ZA200501688B - Chitinase encoding DNA molecule from cotton expressed preferentially in fibers during secondary cell wall deposition and the corresponding promoter - Google Patents
Chitinase encoding DNA molecule from cotton expressed preferentially in fibers during secondary cell wall deposition and the corresponding promoter Download PDFInfo
- Publication number
- ZA200501688B ZA200501688B ZA200501688A ZA200501688A ZA200501688B ZA 200501688 B ZA200501688 B ZA 200501688B ZA 200501688 A ZA200501688 A ZA 200501688A ZA 200501688 A ZA200501688 A ZA 200501688A ZA 200501688 B ZA200501688 B ZA 200501688B
- Authority
- ZA
- South Africa
- Prior art keywords
- plant
- cotton
- dna
- nucleic acid
- acid molecule
- Prior art date
Links
- 108010022172 Chitinases Proteins 0.000 title claims description 189
- 102000012286 Chitinases Human genes 0.000 title claims description 184
- 229920000742 Cotton Polymers 0.000 title claims description 175
- 239000000835 fiber Substances 0.000 title claims description 137
- 108020004414 DNA Proteins 0.000 title claims description 127
- 230000008021 deposition Effects 0.000 title claims description 78
- 102000053602 DNA Human genes 0.000 title claims description 9
- 210000002421 cell wall Anatomy 0.000 title description 37
- 241000196324 Embryophyta Species 0.000 claims description 222
- 108090000623 proteins and genes Proteins 0.000 claims description 177
- 241000219146 Gossypium Species 0.000 claims description 79
- 102000004169 proteins and genes Human genes 0.000 claims description 78
- 102000039446 nucleic acids Human genes 0.000 claims description 41
- 108020004707 nucleic acids Proteins 0.000 claims description 41
- 150000007523 nucleic acids Chemical class 0.000 claims description 41
- 230000001105 regulatory effect Effects 0.000 claims description 34
- 238000013518 transcription Methods 0.000 claims description 18
- 230000035897 transcription Effects 0.000 claims description 18
- 240000008042 Zea mays Species 0.000 claims description 15
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 14
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 13
- 235000002017 Zea mays subsp mays Nutrition 0.000 claims description 12
- 239000002773 nucleotide Substances 0.000 claims description 11
- 125000003729 nucleotide group Chemical group 0.000 claims description 11
- 229920001184 polypeptide Polymers 0.000 claims description 11
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 11
- 240000007594 Oryza sativa Species 0.000 claims description 10
- 235000007164 Oryza sativa Nutrition 0.000 claims description 10
- 235000009566 rice Nutrition 0.000 claims description 10
- 244000299507 Gossypium hirsutum Species 0.000 claims description 9
- 240000000111 Saccharum officinarum Species 0.000 claims description 9
- 235000007201 Saccharum officinarum Nutrition 0.000 claims description 9
- 235000005824 Zea mays ssp. parviglumis Nutrition 0.000 claims description 9
- 235000005822 corn Nutrition 0.000 claims description 9
- 240000004246 Agave americana Species 0.000 claims description 8
- 235000017166 Bambusa arundinacea Nutrition 0.000 claims description 8
- 235000017491 Bambusa tulda Nutrition 0.000 claims description 8
- 240000008564 Boehmeria nivea Species 0.000 claims description 8
- 244000025254 Cannabis sativa Species 0.000 claims description 8
- 235000012766 Cannabis sativa ssp. sativa var. sativa Nutrition 0.000 claims description 8
- 235000012765 Cannabis sativa ssp. sativa var. spontanea Nutrition 0.000 claims description 8
- 244000146553 Ceiba pentandra Species 0.000 claims description 8
- 235000003301 Ceiba pentandra Nutrition 0.000 claims description 8
- 240000000491 Corchorus aestuans Species 0.000 claims description 8
- 235000011777 Corchorus aestuans Nutrition 0.000 claims description 8
- 235000010862 Corchorus capsularis Nutrition 0.000 claims description 8
- 240000000797 Hibiscus cannabinus Species 0.000 claims description 8
- 235000004431 Linum usitatissimum Nutrition 0.000 claims description 8
- 240000006240 Linum usitatissimum Species 0.000 claims description 8
- 240000000907 Musa textilis Species 0.000 claims description 8
- 244000082204 Phyllostachys viridis Species 0.000 claims description 8
- 235000015334 Phyllostachys viridis Nutrition 0.000 claims description 8
- 241000244317 Tillandsia usneoides Species 0.000 claims description 8
- 239000011425 bamboo Substances 0.000 claims description 8
- 235000009120 camo Nutrition 0.000 claims description 8
- 235000005607 chanvre indien Nutrition 0.000 claims description 8
- 239000011487 hemp Substances 0.000 claims description 8
- 238000009396 hybridization Methