Hs.41270procollagen-lysine, 2-oxoglutarate 5-dio 25 132358X60486 NM H4 histone family, 003542Hs.46423 member G

132413AA132969AW361383Hs.260116metalloprotease 1 (pitrilysin family) 132456AA114250AB011084Hs.48924KIAA0512 gene product;

132490F1378 2 LIM domain binding 001290Hs.4980 132676AA283035N92589Hs.261038ESTs, Weakly similar to 138022 hypotheti 132687AB002301AB002301Hs.54985KIAA0303 protein 132718AA056731NM_004600Hs.554 Sjogren syndrome antigen A2 (60kD, ribon 132736068019 AW081883Hs.211578Homo sapiens cDNA;
FLJ23037 fis, clone L

132760H99198 AA125985Hs.56145thymosin, beta, identified in neuroblast 132933AA598702BE263252Hs.6101hypothetical protein 3S 132968N77151 AF234532Hs.61638myosinX

132994AA505133AA112748Hs.279905clone H00310 PR00310p1 133061AB000584AI186431Hs.296638prostate differentiation factor 133147D12763 AA026533Hs.66 interleukin 1 receptor-like 133161AA253193AW021103Hs.6631hypothetical protein 133200AA432248AB037715Hs.183639hypothetical protein 133260AA083572AA403045Hs.6906Homo sapiens cDNA;
FLJ23197 fis, clone R

133363AA479713AI866286Hs.71962ESTs, Weakly similar to 836298 proline-r 133491L40395 BE619053Hs.170001eukaryotic translation initiation factor 133517X52947 NM gap junction protein, 000165Hs.74471 alpha 1, 43kD (con 4$ 133550W80846 - Hs.74669vesicle-associated AI129903 membrane protein 5 (m 133607M34539 BE273749 FK506-binding protein 1A (12kD) 133614D67029 NM SEC14 (S. cerevisiae)-like ~ 003003Hs.75232 1 133627009587 NM-002047Hs.75280 glycyl-tRNA synthetase 133691M85289 M85289Hs.211573heparan sulfate proteoglycan 2 (perlecan 5~ 133696D10522 AI878921Hs.75607myristoylated alanine-rich protein kinas 133913W84712 AU076964Hs.7753calumenin 133975D29992 C18356Hs.295944tissue factor pathway inhibitor 2 133985L34657 L34657Hs.78146plateletlendothelial cell adhesion molec 134039S78569 NM laminin, alpha 4 002290Hs.78672 55 134088D43636 AI379954Hs.79025KIAA0096 protein 134161097188 AA634543Hs.79440IGF-II mRNA-binding protein 3 134299AA487558AW580939Hs.97199complement component C1q receptor 134416M28882 X68264Hs.211579melanoma cell adhesion molecule 134453X70683 A1272141Hs.83484SRY (sex determining region Y)-box 4 6Q 134656X14787 AI750878Hs.87409thrombospondin 1 134989AA236324AW968058Hs.92381nudix (nucleoside diphosphate linked moi 135051C15324 AI272141Hs.83484SRY (sex determining region Y)-box 4 135073AA452000W55956Hs.94030Homo sapiens mRNA;
cDNA DKFZp586E1624 (f 135349D83174 AA114212Hs.9930serine (or cysteine) proteinase inhibito 65 100114D00596 X02308Hs.82962thymidylate synthetase 100130D11428 NM Hs.103724peripheral myelin 000304 protein 22 100143D13640 AU076465Hs.278441KIAA0015 gene product 100168D14874 H73444Hs.394adrenomedullin 100208D26129 NM Hs.78224ribonuclease, RNase 002933 A family,1 (pancrea 100224D28476 AL121516Hs.138617thyroid hormone receptor interactor 12 100405D86425 AW291587Hs.82733nidogen 2 100420D86983 D86983Hs.118893Melanoma associated gene 100455D87953 AW888941Hs.75789N-myc downstream regulated 100529HG1862-HT1897BE313693Hs.334330calmodulin 2 (phosphorylase kinase, delt 100618HG2614-HT2710AI752163Hs.114599collagen, type VIII, alpha 1 100619HG2639-HT2735N24433Hs.241567RNA binding motif, single stranded inter 100658HG2855-HT2995056725Hs.180414heat shock 70kD protein 100676HG3044-HT3742X02761Hs.287820fibronectin 1 100718HG3342-HT3519BE295928Hs.75424inhibitor of DNA
binding 1, dominant neg 100752HG3543-HT3739T81309 insulin-like growth factor 2 (somatomedi 100828HG4069-HT4339AL048753Hs.303649small inducible cytokine A2 (monocyte ch 100850HG417-HT417AA836472Hs.297939cathepsin B

100991J03764 J03836Hs.82085serine (or cysteine) proteinase inhibito 101097L06797 BE245301Hs.89414chemokine (C-X-C
motif), receptor 4 (fus 101110L08246 AI439011Hs.86386myeloid cell leukemia sequence 1 (BCL2-r 1 101142L12711 L12711Hs.89643transketolase (Wemicke-Korsakoff ~ syndro 101156L13977 AA340987Hs.75693prolylcarboxypeptidase (angiotensinase C

101168L15388 NM-005308Hs.211569 G protein-coupled receptor kinase 101184L19871 NM_001674Hs.460 activating transcription factor 3 101192L20859 BE247295Hs.78452solute carrier family 20 (phosphate tran 101317L42176 L42176Hs.8302four and a half LIM
domains 2 101336L49169 NM-006732Hs.75678 FBJ murine osteosarcoma viral oncogene h 101345L76380 NM-005795Hs.152175 calcitonin receptor-like 101400M15990 M15990Hs.194148v-yes-1 Yamaguchi sarcoma viral oncogene 101475M23254 BE410405Hs.76288calpain 2, (mill) large subunit 2~ 101485M24736 AA296520Hs.89546selec6n E (endothelial adhesion molecul 101496M26576 X12784Hs.119129collagen, type IV, alpha 1 101505M27396 AA307680Hs.75692asparagine synthetase 101543M31166 M31166Hs.2050pentaxin-related gene, rapidly induced b 101557M31994 BE293116Hs.76392aldehyde dehydrogenase 1 family, member 2S 101560M32334 AW958272Hs.347326intercellular adhesion molecule 2 101587M35878 AI752416Hs.77326insulin-like growth factor binding prote 101592M36429 AF064853Hs.91299guanine nucleotide binding protein (G pr 101633M57730 NM-004428Hs.1624 ephrin-A1 101634M57731 AV650262Hs.75765GR02 oncogene 30 101667M60858 NM_005381 nucleolin 101682M62994 AF043045Hs.81008filamin B, beta (actin-binding protein-2 101714M68874 M68874Hs.211587phospholipase A2, group IVA (cytosolic, 101720M69043 M69043Hs.81328nuclear factor of kappa light polypeptid 101741M74719 NM_003199Hs.326198 transcriptionfactor4 35 101744M75126 AI879352Hs.118625hexokinase 1 101793M84349 W01076Hs.278573CD59 antigen p18-20 (antigen identified 101837M92843 M92843Hs.343586zinc finger protein homologous to Zfp36 101838M92934 BE243845Hs.75511connective tissue growth factor 101840M93056 AA236291Hs.183583serine (or cysteine) proteinase inhibito 101857M94856 BE550723Hs.153179fatty acid binding protein 5 (psoriasis-101864M95787 BE392588Hs.75777transgelin 101931S76965 NM_006823Hs.75209 protein kinase (CAMP-dependent, catalyti 101966S81914 X96438Hs.76095immediate early response 102012003057 BE259035Hs.118400singed (Drosophila)-like (sea urchin fas 45 102013003100 BE616287Hs.178452catenin (cadherin-associated protein), a 102024003877 AA301867Hs.76224EGF-containing fibulin-like extracellula 102059008021 AI752666Hs.76669nicotinamide N-methyltransferase 102121014391 NNI-004998Hs.82251 myosin IE

102283031384 AW161552Hs.83381guanine nucleotide binding protein 5 102300032944 AI929721Hs.5120dynein, cytoplasmic, ~ light pdlypeptide 102378040369 AUD76887Hs.28491spermidinelspermine N1-acetyltransferase 102395041767 AU077005Hs.92208a disintegrin and metalloproteinase doma 102460048959 048959Hs.211582myosin, light polypeptide kinase 102491051010 051010 gb:Human nicotinamide N-methyltransferas 102499051478 BE243877Hs.76941ATPase, Na+IK+transporting, beta 3 poly 102523053445 053445Hs.15432downregulated in ovarian cancer 1 102560059289 897457Hs.63984cadherin 13, H-cadherin (heart) 102564059423 059423Hs.79067MAD (mothers against decapentaplegic, Dr 102589062015 AU076728Hs.8867cysteine-rich angiogenic inducer, 61 60 102600063825 AI984144Hs.66713hepatitis delta antigen-interacting prot 102645067963 AL119566Hs.6721lysosomal 102687073379 Nlv(_007019Hs.93002 ubiquitin camer protein 102693073824 AA532780Hs.183684eukaryotic translation initiation factor 102709077604 AA122237Hs.81874microsomal glutathione S-transferase 2 65 102759081607 NM_005100Hs.788 A kinase (PRKA) anchor protein (gravin) 102804089942 NM_002318Hs.83354 lysyl oxidase-like 102882X04412 AI767736Hs.290070gelsolin (amyloidosis, Finnish type) 102907X06985 BE409861Hs.202833heme oxygenase (decycling) 102915X07820 X07820Hs.2258matrix metalloproteinase 10 (stromelysin 102927X12876 BE512730Hs.65114keratin 18 102960X15729 AI904738Hs.76053DEADIH (Asp-Glu-Ala-AspIHis) box polypep 103011X52541 AJ243425Hs.326035early growth response 103020X53416 X53416Hs.195464filamin A, alpha (actin-binding protein-103029X54489 AW800726Hs.789GR01 oncogene (melanoma growth stimulati 7$ 103036X54925 M13509Hs.83169matrix metalloproteinase 1 (interstitial 103056X57206 Y18024Hs.78877inositol 1,4,5-trisphosphate 3-kinase B

103080 X59798AU077231 cyclin D1 (PRAD1:
Hs.82932 parathyroid adenomatos 103095 X60957NM_005424Hs.78824tyrosine kinase with immunoglobulin and 103138 X65965X65965 gb;H,sapiens SOD-2 gene for manganese su 103176 X69111AL021154 inhibitor of DNA binding Hs.76884 3, dominant neg $ 103195 X70940AA351647 eukaryotic translation Hs.2642 elongation factor 103347 X87838AU077309 catenin (cadherin-associated Hs.171271 protein), b 103371 X91247X91247 Hs.13046thioredoxin reductase 103432 X97748X97748 gb:H.sapiens PTX3 gene promotor region.

103471 Y00815Y00815 Hs.75216protein tyrosine phosphatase, receptor t 103967 AA303711AL120051 ephrin-B1 Hs.144700 104447 L44538AW204145 ESTs Hs.156044 104764 AA025351A1039243 ESTs Hs.278585 104783 AA027050AA533513 protein disulfide Hs.93659 isomerase related prot 104798 AA029462AW952619 Homo sapiens clone Hs.17235 TCCCIA00176 mRNA
sequ 1$ 104865 AA045136T79340 Hs.22575B-cell CLLllymphoma 6, member B (zinc fi 104877 AA047437AI138635 Homo sapiens clone Hs.22968 IMAGE:451939, mRNA
se 104894 AA054087AF065214 phospholipase A2, Hs.18858 group IVC (cytosolic, 104952 AA071089AW076098 desmoplakin (DPI, Hs.345588 DPII) 105113 AA156450AB037816 Homo sapiens, clone Hs.8982 IMAGE:3506202, mRNA, 105178 AA187490AA313825 AD036 protein Hs.21941 105196 AA195031W84893 Hs.9305angiotensin receptor-like 105215 AA205724AA205759 hypothetical protein Hs.10119 FLJ14957 105263 AA227926AW388633 solute tamer family Hs.6682 7, (cationic amino 105271 AA227986AA807881 ESTs Hs.25329 ~$ 105330 AA234743AW338625 ESTs Hs.22120 105461 AA253216BE539071 hypothetical protein Hs.69388 FLJ20505 105492 AA256210AI805717 CGI-43 protein Hs.289112 105493 AA256268AL047586 RNA binding motif Hs.10283 protein 8B

105594 AA279397A8024334 tyrosine 3-monooxygenaseltryptophan Hs.25001 5-mo 105727 AA292379AL135159 KIAA1002 protein Hs.20340 105732 AA292717AW504170 hypothetical protein Hs.274344 MGC12942 105767 AA346551AW370946 ESTs Hs.23457 105882 AA400292W46802 Hs.81988disabled (Drosophila) homolog 2 (mitogen 105936 AA404338AI678765 ESTs Hs.21812 3 106031 AA412284X64116 Hs.171844Homo Sapiens cDNA:
S FLJ22296 fis, clone H

106124 AA423987H93366 Hs.7567Homo Sapiens cDNA:
FLJ21962 fis, clone H

106222 AA428594AA356392 Homo Sapiens clone Hs.21321 FLB9213 PR02474 mRNA, 106241 AA430108BE019681 Homo sapiens cDNA:
Hs.6019 FLJ21288 fis, clone C

106263 AA431462W21493 Hs.28329hypothetical protein 106264 AA431470AL046859 protein kinase (CAMP-dependent, Hs.3407 catalyti 106366 AA443756AA186715 RIKEN cDNA 9130422N19 Hs.336429 gene 106454 AA449479NM 014038Hs.5216HSPC028 protein 106634 AA459916W25491 Hs.288909hypothetical protein 106724 AA465226N48670 Hs.28631Homo Sapiens cDNA:
FLJ22141 fis, clone H

4$ 106793 AA478778H94997 Hs.16450ESTs 106799 AA479037BE313412 Homo sapiens clone Hs.7961 25012 mRNA sequence 106842 AA482597AF124251 novel SH2-containing Hs.26054 protein 3 106868 AA487561BE185536 molecule possessing Hs.301183 ankyrin repeats indu 106890 AA489245AA489245 mitogen-activated Hs.88500 protein kinase 8 inter $~ 106961 AA504110AW243614 Homo Sapiens cDNA
Hs.18063 FLJ10768 fis, clone NT

106974 AA520989AI817130 Homo sapiens cDNA
Hs.9195 FLJ13698 fis, clone PL

107030 AA599434AL117424 chloride intracellular Hs.25035 channel 4 107061 AA608649BE147611 stromal cell derived Hs.6354 factor receptor 1 107086 AA609519NM-012331 methionine sulfoxide Hs.26458 reductase A

$ 107216 D51069D51069 Hs.211579melanoma cell adhesion $ molecule 107385 U97519NM_005397Hs.16426podocalyxin-like 107444 W28391W28391 Hs.343258proliferation-associated 2G4, 38kD

107985 AA035638T40064 Hs.71968Homo Sapiens mRNA;
cDNA DKFZp564F053 (fr 108507 AA083514AI554545 ESTs Hs.68301 108695 AA121315A8029000 KIAA1077 protein Hs.70823 108931 AA147186AA147186 gb:zo38d01.s1 Stratagene endothelial cel 109001 AA156125A1056548 hypothetical protein Hs.72116 FLJ20992 similar to 109195 AA188932AF047033 solute carrier family Hs.132904 4, sodium bicarbon 109390 AA219653AW007485 EH-domain containing Hs.87125 3 6$ 109456 AA232645AW956580 ESTs Hs.42699 109737 F10078AA055415 ESTs, Moderately similar Hs.13233 to A47582 B-cel 110411 H48032AW001579 Homo Sapiens mRNA
Hs.9645 for KIAA1741 protein, 110660 H82117AA782114 ESTs Hs.28043 110906 N39584AA035211 ESTs Hs.17404 111018 N54067AI287912 mitogen-activated Hs.3628 protein kinase kinase 111091 N59858AA300067 hypothetical protein Hs.33032 DKFZp434N185 111356 N90933BE301871 mannosyl (alpha-1,3-)-glycoprotein Hs.4867 beta-111378 N93764AW160993 hypothetical gene Hs.326292 DKFZp434A1114 111741 826124AB020653 KIAA0846 protein Hs.24024 ~$ 111769 827957AW629414 ESTs Hs.24230 112318 855470AW083384 ESTs, Highly similar Hs.11067 to T46395 hypotheti 112951 T16550AA307634 vacuolar protein Hs.6650 sorting 45B (yeast homo 113057 T26674AW194301 Human DNA sequence Hs.339283 from clone RP1-187J11 113195 T57112H83265 Hs.8881ESTs, Weakly similar to S41044 chromosom 113490 T88700BE178110 Homo sapiens cDNA
Hs.173374 FLJ10500 fis, clone NT

113542 T90527H43374 Hs.7890Homo sapiens mRNA
for KIAA1671 protein, 113803 W42789AW880709 chromosome 8 open Hs.283683 reading frame 4 113847 W60002NM-005032Hs.4114plastin 3 (T isoform) 113910 W78175AA113262 Homo sapiens, clone Hs.17901 IMAGE:3937015, mRNA, 113947 W84768W84768 gb:zh53d03.s1 Soares fetal_liver spleen_ 1 114047 W94427AL035858 _ ~ Hs.3807 FXYD domain-containing ion transport reg 115061 AA253217AI751438 Homo Sapiens mRNA
Hs.41271 full length insert cDN

115819 AA426573AA486620 endomucin-2 Hs.41135 115870 AA432374NM_005985Hs.48029snail 1 (drosophila homology, zinc finge 115964 AA446622AA987568 KIAA1265 protein Hs.74313 1 116228 AA478771AI767947 ESTs 5 Hs.50841 116264 AA482594D51174 Hs.272239lysosomal 116314 AA490588A1799104 Homo Sapiens cDNA
Hs.178705 FLJ11333 fis, clone PL

116589 D59570AI557212 ESTs, Moderately Hs.17132 similar to 154374 gene 117023 H88157AW070211 Homo sapiens mRNA;
Hs.102415 cDNA DKFZp586N0121 ( 2~ 117112 H94648AW969999 ESTs Hs.293658 117156 H97538W73853 ESTs 117176 H98670H45100 Hs.49753uveal autoantigen with coiled coil domai 117280 N22107M18217 Hs.172129Homo Sapiens cDNA:
FLJ21409 fis, clone C

119559 W38197W38197 Empirically selected from AFFX single pr 2$ 119866 W80814AA496205 Homo Sapiens mRNA;
Hs.193700 cDNA DKFZp58610324 (f 120655 AA287347AA305599 hypothetical protein Hs.238205 PR02013 121314 AA402799W07343 Hs.182538phospholipid scramblase 121335 AA404418AA404418 gb:zw37e02.s1 Soares tota~fetus_Nb2HF8_ 121822 AA425107AI743860 metallothionein 1E
(functional) 30 121835 AA425435AB033030 KIAA1204 protein Hs.300670 122331 AA442872AL133437 Homo Sapiens cDNA:
Hs.110771 FLJ21904 fis, clone H

122577 AA452860AA829725 hypothetical protein Hs.334437 MGC4248 123160 AA488687AA488687 ESTs, Weakly similar Hs.284235 to 138022 hypotheti 123486 AA599674BE019072 Homo Sapiens cDNA
Hs.334802 FLJ14680 fis, clone NT

35 124059 F13673BE387335 ESTs,WeaklysimilartoS64054hypotheti Hs.283713 124339 H99093H99093 Hs.343411DEADIH (Asp-Glu-Ala-AspIHis) box polypep 124358 N22495AW070211 Homo sapiens mRNA;
Hs.102415 cDNA DKFZp586N0121 ( 124364 N23031AF265555 baculoviral IAP repeat-containing Hs.250646 6 124726 815740NM 003654Hs.104576carbohydrate (keratan sulfate Gal-6) sul 40 124763 839610BE410405 calpain 2, (mlll) Hs.76288 large subunit 125167 W45560AL137540 netrin 4 Hs.102541 125304 239833AL359573 GTP-binding protein Hs.124940 125307 240583AW580945 ESTs Hs.330466 125329 AA825437AA825437 ESTs Hs.58875 4$ 125598 866613T40064 Hs.71968Homo sapiens mRNA;
cDNA DKFZp564F053 (fr 125609 AA868063AA868063 carbohydrate (keratan Hs.104576 sulfate Gal-6) sul 418245 AA128075AA088767 transmembrane, prostate Hs.83883 androgen induced 127435 N66570X69086 Hs.286161Homo Sapiens cDNA
FLJ13613 fis, clone PL

127566 A1051390A1051390 ESTs Hs.116731 127619 AA627122AA627122 ESTs Hs.163787 128453 X02761X02761 Hs.287820fibronectin 1 128495 AF010193NM_005904Hs.100602MAD (mothers against decapentaplegic, Dr 128515 AA149044BE395085 type I transmembrane Hs.10086 protein Fn14 128580 U82108U82108 Hs.101813solute comer family 9 (sodiumlhydrogen S 128623 D78676BE076608 CTL2 gene 5 Hs.105509 128642 L35240228913 Hs.102948enigma (LIM domain protein) 128669 AA598737W28493 Hs.180414heat shock 70kD protein 128903 869417AW150717 STAT induced STAT
Hs.345728 inhibitor 3 128914 AA232837AW867491 plasmalemma vesicle Hs.107125 associated protein 60 129087 N72695AI348027 hypothetical protein Hs.108557 PP1057 129188 M30257NM-001078Hs.109225vascular cell adhesion molecule 1 129226 M96843BE222494 inhibitor of DNA
Hs.180919 binding 2, dominant neg 129265 X68277AA530892 dual specificity Hs.171695 phosphatase 1 129345 AA292440822497 Hs.110571growth arrest and DNA-damage-inducible, 65 129468 J03040AW410538 secreted protein, Hs.111779 acidic, cysteine-dch 129488 AA228107AW966728 methionine adenosyltransferase Hs.54642 II, beta 129498 AA449789AA449789 connective tissue Hs.75511 growth factor 129557 W01367AL045404 KIAA0948 protein Hs.46366 129619 AA610116AA209534 tetraspan NET-6 protein Hs.284243 7~ 129627 AA258308T40064 Hs.71968Homo Sapiens mRNA;
cDNA DKFZp564F053 (fr 129762 AA460273AA453694 tripartite motif Hs.12372 protein TRIM2 129884 AA286710AF055581 lysosomal Hs.13131 130018 T68873AA353093 metallothionein 1L

130147 D63476D63476 Hs.172813PAK-interacting exchange factor beta 130178 M62403U20982 Hs.1516insulin-like growth factor-binding prate 130282 X55740BE245380 5' nucleotidase (CD73) Hs.153952 130431L10284AW505214Hs.155560calnexin 130495AA243278AW250380Hs.109059mitochondria) ribosomal protein L12 130553AA430032AF062649Hs.252587pituitary tumor-transforming 130638H16402AW021276Hs.17121ESTs 130639D59711AI557212Hs.17132ESTs, Moderately similar to 154374 gene 130657T94452AW337575Hs.201591ESTs 130686AA431571BE548267Hs.337986Homo sapiens cDNA
FLJ10934 fis, clone OV

130776879356AF167706Hs.19280cysteine-rich motor neuron 1 130818AA280375AW190920Hs.19928hypothetical protein 1 130840249269BE048821Hs.20144small inducible cytokine ~ subfamily A (Cy 130899241740A1077288Hs.296323serumlglucocorficoid regulated kinase 131002AA121543AL050295Hs.22039KIAA0758 protein 131080J05008NM_001955Hs.2271 endofhelin 1 131084AA101878NM_017413Hs.303084 apelin; peptide ligand forAPJ receptor 15 131091T35341AJ271216Hs.22880dipeptidylpeptidase III

131107N87590BE620886Hs.75354GCN1 (general control of amino-acid synt 131182AA256153Ai824144Hs.23912ESTs 131207W74533AF104266Hs.24212latrophilin 131319U25997NM stanniocalcin 1 003155Hs.25590 2~ 131328V01512AW939251Hs.25647v-fos FBJ murine osteosarcoma viral onto 131328V01512AW939251Hs.25647v-fos FBJ murine osteosarcoma viral onto 131328V01512AW939251Hs.25647v-fos FBJ murine osteosarcoma viral onto 131328V01512AW939251Hs.25647v-fos FBJ murine osteosarcoma viral onto 131509X56681X56681Hs.2780jun D proto-oncogene 25 131555AA161292T47364Hs.278613interferon, alpha-inducible protein 27 131564AA491465T93500Hs.28792Homo sapiens cDNA
FLJ11041 fis, clone PL

131573AA046593AA040311Hs.28959ESTs 131692D50914BE559681Hs.30736KIAA0124 protein 131756D45304AA443966Hs.31595ESTs 3 131859M90657AW960564 transmembrane 4 superfamily ~ member 1 131909W69127NM-016558Hs.274411 SCAN domain-containing 131915AA316186AI161383Hs.34549ESTs, Highly similar to S94541 1 clone 132046AA384503AI359214Hs.179260chromosome 14 open reading frame 4 132050AA136353AI267615Hs.38022ESTs 3 132151AA044755BE379499Hs.173705Homo sapiens cDNA:
$ FLJ22050 fis, clone H

132164U84573AI752235Hs.41270procollagen-lysine, 2-oxoglutarate 5-dio 132187AA058911AA235709Hs.4193DKFZP58601624 protein 132303AA620962BE177330Hs.325093Homo Sapiens cDNA:
FLJ21210 fis, clone C

132314AA285290AF112222Hs.323806pinin, desmosome associated protein 132358X60486NM_003542Hs.46423 H4 histone family, member G

132398831641AA876616Hs.16979ESTs, Weakly similar to A43932 mucin 2 p 132421AA489190AW163483Hs.48320double ring-finger protein, Dorfin 132490F13782NM_001290Hs.4980 LIM domain binding 132520AA257993AA257992Hs.50651Janus kinase 1 (a protein tyrosine kinas 45 132546M24283M24283Hs.168383intercellular adhesion molecule 1 (CD54) 132610AA443114AA160511Hs.5326amino acid system N transporter 2;
porcu 132716T35289BE379595Hs.283738casein kinase 1, alpha 132840N23817BE218319Hs.5807GTPase Rab14 132883AA047151AA373314Hs.5897Homo Sapiens mRNA;
cDNA DKFZp586P1622 (f 132968N77151AF234532Hs.61638myosin X

132989AA480074AA480074Hs.331328hypothetical protein 132999Y00787Y00787Hs.624interleukin 8 133071T99789BE384932Hs.64313ESTs, Weakly similar to AF2571821 G-pro 133076W84341AW946276Hs.6441Homo sapiens mRNA;
cDNA DKFZp586J021 (fr $5 133099L09209W16518Hs.279518amyloid beta (A4) precursor-like protein 133147D12763AA026533Hs.66 interleukin 1 receptor-like 133149T16484AA370045Hs.6607AXIN1 up-regulated 133161AA253193AW021103Hs.6631hypothetical protein 133200AA432248A8037715Hs.183639hypothetical protein 133220X82200NM_006074Hs.318501 Homo Sapiens mRNA
full length insert cDN

133260AA083572AA403045Hs.6906Homo Sapiens cDNA:
FLJ23197 fis, clone R

133295L00352AI147861Hs.213289low density lipoprotein receptor (famili 133349N75791AW631255Hs.8110L-3-hydroxyacyl-Coenzyme A dehydrogenase 133391X57579AW103364Hs.727inhibin, beta A (activin A, activin AB a 65 133398X02612NNt_000499Hs.72912 cytochrome P450, subfamily I (aromatic o 133436H44631BE294068Hs.737immediate early protein 133454AA090257BE547647Hs.177781hypothetical protein 133478X83703X83703Hs.31432cardiac ankyrin repeat protein 133491L40395BE619053Hs.170001eukaryotic translation initiation factor 133510AA227913AW880841Hs.96908p53-induced protein 133517X52947NM_000165Hs.74471 gap junction protein, alpha 1, 43kD (con 133526M11313AU077051Hs.74561alpha-2-macroglobulin 133538L14837NM_003257Hs.74614 tightjunction protein 1 (zona occludens 133562M60721M60721Hs.74870H2.0 (Drosophila)-like homeo box 1 75 133584D90209D90209Hs.181243activating transcdp6on factor 4 (tax-r 133590T67986T70956Hs.75106clusterin (complement lysis inhibitor, S

133617 BE244334Hs.75249ADP-ribosyla6on factor-like AA148318 6 interacts 133651097105AI301740Hs.173381dihydropyrimidinase-like 133671T25747AW503116Hs.301819zinc finger protein 133678K02574AW247252 nucleoside phosphorylase $ 133681D78577AI352558 tyrosine 3-monooxygenaseltryptophan 5-mo 133722X53331AW969976Hs.279009matrix Gla protein 133730S73591BE242779Hs.179526upregulated by 1,25-dihydroxyvitamin 133750X95735BE410769Hs.75873zyxin 133802L16862AW239400Hs.76297G protein-coupled receptor kinase 6 1 133825044975BE616902Hs.285313core promoter element ~ binding protein 133838M97796BE222494Hs.180919inhibitor of DNA binding 2, dominant neg 133859086782086782Hs.178761268 proteasome-associated pad1 homolog 133889AA099391048959Hs.211582myosin, light polypeptide kinase 133960M19267M19267Hs.77899tropomyosin 1 (alpha) 1 133975D29992C18356Hs.295944tissue factor pathway S inhibitor 2 133977L19314AI125639Hs.250666hairy (Drosophila)-homolog 134039S78569NM-002290Hs.78672 laminin, alpha 4 134075028811NM Golgi apparatus protein Hs.78979 134081L77886AL034349Hs.79005protein tyrosine phosphatase, receptor t 134164C14407AW245540Hs.79516brain abundant, membrane attached signal 134203M60278AA161219Hs.799diphtheria toxin receptor (heparin-binds 134238881509AA102179Hs.160726Homo sapiens cDNA
FLJ11680 fis, clone HE

134299AA487558AW580939Hs.97199complement componentC1qreceptor 134332D86962D86962Hs.81875growth factor receptor-bound protein 10 ~5 134339AA478971870429Hs.81988disabled (Drosophila) homolog 2 (mitogen 134343D50683D50683Hs.82028transforming growth factor, beta recepto 134381056637AI557280Hs.184270capping protein (actin filament) muscle 134403M61199AA334551 sperm specific antigen 134416M28882X68264Hs.211579melanoma cell adhesion molecule 134493X15183M30627Hs.289088heat shock 90kD protein 1, alpha 134558S53911NM CD34 antigen 001773Hs.85289 134817020734AU076592Hs.198951jun B proto-oncogene 134983D28235D28235Hs.196384prostaglandin-endoperoxide synthase 2 (p 134989AA236324AW968058Hs.92381nudix (nucleoside diphosphate linked mot 3 135052AA148923AL136653Hs.93675decidual protein induced $ by progesterone 135062AA174183AK000967Hs.93872KIAA1682 protein 135069AA456311AA876372Hs.93961Homo sapiens mRNA;
cDNA DKFZp667D095 (fr 135071L08069W27190Hs.94 DnaJ (Hsp40) homolog, subfamily A, membe 135073AA452000W55956Hs.94030Homo sapiens mRNA;
cDNA DKFZp586E1624 (f 135170AA282140T53169Hs.9587Homo sapiens cDNA:
FLJ22290 fis, clone H

135196J02854C03577Hs.9615myosin regulatory light chain 2, smooth 135348AA442054080983Hs.268177phospholipase C, gamma 1 (formerly subty 134404AB000450AB000450Hs.82771vaccinia related kinase 439561AB002380AF180681Hs.6582Rho guanine exchange factor (GEF) 12 4$ 100082AB003103AA130080Hs.4295proteasome (prosome, macropain) 268 subu 132817AB004884N27852Hs.57553tousled-like kinase 130150AF000573BE094848Hs.15113homogentisate 1,2-dioxygenase (homogenti 100104AF008937AF008937 syntaxin 16 447973AF009301AB011169Hs.20141similar to S. cerevisiae 332613AF009368AF029674Hs.173422KIAA1605 protein 100113D00591NM chromosome condensation 001269Hs.84746 1 133980D00760AA294921Hs.348024v-ral simian leukemia viral oncogene hom 100129D11139AA469369Hs.5831tissue inhibitor of metalloproteinase 100154D14657H60720Hs.81892KIAA0101 gene product S$ 100169D14878AL037228Hs.82043D123 gene product 129718D17716NM-002410Hs.121502 mannosyl (alpha-1,6-)-glycoprotein beta-100190D21090M91401Hs.178658RAD23 (S. cerevisiae) homolog B

134742D26135NM-001346Hs.89462 diacylglycerol kinase, gamma (90kD) 100211D26528D26528Hs.123058DEADIH (Asp-Glu-Ala-AspIHis) box polypep 60 100238D30742L24959Hs.348calciumicalmodulin-dependent protein kin 130283D31762NM TRAM-like protein 012288Hs.153954 134237D31765D31765Hs.170114KIAA0061 protein 100248D31888NM_015156Hs.78398 KIAA0071 protein 100256D38128D25418Hs.393prostaglandin 12 (prostacyclin) receptor 65 100262D38500D38500Hs.278468postmeiotic segregation increased 2-like 134329D38551N92036Hs.81848RAD21 (S. pombe) homolog 100281D42087AF091035Hs.184627KIAA0118 protein 100294D49396AA331881Hs.75454peroxiredoxin 3 100327D55640D55640 gb:Human monocyte PABL (pseudoautosomal 100335D63391AW247529Hs.6793platelet-activating factoracetylhydrola 134495D63477D63477Hs.84087KIAA0143 protein 100338D63483D86864Hs.57735acetyl LDL receptor;
SREC

135152D64015M96954Hs.182741TIA1 cytotoxic granule-associated RNA-bi 134269D79990NM_014737Hs.80905 Ras association (RaIGDSIAF-6) domain fam 100372D79997NM KIAA0175 gene product Hs.184339 134304D80010BE613486Hs.81412lipin 1 100394 D84276D84284 Hs.66052CD38 antigen (p45) 100405 D86425AW291587 nidogen 2 Hs.82733 100418 D86978D86978 Hs.84790KIAA0225 protein 133154 D87012D87012 Hs.194685topoisomerase (DNA) III beta $ 134347 D87075AF164142 solute camerfamily Hs.82042 23 (nucleobase tra 444099 D87432D87432 Hs.10315solute carrier family 7 (cationic amino 100438 D87448AA013051 topoisomerase (DNA) Hs.91417 II binding protein 134593 D87845NM_000437Hs.234392platelet-activating factor acetylhydrola 100481 HG1098-HT1098 cystatin D
X70377 Hs.121489 100552 HG2167-HT2237 lysosomal Hs.301946 100591 HG2415-HT2511 Homo Sapiens, Similar NM_004091Hs.231444 to hypothetical pr 100652 HG2825-HT2949 ret finger protein Hs.142653 100662 HG2887-HT3031 SRY (sex determining AI368680 region Y)-box Hs.816 2 100899 HG4660-HT5073 microtubule-associated AL039123 protein 1B
Hs.103042 1$ 100905 HG4704-HT5146 neuregulin 1 L12260 Hs.172816 100945 HG884-HT884AF002225 ubiquitin protein Hs.180686 ligase E3A (human papi 100950 HG919-HT919AF128542 polymerase (DNA
Hs.166846 directed), epsilon 100964 J00212J00212 Empirically selected from AFFX single pr 135407 J04029J04029 Hs.99936keratin 10 (epidermolytic hyperkeratosis 130149 J04031AW067805 methylenetetrahydrofolate Hs.172665 dehydrogenase 131877 J04088J04088 Hs.156346topoisomerase (DNA) II alpha (170kD) 101016 J04543J04543 Hs.78637annexin A7 134786 L06139T29618 Hs.89640TEK tyrosine kinase, endothelial (venous 134100 L07540AA460085 replication factor Hs.171075 C (activator 1 ) 5 (36 ~$ 134078 L08895L08895 Hs.78995MADS box transcription enhancer factor 101132 L11239L11239 Hs.36993gastrula6on brain homeo box 1 134849 L11353BE409525 neurofibromin 2 Hs.902 (bilateral acoustic neur 332736 L13773283689 Hs.114765myeloidllymphoid or mixed-lineage leukem 101152 L13800AI984625 spindle pole body Hs.9884 protein 30 135397 L14922L14922 Hs.166563replication factor C (activator 1) 1 (14 432642 L15189BE297635 heat shock 70kD
Hs.3069 protein 9B (mortalin-2) 101168 L15388NM-005308Hs.211569G protein-coupled receptor kinase 421155 L16895H87879 Hs.102267lysyl oxidase 101226 L27476AF083892 tightjunction protein Hs.75608 2 (zona occludens 3 415138 L27624C18356 Hs.295944tissue factor pathway $ inhibitor 2 134739 L32976NM-002419Hs.89449mitogen-activated protein kinase kinase 130155 L33404AA101043 kallikrein 7 (chymotryptic, Hs.151254 stratum com 440538 L35263W76332 Hs.79107mitogen-activated protein kinase 409916 L37347BE313625 solute comer family Hs.57435 11 (proton-coupled 101294 L40371AF168418 thyroid hormone Hs.116784 receptor interactor 101300 L40391BE535511 transmembrane trafficking protein 101310 L41607L41607 Hs.934glucosaminyl (N-acetyl) transferase 2, I

130344 L77566AW250122 DiGeorge syndrome Hs.154879 critical region gene D

101381 M13928AW675039 aminolevulinate, Hs.1227 delta-, dehydratase 4$ 101381 M13928AW675039 aminolevulinate, Hs.1227 delta-, dehydratase 415678 M14016AW005903 uroporphyrinogen Hs.78601 decarboxylase 133780 M14219AA557660 decorin Hs.76152 101396 M15796BE267931 proliferating cell Hs.78996 nuclear antigen 101447 M21305M21305 gb:Human alpha satellite and satellite 3 $0 101458 M22092M22092 gb:Human neural cell adhesion mclecule 101470 M22898NM..000546Hs.1846tumor protein p53 (Li-Fraumeni syndrome) 134604 M22995NM_002884Hs.865RAP1A, member of RAS oncogene family 101478 M23379NM 002890Hs.758RAS p21 protein activator (GTPase activa 133519 M24400AW583062 chymotrypsinogen Hs.74502 B1 $$ 131185 M25753BE280074 cyclin B1 Hs.23960 134116 M27691884694 Hs.79194cAMP responsive element binding protein 133999 M28213AA535244 RA82, member RAS
Hs.78305 oncogene family 130174 M29550M29551 Hs.151531protein phosphatase 3 (formerly 2B), cat 129963 M29971M29971 Hs.13840-6-methylguanine-DNA
methyltransferase 60 132983 M30269M30269 nidogen (enactin) 133900 M31158M31158 Hs.77439protein kinase, CAMP-dependent, regulato 101543 M31166M31166 Hs.2050pentaxin-related gene, rapidly induced'b 101545 M31210BE246154 endothelial differentiation, Hs.154210 sphingolipi 101620 M55420S55271 Hs.247930Epsilon , IgE

6$ 134691 M59979AW382987 prostaglandin-endoperoxide Hs.88474 synthase 1 (p 133595 M62810AA393273 transcription factor Hs.75133 6-like 1 (mitochond 101700 M64710D90337 Hs.247916natriuretic peptide precursor C

101714 M68874M68874 Hs.211587phospholipase A2, group IVA (cytosolic, 134246 M74524D28459 Hs.80612ubiqui6n-conjugating enryme E2A (RAD6 h 101760 M80254M80254 Hs.173125peptidylprolyl isomerase F (cyclophilin 415022 M81780X59960 Hs.77813sphingomyelin phosphodiesterase 1, acid 415022 M81780X59960 Hs.77813sphingomyelin phosphodiesterase 1, acid 415022 M81780X59960 Hs.77813sphingomyelin phosphodiesterase 1, acid 415022 M81780X59960 Hs.77813sphingomyelin phosphodiesterase 1, acid ~$ 415022 M81780X59960 Hs.77813sphingomyelin phosphodiesterase 1, acid 101791 M83822M83822 Hs.62354cell division cycle 4-like 101812M86934BE439894Hs.78991DNA segment, numerous copies, expressed 101813M87338NM 002914Hs.139226 replication factor C (activator 1) 2 (40 133396M96326M96326 Hs.72885azurocidin 1 (cationic antimicrobial pro 428161M96954M96954 Hs.182741TIA1 cytotoxic granule-associated RNA-bi $ 129026M98833AL120297Hs.108043Friend leukemia virus integration 1 101901S66793H38026 Hs.308arrestin 3, retinal (X-arrestin) 134831S72370AA853479Hs.89890pyruvate carboxylase 134039S78569NM_002290Hs.78672 laminin, alpha 4 442355S79873AA456539Hs.8262lysosomal-associated membrane protein 1 101975S83325AA079717Hs.283664aspartate beta-hydroxylase ~

101977S83364AF112213Hs.184062putative RabS-interacting protein 101978S83365BE561610Hs.5809putative transmembrane protein; homolog 101998001212001212 Hs.248153olfactory marker protein 102003001922001922 Hs.125565translocase of inner mitochondria) membr 1$ 102007002556002556 Hs.75307t-complex-associated-testis-expressed 102009002680BE245149Hs.82643protein tyrosine kinase 9 416658003272003272 Hs.79432fibrillin 2 (congenital contractural ara 132951004209AW821182Hs.61418microfibrillar-associated protein 1 135389005237005237 Hs.99872fetal Alzheimer antigen 2~ 102048007225007225 Hs.339purinergicreceptorP2Y,G-proteincoupl 130145007620034820 Hs.151051mitogen-activated protein kinase 10 303153009759009759 Hs.246857mitogen-activated protein kinase 9 420269009820072937 Hs.96264alpha thalassemialmental retardation syn 102095011313011313 Hs.75760sterol carrier protein 2$ 102123014518NM-001809Hs.1594 centromere protein A (17kD) 102126014575AW950870Hs.78961protein phosphatase 1, regulatory (inhib 102133015173AU076845Hs.155596BCL2ladenovirus E1B
19kD-interacting pro 102139015932NM 004419Hs.2128 dual specificity phosphatase 5 102162018291AA450274Hs.1592CDC16 (cell division cycle 16, S. cerevi 102164018300NM_000107Hs.77602 damage-specific DNA
binding protein 2 (4 427653018383AA159001Hs.180069nuclear respiratory factor 1 131817020536020536 Hs.3280caspase 6, apoptosis-related cysteine pr 102200021551AA232362Hs.157205branched chain aminotransferase 1, cytos 102210023028BE619413Hs.2437eukaryotic translation initiation factor 3 102214023752023752 Hs.32964SRY (sex determining $ region Y)-box 11 132811025435025435 Hs.57419CCCTC-binding factor (zinc finger protei 131319025997NM 003155Hs.25590 stanniocalcin 1 102256028251028251 Hs.53237ESTs, Highiy similar to Z169_HUMAN ZINC

132316028831028831 Hs.44566KIAA1641 protein 102269030245030245 gb:Human myelomonocytic specific protein 417526032315AA568906Hs.82240syntaxin 3A

102293032439AF090116Hs.79348regulator of G-protein signalling 7 102298032849AA382169Hs.54483N-myc (and STAT) interactor 102325035139AI815867Hs.50130necdin (mouse) homolog 4$ 428734036764BE303044Hs.192023eukaryotic translation initiation factor 102361039400AA223616Hs.75859chromosome 11 open reading frame 4 102367039657039656 Hs.118825mitogen-activated protein kinase kinase 102388041344AA362907Hs.76494proline arginine-rich end leucine-rich r 102394041766NM-003816Hs.2442 a disintegrin and metalloproteinase doma $ 129829041813AF010258Hs.127428homeo box A9 ~

102409043286BE300330Hs.118725selenophosphate synthetase 133746044378AW410035Hs.75862MAD (mothers against decapentaplegic, Dr 102423044754247542 Hs.179312small nuclear RNA
activating complex, po 132828047011AB014615Hs.57710fibroblast growth factor 8 (androgen-ind $ 132828047011AB014615Hs.57710fibroblast growth $ factor 8 (androgen-ind 132828047011AB014615Hs.57710fibroblast growth factor 8 (androgen-ind 132828047011AB014615Hs.57710fibroblastgrowthfactor8(androgen-ind 425322047077063630 Hs.155637protein kinase, DNA-activated, catalytic 102450048251048251 Hs.75871protein kinase C
binding protein 60 129350050535050535 Hs.110630Human BRCA2 region, mRNA sequence CG006 102534056833096759 Hs.198307von Hippel-Lindau binding protein 130457058091AB014595Hs.155976cullin 4B

135065058837AA019401Hs.93909cyclic nucleotide gated channel beta 102560059289897457 Hs.63984cadherin 13, H-cadherin (heart) 6$ 102567059863063830 Hs.146847TRAF family member-associated NFKB activ 417173067122061397 Hs.81424ubiquitin-like 1 (sentrin) 102638067319067319 Hs.9216caspase 7, apoptosis-related cysteine pr 132736068019AW081883Hs.211578Homo Sapiens cDNA:
FLJ23037 fis, clone L

133070069611092649 Hs.64311a disintegrin and metalloproteinase doma 102663070322NM-002270Hs.168075 karyopherin (importin) beta 2 134660073524073524 Hs.87465ATPIGTP-binding protein 102735079267AF111106Hs.3382protein phosphatase 4, regulatory subuni 102741079291AW959829Hs.83572hypothetical protein 130564US2671082671 Hs.36980melanoma antigen, family A, 2 7$ 130564082671082671 Hs.36980melanoma antigen, family A, 2 132164084573AI752235Hs.41270procollagen-lysine, 2-oxoglutarate 5-dio 102823090914D85390Hs.5057carboxypepGdase D

102826091316NM cytosolic acyl coenryme 007274Hs.8679 A thioester hydr 102831091932AA262170Hs.80917adaptor-related protein complex 3, sigma 102846096131BE264974Hs.6566thyroid hormone receptor interactor 13 129777097018097018Hs.12451echinoderm microtubule-associated protei 134161097188AA634543Hs.79440IGF-II mRNA-binding protein 134854V00503J03464Hs.179573collagen, type I, alpha 429257X04327AW163799Hs.1983652,3-bisphosphoglycerate mutase 413985X06389A1018666Hs.75667synaptophysin 419768X07496T72104Hs.93194apolipoprotein A-I

102915X07820X07820Hs.2258matrix metalloproteinase 10 (stromelysin 134656X14787AI750878Hs.87409thrombospondin 1 413858X15525NM acid phosphatase 2, lysosomal 001610Hs.75589 102968X16396AU076611Hs.154672methylene tetrahydrofolate dehydrogenase I 102971X16609X16609Hs.183805ankyrin 1, erythrocytic S

134037X53586AI808780Hs.227730integrin, alpha 6 134037X53586AI808780Hs.227730integrin, alpha 6 103023X53793AW500470Hs.117950multifunctional polypeptide similar to S

103037X54936BE018302Hs.2894placental growth factor, vascular endoth 130282X55740BE245380Hs.1539525' nucleotidase (CD73) 134542X57025M14156Hs.85112insulin-like growth factor 1 (somatomedi 128568X60673H12912Hs.274691adenylate kinase 3 128568X60673H12912Hs.274691adenylate kinase 3 103093X60708S79876Hs.44926dipeptidylpeptidase IV
(CD26, adenosine ~$ 413076X62048010564Hs.75188wee1 (S. pombe) homolog 129063X63097X63094Hs.283822Rhesus blood group, D
antigen 424460X63563BE275979Hs.296014polymerase (RNA) II (DNA
directed) polyp 411077X64037AW977263Hs.68257general transcription factor IIF, polype 103181X69636X69636Hs.334731Homo sapiens, clone IMAGE:3448306, mRNA, 103184X69878043143Hs.74049fms-related tyrosine kinase 4 103194X70649NM-004939Hs.78580 DEADIH (Asp-Glu-Ala-AspIHis) box polypep 103208X72841AW411340Hs.31314retinoblastoma-binding protein 7 129698X74987BE242144Hs.12013ATP-binding cassette, sub-family E (OABP

131486X83107F06972Hs.27372BMX non-receptor tyrosine kinase 3S 130729X84194AI963747Hs.18573acylphosphatase 1, erythrocyte (common) 103334X85753NM-001260Hs.25283 cyclin-dependent kinase 132645X87870AI654712Hs.54424hepatocyte nuclearfactor4, alpha 135094X89066NM transient receptor potential 003304Hs.250687 channel 1 103352X89398H09366Hs.78853uracil-DNA glycosylase 103352X89398H09366Hs.78853uracil-DNA glycosylase 103353X89399X89399Hs.119274RAS p21 protein activator (GTPase activa 132173X89426X89426Hs.41716endothelial cell-specific molecule 1 103371X91247X91247Hs.13046thioredoxin reductase 131584X91648AA598509Hs.29117purine-rich element binding protein A

4$ 103376X92098AL036166Hs.323378coated vesicle membrane protein 103378X92110AL119690Hs.153618HCGVIII-1 protein 128510X94703X94703 RAB28, member RAS oncogene family 103410X96506AA158294Hs.295362DR1-associated protein 1 (negative cofac 133490X97230AF022044Hs.274601killer cell immunoglobulin-like receptor 332689X97230AF022044Hs.274601killer cell immunoglobulin-like receptor 103438X98263AW175781Hs.152720M-phase phosphoprotein 103440X98296X98296Hs.77578ubiquitin specific protease 9, X chromos 103452X99584NM SMT3 (suppressor of mif 006936Hs.85119 two 3, yeast) ho 133536Y00264W25797.comp Hs.177486 amyloid beta (A4) precursor protein (pro $ 420234Y07566AW404908Hs.96038Ric (Drosophila)-like, $ expressed in many 426502Y07759Y07759Hs.170157myosin VA (heavy polypeptide 12, myoxin) 134662Y07827NM-007048Hs.284283 butyrophilin, subfamily 3, member A1 132083Y07867BE386490Hs.279663Pirin 103500Y09443AW408009Hs.22580aikylglycerone phosphate synthase 134389Y09858Y09858Hs.82577spindlin-like 132084Y12394NM karyopherin alpha 3 (importin 002267Hs.3886 alpha 4) 103540211559NM aconitase 1, soluble 002197Hs.154721 133152211695211695Hs.324473mitogen-activated protein kinase 1 103548215005215005Hs.75573centromere protein E
(312kD) 6S 103612246261BE336654Hs.70937H3 histone family, member A

129092AA011243D56365Hs.63525poly(rC)-binding protein 103692AA018418AW137912Hs.227583Homo Sapiens chromosome X map Xp11.23 L-103695AA018758AW207152Hs.186600ESTs 129796AA018804BE218319Hs.5807GTPase Rabl4 434993AA031993AA306325Hs.4311SUMO-1 activating enryme subunit 2 132683AA044217BE264633Hs.143638WD repeat domain 4 131887AA046548W17064Hs.332848SWIISNF related, matrix associated, acti 103723AA057447BE274312Hs.214783Homo sapiens cDNA FLJ14041 fis, clone HE

453368AA058376W20296Hs.288178Homo Sapiens cDNA FLJ11968 fis, clone HE

~S 133260AA083572AA403045Hs.6906Homo Sapiens cDNA: FLJ23197 fis, clone R

103765AA085696AA085696Hs.169600KIAA0826 protein 103766 AA088744AI920783Hs.191435ESTs 103767 AA089688BE244667 CGI-100 protein 132051 AA091284AA393968Hs.180145HSPC030 protein 103773 AA092700AI219323Hs.101077ESTs, Weakly similar to T22363 hypotheti $ 135289 AA092968AW372569Hs.9788hypothetical protein MGC10924 similar to 409659 AA094800AW970843Hs.55682eukaryotic translation initiation factor 103794 AA100219AF244135Hs.30670hepatocellular carcinoma-associated anti 131471 AA114885AA164842Hs.192619KIAA1600 protein 134319 AA129547BE304999Hs.285754fumarate hydratase 1 103807 AA133016AW958264Hs.103832similar to yeast Upf3, ~ variant B

446392 AA149507AF142419Hs.15020homolog of mouse quaking QKI (KH domain 129863 AA151005BE379765Hs.129872sperm associated antigen 103850 AA187101AA187101Hs.213194hypothetical protein 103855 AA195179W02363 hypothetical protein 15 103861 AA206236AA206236Hs.4944hypothetical protein 130634 AA227621AI769067Hs.127824ESTs, Weakly similar to T28770 hypotheti 447735 AA248283AA775268Hs.6127Homo sapiens cDNA:
FLJ23020 fis, clone L

103909 AA249611AA249611Hs.47438SH3 domain binding glutamic acid-rich pr 458928 AA282640AF043117Hs.24594ubiquitination factor E4B (homologous to 415824 AA287199D42039 Hs.78871mesoderm development candidate 2 129013 AA313990AA371156Hs.107942DKFZP564M112 protein 129435 AA314256AF151852Hs.111449CGI-94 protein 103988 AA314389AA314389Hs.342849ADP-dbosylation factor-like 104000 AA324364AI146527Hs.80475polymerase (RNA) II
(DNA directed) polyp 425284 AA329211AF155568Hs.348043NS1-associated protein 128629 AA399187AL096748Hs.102708DKFZP434A043 protein 133281 AA421079AK001601Hs.69594high-mobility group 104104 AA422029AA422029Hs.143640ESTs, Weakly similar to hyperpolarizatio 332455 AA425230NM_005754Hs.220689 Ras-GTPase-activating protein SH3-domain 3 132091 AA447052AW954243 KIAA0251 protein ~

135073 AA452000W55956 Hs.94030Homo Sapiens mRNA;
cDNA DKFZp586E1624 (f 131367 AA456687AI750575Hs.173933nuclear factorllA

129593 AA487015AI338247Hs.98314Homo Sapiens mRNA;
cDNA DKFZp586L0120 (f 133505 C01527AI630124Hs.324504Homo Sapiens mRNA;
cDNA DKFZp586J0720 (f 35 132064 C01714AA121098Hs.3838serum-induciblekinase 442351 C01811W52642 Hs.8261hypothetical protein 131427 C02352AF151879Hs.26706CGI-121 protein 433892 C02375AI929357Hs.323966Homo sapiens clone H63 unknown mRNA

104282 C14448C14448 Ns.332338EST

40 134827 D16611BE314037Hs.89866coproporphyrinogen oxidase (coproporphyr 425330 D25216D25216 Hs.155650KIAA0014 gene product 131742 D31352AA961420Hs.31433ESTs 456935 D58024AA370362Hs.57958EGF-TM7-latrophilin-related protein 425218 D80897NM_014909Hs.155182 KIAA1036 protein 45 104334 D82614D82614 Hs.78771phosphoglycerate kinase 134593 D87845NM 000437Hs.234392 platelet-activating factor acetylhydrola 134731 D89377D89377 Hs.89404msh (Drosophila) homeo box homolog 2 445776 H06583NM 001310Hs.13313 cAMP responsive element binding protein-131670 H40732H03514 Hs.15589ESTs 50 104394 H46617AA129551Hs.172129Homo sapiens cDNA:
FLJ21409 fis, clone C

104402 H56731H56731 Hs.132956ESTs 439130 H75570AA306090Hs.124707ESTs 129077 H78886N74724 Hs.108479ESTs 104417 H81241A1819448Hs.320861Kruppel-like factor $ 134927 L36531L36531 Hs.91296integrin, alpha 8 S

129280 M63154M63154 Hs.110014gastric intrinsic factor (vitamin B
synt 134498 M63180AW246273Hs.84131threonyl-tRNA synthetase 104460 M91504AW955705Hs.62604Homo Sapiens, clone IMAGE:4299322, mRNA, 104488 N56191N56191 Hs.106511protocadherin 17 131248 N78483A1038989Hs.332633Bardet-Biedl syndrome 130017 814652AK000096Hs.143198inhibitor of growth family, member 3 104530 820459AK001676Hs.12457hypothetical protein 104534 822303822303 gb:yh26b09.r1 Soares placenta Nb2HP Homo 104544 833779A1091173Hs.222362ESTs, Weakly similar to p40 [H.sapiens]

6$ 133328 836553AW452738Hs.265327hypothetical protein DKFZp7611141 104567 864534AA040620Hs.5672hypothetical protein 129575 870621F08282 Hs.278428progestin induced protein 130776 879356AF167706Hs.19280cysteine-rich motor neuron 1 104599 884933AW815036Hs.151251ESTs 104660 AA007160BE298665Hs.14846Homo Sapiens mRNA;
cDNA DKFZp564D016 (fr 104667 AA007234AI239923Hs.63931ESTs 104718 AA018409A1143020Hs.36250ESTs, Weakly similar to 138022 hypothe6 104764 AA025351A1039243Hs.278585ESTs 104786 AA027168AA027167Hs.10031KIAA0955 protein 104787 AA027317AA027317 gb:ze97d11.s1 Soares fetal-hear~NbHH19W

134079 AA029423AK001751Hs.171835hypothetical protein 104804 AA031357AI858702Hs.31803ESTs, Weakly similar to N-WASP [H.sapien 104865 AA045136T79340Hs.22575B-cell CLLllymphoma 6, member B (zinc fi 130828 AA053400AW631469Hs.203213ESTs 104907 AA055829AA055829Hs.196701ESTs, Weakly similar to ALU1 HUMAN ALU
S

$ 104943 AA065217AF072873Hs.114218frizzled (Drosophila) homolog 6 105013 AA116054H63789Hs.296288ESTs, Weakly similar to KIAA0638 protein 105024 AA126311AA126311Hs.9879ESTs 132592 AA129390AW803564Hs.288850Homo Sapiens cDNA:
FLJ22528 fis, clone H

105038 AA130273AW503733Hs.9414KIAA1488 protein 105077 AA142919W55946Hs.234863Homo Sapiens cDNA
FLJ12082 fis, clone HE

105096 AA150205AL042506Hs.21599Kruppel-like factor 7 (ubiquitous) 129215 AA176867AB040930Hs.126085KIAA1497 protein 105169 AA180321BE245294Hs.180789S164 protein 132796 AA180487NM-006283Hs.173159 transforming, acidic coiled-coil contain 1$ 427210 AA187634BE396283Hs.173987eukaryotic translation initiation factor 105200 AA195399AA328102Hs.24641cytoskeleton associated protein 2 130114 AA234717AA233393Hs.14992hypothetical protein 105330 AA234743AW338625Hs.22120ESTs 105337 AA234957AI468789Hs.347187myotubularin related protein 1 422040 AA235604AA172106Hs.110950Rag C protein 105376 AA236559AW994032Hs.8768hypothetical protein 105397 AA242868AA814807Hs.7395hypothetical protein 431679 AA251776AK000046Hs.343877hypothetical protein 131991 AA251909AF053306Hs.36708budding uninhibited by benzimidazoles ~$ 421305 AA252672BE397354Hs.324830diptheria toxin resistance protein requi 105489 AA256157AA256157Hs.24115Homo sapiens cDNA
FLJ14178 fis, clone NT

105508 AA256680AA173942Hs.326416Homo Sapiens mRNA;
cDNA DKFZp564H1916 (f 105539 AA258873AB040884Hs.109694KIAA1451 protein 135172 AA262727AB028956Hs.12144KIAA1033 protein 3~ 131569 AA281451AL389951Hs.271623nucleoporin 50kD

431129 AA281545AL137751Hs.263671Homo Sapiens mRNA;
cDNA DKFZp43410812 (f 105643 AA282069BE621719Hs.173802KIAA0603 gene product 105659 AA283044AA283044Hs.25625hypothetical protein 105666 AA283930AA426234Hs.34906ESTs, Weakly similar to T17210 hypotheti 3 105674 AA284755AI609530Hs.279789histone deacetylase $ 3 105709 AA291268AI928962Hs.26761DKFZP586L0724 protein 105722 AA291927Ai922821Hs.32433ESTs 105765 AA343514AA299688Hs.24183ESTs 115951 AA398109BE546245Hs.301048sec13-like protein 130884 AA398109BE546245Hs.301048secl3-like protein 105962 AA405737AW880358Hs.339808hypothetical protein 105985 AA406610AA406610 gb:zv15b10.s1 Soares-NhHMPu S1 Homo sapi 106008 AA411465A8033888Hs.8619SRY (sex determining region Y)-box 18 457322 AA416886AI815486Hs.243901Homo sapiens cDNA
FLJ20738 fis, clone HE

4$ 134222 AA424013AW855861Hs.8025Homo Sapiens clone 23767 and 23782 mRNA

446954 AA424148AB037850Hs.16621DKFZP4341116 protein 106141 AA424558AF031463Hs.9302phosducin-like 447973 AA424961AB011169Hs.20141similar to S. cerevisiae 106157 AA425367W37943Hs.34892KIAA1323 protein $0 428314 AA425921AW135049Hs.26285Homo sapiens cDNA
FLJ10643 fis, clone NT

446727 AA426220AB011095Hs.16032KIAA0523 protein 106196 AA427735AA525993Hs.173699ESTs, Weakly similar to ALU1 HUMAN ALU
S

457714 AA430673AA083764 hypothetical protein 133200 AA432248AB037715Hs.183639hypothetical protein $5 106302 AA435896AA398859Hs.18397hypothetical protein 106328 AA436705AL079559Hs.28020KIAA0766 gene product 450534 AA446561AI570189Hs.25132KIAA0470 gene product 106423 AA448238AB020722Hs.16714Rho guanine exchange factor (GEF) 15 439608 AA449756AW864696Hs.301732hypothetical protein 106477 AA450303823324Hs.41693DnaJ (Hsp40) homolog, subfamily B, membe 106503 AA452411AB033042Hs.29679cofactor required for Sp1 transcriptiona 446999 AA454566AA151520 hypothetical protein 106543 AA454667AA676939Hs.69285neuropilin 1 442007 AA456437AA301116Hs.142838nucleolar phosphoprotein Nopp34 6$ 106589 AA456646AK000933Hs.28661Homo Sapiens cDNA
FLJ10071 fis, clone HE

106593 AA456826AW296451Hs.24605ESTs 106596 AA456981AA452379 ESTs, Moderately similar to ALU7-HUMAN A

423064 AA458959AF265208Hs.8740SWIISNF related, matrix associated, acti 106636 AA459950AW958037Hs.286ribosomal protein 106654 AA460449AW075485Hs.286049phosphoserine aminotransferase 131353 AA463910AW754182 gb:RC2-CT0321-131199-011-c01 CT0321 Homo 106707 AA464603AK000566Hs.98135hypothetical protein 452909 AA464606NM_015368Hs.30985 pannexin 1 106717 AA465093AA600357Hs.239489TIA1 cytotoxic granule-associated RNA-bi ~$ 453141 AA465692AB014548Hs.31921KIAA0648 protein 106747 AA476473NM_007118Hs.171957 triple functional domain (PTPRF interact 106773 AA478109AA478109 ESTs Hs.188833 106781 AA478474AA330310 ESTs Hs.24181 106817 AA480889D61216 Hs.18672ESTs 106846 AA485223AB037744 KIAA1323 protein Hs.34892 $ 106848 AA485254AA449014 chromosome 11 open Hs.121025 reading frame 5 106856 AA486183W58353 Hs.285123Homo sapiens mRNA
full length insert cDN

418699 AA496936BE539639 ESTs, Weakly similar Hs.173030 to ALU8_HUMAN ALU
S

107001 AA598589AI926520 putative DNA binding Hs.31016 protein 442853 AA598831AW021276 ESTs Hs.17121 1 107054 AA600150A1076459 KIAA1272 protein ~ Hs.15978 107059 AA608545BE614410 RAD51 (S. cerevisiae) Hs.23044 homolog (E coli Re 107080 AA609210AL122043 hypothetical protein Hs.19221 DKFZp566G1424 107115 AA610108BE379623 peptidylprolyl isomerase Hs.27693 (cyclophilin)-I

107130 AA620582AB033106 KIAA1280 protein Hs.12913 15 107156 AA621239AA137043 programmed cell death Hs.9663 6-interacting prat 107174 AA621714BE122762 ESTs Hs.25338 130621 AA621718AW513087 LUC7 (S. cerevisiae)-like Hs.16803 107190 D19673AA836401 ESTs Hs.87860 132626 D25755AW504732 hypothetical protein Hs.21275 FLJ11011 20 107217 D51095AL080235 DKFZP586E1621 protein Hs.35861 332584 D60272AA357879 ESTs; Weakly similar Hs.29423 to macrophage lecti 444655 T08879AF088886 cathepsin F
Hs.11590 107295 T34527AA186629 UDP-N-acetyl-alpha-D-galactosamine:polyp Hs.80120 107299 T40327BE277457 hypothetical protein Hs.30661 MGC4606 2$ 107315 T62771AA316241 nucleophosminlnucleoplasmin Hs.90691 3 107316 T63174T63174 Hs.193700Homo sapiens mRNA;
cDNA DKFZp58610324 (f 107328 T83444AW959891 KIAA0887 protein Hs.76591 107334 T93641T93597 Hs.187429ESTs 456340 048263048263 Hs.89040prepronaciceptin 3~ 128636 049065049065 Hs.102865interleukin 1 receptor-like2 129938 079300AW003668 Human clone 23629 Hs.135587 mRNA sequence 107375 088573BE011845 high-mobility group Hs.251064 (nonhistone chromoso 130074 093867AL038596 polymerase (RNA) Hs.250745 III (DNA directed) (62k 107387 W01094D86983 Hs.118893Melanoma associated gene 35 132036 W01568AL157433 hypothetical protein Hs.37706 DKFZp434E2220 107426 W26853W26853 Hs.291003hypothetical protein 135388 W27965W27965 Hs.99865epimorphin 130419 W36280AF037448 NS1-associated protein Hs.155489 1 107469 W47063W47063 Hs.94668ESTs 434203 W79060BE262677 hypothetical protein Hs.283558 PR01855 107506 W88550AB028981 KIAA1058 protein Hs.8021 132358 X60486NM-003542Hs.46423H4 histone family, member G

107522 X78931X78931 Hs.99971zinc finger protein 456495 214077NM-003403Hs.97496YY1 transcription factor Hs.59952 107609 AA004711875654 Hs.164797hypothetical protein 107661 AA010383AA010383 ESTs Hs.60389 107714 AA015761AA015761 ESTs Hs.60642 107775 AA018772AW008846 ESTs Hs.60857 5Q 107832 AA021473AA021473 gb:ze66c11.s1 Soares retina N2b4HR Homo 107859 AA024835AW732573 potassium voltage-gated Hs.47584 channel, delayed 107914 AA027229AA027229 ESTs, Weakly similar Hs.61329 to T16370 hypotheti 107935 AA029428AA029428 ESTs Hs.61555 410196 AA035143A1936442 hypothetical protein Hs.59838 FLJ10808 55 131461 AA035237AA992841 KIAA1458 protein Hs.27263 Hs.61916 108029 AA040740AA040740 ESTs Hs.62007 108040 AA041551AL121031 SWIISNF related, Hs.159971 matrix associated, acti 108084 AA045513AA058944 Homo sapiens, clone Hs.116602 IMAGE:4154008, mRNA, 108088 AA045745AA045745 ESTs Hs.62886 108168 AA055348AI453137 ESTs Hs.63176 130719 AA056582AA679262 hypothetical protein Hs.14235 FLJ20008; KIAA1839 108189 AA056697AW376061 ESTs, Moderately Hs.63335 similar to A46010 X-lin Hs.63338 6$ 108203 AA057678AW847814 Homo sapiens cDNA:
Hs.289005 FLJ21532 fis, clone C

108216 AA058681AA524743 ESTs Hs.44883 108217 AA058686AA058686 ESTs Hs.62588 108245 AA062840BE410285 proteasome (prosome, Hs.89545 macropain) subunit, 108277 AA064859AA064859 gb:zm50f03.s1 Stratagene fibroblast (937 70 108280 AA065069AA065069 gb:zm12e11.s1 Stratagene pancreas (93720 108309 AA069923AA069818 gb:zm67e03.r15tratagene neuroepithelium 108340 AA070815AA069820 peroxiredoxin 1 Hs.180909 108403 AA075374AA075374 gb:zm87a01.s1 Stratagene ovarian cancer 108427 AA076382AA076382 gb:zm91g08.s1 Stratagene ovarian cancer ~$ 108435 AA078787T82427 Hs.194101Homo sapiens cDNA:
FLJ20869 fis, clone A

108439 AA078986AA078986 gb:zm92h01.s1 Stratagene ovarian cancer 108465 AA079393AA079393Hs.3462cytochrome c oxidase subunit Vllc 108469 AA079487AA079487 gb:zm97f08.s1 Stratagene colon HT29 (937 108500 AA083207AA083207Hs.68270EST

108501 AA083256AA083256 gb:zn08g12.s1 Stratagene hNT neuron (937 108533 AA084415AA084415 gb:zn06g09.s1 Stratagene hNT neuron (937 108562 AA085274AA100796 gb:zm26c06.s1 Stratagene pancreas (93720 108589 AA088678AI732404Hs.68846ESTs 130890 AA100925A1907537Hs.76698stress-associated endoplasmic reticulum 432645 AA101255D14041Hs.347340H-2K binding factor-2 1 130385 AA126474AW067800Hs.155223stanniocalcin 2 ~

108749 AA127017AA127017Hs.71052ESTs 108807 AA129968A1652236Hs.49376hypothetical protein 108808 AA130240AA045088Hs.62738ESTs 108833 AA131866AF188527Hs.61661ESTs, Weakly similar to AF1746051 F-box 1$ 108846 AA132983AL117452Hs.44155DKFZP586G1517 protein 108857 AA133250AK001468Hs.62180anillin (Drosophila Scraps homology, act 131474 AA133583L46353Hs.2726high-mobility group (nonhistone chromoso 108894 AA135941AK001431Hs.5105hypothetical protein 108941 AA148650AA148650 gb:zo09e06.s1 Stratagene neuroepithelium 108968 AA151110AI304870Hs.188680ESTs 108996 AA155754AW995610Hs.332436EST

109001 AA156125A1056548Hs.72116hypothetical protein FLJ20992 similar to 131183 AA156289AI611807Hs.285107hypothetical protein 109019 AA156997AA156755Hs.72150ESTs 109022 AA157291AA157291Hs.21479ubinuclein 1 109023 AA157293AA157293Hs.72168ESTs 109068 AA164293AA164293Hs.72545ESTs 109072 AA164676A1732585Hs.22394hypothetical protein 426981 AA167375AL044675Hs.173081KIAA0530 protein 3 130346 AA167550H05769Hs.188757Homo Sapiens, clone ~ MGC:5564, mRNA, comp 109146 AA176589AA176589Hs.142078EST

109172 AA180448AA180448Hs.144300EST

428438 AA187144NM endothelin 1 001955Hs.2271 129208 AA189170AI587376Hs.109441MSTP033 protein 35 109222 AA192757AA192833Hs.333512similar to ratmyomegalin 109300 AA205650AA418276Hs.170142ESTs 109481 AA233342AA878923Hs.289069hypothetical protein 109485 AA233472BE619092Hs.28465Homo sapiens cDNA:
FLJ21869 fis, clone H

109516 AA234110AI471639Hs.71913ESTs 40 109537 D80981AI858695Hs.34898ESTs 109556 F01660Ai925294Hs.87385ESTs 109577 F02206F02206Hs.296639Homo Sapiens potassium channel subunit 109578 F02208F02208Hs.27214ESTs 109595 F02544AA078629Hs.27301ESTs 4S 109625 F03918H29490Hs.22697ESTs 428376 F04258AF119665Hs.184011pyrophosphatase (inorganic) 109648 F04600H17800Hs.7154ESTs 109671 F08998859210Hs.2663,4ESTs 109699 F09605H18013Hs.167483ESTs 109820 F11115AW016809Hs.119021ESTs 109933 H06371852417Hs.20945Homo Sapiens clone 24993 mRNA sequence 110014 H AL109666Hs.7242Homo Sapiens mRNA
10995 full length insert cDN

110039 H11938H11938Hs.21907histone aceiylfransferase 110099 H16568844557Hs.23748ESTs $S 110107 H16772AW151660Hs.31444ESTs 110155 H18951AI559626Hs.93522Homo sapiens mRNA
for KIAA1647 protein, 110197 H20859AW090386Hs.112278arrestin, beta 1 110223 H23747H19836Hs.31697ESTs 110306 H38087H38087Hs.105509CTL2 gene 110335 H40331H65490Hs.18845ESTs 110342 H40567H40961Hs.33008ESTs 110395 H46966AA025116Hs.33333ESTs 110511 H56640H56640Hs.221460ESTs 110523 H57154A1040384Hs.19102ESTs, Weakly similar to organic anion tr 6$ 110715 H96712H96712Hs.269029ESTs 110754 N20814AW302200Hs.6336KIAA0672 gene product 428454 N25249U55936Hs.184376synaptosomal-associated protein, 23kD

431663 N27100NM-016569Hs.267182 TBX3-iso protein 134263 N39616AW973443Hs.8086RNA (guanine-7-) methyltransferase 110938 N48982N48982Hs.38034Homo sapiens cDNA
FLJ12924 fis, clone NT

110983 N51957NM_015367Hs.10267 MIL1 protein 111081 N59435AI146349Hs.271614CGI-112 protein 111128 N64139AW505364Hs.19074LATS (large tumor suppressor, Drosophila 431548 N66981AI834273Hs.9711novel protein 75 111216 N68640AW139408Hs.152940ESTs 437562 N69352AB001636Hs.5683DEADIH (Asp-Glu-Ala-AspIHis) box polypep 111399800138AW270776Hs.18857ESTs 111514807998807998 gb:yf16g11.s1 Soaresfetal liver spleen 428744808929BE267033Hs.192853ubiquitin-conjugating enzyme E2G 2 (homo 111574810307A1024145Hs.188526ESTs $ 111804833354AA482478Hs.181785ESTs 111831836083836095Hs.268695ESTs 426773837938NM_015556Hs.172180 KIAA0440 protein 111904839330241572 gb:HSCZYB122 normalized infant brain cDN

428371840816AB012193Hs.183874cullin 4A

1 112033843162849031Hs.22627ESTs ~

130987845698BE613269Hs.21893hypothetical protein DKFZp761N0624 112300854554H24334Hs.26125ESTs 112513868425868425Hs.13809hypothetical protein 112514868568868568Hs.183373src homology 3 domain-containing protein 1 112522868763868857Hs.265499ESTs $

112540870467869751 gb:yi40a10.s1 Soares placenta Nb2HP Homo 428655873565H05769Hs.188757Homo Sapiens, clone MGC:5564, mRNA, comp 129534873640AK002126Hs.11260hypothetical protein 112597878376878376Hs.29733EST

2~ 112732892453892453Hs.34590ESTs 451798T03865BE297567Hs.27047hypothetical protein 112888T03872AW195317Hs.107716hypothetical protein 131863T10072AI656378Hs.33461ESTs 112911T10080AW732747Hs.13493like mouse brain protein 2$ 132215T10132AL035703Hs.4236KIAA0478 gene product 11293'1T15343T02966Hs.167428ESTs 112984T23457T16971Hs.289014ESTs, Weakly similar to A43932 mucin 2 p 112998T23555H11257Hs.22968Homo sapiens clone IMAGE:451939, mRNA
se 133376T23670BE618768Hs.7232acetyl-Coenzyme A
carboxylase alpha 3~ 113026T23948AA376654 eukaryotlc translation initiation factor 113070T33464AB032977Hs.6298KIAA1151 protein 410781T34413AI375672Hs.165028ESTs 113074T34611AK001335Hs.31137protein tyrosine phosphatase, receptort 113095T40920AA828380Hs.126733ESTs 3$ 113179T55182BE622021Hs.152571ESTs, Highly similar to IGF-II mRNA-bind 113337T77453T77453Hs.302234ESTs 113421T84039A1769400Hs.189729ESTs 113454T86458A1022166Hs.16188ESTs 113481T87693T87693Hs.204327EST

453345T89350AA302862Hs.90063neurocalcin delta 113557T90945H66470Hs.16004ESTs 113559T90987T79763Hs.14514ESTs 113589T91863A1078554Hs.15682ESTs 113591T91881T91881Hs.200597KIAA0563 gene product 4$ 113619T93783808665Hs.17244hypothetical protein 113683T96687AB035335Hs.144519T-cell leukemiallymphoma 113692T96944AL360143Hs.17936DKFZP434H132 protein 113702T97307T97307 gb:ye53h05.s1 Soaresfetal liver spleen 113717T97764T99513Hs.187447ESTs $~ 113824W48817A1631964Hs.34447ESTs 113840W58343872137Hs.7949DKFZP586B2420 protein 113844W59949AI369275Hs.243010Homo Sapiens cDNA
FLJ14445 fis, clone HE

113902W74644AA340111Hs.100009acyl-Coenzyme A oxidase 1, palmitoyl 113904W74761AF125044Hs.19196ubiquitin-conjugating enzyme HBUCE1 $$ 113905W74802881733Hs.33106ESTs 113931W81205BE255499Hs.3496hypothetical protein 113932W81237AA256444Hs.126485hypothetical protein FLJ12604; KIAA1692 131965W90146W79283Hs.35962ESTs 114035W92798W92798Hs.269181ESTs 114106238412AW602528 gb:RCS-BT0562-260100-011-A02 BT0562 Homo 457308238709AI416988Hs.238272inositol 1,4,5-triphosphate receptor, ty 114161238904BE548222Hs.299883hypothetical protein 424949239103AF052212Hs.153934core-binding factor, runt domain, alpha 457548239930AW069534Hs.279583CGI-81 protein 6$ 128937239939AA251380Hs.10726ESTs, Weakly similar to ALU1 HUMAN ALU
S

432554240012AI479813Hs.278411NCK-associated protein 114277240377A1052229Hs.25373ESTs, Weakly similar to T20410 hypotheti 114304240820AI934204Hs.16129ESTs 114364241680AL117427Hs.172778Homo sapiens mRNA;
cDNA DKFZp566P013 (fr 432620AA005112AA777749Hs.5978LIM domain only 7 129034AA005432AA481157Hs.108110DKFZP547E2110 protein 131881AA010163AW361018Hs.3383upstream regulatory element binding prot 332421AA026356AI909968Hs.108106transcription factor 114465AA026901BE621056Hs.131731hypothetical protein ~$ 451271AA036867AK001644Hs.26156hypothetical protein 332498AA044644AA303661 lymphocyte-specific protein 1 13$

431555 AA046426AI815470Hs.260024Cdc42 effector protein 132944 AA054515T96641Hs.6127Homo Sapiens cDNA:
FLJ23020 fis, clone L

114618 AA084162AW979261Hs.291993ESTs 332509 AA085749AA128376Hs.153884ATP binding protein associated with cell $ 114648 AA101056AA101056 gb;zn25b03.s1 Stratagene neuroepithelium 114658 AA102746AA102383Hs.249190tumor necrosis factor receptor superfami 132456 AA114250AB011084Hs.48924KIAA0512 gene product;

450847 AA126561NM stanniocalcin 1 003155Hs.25590 132225 AA128980AA128980 gb:zo09a11.s1 Stratagene neuroepithelium 1 437197 AA129757W38586 guanine nucleotide ~ binding protein (G
pr 114709 AA129921AA397651Hs.301959proline synthetase co-transcribed (bacte 456926 AA133331AB018284Hs.158688KIAA0741 gene product 114750 AA135958AA887211Hs.129467ESTs 426806 AA136524T19228Hs.172572hypothetical protein 1$ 114763 AA147044AA810755Hs.102500hypothetical protein dJ511 E16.2 114767 AA14BB85AI859865Hs.154443minichromosome maintenance deficient (S.

114774 AA150043AV656017Hs.184325CGI-76 protein 129388 AA151621AA662477Hs.110964hypothetical protein 457742 AA155743BE561824Hs.273369uncharacterized hematopoietic stemiproge 456200 AA156335AA768242Hs.80618hypothetical protein 130207 AA156336AF044209Hs.144904nuclear receptor co-repressor 114798 AA159181AA159181Hs.54900serologically defined colon cancer antig 114800 AA159825219448Hs.131887ESTs, Weakly similar to T24396 hypotheti 114828 AA234185AA252937Hs.283522Homo Sapiens mRNA;
cDNA DKFZp434J1912 (f 2$ 114846 AA234929BE018682Hs.166196ATPase, Class I, type 8B, member 1 114848 AA234935BE614347Hs.169615hypothetical protein 114902 AA236359AW275480Hs.39504hypothetical protein 132271 AA236466AB030034Hs.115175sterile-alpha motif and leucine zipper c 114907 AA236535N29390Hs.13804hypothetical protein dJ462023.2 3~ 420170 AA236935U43374Hs.95631Human normal keratinocyte mRNA

132204 AA236942AA235827Hs.42265ESTs 114928 AA237018AA237018Hs.94869ESTs 132481 AA237025W93378Hs.49614ESTs 114932 AA242751AA971436Hs.16218KIAA0903 protein ' 3$ 314162 AA242760BE041820Hs.38516Homo sapiens, clone MGC:15887, mRNA, com 131006 AA242763AF064104Hs.22116CDC14 (cell division cycle 14, S. cerevi 114935 AA242809H23329Hs.290880ESTs,WeaklysimilartoALU1 FIUMANALUS

4089D8 AA243133BE296227Hs.250822serinelthreonine kinase 437754 AA243495860366Hs.5822Homo sapiens cDNA:
FLJ22120 fis, clone H

4~ 114957 AA243706AW170425Hs.87680ESTs 114974 AA250848AW966931Hs.302649nucleosome assembly protein 1-like 1 114977 AA250868AW296978Ns.87787ESTs 114995 AA251152AA769266Hs.193657ESTs 115005 AA251544A1760825Hs.153042ESTs 4$ 417177 AA251792NM fatty-acid-Coenzyme 004458Hs.81452 A ligase, long-chain 115026 AA252144AA251972Hs.188718ESTs 115045 AA252524AW014549Hs.58373ESTs 115068 AA253461AW512260Hs.87767ESTs 133138 AA255522AV657594Hs.181161Homo Sapiens cDNA
FLJ14643 fis, clone NT

$0 332668 AA255522AV657594Hs.181161ESTs 115114 AA256468AA527548Hs.7527small fragment nuclease 129584 AA256528AV656017Hs.184325CGI-76 protein 115137 AA257976AW968304Hs.56156ESTs 417187 AA258296AB011151Hs.334659hypothetical protein $ 115166 AA258409AF095727Hs.287832myelin protein zero-like $ 1 115167 AA258421AA749209Hs.43728hypothetical protein 436719 AA262077Y11192Hs.5299aldehyde dehydrogenase 5 family, member 115239 AA278650BE251328Hs.73291hypothetical protein 115243 AA278766AA806600Hs.116665KIAA1842 protein 428419 AA280791U49436 KIAA1856 protein 115322 AA280819L08895Hs.78995MADS box transcription enhancer factor 2 413303 AA280828AW836130Hs.75277hypothetical protein 115372 AA282195AW014385Hs.88678ESTs, Weakly similar to Unknown [H.sapie 409962 AA283127U82671Hs.57698Target CAT

6$ 130269 AA284694F05422Hs.168352nucleopodn-like protein 456570 AA291137AA286914Hs.183299ESTs 332675 AA291708BE439944 ESTs 407864 AA293495AF069291Hs.40539chromosome 8 open reading frame 1 115536 AA347193AK001468Hs.62180anillin (Drosophila Scraps homology, act 408799 AA398474AA059412Hs.47986hypothetical protein 115575 AA398512AA393254Hs.43619ESTs 115601 AA400277AA148984Hs.48849ESTs, Weakly similar to ALU4 HUMAN ALU
S

434428 AA400896D14540Hs.199160myeloidllymphoid or mixed-lineage leukem 115683 AA410345AF255910Hs.54650functional adhesion molecule 2 7$ 115715 AA416733BE395161Hs.1390profeasome (prosome, macropain) subunit, 132952 AA425154AI658580Hs.61426Homo sapiens mesenchymal stem cell prote 115819 AA486620Hs.41135endomucin-2 409124AA431418AW292809Hs.50727N-acetylglucosaminidase, alpha-(Sanfili 115895AA436182AB033035Hs.51965KIAA1209 protein 458073AA437099AA192669Hs.45032ESTs 115962AA446585A1636361Hs.179520hypothetical protein 115967AA446887AI745379Hs.42911ESTs 115974AA447224BE513442Hs.238944hypothetical protein 115985AA447709AA447709Hs.268115ESTs, Weakly similar to T08599 probable 129254AA453624AA252468Hs.1098DKFZp434J1813 protein 1 446730AA455044BE384932Hs.64313ESTs, Weakly similar ~ to AF2571821 G-pro 116095AA456045AA043429Hs.62618ESTs 426856AA460454819768Hs.172788ALEX3 protein 116210AA476494BE622792Hs.172788ALEX3 protein 116213AA476738AA292105Hs.326740hypothetical protein 1$ 432645AA481422D14041Hs.347340H-2K binding factor-2 116265AA482595BE297412Hs.55189hypothetical protein 129334AA485084AW157022Hs.343551hypothetical protein 116274AA485431AI129767Hs.182874guanine nucleotide binding protein (G
pr 426002AA489638BE514376Hs.165998PAI-1 mRNA-binding protein 116331AA491000N41300Hs.71616Homo Sapiens mRNA;
cDNA DKFZp586N1720 (f 116333AA491250AF155827Hs.203963hypothetical protein 132994AA505133AA112748Hs.279905clone HQ0310 PR00310p1 418538AA598447BE244323Hs.85951exportin, tRNA (nuclear export receptor 116391AA599243T86558Hs.75113general transcription factor IIIA

116394AA599574NM lipase, endothelial 006033Hs.65370 134531AA600153AI742845Hs.110713DEK oncogene (DNA
binding) 116417AA609309AW499664 Human clone 23826 mRNA sequence 116429AA609710AF191018Hs.279923putative nucleotide binding protein, est 116439AA610068AA251594Hs.43913PIBF1 gene product 3 116459AA621399880137Hs.302738Homo sapiens cDNA:
~ FLJ21425 fis, clone C

427505AA621752AA361562Hs.17876126S proteasome-associated pad1 homolog 409633C21523AW449822Hs.55200ESTs 116541D12160D12160Hs.249212polymerase (RNA) III
(DNA directed) (155 132557D19708AA114926Hs.169531ESTs 3 414964D25801AA337548Hs.333402hypothetical protein $ MGC12760 116571D45652D45652Hs.211604gb:HUMGS02848 Human adult lung 3' direct 451522D60208BE565817Hs.26498hypothetical protein 421919D80504AJ224901Hs.109526zinc fingerprotein198 116643F03010AI367044Hs.153638myeloidllymphoid or mixed-lineage leukem 40 116661F04247861504 gb:yh16a03.s1 Soares infant brain 1NIB
H

116715F10966AL117440Hs.170263tumor protein p53-binding protein,1 116729F13700BE549407Hs.115823ribonuclease P, 40kD
subunit 318709H05063852576Hs.285280Homo sapiens cDNA:
FLJ22096 fis, clone H

418999H16758NM_000121Hs.89548 erythropoietin receptor 4$ 116773H17315AI823410Hs.343581karyopherin alpha 1 (importin alpha 5) 116780H22566H22566Hs.63931ESTs 453884H48459AA355925Hs.36232KIAA0186 gene product 116819H53073H53073Hs.93698EST

427278H56559AL031428Hs.174174KIAA0601 protein $ 407833H57957AW955632Hs.66666ESTs, Weakly similar 0 to S19560 proline-r 116844H64938H64938Hs.337434ESTs, Weakly similar to A46010 X-linked 116845H64973AA649530Hs.348148gb:ns44f05.s1 NCI-CGAP
AIv1 Homo sapiens 116892H69535AI573283Hs.38458ESTs 116925H73110H73110Hs.260603ESTs, Moderately similar to A47582 B-cel $$ 116981H81783N29218Hs.40290ESTs 453133H86259AC005757Hs.31809hypothetical protein 117031H88353H88353Hs.347265gb:yw21a02.s1 Morton Fetal Cochlea Homo 117034HS8639072209 YY1-associatedfactor2 431129H88675AL137751Hs.263671Homo Sapiens mRNA;
cDNA DKFZp43410812 (f 417861H93708AA334551 sperm specific antigen 117280N22107M18217Hs.172129Homo Sapiens cDNA:
FLJ21409 fis, clone C

117344N24046819085Hs.210706Homo Sapiens cDNA
FLJ13182 fis, clone NT

117422N27028AI355562Hs.43880ESTs, Weakly similar to A46010 X-linked 117475N30205N30205Hs.93740ESTs, Weakly similar to 138022 hypothe6 65 117487N30621N30621Hs.44203ESTs 117937N33258AF044209Hs.144904nuclear receptor co-repressor 130207N33258AF044209Hs.144904nuclear receptor co-repressor 117549N33390N33390Hs.44483EST

117683N40180N40180 gb:yy44d02.s1 Soares multiple-sclerosis_ 117710N45198N45198Hs.47248ESTs, Highly similar to similar to Cdc14 117791N48325N48325Hs.93956EST

117822N48913AA706282Hs.93963ESTs 422544N49394AB018259Hs.118140KIAA0716 gene product 117895N50656AW450348Hs.93996ESTs, Highly similarto SORL_HUMAN SORTI

7$ 452259N50721AA317439Hs.28707signal sequence receptor, gamma (translo 133057N53143AA465131Hs.64001Homo Sapiens clone 25218 mRNA sequence 118103 N55326AA401733Hs.184134ESTs 118111 N55493N55493 gb:yv50c02.s1 Soares fetal liver spleen 118129 N57493N57493 gb:yy54c08.s1 Soares_multiple_sclerosis 118278 N62955N62955Hs.316433Homo sapiens cDNA
FLJ11375 fis, clone HE

$ 118329 N63520N63520 gb:yy62f01.s1 Soares_multiple_sclerosis_ 118336 N63604BE327311Hs.47166HT021 417098 N64166AB017365Hs.173859frizzled (Drosophila) homolog 7 118363 N64168AI183838Hs.48938hypothetical protein 118364 N64191N46114Hs.29169hypothetical protein 118475 N66845N66845 gb:za46c11.s1 Soaresfetal liver spleen 118491 N67135AV647908Hs.90424Homo Sapiens cDNA:
FLJ23285 fis, clone H

118500 N67295W32889Hs.154329ESTs 118584 N68963AW136928 gb:Ul-H-B11-adp-d-08-0-ULs1 NCI CGAP_Su 4 Peptidylprolyl isomerase C (cyclophilin 1$ 118661 N70777AL137554Hs.49927protein kinase NYD-SP15 118684 N71364N71313Hs.163986Homo Sapiens cDNA:
FLJ22765 fis, clone K

118689 N71545AW390601Hs.184544Homo sapiens, clone IMAGE:3355383, mRNA, 118690 N71571N71571Hs.269142ESTs 118766 N74456N74456Hs.50499EST

2~ 118793 N75594N75594Hs.285921ESTs, Moderately similar to T47135 hypot 118817 N79035AI668658Hs.50797ESTs 118844 N80279AL035364Hs.50891hypothetical protein 118919 N91797AW452696Hs.130760myosin phosphatase, target subunit 2 129558 N92454AW580922Hs.180446karyopherin (importin) beta 1 2$ 407604 N94581AW191962Hs.288061collagen, type VIII, alpha 2 118996 N94746N94746Hs.274248hypothetical protein 119021 N98238N98238Hs.55185ESTs 119039 802384A1160570Hs.252097pregnancy specific beta-1-glycoprotein 119063 816833816833Hs.53106ESTs, Moderately similar to ALU1 HUMAN A

3~ 332622 841828810674 CSR1 protein 119111 843203T02865Hs.328321EST

415115 846395AA214228Hs.127751hypothetical protein 119146 858863858863Hs.91815ESTs 449224 878248AW995911Hs.299883hypothetical protein 3 119239 T11483T11483 gb:CHR90049 Chromosome $ 9 exon Homo sapie 119281 T16896AI692322Hs.65373ESTs, Weakly similar to T02345 hypotheti 119298 T23820NM cyclinT2 001241Hs.155478 126502 T30222T10077Hs.13453hypothetical protein 419983 W15275W55956Hs.94030Homo sapiens mRNA;
cDNA DKFZp586E1624 (f 119558 W38194W38194 Empirically selected from AFFX single pr 429641 W42414AW081883Hs.211578Homo sapiens cDNA:
FLJ23037 fis, clone L

419445 W49632AA884471Hs.90449Human clone 23908 mRNA sequence 119650 W57613882342Hs.79856ESTs, Weakly similar to S65657 alpha-1C-119654 W57759W57759 gb:zd20g11.s1 Soares-fetal-heart ,NbHH19W

4$ 119683 W61118W65379Hs.57835ESTs 119694 W65344AA041350Hs.57847ESTs, Moderately similar to ICE4_HUMAN C

119718 W69216W69216Hs.92848ESTs 410365 W69379AI287518 Homo Sapiens mRNA;
cDNA DKFZp586D0923 (f 119938 W86728AW014862Hs.58885ESTs $~ 120128 238499BE379320Hs.91448MKP-1 like protein tyrosine phosphatase 120130 238630AA045767Hs.5300bladder cancer associated protein 120148 239494F02806Hs.65765ESTs 120155 239623239623Hs.65783ESTs 451979 240071F06972Hs.27372BMX non-receptor tyrosine kinase $$ 120183 240174AW082866Hs.65882ESTs 120184 240182240182Hs.65885EST

120211 240904240904Hs.66012EST

120245 AA166965AW959615Hs.111045ESTs 120247 AA167500AA167500Hs.103939EST

120254 AA169599W90403Hs.111054ESTs 120259 AA171724AW014786Hs.192742hypothetical protein 120260 AA171739AK000061Hs.101590hypothetical protein 120275 AA177105AA177105Hs.78457solute tamer family 25 (mitochondrial 120284 AA182626AA179656 gb:zp54e11.s1 Stratagene NT2 neuronal pr 6$ 417735 AA186324AA188175Hs.82506KIAA1254 protein 422137 AA192099AJ236885 zinc finger protein 148 (pHZ-52) 120302 AA192173AA837098Hs.269933ESTs 120303 AA192415A1216292Hs.96184ESTs 120305 AA192553AW295096Hs.101337uncoupling protein 3 (mitochondrial, pro 120319 AA194851T57776Hs.191094ESTs 408729 AA195520AA195764Hs.72639ESTs 120326 AA196300AA196300Hs.21145hypothetical protein RG083M05.2 133145 AA196549H94227Hs.6592Homo Sapiens, clone IMAGE:2961368, mRNA, 120327 AA196721AK000292Hs.130732hypothetical protein 7$ 120328 AA196979AA923278Hs.290905ESTs, Weakly similar to protease [H.sapi 120340 AA206828AA206828 gb:zq80b08.s1 Stratagene hNT neuron (937 13~

417122 AA207123AI906291Hs.81234immunoglobulin superfamily, member 3 131522 AA214539AI380040Hs.239489TIA1 cytotoxic granule-associated RNA-bi 421787 AA226914AA227068Hs.108301nuclear receptor subfamily 2, group C, m 120375 AA227260AF028706Hs.111227Zic family member 3 (odd-paired Drosophi S 120376 AA227469AA227469 gb:zr18a07.s1 Stratagene NT2 neuronal pr 120390 AA233122AA837093Hs.111460calciumlcalmodulin-dependent protein kin 410804 AA233334064820 Hs.66521Machado-Joseph disease (spinocerebellar 434223 AA233347AI825842Hs.3776zinc finger protein 312771 AA233714AA018515Hs.264482Homo Sapiens mRNA;
cDNA DKFZp761A0411 10120396 AA233796AA134006Hs.79306eukaryotic translation initiation factor 120409 AA235050AA235050 gb:zs38e04.s1 Soares NhHMPu-S1 Homo sapi 120414 AA235704AW137156Hs.181202hypothetical protein 120420 AA236031AI128114Hs.112885spinal cord-derived growth factor-B

120422 AA236352AL133097Hs.301717hypothetical protein DKFZp434N1928 1$419326 AA236390W94915 Hs.42419ESTs 120423 AA236453AA236453Hs.18978Homo sapiens cDNA:
FLJ22822 fis, clone K

120435 AA243370AA243370Hs.96450EST

120453 AA250947AA250947Hs.170263tumor protein p53-binding protein,1 120455 AA251083AA251720Hs.104347ESTs, Weakly similar toALUC_HUMAN Jill 120456 AA251113AA488750Hs.88414BTB and CNC homology 1, basic leucine zi 120473 AA251973AA251973Hs.269988ESTs 128922 AA252023A1244901Hs.9589ubiquilin 1 120477 AA252414AA252414Hs.43141DKFZP727C091 protein 120479 AA252650AF006689Hs.110299mitogen-activated protein kinase kinase 2.5120488 AA255523AW952916Hs.63510KIAA0141 gene product 120510 AA258128AI796395Hs.111377ESTs 120527 AA262105AA262105Hs.4094Homo sapiens cDNA
FLJ14208 fis, clone NT

120528 AA262107AI923511Hs.104413ESTs 120529 AA262235A1434823Hs.104415ESTs 3~120541 AA278298W07318 Hs.240M-phase phosphoprotein 120544 AA278721BE548277Hs.103104ESTs 120562 AA280036BE244580Hs.342307hypothetical protein 120569 AA280648AA807544Hs.24970ESTs, Weakly similar to B34323 GTP-bindi 120571 AA280738A8037744Hs.34892KIAA1323 protein 35120572 AA280794H39599 Hs.294008ESTs 129434 AA280837AW967495Hs.186644ESTs 130529 AA280886AA178953Hs.309648gb:zp39e03.s1 Stratagene muscle 937209 H

120575 AA280934AW978022Hs.238911hypothetical protein DKFZp762E1511; KIAA

409339 AA281535A8020686Hs.54037ectonucleotide pyrophosphataselphosphodi 120591 AA281797AF078847Hs.191356general transcription factor IIH, polype 120593 AA282047AA748355Hs.193522ESTs 430275 AA283002211773 Hs.237786zinc finger protein 440303 AA283709AA306166Hs.7145calpain 7 120609 AA283902AW978721Hs.266076ESTs, Weakly similar to A46010 X-linked 4$409702 AA284108AI752244 eukaryo6c translation elongation factor 456870 AA284109AI241084Hs.154353nonselective sodium potassiumlproton exc 132614 AA284371AA284371Hs.118064similar to rat nuclear ubiquitous casein 458750 AA284744AA115496Hs.336898Homo sapiens, Similar to RIKEN cDNA 1810 135376 AA284784BE617856Hs.99756mitochondria) ribosome recycling factor 50120621 AA284840AW961294Hs.143818hypothetical protein 452279 AA286844AA286844Hs.61260hypothetical protein 332484 AA287032AW172431Hs.13012ESTs 120644 AA287038AI869129Hs.96616ESTs 120660 AA287546AA286785Hs.99677ESTs 55135370 AA287553BE622187Hs.99670ESTs, Weakly similar to 138022 hypotheti 120661 AA287556AA287556Hs.263412ESTs, Weakly similar to ALUB_HUMAN !III

429828 AA287564AB019494Hs.225767IDN3 protein 452291 AA291015AF015592Hs.28853CDC7 (cell division cycle 7, S. cerevisi 120699 AA291716AI683243Hs.97258ESTs, Moderately similar to S29539 ribos 100690 AA291749AA383256Hs.1657estrogen receptor 120726 AA293656AA293655Hs.21198ESTs 120737 AA302430AL049176Hs.82223chordin-like 120745 AA302809AA302809 gb:EST10426 Adipose tissue, white I Homo 443574 AA302820083993 Hs.321709purinergic receptor P2X, ligand-gated io 6$120750 AA310499AI191410Hs.96693ESTs, Moderately similar to 2109260A B c 120761 AA321890AA321890 branched chain keto acid dehydrogenase E

120768 AA340589AA340589Hs.104560EST

120769 AA340622A1769467Hs.9475ESTs 135232 AA342457AL038812Hs.96800ESTs, Moderately similar to ALU7-HUMAN A

120793 AA342864AA342864Hs.96812ESTs 120796 AA342973A1247356Hs.96820ESTs 120809 AA346495AA346495 gb:EST52657 Fetal heart II Homo sapiens 332633 AA347573AL120071Hs.48998fibronectin leucine rich transmembrane p 120825 AA347614AI280215Hs.96885ESTs 120827 AA347717AA382525Hs.132967Human EST clone 122887 mariner transposo 120839 AA348913AA348913 gb:EST55442 Infant adrenal gland II
Homo 120850 AA349647AA349647 Homo sapiens cDNA
Hs.96927 FLJ12573 fis, clone NT

120852 AA349773AA349773 ESTs Hs.191564 128852 AA350541840622 Hs.106601ESTs Hs.96986 120870 AA357172AA357172 ESTs, Moderately similar Hs.292581 to ALU1 HUMAN A

120894 AA370132AA370132 ESTs Hs.97063 435737 AA370472AF229839 I-kappa-B-interacting Hs.173202 Ras-like protein 120897 AA370867AA370867 ESTs, Moderately similar Hs.97079 to AF1746051 F

120915 AA377296AL135556 ESTs Hs.97104 120935 AA383902AL048409 ESTs, Weakly similar Hs.97177 to ALU1 HUMAN ALU
S

120936 AA385934AA385934 EST, Highly similar Hs.97184 to (defline not avai Hs.97186 Hs.104632 417632 AA386266820855 Hs.5422glycoprotein M6B

5 Hs.104684 120985 AA398222A1219896 ESTs Hs.97592 120988 AA398235AA398235 ESTs Hs.97631 121008 AA398348AA398348 Human DNA sequence Hs.130546 from clone RP11-251J8 Hs.97641 121032 AA398504AA393037 ESTs Hs.161798 121033 AA398505AA398505 ESTs Hs.97360 121034 AA398507AL389951 nucleoporin 50kD
Hs.271623 121035 AA398523AA398523 ESTs Hs.210579 121058 AA398625AA398625 ESTs Hs.97391 121060 AA398632AA398632 ESTs Hs.97395 121061 AA398633AA393288 ESTs Hs.97396 121091 AA398894AA398894 ESTs, Moderately similar Hs.97657 to ALU8_HUMAN A

Hs.97658 121094 AA398900AA402505 gb:zt62h10.r1 Soares testis_NHT Homo sap 3 121096 AA398904AA398904 ESTs 0 Hs.332690 121115 AA399122AA398187 ESTs, Weakly similar Hs.104682 to mitochondria) ci 121121 AA399371AA399371 similar to SALL1 (sal Hs.189095 (Drosophila)-like 121122 AA399373AI126713 ESTs, Highly similar Hs.192233 to T00337 hypotheti 121125 AA399441AL042981 KIAA1201 protein Hs.251278 3$ 121151 AA399636AA399636 ESTs Hs.143629 121153 AA399640AA399640 ESTs Hs.97694 121163 AA399680A1676062 ESTs Hs.111902 121176 AA400080AL121523 ESTs Hs.97774 121192 AA400262AA400262 ESTs Hs.190093 40 121223 AA400725A1002110 ESTs, Weakly similar Hs.97169 to dJ667H12.2.1 [H.

121227 AA400748AA400748 Homo Sapiens mRNA;
Hs.97823 cDNA DKFZp434D024 (fr 121231 AA400780AA814948 ESTs,WeaklysimilartoALUC
Hs.96343 HUMAN!I!!

121278 AA401631AA037121 Homo sapiens cDNA
Hs.98518 FLJ11490 fis, clone HE

121279 AA401688AA292873 ESTs Hs.177996 45 121282 AA401695AA401695 ESTs Hs.97334 121299 AA402227AA402227 tropomodulin 3 (ubiquitous) Hs.22826 121301 AA402329NM 006202Hs.89901phosphodiesterase 4A, cAMP-specific (dun 121302 AA402398AA402587 LAT1-3TM protein Hs.325520 Hs.97316 121305 AA402468AA402468 ESTs Hs.291557 134721 AA403268AK000112 hypothetical protein Hs.89306 FLJ20105 121323 AA403314AA291411 ESTs Hs.97247 Hs.97842 444422 AA404260A1768623 ESTs Hs.108264 $$ 131074 AA404271016125 Hs.181581glutamate receptor, ionotropic, kainate 121344 AA405026AA405026 ESTs Hs.193754 121348 AA405182AA405182 ESTs Hs.97973 121350 AA405237AA405237 gb:ztO6e10.s1 NCI-CGAP-GCB1 Homo Sapiens HS.98001 60 121402 AA406063AA406063 ESTs Hs.98003 Hs.98004 Hs.98019 121431 AA406335AA035279 ESTs Hs.176731 121471 AA411804AA411804 ESTs Hs.261575 65 121474 AA411833AA402335 ESTs, Highly similarto Hs.188760 Trad (H.sapiens]

121526 AA412219AW665325 ESTs Hs.98120 121530 AA412259AA778658 ESTs Hs.98122 121558 AA412497AA412497 gb:zt95g12.s1 Soares-testis_NHT
Homo sap 121559 AA412498AI192044 ESTs Hs.104778 121584 AA416586A1024471 ESTs Hs.98232 Hs.98185 121612 AA416874AA416874 ESTs Hs.98168 121737 AA421133AA421133 erythrocyte transmembrane Hs.104671 protein Hs.143835 436032 AA422079AA150797 latexin protein Hs.109276 121784 AA423837T90789 Hs.94308RAB35, member RAS
oncogene family 121802 AA424328AI251870Hs.188898ESTs 121803 AA424339AI338371Hs.157173ESTs 135286 AA424469AW023482Hs.97849ESTs 332778 AA424469AW023482Hs.97849ESTs $ 121806 AA424502AA424313Hs.98402ESTs 129517 AA425004AW972853Hs.112237ESTs 121845 AA425734AI732692Hs.165066ESTs, Moderately similar to ALU2 HUMAN A

121853 AA425887AA425887Hs.98502hypothetical protein 121891 AA426456AA426456Hs.98469ESTs 1 121895 AA427396AA427396 gb:zw33a02.s1 Soares ~ ovary tumor NbHOT
H

121899 AA427555855341 Hs.50421KIAA0203 gene product 121917 AA428218AA406397Hs.139425ESTs 121918 AA428242BE274689Hs.184175chromosome 2 open reading frame 3 121919 AA428281AA428281Hs.98560EST

1 121941 AA428865AA428865Hs.98563ESTs $

121942 AA428994AW452701Hs.293237ESTs 121970 AA429666AA429666Hs.98617EST

121993 AA430181AW297880Hs.98661ESTs 418706 AA430184073524 Hs.87465ATPIGTP-binding protein 122022 AA431293AA431293Hs.98716ESTs, Moderately similar to T42650 hypot 122050 AA431478AI453076 ELAV (embryonic lethal, abnormal vision, 122051 AA431492AA431492Hs.98742EST

122055 AA431732AA431732Hs.98747EST

122105 AA432278AW241685Hs.98699ESTs ~$ ~ 122125 AK000492Hs.98806hypothetical profein 135235 AA435512AW298244Hs.266195ESTs 122162 AA435698AA628233Hs.79946cytochrome P450, subfamily XIX (aromatiz 422072 AA435711AB018255Hs.111138KIAA0712 gene product 415106 AA435815040763 Hs.77965peptidyl-prolyl isomerase G (cyclophilin 122186 AA435842AA398811Hs.104673ESTs 122235 AA436475AA436475Hs.112227membrane-associated nucleic acid binding 412970 AA436489AB026436Hs.177534dual specificity phosphatase 419288 AA442060AA256106Hs.87507ESTs 122310 AA442079AW192803Hs.98974ESTs, Weakly similar to S65824 reverse t 3 122334 AA443151BE465894Hs.98365ESTs, Weakly similar $ to LB4D HUMAN NADP-122382 AA446133AA446440Hs.98643ESTs 122425 AA447145AB007859Hs.100955KIAA0399 protein 122431 AA447398AA447398Hs.99104ESTs 122450 AA447643AA447643Hs.112095hypothetical protein DKFZp434F1819 4~ 426284 AA447742AJ404468Hs.284259dynein, axonemal, heavy polypeptide 122477 AA448226AA448226Hs.324123ESTs 122500 AA448825AA448825Hs.99190ESTs 122522 AA449444AA299607Hs.98969ESTs 122536 AA450087AF060877Hs.99236regulafor of G-protein signalling 20 4$ 122538 AA450211AA450211Hs.99239ESTs 122540 AA450244AA476741Hs.98279ESTs, Weakly similar to A43932 mucin 2 p 122560 AA452123AW392342Hs.283077centrosomal P4.1-associated protein; unc 421919 AA452155AJ224901Hs.109526zinc fingerprotein198 122562 AA452156AA452156 gb:zx29c03.s1 Soares total-fetus_Nb2HF8_ $~ 122585 AA453036AI681654Hs.170737hypothetical protein 122608 AA453526AA453525Hs.143077ESTs 122635 AA454085AA454085 gb:zx33a08.s1 Soares_total-fetus-Nb2HF8-122636 AA454103AW651706Hs.99519hypothetical protein 122653 AA454642AW009166Hs.99376ESTs $ 122660 AA454935AI816827Hs.180069nuclear respiratory $ factor 1 122703 AA456323AA456323Hs.269369ESTs 122724 AA457395AA457395Hs.99457ESTs 122749 AA458850AA458850Hs.293372ESTs, Weakly similar to B34087 hypotheti 122772 AA459662AW117452Hs.99489ESTs 60 430242 AA459668066669 Hs.2366423-hydroxyisobutyryl-Coenzyme A hydrolase 429838 AA459679AW904907Hs.30732hypothetical protein FLJ13409; KIAA1711 122777 AA459702AK001022Hs.214397hypothetical protein FLJ10160 similar to 135362 AA460017AA978128Hs.99513ESTs, Weakly similar to T17454 diaphanou 122798 AA460324AW366286Hs.145696splicing factor (CC1.3) 6$ 122837 AA461509AA461509Hs.293565ESTs, Weakly similar to putative p150 [H

122860 AA464414AA464414 gb:zx78g01.s1 Soares ovary tumor NbHOT
H

122861 AA464428AA335721Hs.213628ESTs 122910 AA470084AA470084Hs.98358ESTs 132899 AA476606AA476606Hs.59666SMAD in the antisense orientation 70 122967 AA478521AA806187Hs.289101glucose regulated protein, 58kD

422845 AA478523AA317841Hs.7845hypothetical protein 123009 AA479949AA535244Hs.78305RAB2, member RAS oncogene family 128917 AA481252AI365215Hs.206097oncogene TC21 123081 AA485351A1815486Hs.243901Homo sapiens cDNA
FLJ20738 fis, clone HE

~$ 123133 AA487264AA487264Hs.154974Homo sapiens mRNA;
cDNA DKFZp667N064 (fr 123184 AA489072BE247767Hs.18166KIAA0870 protein 332467AA489630NM_014700Hs.119004 KIAA0665 gene product 123233AA490225AW974175Hs.151875ESTs, Weakly similar to MAPB_HUMAN MICRO

123234AA490227NM down-regulatoroftranscription1,TBP-b 001938Hs.16697 123236AA490255AW968504Hs.123073CDC2-related protein kinase 7 $ 123255AA490890AA830335Hs.105273ESTs 430015AA490916AW768399Hs.106357ESTs 448892AA490925AF084535Hs.22464epilepsy, progressive myoclonus type 2, 123259AA490955AI744152Hs.283374ESTs, Weakly similar to CA15-HUMAN COLLA

123284AA495812AA488988Hs.293796ESTs 123286AA495824AA495824Hs.188822ESTs, Weakly similar to A46010 X-linked 123315AA496369AA496369 gb:zv37d10.s1 Soares ovary tumor NbHOT
H

457397AA504125AW969025Hs.109154ESTs 433049AA521473AU076668Hs.334884SEC10 (S. cerevisiae)-like 123421AA598440AA598440Hs.291154EST, Weakly similar to 138022 hypothetic 1$ 123449AA598899AL049325Hs.112493Homo sapiens mRNA;
cDNA DKFZp564D036 (fr 426981AA599244AL044675Hs.173081KIAA0530 protein 409986AA599694NM KIAA0133 gene product 014777Hs.57730 123497AA600037AA765256Hs.135191ESTs, Weakly similar to unnamed protein 123604AA609135AA609135Hs.293076ESTs 123712AA609684AA609684 Homo Sapiens cDNA:
FLJ21543 fis, clone C

123731AA609839AA609839Hs.334437gb:ae62f01.s1 Stratagene lung carcinoma 123800AA620423AA620423Hs.112862EST

123841AA620747AA620747Hs.112896ESTs 123929AA621364AA621364Hs.112981ESTs 2$ 123978C20653T89832Hs.170278ESTs 133184D20085AA001021Hs.6685thyroid hormone receptor interactor 8 132835D20749283844Hs.5790hypothetical protein dJ37E16.5 435147D51285AL133731Hs.4774Homo sapiens mRNA;
cDNA DKFZp761C1712 (f 128695D59972NM cullin 5 003478Hs.101299 30 124029F04112F04112Hs.312553gb:HSC2JH062 normalized infant brain cDN

124057F13604AA902384Hs.73853bone morphogenetic protein 2 449316H01662AI609045Hs.321775hypothetical protein DKFZp434D1428 130973H05135AI638418Hs.1440DEADIH (Asp-Glu-Ala-AspIHis) box polypep 124106H12245H12245 gb:ym17a12.r1 Soares infant brain 1NIB
H

3$ 124136H22842H22842Hs.101770EST

124165H30894H30039Hs.107674ESTs 429627H43442NM_015340Hs.2450 leucyl-tRNA synthetase, mitochondrial 124178H45996BE463721Hs.97101putative G protein-coupled receptor 129948H69281AI537162Hs.263988ESTs 452114H69485N22687Hs.8236ESTs 124+D826254 H69899H69899gb:yu70c12.s1 Weizmann Olfactory Epithet 129056H70627AI769958Hs.108336ESTs, Weakly similar to ALUE-HUMAN 1111 427580H73260AK001507Hs.44143Homo Sapiens clone FLB6914 PR01821 mRNA, 426793H77531X89887Hs.172350HIR (histone cell cycle regulation defec 4S 124274H80552H80552Hs.102249EST

129078H80737A1351010Hs.102267lysosomal 457658H93412AW952124Hs.13094presenilins associated rhomboid-like pro 124315H94892NM v-rat simian leukemia 005402Hs.288757 viral oncogene hom 437712H95643X04588Hs.85844neurotrophic tyrosine kinase, receptor, 50 124324H96552H96552Hs.159472Homo Sapiens cDNA:
FLJ22224 fis, clone H

452933H97146AW391423Hs.288555Homo Sapiens cDNA;
FLJ22425 fis, clone H

132231H99131AA662910Hs.42635hypothetical protein DKFZp434K2435 421877H99462AW250380Hs.109059mitochondrial ribosomal protein L12 443123H99837AA094538Hs.272808putative transcription regulation nuclea 5$ 132963N22140AA099693Hs.34851epsilon-tubulin 420473N22197AL118782Hs.300208Sec23-interacting protein p125 417381N23756AF164142Hs.82042solute tamer family 23 (nucleobase tra 130365N24134W56119Hs.155103eukaryotic translation initiation factor 456610N24195AF172066Hs.106346retinoic acid repressible protein 439311N26739BE270668Hs.151945mitochondrial ribosomal protein L43 124383N27098N27098Hs.102463EST

124387N27637N27637Hs.109019ESTs 129341N33090A1193519Hs.226396hypothefical profein 419793N35967AI364933Hs.168913serinelthreonine kinase 24 (Ste20, yeast 6$ 124433N39069AA280319Hs.288840PR01575 protein 124441N46441AW450481Hs.161333ESTs 132338N48270AA353868Hs.182982golgin-67 436575N48365AI473114 ESTs 124466N51316810084Hs.113319kinesin heavy chain member 2 408048N51499NM-007203Hs.42322 A kinase (PRKA) anchor protein 2 124483N53976AI821780Hs.179864ESTs 124484N54157H66118Hs.285520ESTs, Weakly similar to 2109260A B cell 124485N54300AB040933Hs.15420KIAA1500 protein 124494N54831N54831Hs.271381ESTs, Weakly similar to 138022 hypotheti ~5 129200N59849N59849Hs.13565Sam68-like phosphotyrosine protein, T-ST

124527N62132N79264Hs.269104ESTs 124532 N62375N62375 Hs.102731EST

133213 N63138AA903424 ESTs Hs.6786 124539 N63172D54120 Hs.146409cell division cycle 42 (GTP-binding prot 129196 N63787BE296313 ESTs, Weakly similar Hs.265592 to 138022 hypotheti $ 124575 N68168N68168 gb:za11c01.s1 Soaresfetalliverspleen 124576 N68201N68201 ESTs, Weakly similar to 138022 hypotheti 124577 N68300N68300 Hs.138485gb:za12g07.s1Soaresfetalliverspleen 124578 N68321N68321 Hs.231500EST

124593 N69575N69575 Hs.102788ESTs 1 128501 N75007AL133572 protein containing ~ Hs.199009 CXXC domain 2 332434 N75542AI680737 Homo sapiens cDNA
Hs.289068 FLJ11918 fis; clone HE

128473 N90066T78277 Hs.1002930-linked N-acetylglucosamine (GIcNAc) tr 128639 N91246AW582962 CGI-47 protein Hs.102897 124652 N92751W19407 Hs.3862regulator of nonsense transcripts 2; DKF

1$133137 N93214AB002316 KIAA0318 protein Hs.65746 124671 N99148AK001357 Homo sapiens cDNA
Hs.102951 FLJ10495 fis, clone NT

133054 807876AA464836 ESTs, Weakly similar Hs.291079 to T27173 hypotheti 425266 810865J00077 Hs.155421alpha-fetoprotein 124720 811056805283 gb:ye91c08.s1Soaresfetalliverspleen 20124722 811488T97733 Hs.185685ESTs 128944 823930AL137586 anaphase-promoting Hs.52763 complex subunit 7 132965 826589AI248173 hypothetical protein Hs.191460 MGC12936 426504 837588AW162919 RAB2, member RAS oncogene Hs.170160 family-like 438828 837613AL134275 hypothetical protein Hs.6434 DKFZp761F2014 2$124757 838398H11368 Hs.141055Homo sapiens clone 23758 mRNA sequence 124762 839179AA553722 ESTs, Moderately similar Hs.92096 to A46010 X-tin 124773 840923845154 Hs.338439ESTs 135266 841179841179 Hs.97393KIAA0328 protein 427961 841294AW293165 ESTs Hs.143134 30414303 842307NM 004427Hs.165263early development regulator 2 (homolog o Hs.328317 124785 843306W38537 Hs.280740hypothetical protein 124792 844357844357 Hs.48712hypothetical protein 124793 844519844519 gb:yg24h04.s1 Soares infant brain 1N18 H

3$124799 845088845088 gb:yg38g04.s1 Soares infant brain 1N18 H

124812 847948847948 Hs.188732ESTs 124821 851524H87832 Hs.7388ketch (Drosophila)-like 424123 854950AW966158 Homo sapiens cDNA
Hs.58582 FLJ12789 fis, clone NT

124835 855241855241 Hs.101214EST

4~124845 859585859585 Hs.101255ESTs , 124847 860044W07701 Hs.304177Homo sapiens clone FLB8503 PR02286 mRNA, 440630 860872BE561430 Human DNA sequence Hs.239388 from clone RP1-304814 124861 866690867567 Hs.107110ESTs 332503 867266NM-004455Hs.150956exostoses (multiple)-like 4$124879 873588873588 Hs.101533ESTs 124892 879403A1970003 hypothetical protein Hs.23756 similar to swine ac 124906 887647H75964 Hs.107815ESTs 124922 893622893622 Hs.12163eukaryotic translation initiation factor 124940 899599AF068846 heterogeneous nuclear Hs.103804 ribonucleoprotein $0124941 899612AI766661 ESTs,HighlysimilartoAF1613491HSPC0 Hs.27774 124943 T02888AW963279 ESTs, Weakly similar Hs.123373 to ALU1 HUMAN ALU
S

124947 T03170T03170 Hs.100165ESTs 124954 T10465AW964237 KIAA1548 protein Hs.6728 456862 T15418U55184 Hs.154145hypothetical protein $ 410653 T15597BE383768 95 kDa retinoblastoma $ Hs.65238 protein binding pr .

418133 T15652843504 Hs.6181ESTs 440014 T16898AW960782 ash2 (absent, small, Hs.6856 or homeotic, Drosop 131082 T26644A1091121 Homo sapiens cDNA:
Hs.246218 FLJ21781 fis, clone H

124980 T40841T40841 Hs.98681ESTs 124984 T47566BE313210 eukaryotic translation Hs.334798 elongation factor 124991 T50116T50116 gb:yb77c10.s1 Stratagene ovary (937217) 457222 T50145NM-004477Hs.203772FSHD region gene 1 125000 T58615T58615 Hs.235887ESTs 132932 T59940AW118826 Homo Sapiens cDNA:
Hs.6093 FLJ22783 fis, clone K

6$444484 T63595AK002126 hypothetical protein Hs.11260 FLJ11264 125008 T64891T91251 gb:yd60a10.s1 Soares fetal liver spleen 125009 T64924T64924 Hs.303046ESTs 445384 T64933T79136 Hs.127243Homo sapiens mRNA
for KIAA1724 protein, 125017 T68875T68875 gb:yc30f05.s1 Stratagene liver (937224) 125018 T69027T69027 Hs.269481sex comb on midleg homolog 1 125020 T69924T69981 gb:yc19d03.r1 Stratagene lung (937210) H

437871 T70353A1084813 ESTs Hs.114088 134204 T79780A1873257 hypothetical protein Hs.7994 FLJ20551 125050 T79951 AW970209 ESTs Hs.111805 ~$125052 T80174T85104 Hs.222779ESTs, Moderately similar to similar to N

125054 T80622T80622 Hs.268601ESTs, Weakly similar to envelope [H.sapi 125063 T85352T85352 gb:yd82d01.s1 Soaresfetalliverspleen 125064 T85373T85373 gb:yd82f07.s1 Soares fetal liver spleen 125066 T86284T86284 gb:yd77b07.s1 Soaresfetalliverspleen 416507 T89579AL045364Hs.79353transcription factor Dp-1 $ 125080 T90360T90360Hs.268620ESTs, Highly similar to ALU6-HUMAN ALU
S

125097 T94328AW576389Hs.335774EST, Moderately similar to S65657 alpha-125104 T95590T95590 gb:ye40a03.s1Soaresfetalliverspleen 135107 T97257T97257Hs.94560ESTs, Moderately similar to 138022 hypot 423122 T97599. AA845462Hs.124024deltex (Drosophila) homolog 1 1 125118 T97620810606Hs.269890gb:yf35f11.s1 Soares ~ fetal liver spleen 125120 T97775T97775Hs.100717EST

134160 T98152T98152Hs.79432fibrillin 2 (congenital contractural ara 125136 W31479AW962364Hs.129051ESTs 125144 W37999AB037742Hs.24336KIAA1321 protein 1$ 125150 W38240W38240 Empirically selected from AFFX single pr 450142 W40150AW207469Hs.24485chondroitin sulfate proteoglycan 6 (bama 131987 W45435AW453069Hs.3657activity-dependent neuroprotective prote 125178 W58202W93127Hs.31845ESTs 125180 W58344W58469Hs.103120ESTs 20 125182 W58650AA451755Hs.263560ESTs 446888 W68736AL030996Hs.16411hypothetical protein 125197 W69106AF086270Hs.278554heterochromatin-like protein 1 133497 W69111BE617303Hs.74266hypothetical protein 429922 W69399297630Hs.226117H1 histone family, member 0 ~,$129232 W69459898881Hs.109655sex comb on midleg (Drosophila)-like 422166 W72424W72424Hs.112405S100 calcium-binding protein A9 (calgran 125209 W72724W72724Hs.103174ESTs, Weakly similar to TSP2-HUMAN THROM

125212 W72834AA746225Hs.103173ESTs 456631 W73955BE383436Hs.108847hypothetical protein 30 125223 W74701AI916269Hs.109057ESTs, Weakly similar to ALU5_HUMAN ALU
S

125225 W76540W74169Hs.16492DKFZP564G2022 protein 125228 W79397AA033982Hs.110059ESTs, Weakly similar to 138022 hypotheti 132393 W85888AL135094Hs.47334hypothetical protein 125238 W86038N99713Hs.109514ESTs 3 125247 W86881AA694191Hs.163914ESTs $

129296 W87804A1051967Hs.110122ESTs 125263 W88942AA098878 gb:zn45g10.r1 Stratagene HeLa cell s3 93 125266 W90022W90022Hs.186809ESTs, Highly similar to LCT2 HUMAN LEUKO

450862 W92272U91543Hs.25601chromodomain helicase DNA binding protei 4~ 452401 W92764NNI_007115Hs.29352 tumor necrosis factor, alpha-induced pro 428243 W93040H05317Hs.283549ESTs 125277 W93227W93227Hs.103245EST

125278 W93523AI218439Hs.129998enhancerofpolycomb1 125280 W93659AI123705Hs.106932ESTs 4$ 448205 W94003W93949Hs.33245ESTs 131844 W94401AI419294Hs.324342ESTs 125284 W94688NM-002666Hs.103253 perilipin 417111 W94787AW016321Hs.82306destdn (actin depolymerizing factor) 445424 238294AB028945Hs.12696cortactin SH3 domain-binding protein $~ 125289 238311T34530Hs.4210Homo sapiens cDNA
' FLJ13069 fis, clone NT

446313 238465H06245Hs.106801ESTs, Weakly similar to PC4259 femtin 431342 238525AW971018Hs.21659ESTs 433227 238538AB040923Hs.106808ketch (Drosophila)-like 428306 238551AB037715Hs.183639hypothetical protein $ 424624 238783AB032947Hs.151301Ca2+dependent activator $ protein for sect 125295 239113AB022317Hs.25887sema domain, immunoglobulin domain (1g), 125298 239255AW972542Hs.289008Homo sapiens cDNA:
FLJ21814 fis, clone H

125300 239591239591Hs.101376EST

448378 239783BE622770Hs.264915Homo sapiens cDNA
FLJ12908 fis, clone NT

60 444582 239920855344Hs.22142cytochrome b5 reductase b58.2 130882 240166AA497044Hs.20887hypothetical protein 128888 240388AI760853Hs.241558ariadne (Drosophila) homolog 2 125310 240646859161Hs.124953ESTs 125315 241697838110Hs.106296ESTs 6$ 125317 299349299348Hs.112461ESTs, Weakly similar to 138022 hypotheG

135096 299394AA081258 zinc finger protein 36 (KOX 18) 1$

Table 3A shows the accession numbers for those pkeys lacking unigenelD's for Table 3. The pkeys in Table 7 lacking unigenelD's are represented within Tables 1-6A. For each probeset we have listed the gene cluster number from which the oligonucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs. These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubIeTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession"
column.
Pkey; Unique Eos probeset identifier number CAT number: Gene cluster number Accession: Genbank accession numbers Pkey CAT Number Accession 2$ AW118940 AA121666 AI832409 AA683475 AI140901 AI623576 Ai801493 AA448691 AI673767 A1076042 AI804327 AA813438 3 $ AA897470 AA907729 AI708679 A1078010 AA452830 AW419160 117034 20113_2 U72209 NM 005748 AI655607 A1052758 AA385199 AW956794 4~ AA568443 AA804610 AI873513 H88639 225371 863456 100752 33207_21T81309 BE019033 894181 BE019198 NM 000612 J03242 4$ T48617 BE313761 H77309 AI207601 X06159 H40413 X03425 $ ~ H68198 H52276 8E207832 N91192 H70332 X07868 X07868 $ $ AA340437 H57125 H58908 H79027 H63450 N74623 893425 6 $ AW885492 AW880519 AA334887 AW878715 W06882 AW630222 ~$ AI985564 AW629495 AW614573 AI859571 AI693486 AA913892 14$

125020 116017_1T69981 T69924 AA078476 1~ 116661 1532859_1861504 F04247 _ AW176446 AA304671 AW583735 T61714 AA316968 AI446615 1$ AA343532 AA083489 AA488005 W52095 W39480 N57402 - M30269 NM_002508 X82245 A1078760 AW957003 D78945 132983 11922_1 M27445 AA650439 AL048816 AV660256 AV660347 _ BE617431 N98537 AA158093 AL047800 M34539 NM 000801 4o H53220 AI471471 AA399303 AA007386 W35106 BE613277 4$ AA338067 N55052 BE398154 BE621210 AA740760 C03739 'J 5 AI699321 AI393601 AW592611 AI146747 AA608921 AA158365 1 ~ A1082545 AW468176 AI608761 A1082748 AI911682 AI248943 1$ AA565955 N20527 AI279782 W46596 AA776573 H23204 135096 33756_2 AA081258 AA160311 W17034 H83596 299393 AI831206 40 103855 84277_1W02363 N80298 AA304486 AW954799 AW805136 AW970817 4S 126872 142696_1AW450979 AA136653 AA136656 AW419381 AA984358 AA492073 5 128510 19829 X94703 NM_004249 852316 T87420 N46403 236855 BE076834 107832 genbanILAA021473 AA021473 .

123523 genbank_AA608588 123533 genbanI~AA608751 132225 genbank_AA128980 125017 genbank_T68875T68875 125063 genbanhT85352T85352 125064 genbank_T85373T85373 125091genbanILT91518 T91518 100964entrez-J00212 J00212 102269entrez_U30245 U30245 125150FOUND enfrez NOT

$ 123964_ _ genbanILC13961 C13961 118111genbanl~N55493 N55493 118129genbanILN57493 N57493 102491entrez_U51010 U51010 118329genbanILN63520 N63520 1 118475genbank_N66845 N66845 ~

118581genbank_N68905 N68905 111514genbank_807998 807998 104534822303 at 822303 12034DgenbanILAA206828 AA206828 15120376genbanILAA227469 AA227469 104787genbank_AA027317 AA027317 120409genbank-AA235050 AA235050 120745genbank-AA302809 AA302809 120809genbank 120839_ genbank-AA348913 AA348913 113702genbank_T97307 T97307 113947genbank_W84768W84768 122562genbank_AA452156 AA452156 ~$122635genbanILAA454085 AA454085 108277genbank_AA064859 AA064859 108403genbank_AA075374 AA075374 122860genbanILAA464414 AA464414 108427genbanILAAD76382 AA076382 3 108439genbank_AA078986 AA078986 131353231290_1 AW411259 H23555 AW015049 A1684275 AW015886 AW068953 108533genbanILAA084415 AA084415 124254genbank_H69899 H69899 3 101447entrez_M21305 M21305 S

101458entrez_M22092 M22092 10166713349_1 NNL005381 M60858 AW373732 AW373724 AW373689 AW373629 4~ AW382712 H05665 F07292 N39875 AA089729 H62556 N42842 812952 4$ AA580453 AW021292 AI267215 AW080082 AW383778 AI933053 AI919097 $ AW380424 AA306040 A1145674 AW300951 AI188579 AI438973 AI305271 124576genbank_N68201 N68201 108931genbank_AA147186 AA147186 108941genbank-AA148650 AA148650 124793genbank_R44519 844519 124799genbanILR45088 845088 103138entre~X65965 X65965 117683genbank.N40180 N40180 65124991genbank T50116 T50116 103432entrez_X97748 X97748 119174genbank_R71234 871234 13367811235_1 AW247252 AA346143 NM 000270 AA381085 N91995 X00737 ' AA381079 AA296473 AA296110 AA315735 AA311617 $ AI699770 AW025156 H69719 AI984717 N69225 AI459856 AA953577 119416genbank_T97186 T97186 119558NOT_FOUND entrez_W38194 W38194 119559NOT_FOUND entrez..W38197 W38197 119654genbanILW57759W57759 121350genbank_AA405237 AA405237 121558genbanILAA412497 AA412497 105985genbank_AA406610 AA406610 1 114648genbank_AA101056 AA101056 $

121895genbank_AA427396 AA427396 100327entre~D55640 D55640 123473genbank-AA599143 AA599143 TABLE 4:
Pkey; Unique Eos probeset identifier number Accession: Accession number used for previous patent filings ExAccn: Exemplar Accession number, Genbank accession number UnigenelD; Unigene number Unigene Title: Unigene gene title Pkey Accession ExAccn UniGene UnigeneTitle 100405D86425 AW291587Hs.82733nidagen 2 100420D86983 D86983Hs.118893Melanoma associated gene 1$ 100481HG1098-HT1098X70377Hs.121489cystatin D

100484HG1103-HT1103NM v-ral simian leukemia 005402Hs.288757 viral oncogene hom 100718HG3342-HT3519BE295928Hs.75424inhibitor of DNA
binding 1, dominant neg 100991J03764 J03836Hs.82085serine (or cysteine) proteinase inhibito 101097L06797 BE245301Hs.89414chemokine (C-X-C
motif), receptor 4 (fus 101168L15388 NM G protein-coupled 005308Hs.211569 receptor kinase 101194L20971 L20971Hs.188phosphodiesterase 4B, cAMP-specific (dun 101261L35545 D30857Hs.82353protein C receptor, endothelial (EPCR) 101345L76380 NM-005795Hs.152175 calcitonin receptor-like 101447M21305 M21305 gb:Human alpha satellite and satellite 3 ~$ 101485M24736 AA296520Hs.89546selectin E (endothelial adhesion molecul 101543M31166 M31166Hs.2050pentaxin-related gene, rapidly induced b 101550M31551 Y00630Hs.75716serine (or cysteine) proteinase inhibito 101560M32334 AW958272Hs.347326intercellular adhesion molecule 2 101674M61916 NM laminin, beta 1 002291Hs.82124 101714M68874 M68874Hs.211587phospholipase A2, group IVA (cytosolic, 101741M74719 NM_003199Hs.326198 transcriptionfactor4 101838M92934 BE243845Hs.75511connective tissue growth factor 101857M94856 BE550723Hs.153179fatty acid binding protein 5 (psoriasis-102012003057 BE259035Hs.118400singed (Drosophila)-like (sea urchin fas 3 102024003877 AA301867Hs.76224EGF-containing fibulin-like $ extracellula 102164018300 NM damage-specific 000107Hs.77602 DNA binding protein 2 (4 102241027109 NM multimerin 007351Hs.268107 102283031384 AW161552Hs.83381guanine nucleofide binding protein 102303033053 033053Hs.2499protein kinase C-like 102564059423 059423Hs.79067MAD (mothers against decapentaplegic, Dr 102663070322 NM karyopherin (importin) 002270Hs.168075 beta 2 102759081607 NM A kinase (PRKA) 005100Hs.788 anchor protein (gravin) 102778083463 AF000652Hs.8180syndecan binding protein (syntenin) 102804089942 NM_002318Hs.83354 lysyl oxidase-like 4$ 102887X04729 J03836Hs.82085serine (or cysteine) proteinase inhibito 102898X06256 NM-002205Hs.149609 integrin, alpha 5 (fibronectin receptor, 102915X07820 X07820Hs.2258matrix metalloproteinase 10 (stromelysin 103036X54925 M13509Hs.83169maUix metalloproteinase 1 (interstitial 103037X54936 BE018302Hs.2894placental growth factor, vascular endoth $0 103095X60957 NM_005424Hs.78824 tyrosine kinase with immunoglobulin and 103158X67235 BE242587Hs.118651hematopoietically expressed homeobox 103166X67951 AA159248Hs.180909peroxiredoxin 1 103185X69910 NM transmembrane protein 006825Hs.74368 (63kD), endoplasmi 103280X79981 084722Hs.76206cadherin 5, type 2, VE-cadherin (vascula $$ 103554218951 AI878826Hs.74034caveolin 1, caveolae protein, 22kD

103850AA187101AA187101Hs.213194hypothetical protein 104465N24990 244203Hs.26418ESTs 104592881003 AW630488Hs.25338protease, serine, 104764AA025351A1039243Hs.278585ESTs 60 104786AA027168AA027167Hs.10031KIAA0955 protein 104850AA040465AL133035Hs.8728hypothetical protein DKFZp434G171 104865AA045136T79340Hs.22575B-cell CLLllymphoma 6, member B (zinc fi 104894AA054087AF065214Hs.18858phospholipase A2, group IVC (cytosolic, 104952AA071089AW076098Hs.345588desmoplakin (DPI, DPII) 6$ 104974AA085918Y12059Hs.278675bromodomain-containing 105178AA187490AA313825Hs.21941AD036 protein 105263AA227926AW388633Hs.6682solute carrier family 7, (cationic amino 105330AA234743AW338625Hs.22120ESTs 105376AA236559AW994032Hs.8768hypothetical protein 105729AA292694H46612Hs.293815Homo Sapiens HSPC285 mRNA, partial cds 105826AA398243AA478756Hs.194477E3 ubiquitin ligase 105977AA406363AK001972Hs.30822hypothetical protein 106008AA411465AB033888Hs.8619SRY (sex determining region Y)-box 18 106031AA412284X64116Hs.171844Homo sapiens cDNA:
FLJ22296 fis, clone H

~$ 106124AA423987H93366Hs.7567Homo sapiens cDNA:
FLJ21962 fis, clone H

1$0 106155AA425309AA425414Hs.33287nuclear factor IIB

106302AA435896AA398859Hs.18397hypothetical protein 106423AA448238AB020722Hs.16714Rho guanine exchange factor (GEF) 15 106793AA478778H94997Hs.16450ESTs $ 107174AA621714BE122762Hs.25338ESTs 107216D51069D51069Hs.211579melanoma cell adhesion molecule 107295T34527AA186629Hs.80120UDP-N-acetyl-alpha-D-galactosamine:polyp 107385U97519NM podocalyxin-like 005397Hs.16426 108756AA127221AA127221Hs.117037ESTs 1 108846AA132983AL117452Hs.44155DKFZP586G1517 protein ~

108888AA135606AA135606Hs.189384gb:z110a05.s1 Soares-pregnan~uterus NbH

109001AA156125A1056548Hs.72116hypothetical protein FLJ20992 similar to 109166AA179845AA219691Hs.73625RAB6 interacting, kinesin-like (rabkines 109456AA232645AW956580Hs.42699ESTs 1 109768F10399F06838Hs.14763ESTs $

110107H16772AW151660Hs.31444ESTs 110906N39584AA035211Hs.17404ESTs 110984N52006AW613287Hs.80120UDP-N-acetyl-alpha-D-galactosamine:polyp 111006N53375BE387014Hs.166146Homer, neuronal immediate early gene, 3 111018N54067AI287912Hs.3628mitogen-activated protein kinase kinase 111133N64436AW580939Hs.97199complement componentC1qreceptor 111760826892BE551929Hs.268754Homo Sapiens cDNA
FLJ11949 fis, clone HE

113073T33637N39342Hs.103042microtubule-associated protein 1B

113195T57112H83265Hs.8881ESTs, Weakly similar to S41044 chromosom 2$ 113923W80763AW953484Hs.3849hypothetical protein FLJ22041 similar to 114521AA046808AW139036Hs.10895740S ribosomal protein S27 isoform 115061AA253217AI751438Hs.41271Homo Sapiens mRNA
full length insert cDN

115096AA255991AI683069Hs.175319ESTs 115145AA258138AA740907Hs.88297ESTs 30 115819AA426573AA486620Hs.41135endomucin-2 115947AA443793847479Hs.94761KIAA1691 protein 116314AA490588AI799104Hs.178705Homo sapiens cDNA
FLJ11333 fis, clone PL

116339AA496257AK000290Hs.44033dipeptidyl peptidase 116430AA609717AK001531Hs.66048hypothetical protein 3$ 116589D59570AI557212Hs.17132ESTs, Moderatelysimilarto 154374 gene 116733F13787AL157424Hs.61289synaptojanin 2 117023H88157AW070211Hs.102415Homo sapiens mRNA;
cDNA DKFZp586N0121 (1 117186H98988H98988Hs.42612ESTs, Weakly similar to ALU1HUMAN ALU
S

117563N34287AF055634Hs.44553unc5 (C.elegans homology c 40 117997N52090N52090Hs.47420EST

118475N66845N66845 gb:za46c11.s1 Soares fetal liver spleen 118581N68905N68905 gb:za69b09.s1 Soares fetal_lung-NbHL19W

119073832894BE245360Hs.279477ESTs 119155861715861715Hs.310598ESTs, Moderately similar to ALU1 HUMAN A

4$ 119174871234871234 gb:yi54cO8.s1 Soares placenta Nb2HP Homo 119221898105C14322Hs.250700tryptase beta 1 119416T97186T97186 gb:ye50h09.s1 Soaresfetalliverspleen 119866W80814AA496205Hs.193700Homo sapiens mRNA;
cDNA DKFZp58610324 (f 121335AA404418AA404418 gb:zw37e02.s1 Soares total_fetus_Nb2HF8_ $ 121381AA405747AW088642Hs.97984hypothetical protein ~ FLJ22252 similar to 123160AA488687AA488687Hs.284235ESTs, Weakly similar to 138022 hypothe6 123473AA599143AA599143 gb:ae52d04.s1 Stratagene lung carcinoma 123523AA608588AA608588 gb:ae54e06.s1 Stratagene lung carcinoma 123533AA608751AA608751 gb:ae56h07.s1 Stratagene lung carcinoma $$ 123964C13961C13961 gb:C13961 Clontech human aorta polyA+mR

124006D60302AI147155Hs.270016ESTs 124315H94892NM_005402Hs.288757 v-ral simian leukemia viral oncogene hom 124659N93521AI680737Hs.289068Homo sapiens cDNA
FLJ11918 fis, clone HE

124669N95477AI571594Hs.102943hypothetical protein 60 124847860044W07701Hs.304177Homo Sapiens clone mRNA, 124875870506AI887664Hs.285814sprouty (Drosophila) homolog 4 125091T91518T91518 gb:ye20f05.s1 Stratagene lung (937210) H

125103T95333AA570056Hs.122730ESTs, Moderately similar to KIAA1215 pro 125355845630860547Hs.170098KIAA0372 gene product 6$ 125565820839820840 gb:yg05cO8.r1 Soares infant brain 1NIB
H

125590823858823858Hs.143375Homo Sapiens, clone IMAGE:3840937, mRNA, 423765823858823858Hs.143375Homo sapiens, clone IMAGE:3840937, mRNA, 126511A1024874T92143Hs.57958EGF-TM7-latrophilin-related protein 100286W26247BE247550Hs.86859growth factor receptor-bound protein 7 70 126563W26247AA516391Hs.181368U5 snRNP-specific protein (220 kD), orth 126649AA856990AA001860Hs.279531ESTs 449602AA856990AA001860Hs.279531ESTs 126872AA136653AW450979 gb:Ul-H-B13-ala-a-12-0-ULs1 NCI CGAP_Su 456000AA136653BE180876Hs.11614HSPC065 protein ~$ 414221AA136653AW450979 gb:Ul-H-BI3-ala-a-12-0-ULs1 NCI_CGAP Su 127402AA358869AA358869Hs.227949SEC13 (S. cerevisiae)-like 1$1 127651AI123976AA382523Hs.105689MSTP031 protein 424806AI123976AA382523Hs.105689MSTP031 protein 128062AA379500AA379621Hs.105547neural proliferation, differentiation an 128992849693H04150Hs.107708ESTs 129046AA195678AB029290Hs.108258actin binding protein;
macrophin (microf 129188M30257NM-001078Hs.109225 vascular cell adhesion molecule 1 129314AA028131BE622768Hs.290356mesoderm development candidate 1 129371M10321X06828Hs.110802von Willebrand factor 129468J03040AW410538Hs.111779secreted protein, acidic, cysteine-rich 1 129765M86933M86933Hs.1238amelogenin (Y chromosome) ~

129805AA012933AA012848Hs.12570tubulin-specific chaperone d 129884AA286710AF055581Hs.13131lysosomal 130495AA243278AW250380Hs.109059mitochondria) ribosomal protein L12 130639D59711AI557212Hs.17132ESTs, Moderately similarto 154374 gene 1 130657T94452AW337575Hs.201591ESTs S

130828AA053400AW631469Hs.203213ESTs 130972AA370302D81866Hs.21739Homo sapiens mRNA;
cDNA DKFZp58611518 (f 131080J05008NM-001955Hs.2271 endothelin 1 131137U85193W27392Hs.33287nuclear factorIIB

20 131182AA256153AI824144Hs.23912ESTs 131486X83107F06972Hs.27372BMX non-receptor tyrosine kinase 131573AA046593AA040311Hs.28959ESTs 131647AA410480AA359615Hs.30089ESTs 131756D45304AA443966Hs.31595ESTs 2S 131859M90657AW960564 transmembrane 4 superfamily member 1 131881AA010163AW361018Hs.3383upstream regulatory element binding prot 132050AA136353AI267615Hs.38022ESTs 132083Y07867BE386490Hs.279663Pirin 132164U84573AI752235Hs.41270procollagen-lysine, 2-oxoglutarate 5-dio 30 132358X60486NM-003542Hs.46423 H4 histone family, member G

132413AA132969AW361383Hs.260116metalloprotease 1 (pitrilysin family) 132456AA114250AB011084Hs.48924KIAA0512 gene product;

132490F13782NM_001290Hs.4980 LIM domain binding 132676AA283035N92589Hs.261038ESTs, Weakly similar to 138022 hypotheti 35 132687AB002301AB002301Hs.54985KIAA0303 protein 132718AA056731NM Sjogren syndrome 004600Hs.554 antigen A2 (60kD, ribon 132736U68019AW081883Hs.211578Homo sapiens cDNA:
FLJ23037 fis, clone L

132760H99198AA125985Hs.56145thymosin, beta, identified in neuroblast 132933AA598702BE263252Hs.6101hypothetical protein 40 132968N77151AF234532Hs.61638myosin X

132994AA505133AA112748Hs.279905clone HQ0310 PR00310p1 133061AB000584AI186431Hs.296638prostate differentiation factor 133147D12763AA026533Hs.66interleukin 1 receptor-like 133161AA253193AW021103Hs.6631hypothetical protein 4$ 133200AA432248AB037715Hs.183639hypothetical protein 133260AA083572AA403045Hs.6906Homo sapiens cDNA:
FLJ23197 fis, clone R

133363AA479713AI866286Hs.71962ESTs, Weakly similar to 836298 proline-r 133491L40395BE619053Hs.170001eukaryotictranslation initiation factor 133517X52947NM gap junction protein, 000165Hs.74471 alpha 1, 43kD (con 133550W80846AI129903Hs.74669vesicle-associated membrane protein 5 (m 133607M34539BE273749 FK506-binding protein 1A (12kD) 133614D67029NM SEC14 (S. cerevisiae)-like 003003Hs.75232 1 133627U09587NM glycyl-tRNA synthetase 002047Hs.75280 133691M85289M85289Hs.211573heparan sulfate proteoglycan 2 (perlecan 55 133696D10522AI878921Hs.75607myristoylated alanine-rich protein kinas 133913W84712AU076964Hs.7753calumenin 133975D29992C18356Hs.295944tissue factor pathway inhibitor 2 133985L34657L34657Hs.78146plateletlendothelial cell adhesion molec 134039S78569NM-002290Hs.78672 laminin, alpha 4 134088D43636AI379954Hs.79025KIAA0096 protein 134161U97188AA634543Hs.79440IGF-II mRNA-binding protein 3 134299AA487558AW580939Hs.97199complement component C1q receptor 134416M28882X68264Hs.211579melanoma cell adhesion molecule 116470X70683AI272141Hs.83484SRY (sex determining region Y)-box 4 6$ 134656X14787AI750878Hs.87409thrombospondin 1 134989AA236324AW968058Hs.92381nudix (nucleoside diphosphate linked moi 135051C15324AI272141Hs.83484SRY (sex determining region Y)-box 4 135073AA452000W55956Hs.94030Homo Sapiens mRNA;
cDNA DKFZp586E1624 (f 135349D83174AA114212Hs.9930serine (or cysteine) proteinase inhibito 100114D00596X02308Hs.82962thymidylate synthetase 100130D11428NM peripheral myelin 000304Hs.103724 protein 22 ~' 100143D13640AU076465Hs.278441KIAA0015 gene product 100168D14874H73444Hs.394adrenomedullin 100208D26129NM_002933Hs.78224 ribonuclease, RNase A family,1 (pancrea 7$ 100224D28476AL121516Hs.138617thyroid hormone receptor interactor 12 100405D86425AW291587Hs.82733nidogen 2 100420D86983 D86983Hs.118893Melanoma associated gene 100455D87953 AW888941Hs.75789N-myc downstream regulated 100529HG1862-HT1897BE313693Hs.334330calmodulin 2 (phosphorylase kinase, delt 100618HG2614-HT2710AI752163Hs.114599collagen, type VIII, alpha 1 $ 100619HG2639-HT2735N24433Hs.241567RNA binding motif, single stranded inter 100658HG2855-HT2995056725Hs.180414heat shock 70kD
protein 2 100676HG3044-HT3742X02761Hs.287820fibronectin 1 100718HG3342-HT3519BE295928Hs.75424inhibitor of DNA
binding 1, dominant neg 100752HG3543-HT3739T81309 insulin-like growth factor 2 (somatomedi 100828HG4069-HT4339AL048753Hs.303649small inducible cytokine A2 (monocyte ch 100850HG417-HT417AA836472Hs.297939cathepsin B

100991J03764 J03836Hs.82085serine (or cysteine) proteinase inhibito 101097L06797 BE245301Hs.89414chemokine (C-X-C
motif), receptor 4 (fus 101110L08246 AI439011Hs.86386myeloid cell leukemia sequence 1 (BCL2-r 1$ 101142L12711 L12711Hs.89643transketolase (Wemicke-Korsakoff syndro 101156L13977 AA340987Hs.75693prolylcarboxypeptidase (angiotensinase C

101168L15388 NM_005308Hs.211569 G protein-coupled receptor kinase 101184L19871 NM activating transcription 001674Hs.460 factor3 101192L20859 BE247295Hs.78452solute carrier family 20 (phosphate trap 2~ 101317L42176 L42176Hs.8302four and a half LIM domains 2 101336L49169 NM-006732Hs.75678 FBJ murine osteosarcoma viral oncogene h 101345L76380 NM_005795Hs.152175 calcitonin receptor-like 101400M15990 M15990Hs.194148v-yes-1 Yamaguchi sarcoma viral oncogene 101475M23254 BE410405Hs.76288calpain 2, (mill) large subunit 2$ 101485M24736 AA296520Hs.89546selectin E (endothelial adhesion molecul 101496M26576 X12784Hs.119129collagen, type IV, alpha 1 101505M27396 AA307680Hs.75692asparagine synthetase 101543M31166 M31166Hs.2050pentaxin-related gene, rapidly induced b 101557M31994 BE293116Hs.76392aldehyde dehydrogenase 1 family, member 3 101560M32334 AW958272Hs.347326intercellular adhesion ~ molecule 2 101587M35878 AI752416Hs.77326insulin-like growth factor binding prote 101592M36429 AF064853Hs.91299guanine nucleotide binding protein (G pr 101633M57730 NM ephrin-A1 004428Hs.1624 101634M57731 AV650262Hs.75765GR02 oncogene 3$ 101667M60858 NM_005381 nucleolin 101682M62994 AF043045Hs.81008filamin B, beta (actin-binding protein-2 101714M68874 M68874Hs.211587phospholipase A2, group IVA (cytosolic, 101720M69043 M69043Hs.81328nuclearfactor of kappa light polypeptid 101741M74719 NM transcriptionfactor4 003199Hs.326198 101744M75126 AI879352Hs.118625hexokinase 1 101793M84349 W01076Hs.278573CD59 antigen p18-20 (antigen identified 101837M92843 M92843Hs.343586zinc finger protein homologous to Zfp-36 101838M92934 BE243845Hs.75511connective tissue growth factor 101840M93056 AA236291Hs.183583serine (or cysteine) proteinase inhibito 4$ 101857M94856 BE550723Hs.153179fatty acid binding protein 5 (psoriasis-101864M95787 BE392588Hs.75777transgelin 101931S76965 NM-006823Hs.75209 protein kinase (CAMP-dependent, catalyti 101966S81914 X96438Hs.76095immediate early response 3 102012003057 BE259035Hs.118400singed (Drosophila)-like (sea urchin fas $ 102013003100 BE616287Hs.178452catenin (cadherin-associated ~ protein), a 102024003877 AA301867Hs.76224EGF-containing fibulin-like extracellula 102059008021 AI752666Hs.76669nicotinamide N-methyltransferase 102121014391 NM_004998Hs.82251myosin IE

102283031384 AW161552Hs.83381guanine nucleotide binding protein $$ 102300032944 AI929721Hs.5120dynein, cytoplasmic, lightpolypeptide 102378040369 AU076887Hs.28491spermidinelspermine N1-acetyltransferase 102395041767 AU077005Hs.92208a disintegrin and metalloproteinase doma 102460048959 048959Hs.211582myosin, light polypepGde kinase 102491051010 051010 gb:Human nicotinamide N-mefhyltransferas 102499051478 BE243877Hs.76941ATPase, Na+IK+transporting, beta 3 poly 102523053445 053445Hs.15432downregulated in ovarian cancer 102560059289 897457Hs.63984cadherin 13, H-cadherin (hear.) 102564059423 059423Hs.79067MAD (mothers against decapentaplegic, Dr 102589062015 AU076728Hs.8867cysteine-rich, angiogenic inducer, 61 6$ 102600063825 AI984144Hs.66713hepatitis delta antigen-interacting prot 102645067963 AL119566Hs.6721lysosomal 102687073379 NM-007019Hs.93002 ubiquitin comer protein E2-C

102693073824 AA532780Hs.183684eukaryotic translation initiation factor 102709077604 AA122237Hs.81874microsomal glutathione S-transferase 2 102759081607 NM-005100Hs.788 A kinase (PRKA) anchor protein (gravin) 102804089942 NM_002318Hs.83354 lysyl oxidase-like . 2 102882X04412 AI767736Hs.290070gelsolin (amyloidosis, Finnish type) 102907X06985 BE409861Hs.202833heme oxygenase (decycling) 102915X07820 X07820Hs.2258matrix metalloproteinase 10 (stromelysin ~$ 102927X12876 BE512730Hs.65114keratin 18 102960X15729 AI904738Hs.76053DEADIH (Asp-Glu-Ala-AspIHis) box polypep 1$3 103011 X52541AJ243425Hs.326035early growth response 103020 X53416X53416Hs.195464filamin A, alpha (actin-binding protein-103029 X54489AW800726Hs.789GR01 oncogene (melanoma growth sGmulati 103036 X54925M13509Hs.83169matrix metalloproteinase 1 (interstitial $ 103056 X57206Y18024Hs.78877inositol 1,4,5-trisphosphate 3-kinase B

103080 X59798AU077231Hs.82932cyclin D1 (PRAD1:
parathyroid adenomatos 103095 X60957NM tyrosine kinase with 005424Hs.78824 immunoglobulin and 103138 X65965X65965 gb:H.sapiens SOD-2 gene for manganese su 103176 X69111AL021154Hs.76884inhibitor of DNA
binding 3, dominant neg 103195 X70940AA351647Hs.2642eukaryotic translation elongation factor 103347 X87838AU077309Hs.171271catenin (cadherin-associated protein), b 103371 X91247X91247Hs.13046thioredoxin reductase 103432 X97748X97748 gb:H.sapiens PTX3 gene promotor region.

103471 Y00815Y00815Hs.75216protein tyrosine phosphatase, receptor t 1 103967 AA303711AL120051Hs.144700ephrin-B1 $

104447 L44538AW204145Hs.156044ESTs 104764 AA025351A1039243Hs.278585ESTs 104783 AA027050AA533513Hs.93659protein disulfide isomerase related prot 104798 AA029462AW952619Hs.17235Homo Sapiens clone TCCCIA00176 mRNA
sequ 2~ 104865 AA045136T79340Hs.22575B-cell CLLllymphoma 6, member B (zinc fi 104877 AA047437AI138635Hs.22968Homo Sapiens clone IMAGE:451939, mRNA
se 104894 AA054087AF065214Hs.18858phospholipase A2, group IVC (cytosolic, 104952 AA071089AW076098Hs.345588desmoplakin (DPI, DPII) 105113 AA156450AB037816Hs.8982Homo Sapiens, clone IMAGE:3506202, mRNA, ~$ 105178 AA187490AA313825Hs.21941AD036 protein 105196 AA195031W84893Hs.9305angiotensin receptor-like 105215 AA205724AA205759Hs.10119hypothetical protein 105263 AA227926AW388633Hs.6682solute carrier family 7, (cationic amino 105271 AA227986AA807881Hs.25329ESTs 105330 AA234743AW338625Hs.22120ESTs 105461 AA253216BE539071Hs.69388hypothetical protein 105492 AA256210AI805717Hs.289112CGI-03 protein 105493 AA256268AL047586Hs.10283RNA binding motif protein 8B

105594 AA279397AB024334Hs.25001tyrosine 3-moncoxygenaseltryptophan 5-mo 3$ 105727 AA292379AL135159Hs.20340KIAA1002 protein 105732 AA292717AW504170Hs.274344hypothetical protein 105767 AA346551AW370946Hs.23457ESTs 105882 AA400292W46802Hs.81988disabled (Drosophila) homolog 2 (mitogen 105936 AA404338AI678765Hs.21812ESTs 4~ 106031 AA412284X64116Hs.171844Homo Sapiens cDNA:
FLJ22296 fis, clone H

106124 AA423987H93366Hs.7567Homo Sapiens cDNA:
FLJ21962 fis, clone H

106222 AA428594AA356392Hs.21321Homo Sapiens clone mRNA, 106241 AA430108BE019681Hs.6019Homo Sapiens cDNA:
FLJ21288 fis, clone C

106263 AA431462W21493Hs.28329hypothetical protein 4$ 106264 AA431470AL046859Hs.3407protein kinase (CAMP-dependent, catalyti 106366 AA443756AA186715Hs.336429RIKEN cDNA 9130422N19 gene 106454 AA449479NM_014038Hs.5216 HSPC028 protein 106634 AA459916W25491Hs.288909hypothetical protein 106724 AA465226N48670Hs.28631Homo Sapiens cDNA:
FLJ22141 fis, clone H

SD 106793 AA478778H94997Hs.16450ESTs 106799 AA479037BE313412Hs.7961Homo sapiens clone 25012 mRNA sequence 106842 AA482597AF124251Hs.26054novel SH2-containing protein 3 106868 AA487561BE185536Hs.301183molecule possessing ankyrin repeafs indu 106890 AA489245AA489245Hs.88500mitogen-activated protein kinase 8 inter $$ 106961 AA504110AW243614Hs.18063Homo Sapiens cDNA
FLJ10768 fis, clone NT

106974 AA520989AI817130Hs.9195Homo sapiens cDNA
FLJ13698 fis, clone PL

107030 AA599434AL117424Hs.25035chloride intracellularchannel4 107061 AA608649BE147611Hs.6354stromal cell derived factor receptor 107086 AA609519NI1~012331Hs.26458 methionine sulfoxide reductase A

107216 D51069D51069Hs.211579melanoma cell adhesion molecule 107385 U97519NM podocalyxin-like 005397Hs.16426 107444 W28391W28391Hs.343258proliferation-associated 2G4, 38kD

107985 AA035638T40064Hs.71968Homo Sapiens mRNA;
cDNA DKFZp564F053 (fr 108507 AA083514AI554545Hs.68301ESTs 6$ 108695 AA121315AB029000Hs.70823KIAA1077 protein 108931 AA147186AA147186 gb:zo38d01.s1 Stratagene endothelial cel 109001 AA156125A1056548Hs.72116hypothetical protein FLJ20992 similar to 109195 AA188932AF047033Hs.132904solute carrier family 4, sodium bicarbon 109390 AA219653AW007485Hs.87125EH-domain containing 70 109456 AA232645AW956580Hs.42699ESTs 109737 F10078AA055415Hs.13233ESTs, Moderately similar to A47582 B-cel 110411 H48032AW001579Hs.9645Homo Sapiens mRNA
for KIAA1741 protein, 110660 H82117AA782114Hs.28043ESTs 110906 N39584AA035211Hs.17404ESTs 7$ 111018 N54067AI287912Hs.3628mitogen-activated protein kinase kinase 111091 N59858AA300067Hs.33032hypothetical protein DKFZp434N185 1$4 111356 N90933BE301871Hs.4867mannosyl (alpha-1,3-)-glycoprotein beta-111378 N93764AW160993Hs.326292hypothetical gene DKFZp434A1114 111741 826124AB020653Hs.24024KIAA0846 protein 111769 827957AW629414Hs.24230ESTs $ 112318 855470AW083384Hs.11067ESTs, Highly similar to T46395 hypotheti 112951 T16550AA307634Hs.6650vacuolar protein sorting 45B (yeast homo 113057 T26674AW194301Hs.339283Human DNA sequence from clone RP1-187J11 113195 T57112H83265Hs.8881ESTs, Weakly similar to S41044 chromosom 113490 T88700BE178110Hs.173374Homo Sapiens cDNA
FLJ10500 fis, clone NT

1 113542 T90527H43374Hs.7890Homo Sapiens mRNA
~ for KIAA1671 protein, 113803 W42789AW880709Hs.283683chromosome 8 open reading frame 4 113847 W60002NM plastin 3 (T isoform) 005032Hs.4114 113910 W78175AA113262Hs.17901Homo sapiens, clone IMAGE:3937015, mRNA, 113947 W84768W84768 gb:zh53d03.s1 Soares fetal_liver-spleen 1$ 114047 W94427AL035858Hs.3807FXYD domain-containing ion transport reg 115061 AA253217AI751438Hs.41271Homo Sapiens mRNA
full length insert cDN

115819 AA426573AA486620Hs.41135endomucin-2 115870 AA432374NM_005985Hs.48029 snail 1 (drosophila homology, zinc finge 115964 AA446622AA987568Hs.74313KIAA1265 protein 116228 AA478771AI767947Hs.50841ESTs 116264 AA482594D51174Hs.272239lysosomal 116314 AA490588AI799104Hs.178705Homo Sapiens cDNA
FLJ11333 fis, clone PL

116589 D59570AI557212Hs.17132ESTs, Moderately similar to 154374 gene 117023 H88157AW070211Hs.102415Homo Sapiens mRNA;
cDNA DKFZp586N0121 (f 2$ 117112 H94648AW969999Hs.293658ESTs 117156 H97538W73853 ESTs 117176 H98670H45100Hs.49753uveal autoantigen with coiled coil domai 117280 N22107M18217Hs.172129Homo Sapiens cDNA:
FLJ21409 fis, clone C

119559 W38197W38197 Empirically selected from AFFX single pr 30 119866 W80814AA496205Hs.193700Homo Sapiens mRNA;
cDNA DKFZp58610324 (f 120655 AA287347AA305599Hs.238205hypothetical protein 121314 AA402799W07343Hs.182538phospholipid scramblase 121335 AA404418AA404418 gb:zw37e02.s1 Soares total-fetus_Nb2HF8-121822 AA425107AI743860 metallothionein 1 E (functional) 3 121835 AA425435A8033030Hs.300670KIAA1204 protein $

122331 AA442872AL133437Hs.110771Homo Sapiens cDNA:
FLJ21904 fis, clone H

122577 AA452860AA829725Hs.334437hypothetical protein 123160 AA488687AA488687Hs.284235ESTs, Weakly similar to 138022 hypotheti 123486 AA599674BE019072Hs.334802Homo Sapiens cDNA
FLJ14680 fis, clone NT

124059 F13673BE387335Hs.283713ESTs, Weakly similar to S64054 hypotheti 124339 H99093H99093Hs.343411DEADIH (Asp-Glu-Ala-AspIHis) box polypep 124358 N22495AW070211Hs.102415Homo sapiens mRNA;
cDNA DKFZp586N0121 (f 124364 N23031AF265555Hs.250646baculoviral IAP repeat-containing ~ 6 124726 815740NM..003654Hs.104576 carbohydrate (keratan sulfate Gal-6) sul 4$ 124763 839610BE410405Hs.76288calpain 2, (mill) large subunit 125167 W45560AL137540Hs.102541netrin 4 125304 239833AL359573Hs.124940GTP-binding protein 125307 240583AW580945Hs.330466ESTs 125329 AA825437AA825437Hs.58875ESTs S~ 107985 866613T40064Hs.71968Homo Sapiens mRNA;
cDNA DKFZp564F053 (fr 125598 866613T40064Hs.71968Homo Sapiens mRNA;
cDNA DKFZp564F053 (fr 125609 AA868063AA868063Hs.104576carbohydrate (keratan sulfate Gal-6) sul 116024 AA128075AA088767Hs.83883transmembrane, prostate androgen induced 418000 AA128075AA932794Hs.83147guanine nucleotide binding protein-like $$ 126399 AA128075AA088767Hs.83883transmembrane, prostate androgen induced 127435 N66570X69086Hs.286161Homo sapiens cDNA
FLJ13613 fis, clone PL

127566 A1051390A1051390Hs.116731ESTs 127619 AA627122AA627122Hs.163787ESTs 434190 AA627122AA627122Hs.163787ESTs 60 128453 X02761X02761Hs.287820fibronectin 1 128495 AF010193NM_005904Hs.100602 MAD (mothers against decapentaplegic, Dr 128515 AA149044BE395085Hs.10086type I transmembrane protein Fn14 128580 U82108U82108Hs.101813solute tamer family 9 (sodiumihydrogen 128623 D78676BE076608Hs.105509CTL2 gene 6$ 128642 L35240228913Hs.102948enigma (LIM domain protein) 128669 AA598737W28493Hs.180414heat shock 70kD protein 128903 869417AW150717Hs.345728STAT induced STAT
inhibitor 3 128914 AA232837AW867491Hs.107125plasmalemma vesicle associated protein 129087 N72695AI348027Hs.108557hypothetical protein 129188 M30257NM-001078Hs.109225 vascular cell adhesion molecule 1 129226 M96843BE222494Hs.180919inhibitor of DNA binding 2, dominant neg 129265 X68277AA530892Hs.171695dual specificity phosphatase 129345 AA292440822497Hs.110571growth arrest and DNA-damage-inducible, 129468 J03040AW410538Hs.111779secreted protein, acidic, cysteine-rich ~$ 129488 AA228107AW966728Hs.54642methionine adenosyltransferase II, beta 101838 AA449789BE243845Hs.75511connective tissue growth factor 1$5 413731 AA449789BE243845 Hs.75511 connective tissue growth factor 129557 W01367AL045404 Hs.46366 KIAA0948 protein 129619 AA610116AA209534 Hs.284243 tetraspan NET-6 protein 129627 AA258308T40064 Hs.71968 Homo sapiens mRNA; cDNA DKFZp564F053 (fr $ 129762 AA460273AA453694 Hs.12372 tripartite motif protein TRIM2 129884 AA286710AF055581 Hs.13131 lysosomal 130018 T68873AA353093 metallothionein 1L

130147 D63476D63476 Hs.172813 PAK-interacting exchange factor beta 130178 M62403020982 Hs.1516 insulin-like growth factor-binding prote 10130282 X55740BE245380 Hs.153952 5' nucleotidase (CD73) 130431 L10284AW505214 Hs.155560 calnexin 130495 AA243278AW250380 Hs.109059 mitochondrfal ribosomal protein L12 130553 AA430032AF062649 Hs.252587 pituitary tumor-transforming 1 130638 H16402AW021276 Hs.17121 ESTs 15130639 D59711A1557212 Hs.17132 ESTs, Moderately similar to 154374 gene 130657 T94452AW337575 Hs.201591 ESTs 130686 AA431571BE548267 Hs.337986 Homo Sapiens cDNA FLJ10934 fis, clone OV

130776 879356AF167706 Hs.19280 cysteine-rich motor neuron 1 130818 AA280375AW190920 Hs.19928 hypothetical protein SP329 2~130840 249269BE048821 Hs.20144 small inducible cytokine subfamily A (Cy 130899 241740A1077288 Hs.296323 serumiglucocorticoid regulated kinase 131002 AA121543AL050295 Hs.22039 KIAA0758 protein 131080 J05008NM-001955Hs.2271 endothelin 1 131084 AA101878NM-017413Hs.303084 apelin; peptide ligand forAPJ receptor 131091 T35341AJ271216 Hs.22880 dipeptidylpeptidase III

131107 N87590BE620886 Hs.75354 GCN1 (general control of amino-acid synt 131182 AA256153AI824144 Hs.23912 ESTs 131207 W74533AF104266 Hs.24212 latrophilin 131319 025997NM-003155Hs.25590 stanniocalcin 131328 V01512AW939251 Hs.25647 v-fos FBJ mudne osteosarcoma viral onco 131509 X56681X56681 Hs.2780 jun D proto-oncogene 131555 AA161292T47364 Hs.278613 interferon, alpha-inducible protein 27 131564 AA491465T93500 Hs.28792 Homo Sapiens cDNA FLJ11041 fis, clone PL

131573 AA046593AA040311 Hs.28959 ESTs 35131692 D50914BE559681 Hs.30736 KIAA0124 protein 131756 D45304AA443966 Hs.31595 ESTs 131859 M90657AW960564 transmembrane 4 superfamily member 1 131909 W69127NM_016558Hs.274411 SCAN domain-containing 131915 AA316186AI161383 Hs.34549 ESTs, Highly similar to S94541 1 clone 4 4~132046 AA384503AI359214 Hs.179260 chromosome 14 open reading frame 4 132050 AA136353AI267615 Hs.38022 ESTs 132151 AA044755BE379499 Hs.173705 Homo Sapiens cDNA: FLJ22050 fis, clone H

132164 084573AI752235 Hs.41270 procollagen-lysine, 2-oxoglutarate 5-dio 132187 AA058911AA235709 Hs.4193 DKFZP58601624 protein 4S132303 AA620962BE177330 Hs.325093 Homo Sapiens cDNA: FLJ21210 fis, clone C

132314 AA285290AF112222 Hs.323806 pinin, desmosome associated protein 132358 X60486NM-003542Hs.46423 H4 histone family, member G

132398 831641AA876616 Hs.16979 ESTs, Weakly similar to A43932 mucin 2 p 132421 AA489190AW163483 Hs.48320 double ring-finger protein, Dontn 50132490 F13782NM-001290Hs.4980 LIM domain binding 132520 AA257993AA257992 Hs.50651 Janus kinase 1 (a protein tyrosine kinas 132546 M24283M24283 Hs.168383 intercellular adhesion molecule 1 (CD54) 132610 AA443114AA160511 Hs.5326 amino acid system N transporter 2; porcu 132716 T35289BE379595 Hs.283738 casein kinase 1, alpha 1 5$132840 N23817BE218319 Hs.5807 GTPaseRab14 132883 AA047151AA373314 Hs.5897 Homo sapiens mRNA; cDNA DKFZp586P1622 (f 132968 N77151AF234532 Hs.61638 myosin X

132989 AA480074AA480074 Hs.331328 hypothetical protein FLJ13213 132999 Y00787Y00787 Hs.624 interleukin 8 133071 T99789BE384932 Hs.64313 ESTs, Weakly similar to AF2571821 G-pro 133076 W84341AW946276 Hs.6441 Homo sapiens mRNA; cDNA DKFZp586J021 (fr 133099 L09209W16518 Hs.279518 amyloid beta (A4) precursor-like protein 133147 D12763AA026533 Hs.66 interleukin 1 receptor-like 1 133149 T16484AA370045 Hs.6607 AXIN1 up-regulated 6S133161 AA253193AW021103 Hs.6631 hypothetical protein FLJ20373 133200 AA432248AB037715 Hs.183639 hypothetical protein FLJ10210 133220 X82200NM 006074Hs.318501 Homo Sapiens mRNA full length insert cDN

133260 AA083572AA403045 Hs.6906 Homo Sapiens cDNA: FLJ23197 fis, clone R

133295 L00352AI147861 Hs.213289 low density lipoprotein receptor (famili 133349 N75791AW631255 Hs.8110 L-3-hydroxyacyl-Coenryme A dehydrogenase 133391 X57579AW103364 Hs.727 inhibin, beta A (activin A, ac6vin AB a 133398 X02612NM 000499Hs.72912 cytochrome P450, subfamily I (aromatic c 133436 H44631BE294068 Hs.737 immediate early protein 133454 AA090257BE547647 Hs.177781 hypothetical protein MGC5618 133478 X83703X83703 Hs.31432 cardiac ankyrin repeat protein 133491 L40395BE619053 Hs.170001 eukaryotic translation initiation factor 133510 AA227913AW880841 Hs.96908 p53-induced protein 133517 X52947NM 000165Hs.74471 gap junction protein, alpha 1, 43kD (con 133526 M11313AU077051 Hs.74561 alpha-2-macroglobulin 133538 L14837NM 003257Hs.74614 tightjunction protein 1 (zona occludens 133562 M60721M60721 Hs.74870 H2.0 (Drosophila)-like homeo box 1 133584 D90209D90209 Hs.181243 activating transcription factor 4 (tax-r 133590 T67986T70956 Hs.75106 clusterin (complement lysis inhibitor, S

133617 AA148318BE244334 Hs.75249 ADP-ribosylation factor-like 6 interacti 133651 U97105AI301740 Hs.173381 dihydropyrimidinase-like 1 133671 T25747AW503116 Hs.301819 zinc finger ~ protein 146 133678 K02574AW247252 nucleoside phosphorylase 133681 D78577AI352558 tyrosine 3-monooxygenaseltryptophan 5-mo 133722 X53331AW969976 Hs.279009 matrix Gla protein 133730 S73591BE242779 Hs.179526 upregulated by 1,25-dihydroxyvitamin D-3 1$ 133750 X95735BE410769 Hs.75873 zyxin 133802 L16862AW239400 Hs.76297 G protein-coupled receptor kinase 6 133825 U44975BE616902 Hs.285313 core promoter element binding protein 133838 M97796BE222494 Hs.180919 inhibitor of DNA binding 2, dominant neg 133859 U86782U86782 Hs.178761 26S proteasome-associated padl homolog 133889 AA099391U48959 Hs.211582 myosin, light polypeptide kinase 133960 M19267M19267 Hs.77899 tropomyosin 1 (alpha) 133975 D29992C18356 Hs.295944 tissue factor pathway inhibitor 2 133977 L19314AI125639 Hs.250666 hairy (Drosophila)-homolog 134039 S78569NM 002290Hs.78672 laminin, alpha 134075 U28811NM-012201 Hs.78979 Golgi apparatus protein 1 134081 L77886AL034349 Hs.79005 protein tyrosine phosphatase, receptor t 134164 C14407AW245540 Hs.79516 brain abundant, membrane attached signal 134203 M60278AA161219 Hs.799 diphtheria toxin receptor (heparin-bindi 134238 881509AA102179 Hs.160726 Homo Sapiens cDNA FLJ11680 fis, clone HE

134299 AA487558AW580939 Hs.97199 complement component C1 q receptor 134332 D86962D86962 Hs.81875 growth factor receptor bound protein 10 134339 AA478971870429 Hs.81988 disabled (Drosophila) homolog 2 (mitogen 134343 D50683D50683 Hs.82028 transforming growth factor, beta recepto 134381 U56637AI557280 Hs.184270 capping protein (actin filament) muscle 3 134403 M61199AA334551 sperm specific antigen 134416 M28882X68264 Hs.211579 melanoma cell adhesion molecule 134493 X15183M30627 Hs.289088 heat shock 90kD protein 1, alpha 134558 S53911NM-001773Hs.85289 CD34 antigen 134817 U20734AU076592 Hs.198951 jun B proto-oncogene 4~ 134983 D28235D28235 Hs.196384 prostaglandin-endoperoxide synthase 2 (p 134989 AA236324AW968058 Hs.92381 nudix (nucleoside diphosphate linked moi 135052 AA148923AL136653 Hs.93675 decidual protein induced by progesterone 135062 AA174183AK000967 Hs.93872 KIAA1682 protein 135069 AA456311AA876372 Hs.93961 Homo sapiens mRNA; cDNA DKFZp667D095 (fr 45 135071 L08069W27190 Hs.94 DnaJ (Hsp40) homclog, subfamily A, membe 135073 AA452000W55956 Hs.94030 Homo Sapiens mRNA; cDNA DKFZp586E1624 (f 135170 AA282140T53169 Hs.9587 Homo Sapiens cDNA: FLJ22290 fis, clone H

135196 J02854C03577 Hs.9615 myosin regulatory light chain 2, smooth 135348 AA442054U80983 Hs.268177 phospholipase C, gamma 1 (formerly subty Table 4A shows the accession numbers for those pkeys lacking unigenelD's forTable 4. The pkeys in Table 7 lacking unigenelD's are represented within Tables 1-6A. For each probeset we have listed the gene cluster number from which the oligo~ucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs. These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubIeTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession"
column, 1 ~ Pkey: Unique Eos probeset identifier number CAT number: Gene cluster number Accession: Genbank accession numbers 1$ Pkey CAT Number Accession 100752 33207-21 T81309 BE019033 894181 BE019198 NN(-000612 J03242 AW411299 ~$ N77189 889257 AA570502 889432 806366 AA553480 AA776271 AA551359 AA551050 AW883639 AW883230 AW882981.AW882534 AW882874 AW882619 AW883480 AW882826 117156 145392_1 W73853 AA928112 W77887 AW889237 AA148524 AI749182 AI754442 131859 3672_1 AW960564 AA092457 T55890 D56120 T92525 Al815987 BE182608 $5 AA301631 H80982 AA113786 BE620997 AW651691 AA343799 BE613669 BE547180 AA557597 AA383220 AI804422 Ai633575 AW338147 AW603423 AW606800 AW750567 6S 125565 1704098_1 820840 820839 7$ AA303362 N32719 AA358328 AA357877 AI952540 H56279 H02758 H02048 AW805233 $ AA643080 AL135479 AA292329 AA654337 AA041228 AA454888 AA025039 W58331 1$ AA703505 W45449 AW078661 AI292052 AW381707 AI147854 AW381743 AA158905 4$ AI809817 AA905196 AI191245 AI470204 AI188296 AI421367 AI125315 A1087141 $ $ W94127 W65436 AI272249 AA700018 AI579932 A1085941 AW152629 134403 17037-1 AA334551 BE008229 AA307537 AW961156 AW995894 AW995826 NM_006751 123523 genbanILAA608588 AA608588 123533 genbank-AA608751 125091 genbanILT91518T91518 123964 genbank C13961 102491 entrez_U51010U51010 $ 118475 genbanltN66845N66845 118581 genbanILN68905N68905 113947 genbank W84768 101447 entrez_M21305M21305 101667 13349_1 NM 005381 M60858 AW373732 AW373724 AW373689 AW373629 1$ AI832027 AW510442 AI635802 AW088306 AW068672 AW408555 AA074040 AA931657 A1051154 AW410203 Ai921644 H17434 W58323 AA569119 AA508573 AI809050 Ai378996 AW351940 AW373683 Ai940524 AW374953 T56500 N24329 AI305271 AA433818 AA612807 AI831809 Ai940409 108931 genbank-AA147186 30 103138 entrez_X65965X65965 103432 entrez X97748 119174 genbank 871234 133678 11235_1 AW247252 AA346143 NM 000270 AA381085 N91995 X00737 AI979189 AI280889 AW273191866531 AI285845 Ai675927 119416 genbank-T97186T97186 119559 NOT_FOUND
entrez-W38197 123473 genbank-AA599143 TABLE 5:
Pkey: Unique Eos probeset identifier number Accession: Accession number used for previous patent filings ExAccn: Exemplar Accession number, Genbank accession number UnigenelD: Unigene number Unigene Title: Unigene gene title Pkey Accession ExAccn UniGene UnigeneTitle 115819AA426573AA486620Hs.41135AA486620 1 132837D58024AA370362Hs.57958AA370362 $

101545M31210BE246154Hs.154210BE246154 M
002205Hs.149609 101192L20859BE247295Hs.78452BE247295 102915X07820X07820Hs.2258X07820 105330AA234743AW338625Hs.22120AW338625 005397Hs.16426 005397 102024U03877AA301867Hs.76224AA301867 134416M28882X68264Hs.211579X68264 103036X54925M13509Hs.83169M13509 ~$ 104865AA045136T79340Hs.22575T79340 106124AA423987H93366Hs.7567H93366 105330AA234743AW338625Hs.22120AW338625 109001AA156125A1056548Hs.72116A1056548 104764AA025351A1039243Hs.278585A1039243 133200AA432248A8037715Hs.183639AB037715 105263AA227926AW388633Hs.6682AW388633 105178AA187490AA313825Hs.21941AA313825 109456AA232645AW956580Hs.42699AW956580 Table 5A shows the accession numbers for those pkeys lacking unigenelD's for Table 5. The pkeys in Table 7 lacking unigenelD's are represented within Tables 1-6A. For each probeset we have listed the gene cluster number from which the oligonucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs, These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubleTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession"
column.
1 ~ Pkey: Unique Eos probeset identifier number CAT number: Gene cluster number Accession: Genbank accession numbers 1$ Pkey CAT Number Accession ~$ AA082157 AA029129 AA303708 AA028155 D31561 T84689 AA302493 BE153057 3 $ AA165196 AA780683 AA603631 AA047787 AA968580 AA912645 AW890504 AW026913 101545 24607_1 BE246154 M31210 NM 001400 AA193392 NM_016537 AF233365 AF022137 4$ 109456 180633_1 AW956580 AA886361 AI147670 A1090115 AI168683 AA232645 S $ AI613182 N94510 W47343 A1085755 A1076956 AI918426 AA081208 AI282835 133200 28960_1 AB037715 AI351347 AI375796 AI884765 AL121124 W01068 AI807275 102898 24023_1 NM_002205 X06256 M13918 BE070866 AW239485 AW996127 BE273894 H79049 832403 H11213 839710 H49765 H21142 H21006 AA4176fi4 W52075 N56771 Ai274916 AA778367 AI755253 A1033667 AW083222 AAi81979 826865 AA661627 AA706329 Ai798648 AA612799 $ AA502380 AA156334 AA723480 AI803584 AI581026 AA304584 1 ~ AA578313 AW874497 AA181284 AA861947 T29451 D20841 102915 2903 X07820 NM_002425 BE271570 AI263526 AW296143 AI829878 2 AI973162 Ai085155 AA857496 AA709305 C02220 134416 30694_1 X68264 NM 006500 AF089868 BE257461 BE275425 AW997154 1$ AA303513 AA186961 AA173480 N28330 N28379 W40320 AA187118 3 o AA187222 AA187207 AW371052 AW449751 AW748803 AW391606 AA884068 AW771716 AA186662 Ci6364 H15723 AI921181 105263 178672_2AW388633 AW378440 AW388283 AW388339 AW388333 AW388414 4$ . AW378431 AW378421 A1015391 AW352126 N59336 AI352317 104865 102037_1T79340 AI742317 AW182676 AW451460 AI420964 843284 106124 54542_1 H93366 AI653547 AA336265 AW966175 BE566451 871178 7$ W46972 BE293646 BE256647 A1075010 AL041095 AA285300 1 o AW887435 'TABLE 6:
Pkey: Unique Eos probeset identifier number $ ExAccn: Exemplar Accession number, Genbank accession number UnigenelD: Unigene number Unigene Title: Unigene gene title AUC1: 70~ percentile of average intensity (AI) for probeset at each of 2,6,15,24,48, and 96 hour timepoints minus 70~ percentile AI at 0 hrs, summed over 5 experiments.
1 ~ AUC2: AUC1190~ percentile of AI for aorta, aortic valve, vein, and artery.
Pkey Ex.Accn UnigenelD UnigeneTitle AUC1 AUC2 1 314941 AA515902 Hs.130650 ESTs 1038 9 $

327414 predicted exon 303.230.3 321911 AF026944 Hs.293797 ESTs 429.242.9 331578 AI246482 Hs.249989 ESTs 677.410.3 332466 A8018259 Hs.118140 KIAA0716395.239.5 gene product 313513 AW298600 Hs.141840 ESTs, 324 32.4 Weakly similar to S59501 interfero 320635 N50617 Hs.80506 small nuclear394.839.5 ribonucleoprotein polypept 326230 predicted exon 357.235.7 313556 AA628517 Hs.118502 433.612 313665 AW751201 Hs.120932 ESTs -83 0.5 2$ 324852 AI380792 Hs.135104 ESTs 348.234.8 314372 AL040178 Hs.142003 ESTs, -49.20.5 Weakly similar to The KIAA0149 gen 311877 AA084248 Hs.85339 G protein-coupled-13090.2 receptor39 322262 AA632012 Hs.188746 ESTs -247.81 312173 AI821409 Hs.304471 ESTs, -1025.81 Highly similar to AF1168651 hedge 30 319795 AB037821 Hs.146858 protocadherin203.65.2 313350 AW591949 Hs.57958 ETL protein183.818.4 326759 predicted exon 1654.41.2 300318 AW444502 Hs.256982 ESTs,HighlysimilartoAF1168651hedge-346 1 313978 AI870175 Hs.13957 ESTs 576.62.3 3 306840 A1077477 Hs.307912 EST 56.4 0.4 $

310272 AF216389 Hs.148932 semaphorin-127.60 Rs, short form 315044 BE547674 Hs.204169 ESTs -102.60 321325 AB033100 Hs.300646 KIAA 1080.64.8 protein (similar to mouse paladin) 303251 AF240635 Hs.115897 protocadherin1270.85.3 302378 AL109712 Hs.296506 Homo 915.815.8 sapiens mRNA full length insert cDN

315060 AA551104 Hs.189048 ESTs, 1236.84.9 Moderately similar to ALUC-HUMAN
!

332048 AW337575 Hs.201591 ESTs 522.64.7 337214 predicted exon 269 26.9 311598 AW023595 Hs.232048 ESTs 796.420.2 4$ 304782 AA582081 gb:nn32hO8.s1 ens 316.410.5 NCI-CGAP_Gas1 Homo sapi 312802 AA644669 Hs.193042 ESTs 349.67.6 302680 AW192334 Hs.38218 ESTs 638.663.9 317452 AA972965 Hs.135568 ESTs 360.836.1 318558 AW402677 Hs.146381 RNA 700.26.6 binding motif protein, X chromosome $~ 312149 T90309 Hs.269651 ESTs 274.27.5 319267 F11802 Hs.6818 ESTs 238.223.8 321510 H75391 Hs.255748 ESTs 231.823.2 326198 predicted exon 581.68.2 315730 H25899 Hs.201591 ESTs 281.69.7 $$ 310442 AW072215 Hs.208470 ESTs -213 0.3 331237 W87874 Hs.25277 hypothetical285 0.5 protein FLJ21065 300469 BE301708 Hs.233955 hypothetical26.6 0.3 protein FLJ20401 338316 predicted exon 1494.234.7 330968 844557 Hs.23748 ESTs 975.81.8 60 331019 NM-006033Hs.65370 lipase, 201.20.9 endothelial 331261 BE539976 Hs.103305 Homo 478.61.3 sapiens mRNA; cDNA DKFZp434B0425 (f 301822 X17033 Hs.271986 integrin,356.21.7 alpha 2 (CD49B, alpha 2 subuni 325544 predicted exon 1014.69.4 328700 predicted exon 627.462.7 6$ 322882 AW248508 Hs.279727 Homo 84.8 5.7 sapiens cDNA FLJ14035 fis, clone HE

336034 predicted exon 782.678.3 316580 AA938198 Hs.146123 hypothetical746.413.8 protein FLJ12972 309931 AW341683 gb:hd13d01.x1 134.813.5 Soares_NFL_T_GBC S1 Homo s 330692 839288 Hs.6702 ESTs 137 13.7 319962 H06350 Hs.135056 Human 14.6 DNA sequence from clone RP5-850E9 0.5 338033 predicted exon 540.614 314943 Y00272 Hs.184572 cell division-494.81 cycle 2, G1 to S and G2 to 332640 BE568452 Hs.5101 protein -600 1 regulator of cytokinesis 1 338158 predicted exon 311.231.1 ~$ 327036 predicted exon 351.835.2 16$

302655 AJ227892 Hs.146274 ESTs 180.218 327568 predicted exon 229 22.9 324801 AW770553 Hs.14553 sterol 161.216.1 0-acyltransferase (acyl-Coenzyme 317850 AI681545 Hs.152982 hypothetical-690 1 protein FLJ13117 322818 AW043782 Hs.293616 ESTs 126.44.5 324626 AI685464 Hs.292638 ESTs 170.217 317224 X73608 Hs.93029 sparc/osteonectin,-80 0 cwcv and kazal-like d 310955 AI476732 Hs.263912 ESTs 466.846.7 315240 838772 Hs.172619 KIAA1106 277 27.7 protein 1 338388 predicted exon 267.626.8 ~

338442 predicted exon 256 25.6 318617 AW247252 Hs.75514 nucleoside1247.824.2 phosphorylase 338645 predicted exon 206 20.6 313135 N58907 Hs.162430 ESTs 204.820.5 1$ 324716 BE169746 Hs.12504 hypothetical203.620.4 protein DKFZp761 D081 330305 predicted exon 199.820 308248 AI560919 gbaq41g10.x1 NCI 199.419.9 CGAP_Ut1 Homo sapiens 308886 AI833240 gb:at76d10.x1 19.8 Barstead colon HPLRB7 Homo 198.2 315622 AI796144 Hs.258188 Homo 191.219.1 Sapiens cDNA FLJ11674 fis, clone HE

323675 843240 Hs.272168 tumor 189.218.9 differentiallyexpressed1 312164 T91980 Hs.221074 ESTs 187.618.8 300378 245270 Hs.235873 hypothetical271.618.7 protein FLJ22672 317478 AI343569 Hs.107000 Homo c 187 sapiens mRNA for WDC146, complete 18.7 317559 AW452344 Hs.129977 ESTs 184.218.4 2$ 317207 AI873346 Hs.214505 ESTs 182.818.3 334834 predicted exon 178.817.9 320925 D62892 gb:HUM337C07B Clontech 177.217.7 human aorta polyA

303289 AL121460 Hs.272673 hypothetical316.417.6 protein FLJ20508 328548 predicted exon 174.617.5 317108 AA884000 Hs.8173 hypothetical172.417.2 protein FLJ10803 318013 AI188183 Hs.144078 ESTs 326 17.2 314299 AW382682 Hs.154840 ESTs 170.817.1 317702 AW173339 Hs.135665 ESTs 169.817 316094 AW975920 Hs.283361 ESTs 169.416.9 3$ 323706 AA377578 Hs.65234 hypothe6calproteinfLJ20596169.216.9 325843 predicted exon 321.416.9 316012 AA764950 Hs.119898 ESTs 1047.216.9 309687 AW236154 Hs.77385 myosin,lightpolypeptide6,alkali,smoothmu168.216.8 323329 AL134744 Hs.10852 ESTs 168 16.8 312853 W05086 Hs.114256 ESTs 167.416.7 313070 AI422023 Hs.161338 ESTs 298.616.6 314096 AW977642 Hs.291742 ESTs 165.616.6 338728 predicted exon 165.416.5 316609 AW292520 Hs.122082 ESTs 165 16.5 45 305989 AA888220 gb:oj15h01.s1 164.616.5 NCI CLAP-Kids Homo sapiens 312642 AW052128 gb:wx26c02.x1 en 164 NCI-CGAP_Kid11 Homo sapi 16.4 339236 predicted exon 163.616.4 317058 A1217713 Hs.147586 ESTs 161.816.2 .

311137 AW207582 Hs.196042 ESTs 582.216.2 310178 AI936450 Hs.147482 ESTs 161.216.1 320745 H51696 Hs.89278 hypothetical161 16.1 protein FLJ11186 317336 AW014637 Hs.130212 ESTs 160 16 309871 AW300366 gb:xs63b05.x1 159.816 NCI_CGAP_Kid11 Homo sapien 302038 AC004076 Hs.129709 Homo 159 Sapiens chromosome 19, cosmid 15.9 $$ 332237 N52883 Hs.102676 EST 159 15.9 312362 AW015994 gb:Ul-H-BIOp-abh-g-09-0-ULs1 15.9 NCI-CGAP_S 158.6 331558 N62401 Hs.48531 EST 158.615.9 316215 AI684535 Hs.200811 ESTs 158.415.8 336059 predicted exon 157.415.7 302790 AJ245245 gb:Homo Sapiens 155.815.6 mRNA for immunoglobulin 328418 predicted exon 153.815.4 304229 AK000149 Hs.29493 hypothetical153.615.4 protein FLJ20142 331606 AW273285 Hs.50802 ESTs 153 15.3 338962 predicted exon 664.415.3 65 317959 AI204202 Hs.130264 ESTs 152.615.3 336228 predicted exon 152.415.2 313534 AW072916 Hs.78743 zinc 152.215.2 finger protein 131 (clone pHZ-10) 317404 AI806867 Hs.126594 ESTs 152.215.2 311943 AI469911 Hs.26498 hypothetical152 15.2 protein FLJ21657 314680 AI247425 Hs.152182 ESTs 151.415.1 331484 N29696 Hs.44076 EST 151.215.1 338116 predicted exon 151.215.1 329863 predicted exon 150.615.1 315555 AW452886 Hs.239107 ESTs 149.615 ~$ 317039 AA868583 Hs.126153 ESTs 149.615 331138 863816 Hs.28445 ESTs 149.615 316561 AI917222 Hs.121655 ESTs 149.414.9 328695 predicted exon 149.214.9 302282 BE396283 Hs.173987 eukaryotic148.414.8 translation initiation factor 318781 F11802 Hs.6818 ESTs 148.214.8 323709 AW297246 Hs.288546 Homo 148 14.8 Sapiens cDNA FLJ14190 fis, clone NT

310790 AW192063 Hs.248865 ESTs 147.814.8 316833 AW292614 Hs.124367 ESTs 147.814.8 323176 NM_007350Hs.82101 pleckstr;n229 14.8 homology-like domain, family 324188 AW274439 Hs.252709 ESTs 147.614.8 1 317441 AA922798 Hs.196583 ESTs 147.414.7 ~

317584 AI825890 Hs.220513 ESTs 146.814.7 321798 AI308206 Hs.181959 ESTs 146.814.7 304363 AA206045 gb:zq77f05.s1 146.614.7 Stratagene hNT neuron (937 313952 F20956 gb:HSPD05390 HM3 146.614.7 Homo Sapiens cDNA clone 1 301909 AI702609 Hs.15713 ESTs 263.814.7 S

309196 AI904895 Hs.9614 nucleophosmin146.214.6 (nucleolar phosphoprotein 321860 N47474 Hs.212631 ESTs 146.214.6 330187 ~ predicted exon 146 14.6 323042 AA463571 Hs.172550 polypyrimidine145.614.6 tract binding protein (he 313636 AA262397 Hs.201366 ESTs 145.214.5 302437 AB024729 Hs.227473 UDP-N-acetylglucosamine:a-1,3-D-mannosid145 14.5 318197 AI473096 Hs.133403 ESTs 144.814.5 302749 M16951 gb:Human Ig mu-chain 14.5 mRNA VDJ4-region, 5144.6 322357 AI734258 Hs.245367 ESTs, S 144.614.5 Weakly similar to ALU1 HUMAN
ALU
~

25 300391 AI927371 Hs.288839 hypothetical144.414.4 protein FLJ12178 326077 predicted exon 144.414.4 302004 Y18264 Hs.123094 sal (Drosophila)-like144 14.4 1 ~

320668 AA805666 Hs.146217 Homo 144 14.4 sapiens cDNA: FLJ23077 fis, clone L

331212 T88693 Hs.226410 ESTs 144 14.4 311268 AI969727 Hs.231859 ESTs 143.214.3 305159 AA659166 Hs.275668 EST,WeaklysimilartoEF1D-HUMANELONGATIONF 143 14.3 304510 AA457391 Hs.119122 ribosomalproteinL13a142.814.3 320852 AA772920 Hs.303527 ESTs 142.814.3 330854 AW291944 Hs.122139 ESTs 142.814.3 35 318275 AW449952 Hs.190125 basic-helix-loop-helix-PAS142.614.3 protein 314992 AI824879 Hs.211286 ESTs, 142.214.2 Weakly similar to 1207289A reverse 322631 AA001697 Hs.293565 ESTs, 142.214.2 Weakly similar to putative p150 [H

332283 840855 Hs.100839 EST 142 14.2 302894 AA719572 Hs.274441 Homo 141.214.1 Sapiens mRNA; cDNA DKFZp434N011 (fr 301808 835391 Hs.252831 reticulon141 14.1 318608 AI204491 Hs.151502 ESTs 141 14.1 316499 AW292947 Hs.122872 ESTs 140.814.1 317011 AI248760 Hs.150276 ESTs 140.814.1 321840 N45600 Hs.46534 Homo sapiens4 140.814.1 mRNA; cDNA DKFZp434P071 (f 4S 327365 predicted exon 140.814.1 331264 AA278898 Hs.225979 hypothetical140.814.1 protein similar to small G

324545 AW501944 Hs.127243 Homo 140.414 sapiens mRNA for KIAA1724 protein, 312986 AA211586 gb:zn56d05.s1 140.214 Stratagene muscle 937209 H

316053 AA825814 Hs.149065 ESTs 140.214 330723 BE247449 Hs.31082 hypothetical140.214 protein FLJ10525 304876 AA595765 gb:nj28g06.s1 139.814 NCI_CGAP AA1 Homo sapiens 311379 AW134766 Hs.202450 ESTs 139.814 318265 AW019873 Hs.146840 ESTs 139.814 324137 AA393127 Hs.222762 ESTs 139.814 SS 328262 predicted exon 139.614 322349 AK001279 Hs.180171 Homo 139.413.9 sapiens cDNA FLJ10417 fis, clone NT

323504 AA280223 Hs.130865 ESTs 139.413.9 304261 AA059387 gb:zf66d01.s1 139.213.9 Soares retina N2b4HR Homo 310489 AW451493 Hs.235516 hypothetical139.213.9 protein PR02955 335946 predicted exon 139.213.9 318155 A1041546 Hs.132133 ESTs 138.813.9 313796 AI797169 Hs.208486 ESTs 138.613.9 333977 predicted exon 138.613.9 324845 AW969635 Hs.283718 ESTs 138.213.8 65 331139 865706 gb:yi16g12.s1 Soares 13.8 placenta Nb2HP Homo 138.2 331131 854797 gb:yg87b07.s1 Soares669.613.8 infant brain 1NIB H

321250 H58539 Hs.151692 ESTs 138 13.8 312498 AA668782 Hs.191284 ESTs, S 137.813.8 Weakly similar to ALU1_HUMAN
ALU

331252 W52470 Hs.34578 alpha2,3-sialyltransferase137.813.8 70 337407 predicted exon 137.813.8 303973 AW512014 gb:xx68a03.x1 137.413.7 NCI_CGAP Lym12 Homo sapien 314582 AA412258 Hs.188817 ESTs 137.413.7 327373 predicted exon 137.213.7 323367 AA234591 Hs.304123 ESTs 136.613.7 7S 316207 AA832065 Hs.120260 ESTs 136.413.6 315231 AA705809 Hs.119922 ESTs 136.213.6 318592T39310Hs.1139cold shock domain 136.213.6 protein A

320906AW969706Hs.293332ESTs 136.213.6 328937 preFticted exon 136.213.6 329073 predicted exon 136.213.6 $ 318231AV659082Hs.134228ESTs 136 13.6 311992AL360200Hs.114145ESTs 135.813.6 316497AA766457Hs.136849ESTs 135.813.6 317677AA968594Hs.127868ESTs 135.813.6 321680W02848Hs.93704ESTs 135.813.6 326080 predicted exon 135.813.6 330938AF036943Hs.172619KIAA1106 protein 135.813.6 306573AL134878Hs.119500ribosomal protein,135.613.6 large P2 307383AI223207Hs.147888EST 135.613.6 311114AW449382Hs.195297ESTs 135.613.6 320579815138Hs.165570Homo Sapiens clone135 13.5 25052 mRNA sequence 301328AA884104Hs.125546ESTs 134.813.5 312063N58198Hs.182898ESTs 134.813.5 323036H09604Hs.13268ESTs 134.613.5 332776AF241850Hs.151428retfingerprotein2 134.413.4 332494AA282330Hs.145668ESTs 134.213.4 334376 predicted exon 134.213.4 313264N93416Hs.118228ESTs 133.613.4 313669AA351109Hs.5437Tax1 (human T-cell133.213.3 leukemia virus type I

312083T87398Hs.205816ESTs 132.613.3 319354AA993807Hs.167367ESTs 132.613.3 307414AI242106 gb:qh92a02.x1 Soares-NFL_T-GBC 132.213.2 S1 Homo s 312771AA018515Hs.264482Apgl2 (autophagy 131.813.2 12, S. cerevisiae)-like 313004AI274963Hs.145900ESTs 131.213.1 300995AW510641Hs.258018ESTs 220.613 319323F12650Hs.13287ESTs 125.412.5 329451 predicted exon 123.412.3 337603 predicted exon 572 12.2 312480868651Hs.144997ESTs 121.412.1 324934AW452051Hs.147546ESTs 119.411.9 3 320723BE178025Hs.7942hypothetical protein117 11.7 318188AI792566 gb;qi74f02.y5 NCI 116.611.7 CGAP-Ov26 Homo Sapiens 320873AF238869Hs.283955Homo Sapiens clone112.811.3 GLSH-2 similar to gli 331005BE003191Hs.119555ESTs 112.611.3 304969AA614406 gb:np46f05.s1 NCI 112.411.2 CGAP-Br11 Homo Sapiens 319799AI139253Hs.227767zinc finger protein111.211.1 302610AA347945Hs.256024ESTs 111 11.1 309485AW130320Hs.108124ribosomalproteinS4,X-linked111 11.1 311880AW419225Hs.256247ESTs 110.211 313981AW452334Hs.128148ESTs 110.211 45 322442W49701Hs.29667ESTs 109.410.9 315099AA806536Hs.291841ESTs 109 10.9 304793AA583264Hs.182979ribosomalproteinL12108.810.9 330815AA019211Hs.236463KIAA1238 protein 108.810.9 304044T81656Hs.252259ribosomal protein 714.810.8 325222 predicted exon 135 10.8 325889 predicted exon 814.610.8 321447AW891130Hs.38173ESTs 107.810.8 302990AA496212Hs.180182ESTs 106.210.6 308106AI476803 gbaj77e12.x1 Soares_NSF_FS_9W_OT-PA_P 270.610.6 S

S$ 310536AI301041Hs.150174ESTs 106 10.6 315257AW157431Hs.248941ESTs 233 10.6 318787242313Hs.22657ESTs 105.810.6 312306AI927226Hs.175610ESTs 105.210.5 326788 predicted exon 104.410.4 312234AA830640Hs.206934ESTs 104 10.4 314482AW085525Hs.134182ESTs 234 10.4 323597AI185693Hs.135119ESTs 102.410.2 302623AW836724Hs.194110hypothetical protein162.410.2 323594AI791531Hs.129993ESTs 101 10.1 6$ 324315N55761Hs.194718zinc finger protein100.210 314217AA256465Hs.188725ESTs 99.2 9.9 320932AA554913Hs.162297ESTs 98.2 9.8 327876 predicted exon 98.2 9.8 319736817424Hs.6650vacuolar protein 98 9.8 sorting 45B (yeast homo 70 327747 predicted exon 97.6 9.8 327844 predicted exon 97.4 9.7 318200A1061192Hs.166517ESTs 97.2 9.7 329414 predicted exon 97.2 9.7 318296A1089667Hs.270713ESTs 121.4~.
9.7 ~$ 307010AI140014 gb:qa68f09.x1 Soares_fetal-heart 9.7 NbHH19W295 319792AI138635Hs.22968ESTs 385.49.6 305671 96 9.6 Hs.82113 dUTPpyrophosphatase 329440 predicted exon 93.89.4 310381 Hs.145594 ESTs 93.49.3 318824 Hs.27226 ESTs 93.49.3 $ 328957 predicted exon 92.29.2 318804 Hs.160893 ESTs 92 9.2 330836 Hs.226568 ESTs, Moderately 9.2 AA055611 similar to ALU4 HUMAN

324592 Hs.325708 ESTs 91.89.2 311820 Hs.254333 ESTs 91.49.1 1 321614 gb:ys94b01.r1 Soares 91 9.1 ~ H86161 retina N2b5HR Homo 330306 predicted exon 91 9.1 303096 Hs.268562 regulator 90 9 AL080276 of G-protein signalling 313275 Hs.159650 ESTs 110.48.8 302593 Hs.36958 ESTs 88 8.8 1$ 321421 Hs.171688 ESTs 86.28.6 330832 Hs.62930 ESTs 456.48.6 311847 Hs.297260 ESTs 86 8.6 322036 Hs.301905 Homo sapiens 145.88.6 BE002723 cDNA FLJ14080 fis, clone HE

328688 predicted exon 85.68.6 325251 predicted exon 85.48.5 329088 predicted exon 85.48.5 322524 Hs.271762 ESTs 84 8.4 337953 predicted exon 451 8.3 323529 Hs.201485 Homo sapiens 82.6 AA284397 clone FLC0664 PR02866 8.3 mRNA, 2$ 307041 gb:qb85b12.x15oares 306.88.2 AI144243 fetal-heart NbHH19W

318285 Hs.158412 ESTs 81.48.1 312021 Hs.14041 ESTs 81 8.1 329350 predicted exon 81 8.1 326169 predicted exon 80.48 338038 predicted exon 1024.27.9 312549 Hs.146304 ESTs 77.47.7 312542 gb:HUM084E10A Clontech 76.87.7 D60076 human fetal brain 320992 Hs.225972 solute carrier76 7.6 A8026891 family 7, (cationic amino 318596 Hs.172698 EST 150.67.5 3$ 315650 Hs.269615 ESTs 73.47.3 324328 Hs.292020 ESTs 210.47.1 332622 Hs.128856 CSR1 protein 70.27 328229 predicted exon 69.46.9 319110 Hs.98321 hypothetical 68.66.9 T75260 protein FLJ14103 40 316133 Hs.125562 ESTs 308.66.9 303992 gb:hd88g01.x1 NCI-CGAP_GC6 67.8 AW515800 Homo Sapiens 6.8 322675 Hs.146580 enolase 2, 377.26.7 AA017656 (gamma, neuronal) 325753 predicted exon 105.26.6 312539 Hs.200360 Homo Sapiens 92.26.4 A1004377 cDNA FLJ13027 fis, clone NT

4$ 302592 Hs.250811 v-ral simian 361.66.3 AA294921 leukemia viral oncogene hom 314578 Hs.137475 ESTs 201.66.1 335986 predicted exon 108.66 321478 Hs.123253 hypothetical 528 6 AW402593 protein FLJ22009 305192 gb:ag44a04.s1 Jia bone 58.65.9 AA666019 marrow stroma Hom $ 304275 gb:zm53h09.s1 Stratagene78.65.6 0 AA070605 fibroblast (937 302779 gb:Homo sapiens mRNA 278.85.5 AJ235667 for immunoglobulin 301976 Hs.77256 enhancer of 479.25.4 T97905 zeste (Drosophila) homolog 2 316021 Hs.144904 nuclear receptor792.45.3 AW293399 co-repressor 1 320802 Hs.185055 BENE protein 2423.85.3 $ 317282 Hs.176101 ESTs 523.25.1 $ AI733112 316827 Hs.172445 ESTs 578 5.1 303190 Hs.16079 hypothetical 223 5.1 BE280787 protein FLJ10233 315587 Hs.140489 ESTs 136.25 333122 predicted exon 399 5 60 310214 Hs.165893 ESTs 234.44.9 320089 Hs.113274 transcrfption68 4.9 D43945 factor EC

309328 Hs.233191 EST, Weakly 258.84.8 AW024348 similar to A27217 glucose tr 318971 Hs.10957 ESTs 376.64.8 327220 predicted exon 47.44.7 6$ 315757 Hs.179872 ESTs 177.44.7 320730 Hs.151072 ESTs 205.24.6 313339 Hs.163495 Homo sapiens 260 4.5 AI682536 cDNA FLJ13608 fls, clone PL

318634 Hs.156832 ESTs 475.24.5 320955 Hs.278679 a disintegdn 388.64.4 AW820035 and metalloproteinase doma 306605 Hs.119500 ribosomalprotein,largeP281.64.4 309349 gb:wx24a09.x1 NCI_CGAP-Kidl1 102.44.3 AW051913 Homosapien 306004 Hs.2186 eukaryotictranslationelongaticnfactor1ga451.24.2 330020 predicted exan 61.24.1 302308 Hs.91379 ribosomal protein342 3.9 7$ 314648 gb:EST391378 MAGE resequences, 56.4 AW979268 MAGP Homo 3.8 315131 Hs.152484 ESTs 130.43.7 313690 AI493591 Hs.78146 plateletlendothelial3179.63.6 cell adhesion molec 333585 predicted exon 175.43.5 312911 H93366 Hs.7567 Homo Sapiens219 3.5 cDNA: FLJ21962 fis, clone H

322966 AA633669 Hs.235920 Homo 350.23.4 sapiens cell recognition molecule C

$ 312492 871072 Hs.191269 ESTs ~ 322.83 318988 244203 Hs.26418 ESTs 25 2.5 332363 AI123705 Hs.106932 ESTs 773.42.5 324181 A1025476 Hs.131628 ESTs 634.82.4 311717 AW205369 Hs.312830 ESTs 54.2 2.4 321342 AA127984 Hs.222024 transcription23.4 2.3 factor BMAL2 308852 AI829848 Hs.182937 peptidylprolylisomeraseA(cyclophilinA)92 2.3 331466 AA373210 Hs.43047 Homo 494 2.3 sapiens cDNA FLJ13585 fis, clone PL

320279 AB033062 Hs.134970 DKFZP434N17876.2 2.2 protein 322221 N24236 Hs.179662 nucleosome253.22.1 assembly protein 1-like 1 1$ 302925 AL137449 Hs.126666 homeo 136.62.1 box 84 331384 AB041035 Hs.93847 NADPH 720 1.8 oxidase 4 300938 AA514416 Hs.152320 ESTs, 27 1.8 Weakly similar to 1605244A erythro 312695 AW196663 Hs.200242 ESTs 303.81.6 320223 W35132 Hs.267442 ESTs 189 1.5 332743 AW247977 Hs.87595 translocase14.4 1.4 of inner mitochondrial membr 331039 AW378685 Hs.18625 Mitochondrial529.81.4 Acyl-CoA Thicesterase 333123 predicted exon 396.21.4 328455 predicted exon 91.8 1.3 334458 predicted exon 406.41.3 ~$ 313478 AA643008 Hs.192775 ESTs 413.41.1 309899 AW338564 Hs.217493 annexinA2-30,81 311735 AW294416 Hs.144687 Homo -62.81 sapiens cDNA FLJ12981 fis, clone NT

312953 NM-001992Hs.128087 coagulation-73.61 factor II (thrombin) recepto 313055 AW367295 Hs.241175 ESTs -43.81 313291 AI267970 Hs.150614 ESTs, S -63 1 Weakly similar to ALU4-HUMAN
ALU

315059 AW275110 Hs.271106 ESTs -67 1 322284 AI792140 Hs.49265 ESTs -395.21 322450 AL121278 Hs.25144 ESTs -1.6 1 324803 AW975183 Hs.292663 ESTs 4.4 1 3 331495 AW970939 Hs.291039 ESTs -282.81 $

333610 predicted exon -152.61 335093 predicted exon -23.21 339403 predicted exon -331.21 302820 X04588 Hs.85844 neurotrophic591.21 tyrosine kinase, receptor, 302270 856151 Hs.93589 Homo sapiens 276.61 mRNA; cDNA DKFZp564B1162 (f 323755 AW300094 Hs.136252 ESTs 135 0.9 326946 predicted exon 727.40.9 315343 BE144306 Hs.179891 ESTs, 122.8 0.9 Weakly similar to P4HA HUMAN
PROLY

311168 AK001270 Hs.196086 hypothetical304 0.9 protein FLJ10408 4$ 329732 predicted exon 109.20.9 321415 BE621807 Hs.3337 transmembrane414.80.7 4 superfamily member 1 333121 predicted exon 87.8 0.7 333120 predicted exon 379.80.7 330392 AW797956 Hs.75748 proteasome589.20.7 (prosome, macropain) subunit, $ 314711 AA769365 Hs.126058 ESTs -87 0.6 330865 BE409857 Hs.69499 hypothetical347.40.6 protein 333169 predicted exon -11820.6 335095 predicted exon 106.40.6 335815 predicted exon -156 0.6 $ 330232 predicted exon 102.60.6 $

330823 AA031565 Hs.221255 ESTs, 0.5 Moderately similar to ALUS_HUMAN

331704 F04225 Hs.66032 ESTs -14.60.5 302642 NM 016428Hs.130719 NESH 267.60.5 protein 304484 AA432067 Hs.258373 ESTs 85 0.5 60 310230 AK000377 Hs.144840 homolog-70 0.4 of mouse C2PA

301531 AI077462 Hs.134084 ESTs -195.40.4 306337 AA954221 Hs.73742 ribosomalprotein,large,PO-33.40.4 331327 N46436 Hs.109221 ESTs -392 0.4 332961 predicted exon -5.6 0.4 6$ 322796 W31178 Hs.154140 Homo Sapiens-880.60.3 ovary-specific acidic prote 328857 predicted exon 55.2 0.3 316342 AA743935 Hs.202329 ESTs 43.4 0.3 331263 AW780192 Hs.267596 ESTs -180.40.3 335987 predicted exon -134 0.3 70 311923 T60843 Hs.189679 ESTs 12.2 0.3 310522 AW134529 Hs.244647 ESTs -187.80.3 315363 AA759190 Hs.121454 ESTs, 80 0.3 Weakly similar to olfactory recept 001992Hs.128087 coagulaUon factor-877 0.3 II (thrombin) recepto - 95.4 0.3 313140 BE265133 Hs.217493 annexin 7$ 310860 AW015920 Hs.161359 ESTs -239 0.3 317899 AI952430 Hs.150614 ESTs, S -715.2 Weakly similar to ALU4-HUMAN 0.3 ALU

328520 predicted exon -109.20.2 302406 NM_012099Hs.211956 CD3-epsilon-associated10 0.2 protein; antisens 311804 AI866921 Hs.203349 Homo -252.60.2 sapiens cDNA FLJ12149 fis, clone MA

315065 AK001122 Hs.105859 hypothetical-46.20.2 protein FLJ10260 $ 314129 AA228366 Hs.115122 ESTs -308.80.2 335697 predicted exon -47.20.2 335989 predicted exon 89 0.2 320606 AW867943 Hs.127216 hypothetical-205.60.2 protein FLJ13465 329745 predicted exon 103 0.2 313628 AW419069 Hs.209670 ESTs -177.80.2 334616 predicted exon -936.60.2 308820 AI821267 Hs.207243 EST -7.2 0.2 320416 A1026984 Hs.293662 ESTs -18.40.2 335211 predicted exon -142 0.2 1$ 323629 AA375957 Hs.6682 ESTs -100 0.1 331420 AW452904 gb:Ul-H-BI3-aly-h-11-0-ULs183 0.1 NCI_CGAP-Su 315984 A1015862 Hs.131793 ESTs -250.60.1 332833 predicted exon -374.20.1 332607 NM 002314Hs.36566 LIM domain-27.60.1 kinase 1 313467 AA004879 Hs.187820 ESTs -288.20.1 323333 AV651680 Hs.208558 ESTs -735.60.1 330775 AW247020 Hs.250747 SUMO-1 53.6 0.1 activating enryme subunit 1 333168 predicted exon -1041.80.1 332079 AI308876 Hs.103849 ESTs 19.4 0.1 2$ 322724 AF161442 Hs.191591 Homo -123.60.1 Sapiens HSPC324 mRNA, partial cds 303652 AI799111 Hs.64341 ESTs -46.40.1 303131 AW081061 Hs.103180 DC2 -156.40.1 protein 320716 AI479439 Hs.171532 ESTs -146.60.1 300454 AA659037 Hs.163780 ESTs -304 0.1 312757 AI285970 Hs.183817 ESTs -045 0.1 312391 843707 Hs.133159 ESTs, -111.80.1 Weakly similar to PIHUSD salivary 308877 AI832519 gb:at69h03.x1 0 Barstead colon HPLRB7 Homo-149.6 311275 AI659166 Hs.207144 ESTs -62.60 302363 AW163799 Hs.198365 2,3-bisphosphoglycerate-15 0 mutase 3$ 321717 AW956580 Hs.42699 ESTs -1059.60 302638 AA463798 Hs.102696 MCT-1 -332.20 protein 306352 AA961367 gb;or52a05.s1 21.8 NCI CGAP_GC3 Homo sapiens 313798 AI292148 Hs.71622 SWIISNF -97.20 related, matrix associated, acti 320807 AA135370 Hs.188536 Homo -22220 sapiens cDNA: FLJ21635 fis, clone C

320931 AW262836 Hs.252844 ESTs -881.60 332450 AW288085 Hs.11156 hypothetical28.4 0 protein 332535 AF167706 Hs.19280 cysteine-rich-722 0 motorneuronl 335990 predicted exon -421 0 330746 A8033888 Hs.8619 SRY (sex 35.4 0 determining region Y)-box 18 4$ 316820 AI627912 Hs.130783 Forssman-373.60 synthetase 337429 predicted exon -257 0 331192 BE622021 Hs.152571 ESTs, -33 0 Highly similar to IGF-II mRNA-bind 330609 AI346201 Hs.76118 ubiquitin-280 0 carboxyl-terminal esterase L1 323593 AI739435 Hs.39168 ESTs -3627.60 302704 AA531133 Hs.4253 hypothetical-278.60 protein MGC2574 330534 NM 004579Hs.82979 mitogen-activating-244 0 protein kinase kinase 332374 X91195 Hs.100623 phospholipase-1204.20 C, beta 3, neighbor pseudo 333221 predicted exon -189.60 335988 predicted exon -122.60 $ 330574 AI984144 Hs.66713 hepatitis-2257.40 $ delta antigen-interacting prot 312052 BE621697 Hs.14317 nucleolar-359.20 protein family A, member 3 (HI

319568 AF131781 Hs.84753 hypothetical-874.60 protein FLJ12442 337113 predicted exon -24.60 335149 predicted exon -191.80 Table 6A shows the accession numbers for those pkeys lacking unigenelD's for Table 6, The pkeys in Table 7 lacking unigenelD's are represented within Tables 1-6A. For each probeset we have listed the gene cluster number from which the oligonucleotides were designed. Gene clusters were compiled using sequences derived from Genbank ESTs and mRNAs. These sequences were clustered based on sequence similarity using Clustering and Alignment Tools (DoubIeTwist, Oakland California). The Genbank accession numbers for sequences comprising each cluster are listed in the "Accession"
column.
Pkey: Unique Eos probeset identifier number CAT number: Gene cluster number Accession: Genbank accession numbers Pkey CAT Number Accession 312362764066_1 AW015994 839898 AW000978 312986171879_1 AA211586 F35799 AA211641 329350c x hs 329414c-y_hs 30329440c-y-hs 329451c-y hs 338033CH22 6528FG LINK_EM:AC00 338038CH22 6535FG LINK-EM:AC00 338116CH22_6650FG_LINK_EM:AC00 3S338158CH22_6700FG LINK_EM:AC00 329732c14~2 329745c14~2 329863c14 p2 40338316CH22 6944FG-LINK-EM:AC00 338388CH22_7034FG LINK-EM:AC00 338442CH22 7109FG,_LINK-EM:AC00 338645CH22_7410FG LINK-EM:AC00 338728CH22 7527FG~LINK-EM:AC00 333120CH22 349FG 81 3 LINK_EM:A

S0333121CH22_350FG 81 4 LINK-EM:A

333122CH22 351FG 81 6 LINK-EM:A

333123CH22_352FG 81 7 LINK_EM:A

333168CH22_400FG 94_1 LINK-EM:A

333169CH22 401FG 94-2 LINILEM:A

$$333221CH22_458FG_105-1 LINK-EM:

326077c17 hs 326080c17 hs 326169c17 hs 326198c17_hs 326230c17 hs 333585CH22 846FG 203 4 LINK_EM:

333610CH22 871FG 217_5-LINK_EM:

335093CH22_2423FG 492 3 LINK-EM

6$335149CH22 2484FG-499-_5_LINK-EM

326759c20_hs 333977CH22 1254FG-309-6_LINK_EM

326788c20 hs 305192_ 326946c21 hs 328229c_6 hs 328262c-6-hs 328418c_7_hs 328455c 7 hs 335697CH22 3058FG b96_12_LINK_E

328520c 7 hs $ 328548c 7 hs 335815CH22_3187FG 618 3_LINILEM

328688c 7 hs 328695c 7 hs 1 337113CH22 5058FG_493_1_ ~

328700c 7 hs 335946CH22_3324FG 646 20_LINK_D

335986CH22_3366FG 654 10_LINK-D

1$ 335987CH22 3367FG 654_11 LINK-D

335988CH22_3368FG 654_12 LINK D

335989CH22 3369FG 655_2 LINK-DJ

335990CH22_3370FG 655 4 LINK_DJ

337214CH22 5288FG-613 7_ 330020c16_p2 328857c-7 hs 328937c-8 hs 328957c-8 hs ~$ 330187c-4-p2 337407CH22 5607FG_755_1_ 337429CH22 5633FG 762_3_ 330232c_5~2 3 330305c_7_p2 ~

330306c_7_p2 337603CH22 5896FG LINK_C20H12.

337953CH22 6395FG_LINK_EM;AC00 3$ 339403CH22 8384FG LINK_BA232E1 325222c10 hs 325251c10 hs 325544c12_hs 332833CH22 50FG_17 7 LINK_C20H1 4$ 30279034168_1 AJ245245 AJ245247 AJ245257 AJ245248 AJ245254 AJ245256 332961CH22_185FG_48_18-LINK-EM:

325753c14 hs 327036c21_hs $ 325843c16 hs 325889c16 hs 334376CH22 1670FG-379_8 LINK_EM

$ 327220c_1 hs $

334458CH22_1757FG 391-_2_LINK_EM

327365c_1 hs 327373c_2 hs 334616CH22_1923FG-411 15_LINK_E

327414c_2 hs 327568c-3_hs 336034CH22_3419FG 678 5 LINK-DJ

336059CH22_3445FG 684_2 LINft,DJ

6$ 334834CH22 2148FG_439 3 LINK-EM

327747c_5 hs 336228CH22_3626FG_730 4 LINItDA

70 329073c_x_hs ' 329088c_~hs 327844c_5 hs 327876c_6 hs 7$ 306352AA961367 331131genbanh,R54797 854797 331139 genbank_865706 865706 Table 6B shows the genomic positioning far those pkeys lacking unigene ID's and accession numbers in Table 6. The pkeys in Table 7 lacking $ unigenelD's are represented within Tables 1-6B. For each predicted exon, we have listed the genomic sequence source used for prediction. Nucleotide locations of each predicted exon are also listed.
Pkey: Unique number corresponding to an Eos probeset 1 o Ref: Sequence source. The 7 digit numbers in this column are Genbank Identifier (GI) numbers. "Dunham I. et al." refers to the publication entitled "The DNA
sequence of human chromosome 22:' Dunham I. et al., Nature (1999) 402:489-495.
Strand; Indicates DNA strand from which exons were predicted.
Nt-position: Indicates nucleotide positions of predicted exons.
Pkey Ref Strand Nt~osition 332961Dunham, Plus 2521424-2521555 I. et.al.

333221Dunham, Plus 3978070-3978187 I. et.al.

333585Dunham, Plus 6234778-6234894 I. et.al.

333610Dunham, Plus 6547007-6547116 I. et.al.

334376Dunham, Plus 13902218-13902331 I. et.al.

334458Dunham, Plus 14353496-14353572 I. et.al.

2S 334616Dunham, Plus 15176123-15176470 I. et.al.

335149Dunham, Plus 21497441-21497587 I. et.al.

335211Dunham, Plus 21774611-21774680 I. et.al.

335697Dunham, Plus 25481456-25481649 I, et.al.

335986Dunham, Plus 27967791-27967852 I. et.al.

335987Dunham, Plus 27971413-27971481 I. et.al.

335988Dunham, Plus 27977912-27978013 I. et.al.

335989Dunham, Plus 27983788-27983860 I. et.al.

335990Dunham, Plus 27988532-27988608 I. et.al.

336034Dunham, Plus 29014404-29014590 I. et.al.

3 337953Dunham, Plus 6827029-6827125 5 I. et.al.

338033Dunham, Plus 8092128-8092271 I. et.al.

338038Dunham, Plus 8138219-8138392 I. et.al.

338316Dunham, Plus 17089711-17089988 I. et.al.

338442Dunham, Plus 19980640-19980698 I. et.al.

338962Dunham, Plus 29581892-29582020 I. et.al.

332833Dunham, Minus1119848-1119705 I. et.al.

333120Dunham, Minus3307508-3307427 I. et.al.

333121Dunham, Minus3308446-3308358 I, et.al.

333122Dunham, Minus3309596-3309531 I. et.al.

4S 333123Dunham, Minus3310817-3310749 I. et.al.

333168Dunham, Minus3729896-3729788 I. et.al.

333169Dunham, Minus3730864-3730767 I. et.al.

333977Dunham, Minus8722928-8722725 I. et.al.

334834Dunham, Minus17182681-17182535 I. et.al.

50 335093Dunham, Minus21297367-21297214 I. et.al.

335095Dunham, Minus21292546-21292381 I. et.al.

335815Dunham, Minus26320518-26320421 I. et.al.

335946Dunham, Minus27487203-27487035 I. et.al.

336059Dunham, Minus29184079-29183969 I. et.al.

$ 336228Dunham, Minus30904602-30904497 $ I. et.al.

337113Dunham, Minus21233344-21233237 I. et.ai.

337214Dunham, Minus26095902-26095502 I. et.ai.

337407Dunham, Minus31886652-31886567 I. et.al.

337429Dunham, Minus32086238-32086079 I. et.al.

337603Dunham, Minus1299296-1299194 I. et.al.

338116Dunham, Minus10614071-10613814 I. et.al.

338158Dunham, Minus11794465-11794343 I. et.al.

338388Dunham, Minus18662403-18662305 I. et.al.

338645Dunham, Minus24063839-24063775 I. et.al.

65 338728Dunham, Minus25949039-25948927 I. et.al.

339236Dunham, Minus32773355-32773202 I. et.al.

339403Dunham, Minus34050728-34050625 I, et.al.

3252226525287 Minus22332-22473 3252516682448 Minus411693-411751 70 3255446682452 Plus 171228-171286 3257536682474 Plus 398512-398621 3297456065779 Plus 174774-175142 3297326065783 Plus 161252-161322 3298636691797 Plus 196801-196971 7$ 3258895867087 Plus 223829-223891 3258436552453Minus 7126 3300206671887Plus 172397-172491 3261985867215Minus 80295-80674 3262305867230Minus 301868-301972 $ 3261695867255Minus 128321-128388 3260776682495Minus 312108-312168 3260806682495Plus 478644-478847 3267596249610Plus 97216-97311 3267886682503Plus 277132-277335 1 3269466004446Minus 116677-116967 ~

3270366531965Plus 319951-320040 3272205867525Minus 65701-65761 3273656552412Minus 118133-118198 3274145867750Plus 102461-102586 1$ 3273735867792Minus 8186-8742 3275685867811Minus 46152-46287 3301876706138Plus 212923-213020 3277475867947Plus 115322-115498 3278446249582Minus 18895-18958 2 3302326013526Plus 113655-113830 ~

3282295868105Minus 120936-121053 3278765868140Plus 103882-104034 3282626381906Plus 11867-12027 3286885868262Plus 626030-626094 ~ 3287005868264Plus 764089-764203 3286955868264Plus 318632-318695 3284185868409Minus 258811-258894 3284555868431Plus 385576-385633 3285205868477Plus 1942075-1942246 3285485868487Plus 72301-72397 3288576381927Minus 80557-81051 3303054877982Minus 52269-52365 3303064877982Plus 96161-96233 3289375868500Minus 1448241-1448333 3 3289576456773Plus 219195-219297 S

3290735868596Plus 37838-37956 3290885868608Plus 116738-116950 3293506456785Plus 98911-98969 3294145868874Plus 942555-942643 3294405868885Plus 21943-22063 3294515868887Plus 25974-26048 TABLE 7:
Table 7 depicts Seq (D No" UnigenelD, UnigeneTitle, Pkey, and ExAccn for all of the sequences in Table 8. Seq ID No links the nucleic acid and protein sequence information inTable 8 to Table 7.
Pkey: Unique Eos prabeset identifier number ExAccn: Exemplar Accession number, Genbank accession number 1 ~ UnigenelD: Unigene number Unigene Title: Unigene gene title Seq.ID.No.: Sequence Identification Number found in Table 8 PKey ExAccn UnigeneUnigene Tiltle SEQ ID NO
ID

101545BE246154Hs.154210endothelial differentiation,5eq ID 1 &
sphingolipi 2 115819AA486620Hs.41135endomucin-2 Seq ID 3 &

424503NM 002205Hs.149609integrin, alpha 5 (fibronectinSeq ID 5 &
receptor, 6 102917A1016712Hs.287797integrin, beta 1 (fibronectinSeq ID 7 &
receptor, 8 2~ 102915X07820 Hs.2258matrix metalloproteinase Seq ID 9 &
10 (stromelysin 10 105330AW338625Hs.22120ESTs Seq ID 11 &

107385NM 005397Hs.16426podocalyxin-like Seq ID 13 &

102024AA301867Hs.76224EGF-containing fibulin-likeSeq ID 15 &
extracellula 16 102024AA301867Hs.76224EGF-containing fibulin-likeSeq ID 17 &
extracellula 18 134416X68264 Hs.211579melanoma cell adhesion Seq ID 19 &
molecule 20 103036M13509 Hs.83169matrix metalloproteinase Seq ID 21 &
1 (interstitial 22 104865T79340 Hs.22575B-cell CLLllymphoma 6, Seq ID 23 &
member B (zinc fi 24 106124H93366 Hs.7567Homo sapiens cDNA: FLJ21962Seq ID 25 &
fis, clone H 26 109001A1056548Hs.72116hypothetical protein FLJ20992Seq ID 27 &
similar to 28 104764A1039243Hs.278585ESTs Seq ID 29 &

133200AB037715Hs.183639hypothetical protein FLJ10210Seq ID 31 &

105263AW388633Hs.6682solute carrier family 7, Seq ID 33 &
(cationic amino 34 102892BE440042Hs.83326matrix metalloproteinase Seq ID 35 &
3 (stromelysin 36 109456AW956580Hs.42699ESTs Seq ID 37 &

3 110906AA035211Hs.17404ESTs Seq ID 39 &
$ 40 119073BE245360Hs.279477ESTs Seq ID 41 &

132050AI267615Hs.38022ESTs Seq ID 43 &

132490NM 001290Hs.4980LIM domain binding 2 Seq ID 45 &

102283AW161552Hs.83381guanine nucleotide bindingSeq ID 47 &
protein 11 48 40 101714M68874 Hs.211587phospholipase A2, group Seq ID 49 &
IVA (cytosolic, 50 133975C18356 Hs.295944tissue factor pathway inhibitorSeq ID 51 &

106793H94997 Hs.16450ESTs Seq ID 53 &

118511N75620 Hs.43157ESTs Seq ID 54 &

101447M21305 gb;Human alpha satellite Seq ID 56 &
and satellite 3 57 45 314941AA515902Hs,130650ESTs Seq ID 58 &

332466AB018259Hs.118140KIAA0716 gene product Seq ID 60 &

313513AW298600Hs.141840ESTs, Weakly similar to Seq ID 62 &
S59501 interfero 63 313556AA628517Hs.118502ESTs Seq ID 64 &

313665AW751201Hs.51233ESTs Seq ID 66 &

$~ 314372AL040178Hs.142003ESTs Seq ID 68 &

429276AF056085Hs.198612G protein-coupled receptorSeq ID 70 &

101345NM_005795Hs.152175calcitonin receptor-like Seq ID 72 &

418994AA296520Hs.89546selectin E (endothelial Seq ID 74 &
adhesion molecul 75 103850AA187101Hs.213194hypothetical protein MGC10895Seq ID 76 &

SS 133260AA403045Hs.6906Homo sapiens cDNA: FLJ23197Seq ID 78 &
fis, clone R 79 101097BE245301Hs.89414chemokine (C-X-C motif), Seq ID SO &
receptor 4 (fus 81 104786AA027167Hs.10031KIAA0955 protein Seq ID 82 &

132173X89426 Hs.41716endothelial cell-specific Seq ID 84 &
molecule 1 85 100420D86983 Hs.118893Melanoma associated gene Seq ID 86 &

111098AI287912Hs.3628mitogen-activated protein Seq ID 88 &
kinase kinase 89 108507AI554545Hs.68301ESTs Seq ID 90 &

104894AF065214Hs.18858phospholipase A2, group Seq ID 92 &
IVC (cytosolic, 93 118511N75620 Hs.43157ESTs Seq ID 94 &

125609AA868063Hs.104576carbohydrate (keratan sulfateSeq ID 96 &
Gal-6) sul 97 6S 101543M31166 Hs.2050pentaxin-related gene, Seq ID 98 &
rapidly induced b 99 102241NM 007351Hs.268107multimerin Seq ID 100 & 101 101560AW958272Hs.347326intercellular adhesion Seq ID 102 molecule 2 & 103 103280U84722 Hs.76206cadherin 5, type 2, VE-cadherinSeq ID 104 (vascula & 105 105826AA478756Hs.194477E3 ubiquitin ligase SMURF2Seq ID 106 & 107 102804NM 002318Hs.83354lysyl oxidase-like 2 Seq ID 108 & 109 131647AA359615Hs.30089ESTs Seq ID 110 & 111 103095NM-005424Hs.78824tyrosine kinase with immunoglobulinSeq ID 112 and & 113 103037BE018302Hs.2894placental growth factor, Seq ID 114 vascular endoth & 115 100405AW291587Hs.82733nidogen 2 Seq ID 116 & 117 7$ 102012BE259035Hs.118400singed (Drosophila)-like Seq ID 118 (sea urchin fas & 119 101261D30857 Hs.82353protein C receptor, endothelialSeq ID 120 (EPCR) &

105729H46612 Hs.293815Homo Sapiens HSPC285 mRNA, Seq ID 122 partial cds &

107216D51069 Hs.211579melanoma cell adhesion moleculeSeq ID 124 &

131080NM_001955Hs.2271 endothelin 1 Seq ID 126 &

$ 131486F06972 Hs.27372BMX non-receptor tyrosine Seq ID 128 kinase &

134299AW580939Hs.97199complement component C1q Seq ID 130 receptor &

134983D28235 Hs.196384prostaglandin-endoperoxide Seq ID 132 synthase 2 (p &

115827AA428000Hs.283072actin related protein 213 Seq ID 134 complex, subun &

133614NM-003003Hs.75232SEC14 (S. cerevisiae)-like Seq ID 136 1 &

1 116483AI346201Hs.76118ubiquitin carboxyl-terminalSeq ID 138 ~ esterase L1 &

132546M24283 Hs.168383intercellular adhesion moleculeSeq ID 140 1 (CD54) &

133678AW247252NA nucleoside phosphorylase Seq ID 142 &

130184H58306 Hs.15165retinoic acid induced 14 Seq ID 144 &

134786T29618 Hs.89640TEK tyrosine kinase, endothelialSeq ID 146 (venous &

1$ 129371X06828 Hs.110802von Willebrand factor Seq ID 148 &

418506AA084248Hs.85339G protein-coupled receptor39Seq ID 150 &

322262AA632012Hs.188746ESTs Seq ID 152 &

312173AI821409Hs.304471EST Seq ID 154 &

319795AB037821Hs.146858protocadherin 10 Seq ID 156 &

313978AI870175Hs.13957ESTs Seq ID 158 &

306840A1077477Hs.307912ESTs Seq ID 160 &

310272AF216389Hs.148932sema domain, transmembrane Seq ID 162 domain (TM), &

310272AF216389Hs.148932sema domain, transmembrane Seq ID 164 domain (TM), &

315044BE547674Hs.204169ESTs, Weakly similar to Seq ID 166 S65657 alpha-1 C- &

321325AB033100Hs.300646KIAA1274 protein (similar Seq ID 168 to mouse palad &

321325AB033100Hs.300646KIAA1274 protein (similar Seq ID 170 to mouse palad &

303251AF240635Hs.115897protocadherin 12 Seq ID 172 &

302378AL109712Hs.296506Homo sapiens mRNA full lengthSeq ID 174 insert cDN &

319267F11802 Hs.6818 ESTs Seq ID 176 &

310442AW072215Hs.208470ESTs Seq ID 178 &

300469BE301708Hs.233955hypothetical protein FLJ20401Seq ID 180 &

331237W87874 Hs.25277Homo Sapiens cDNA FLJ10717 Seq ID 182 fis; clone NT &

330968844557 Hs.23748ESTs Seq ID 184 &

301822X17033 Hs.271986integrin, alpha 2 (CD49B, Seq ID 186 alpha 2 subuni &

35 422573AW297985Hs.295726integdn, alpha V (vitronectinSeq ID 188 receptor &

133061AI186431Hs.296638prostate differentiation Seq ID 190 factor &

135235AW298244Hs.266195ESTs Seq ID 192 &

101192BE247295Hs.78452solute carrier family 20 Seq ID 194 (phosphate tran &

113195H83265 Hs.8881 ESTs, Weakly similar to Seq ID 196 S41044 chromosom &

101741NM_003199Hs.326198transcription factor4 Seq ID 198 &

321911AF026944Hs.293797ESTs Seq ID 200 &

320635N50617 Hs.80506small nuclear ribonucleoproteinSeq ID 202 polypept &

326230 NM 017643:Homo sapiens hypotheticalSeq ID 204 prot &

132968AF234532Hs.61638myosin X Seq ID 206 &

45 135073W55956 Hs.94030Homo sapiens mRNA; cDNA Seq ID 208 DKFZp586E1624 (f &

108937AL050107Hs.24341transcrip6onal co-activatorSeq ID 210 with PDZ-bi &

116430AK001531Hs.66048hypothetical protein FLJ106695eq ID 212 &

104877AI138635Hs.22968Homo Sapiens clone IMAGE:451939,Seq ID 214 mRNA se &

122697AA420683Hs.98321hypothetical protein FLJ141035eq ID 216 &

S 112522868857 Hs.265499ESTs Seq ID 218 o &

304782AA582081 gb:nn32h08.s1 NCI-CGAP_Gas1Seq ID 220 Homo Sapiens &

312802AA644669Hs.193042ESTs Seq ID 222 &

302680AW192334Hs.38218ESTs ' Seq ID 224 &

326198 Phase 2 & 3 Exons Seq ID 226 &

$ 331019NM-006033Hs.65370lipase; endothelial Seq ID 228 $ &

~ASEE 8 Seq ID NO: 1 DNA secuence Nucleic Acid Accession ~k: NM_001400 Coding sequence: 244-2208 (underlined sequences correspond to start and stop codons)) O

ACCA_TGGGGCCCACCAGCGTCCCGCTGGTCAAGGCCCACCGCAGCTCGGTCTCTGACTAC300 ~S TGGGAAGATGAAGATGGTTTGGAGGTGTAAAACAATGTCCTTCGCTGAGGCCAAAGTTTC2040 CTTGATTTTTGAATGTATTTGTTTCAGGAAGAAGTCATTTTATGGATTTT'TCTAACCCGT2460 TTTGCACATAGCTTTATCAACTTTTAAACATTAATAAACTGATTTTTTTAAAG

Seq ID N0: 2 Protein sequence:
Protein Accession #: NP 001391 6S 1 11 2l 31 41 51 pQKDEGDNPE TIMSSGNVNS SS

Seq ID NO: 3 Nucleotide seauence:
Nucleic Acid Accession #: NM_016242 Coding sequence: 79-864 (underlined sequences correspond to start and stop codons)) O

AATCCCGACTTCCATACCTGCTGCTGG

Seq ID NO: 4 Protein seouence:
Protein Accession #: NP 057326 Seq ID 5 Nucleotide NO: seauence:

Nucleic #: NM 002205 Acid Accession S0 Coding _ sequencesorrespondstart and stop sequence: 24..3173 c to codons) (underlined ~ISGCAGCTCCTTGACCCCCCTGGGGGACCTGGACCAGGATGGCTACAATGATGTGGCCATCG1260 ~S AGGCTGAGTGTTTCAGGCTGCGCTGTGAGCTCGGGCCCCTGCACCAACAAGAGAGCCAAA2820 AAAA
SO

Seq ID NO: 6 Protein seauence:
Protein Accession #: NP 002196.1 ~S VDKAVVYRGRPIVSASASLTIFPAMFNPEERSCSLEGNPVACINLSFCLNASGKHVADSI540 YKLGFFKRSLPYGTAMEKAQLKPPATSDA

1~1 Seq ID NO: 7 Nucleotide se_guence:
Nucleic Acid Accession #: NM_002211 Coding sequence: 104..2500 (underlined sequences correspond to start and stop codons) 6O GTGCCATTTTAAGAGTTACTTAATGTTTGGTAACTTTTATGCCTTCACTTTACAAATTCA37.80 C)SAGCGGTCAATTTGCCTTTTTAATGAACATGTGAAGTTATACTGTGGCTATGCAACAGCTC3480 GTTTTAACAGTTCA

7O Seq ID NO: 8 Protein secruence:
Protein Accession #: NP 002202 1 11 21 31 41 Sl PIYKSAVTTV VNPKYEGK
1S Seq ID NO: 9 Nucleotide seouence:-Nucleic Acid Accession #: NM 002425 Coding sequence: 23..1453 (underlined sequences correspond to start and stop codons) I

I I ~ I I TGTGTCTGCC60 AAAGAAGGTAAGGGCAGTGAGAATGATGCATCTTGCATTCCTTGTGCTGT

~S AAAGGACAGTAATCTCATTGTTAAAAAAATCCAAGGAATGCAGAAGTTCCTTGGGTTGGA240 O

GTTACATTGC_TAGGCGAGATAGGGGGAAGACAGATATGGGTGTTTTTAATAAATCTAATA1500 O

CTT

Seq ID NO: 10 Protein seguence:
SS Protein Accession #: NP 002416 C)O KKIQGMQKFL GLEVTGKLDT DTLEVMRKPR CGVPDVGHFS SFPGMPKWRK THLTYRIVNY 120 FPRLIADDFP GVEPKVDAVL QAFGFFYFFS GSSQFEFDPN ARMVTHILKS NSWLHC
70 Seq ID NO: 11 Nucleotide seo'uence:
Nucleic Acid Accession #: XM_058189 Coding sequence: 169..774 (underlined sequences correspond to start and stop codons) TCCAAGATACTGTGTGGAAGCTATTCAGTGATCTTCCAGCCTGGAATCATT_TGAATAAGG780 ZO ATAAAAAATAAAGAGTACTACATGGTTGTAAAA

Seq ID NO: 12 Protein sectuence:
Protein Accession #: XP 058189 3 O CRTLDGWEYA FEGTAGRFLT DSSIWIQCLE PAFiWEWNII LFSILITLSG LQVIICLIRV 180 VMQLSKILCG SYSVIFQPGI I
Seq ID NO: 13 Nucleotide sequence:
3S Nucleic Acid Accession #: NM_005397 Coding sequence: 251..1837 (underlined sequences correspond to start and stop codons) TGCGCTGCG

4S GCCGCTGCTG_ CGTCGCCGTCGCCGTCGCCGTCGCCCTCCCAGAATGCAAC360 CCGTCGTCGC

CTGTGTGGAATGTTGAACTTTCGCCATGGTCTCCATCGTTCTGGGCGTAAATTCCCTGGG3480' ~S GTCCTGCACCATCTGCCTAATTCCTTCCTCACAGTCTGTAGCCATCTGATATCCTAGGGG3720 O

GCCAAACAGCCATGCATCTATAAAGGTCATCATCTTCTGCCPfCCTTTACTGGGTTCTAAA4380 TTTTCTTACAAAAATATATTTTGGAAAATTGTATACTGTCAATTAAAGT

Seq ID 14 Protein seauence:
NO:

Protein Accession #: NP

PTLEVMETSSEMQEKKWSL NGELGDSWIVPLDNLTKDDLDEEEDTHL

Seq ID N0: 15 Nucleotide seouence:
Nucleic Acid Accession #: NM_004105 Coding sequence: 150..1631 (underlined sequences correspond to start and stop codons) ~S ACTGTGAAGACATTGATGAATGCAGAACCTCAAGCTACCTGTGTCAATATCAATGTGTCA1080 O

3 TTTCATTT_TA_GTCTTTTCTAAGAGTCAACCACAGGCATTTAAGTCAGCCAAAGAATATTG1680 S

O

TTTAAATAAAAATAAATATTCCTTTAGAAG.ATCACTCTAAAA

SS
Seq ID NO: 16 Protein secruence:
Protein Accession #: NP 004096 VLRLTIIVGP FSF
Seq ID NO: 17 Nucleotide seauence:
Nucleic Acid Accession #: NM_018894 7S Coding sequence: 27..1967 (underlined sequences correspond to start and stop codons) 1~6 4S ATTTCTCATCTTCGTACTTGATGCTCACAGAGGAAG1~AAATGATGATGGTTTTTATTCCT2520 AAAAATAAATATTCCTTTAGAAGATCACTCTAAAA

SO Seg ID NO: 18 Protein seouence:
Protein Accession #: NP 061489.1 C)O YQWRSRTCQ DINECETTNE CREDEMCWNY HGGFRCYPRN PCQDPYILTP ENRCVCPVSN 360 PVSAMLVLVK SLSGPREHIV DLEMLTVSSI GTFRTSSVLR LTIIVGPFSF
Seq ID NO: 19 Nucleotide secruence:
6S Nucleic Acid Accession #: NM_006500 Coding sequence: 27..1967 (underlined sequences correspond to start and stop codons) 1~7 AAGCGCCCTC

GGGCTCCGGGAGACCAGGGAGAGAAATACATCGATCTGAGGCAT_TAGCCCCGAATCACTT1980 O

CACTGCACTCCAGCCTGGGC~AACACAGCGAGACTCCGTCTCGAGGAAAAAAAAAGAAAAG2880 O

TGTTAGCAGGAGCTATGTCCCTTCCTATCGTTTCCGTCCACTT

Seq ID N0: 20 Protein seouence:
Protein Accession #: NP 006491 PPSRKTELW EVKSDKLPEE MGLLQGSSGD KRAPGDQGEK YIDLRH

Seq ID NO: 21 Nucleotide seauence:
Nucleic Acid Accession #: NM_002421 Coding sequence: 72..1481 (underlined sequences correspond to start and stop codons) I I I I I I

TA

IO CTCACAGCTT_ CTAGAAACACAAGAGCAAGATGTGGACTTAGTCCAGAAAT180 CCCAGCGACT

~S TTTCTGTTTTCTGGCCACAACTGCCAAATGGGCTTGAAGCTGCTTACGAATTTGCCGACA1080 O

Seq ID NO: 22 Protein seauence:
Protein Accession #: NP 002412 GIGHKVDAVF MKDGFFYFFH GTRQYKFDPK TKRILTLQKA NSWFNCRKN
Seq ID NO: 23 Nucleotide sectuence:
6O Nucleic Acid Accession #: FGENESH predicted ORF
Coding sequence: 141-1580 (underlined sequences correspond to start and stop codons) ACATTCTCGGGGGGCCC_TAGCTGAGCGCAGGCCCAGGCCCCACTTGCTTCCTGCGGGTGG1620 AAAAAAAAAAAAAAAA

Seq ID NO: 24 Protein seauence:
SS Protein Accession #: FGENESH predicted FRHLQTLKSH VRIHTGEKPY HCDPCGLHFR HKSQLRLHLR QKHGAATNTK VHYHILGGP
70 Seq ID NO: 25 Nucleotide seauence:
Nucleic Acid Accession #: U21551 Coding sequence: 1..1155 (underlined sequences correspond to start and stop codons) GGAAAAACCA

O

ATTGTGCTATTGA
CC

20 _ Seq ID N0: 26 Protein seouence:
Protein Accession #: AAB08528 SRILSKLTDI QYGREESDWT IVLS

Seq ID NO: 27 Nucleotide seouence:
Nucleic Acid Accession #: XM_039209 Coding sequence: 656..2758 (underlined sequences correspond to start and stop codons) O

C)STGTGAGTGGGCTGCGGCAGCCCGTTGGTGCCCTGCATAGTGGGGATGGCTCGCAACGTCT1380 TAAAGGGGAA
AGATTATGAA
AGTGAGCCAT

Seq ID NO: 28 Protein secTUence:
Protein Accession #: XP 039209 S

YLGPQCEQVDRNIRRVTRAGILDQIIDMTSYLLDLTSYIV

Seq ID 29 Nucleotide NO: seauence:

Nucleic Acid Accession #: NM

_ and stop Coding codons) sequence:
75..2924 (underlined sequences correspond to start SO

AAGACAACGT.CACTAGCAGTTTCTGGAGCTACTTGCCAAGGCTGAGTGTGAGCTGAGCCT60 CAAGA

SS GGCTGCTGGG_ CAGGCTTCCAGTACTAGCCTCTCTGATCTGCAGAGCTCCA180 GGCATGGGCC

CAGTCTGTACCACTGiGGCAGGGGAGTGGAAGCACAGCAACGGTCTTTGCCATGGCTGAGC2820 O

S

Seq ID 30 Proteinsequence:
NO:

Protein Accession #: NP

1 11 2l 31 41 51 O

C)OAGAASLNASLDGLHNALFATQRSLEQHQRLFHSLFGNFQGLMEANVSLDLGKLQTMLSRK780 GQGSGSTATVFAMAELQKGERVWFELTQGSITKRSLSGTAFGGFLMFKT

6S Seq ID NO: 31 Nucleotide seauence:
Nucleic Acid Accession #: AB037715 Coding sequence: 370..3489 (underlined sequences correspond to start and stop codons) TCGGAGACCA__TGGCAGTGCAGCTGGTGCCCGACTCAGCTCTCGGCCTGCTGATGATGACG420 O

CCGCTGTACATCGAGGGCGG'CGCCACGCCCGTGGTGGTGCGCAGCCTGGAGAGCGACCAG2940 O

GATGAA

S _ AGTGGTACGGGCAGGAAAAAGCCAAGCCCGGGACCCTCGTGTGAGCCAGC3600 S GCTGATGTCC

CCGGCCTAATCTGACCGCCTCAACGCCATT'CTGAGATCACCTCACTGCCTCTCATTTGCC3660 C)O' CTTGGTGGCTTCCCTCTGCCATGACAGCCCCTAGGCCAGGAACCATCAGGGGGGCCAGCC3900 'IOATCCATCTGGACACAAAGAGAGACCTGTGGGAGTCATAGAGGGTACTGTTAGCCCCGGTC4500 AGGGCCCATG

' AGTGTTGTCAACACTTATTAAAGCATTTTCAAAATG

Seq ID NO: 32 Protein seauence:
Protein Accession #: HAA92532 ENSPILDGSESPPHQSTDE

Seq ID N0: 33 Nucleotide seouence:
Nucleic Acid Accession #: NM_014331 Coding sequence: 1..1506 (underlined sequences correspond to start and stop codons) A_TGGTCAGAA AGCCTGTTGT GTCCACCATC TCCAAAGGAG GTTACCTGCA GGGAAATGTT 60 CTGTAGTGAT

TTA_TGAACTAATGGACTTGAGATCTTGGCAATCTGCCCAAGGGGAGACACAAAATAGGGA1560 O

Seq ID NO: 34 Protein sectuence:
Protein Accession #: NP_055146 SO

SEKITRTLQI ILEWPEEDK L
6S Seq ID NO: 35 Nucleotide seauence:
Nucleic Acid Accession #: NM_002422 Coding sequence: 64..1497 (underlined sequences correspond to start and stop codons) GAA_ATGAAGA GTCTTCCAAT CCTACTGTTG CTGTGCGTGG CAGTTTGCTC AGCCTATCCA 120 DEMANDE OU BREVET VOLUMINEUX
LA PRESENTE PARTIE DE CETTE DEMANDE OU CE BREVET COMPREND
PLUS D'UN TOME.

~~ TTENANT LES PAGES 1 A 196 NOTE : Pour les tomes additionels, veuillez contacter 1e Bureau canadien des brevets JUMBO APPLICATIONS/PATENTS
THIS SECTION OF THE APPLICATION/PATENT CONTAINS MORE THAN ONE
VOLUME

NOTE: For additional volumes, please contact the Canadian Patent Office NOM DU FICHIER / FILE NAME
NOTE POUR LE TOME / VOLUME NOTE:

Claims (27)

WHAT IS CLAIMED IS:

1. A method of detecting an angiogenesis-associated transcript in a cell in a patient, the method comprising contacting a biological sample from the patient with a polynucleotide that selectively hybridized to a sequence at least 80%
identical to a sequence as shown in Tables 1-8.

2. The method of claim 1, wherein the biological sample is a tissue sample.

3. The method of claim 1, wherein the biological sample comprises isolated nucleic acids.

4. The method of claim 3, wherein the nucleic acids are mRNA.

5. The method of claim 3, further comprising the step of amplifying nucleic acids before the step of contacting the biological sample with the polynucleotide.

6. The method of claim 1, wherein the polynucleotide comprises a sequence as shown in Tables 1-8 .

7. The method of claim 1, wherein the polynucleotide is labeled.

8. The method of claim 7, wherein the label is a fluorescent label.

9. The method of claim 1, wherein the polynucleotide is immobilized on a solid surface.

10. The method of claim 1, wherein the patient is undergoing a therapeutic regimen to treat a disease associated with angiongenesis.

11. The method of claim 1, wherein the patient is suspected of having cancer.

12. An isolated nucleic acid molecule consisting of a polynucleotide sequence as shown in Tables 1-8.

13. The nucleic acid molecule of claim 12, which is labeled.

14. The nucleic acid of claim 13, wherein the label is a fluorescent label

15. An expression vector comprising the nucleic acid of claim 12.

16. A host cell comprising the expression vector of claim 15.

17. An isolated polypeptide which is encoded by a nucleic acid molecule having polynucleotide sequence as shown in Tables 1-8

18. An antibody that specifically binds a polypeptide of claim 17.

19. The antibody of claim 18, further conjugated or fused to an effector component.

20. The antibody of claim 19, wherein the effector component is a fluorescent label.

21. The antibody of claim 19, wherein the effector component is a radioisotope.

22. The antibody of claim 19, which is an antibody fragment.

23. The antibody of claim 19, which is a humanized antibody

24. A method of detecting a cell undergoing angiogenesis in a biological sample from a patient, the method comprising contacting the biological sample with an antibody of claim 18.

25. The method of claim 24, wherein the antibody is further conjugated or fused to an effector component.

26. The method of claim 25, wherein the effector component is a fluorescent label.

27. The method of detecting antibodies specific to angiogenesis in a patient, the method comprising contacting a biological sample from the patient with a polypeptide which is encoded by a nucleotide sequence of Tables 1-8.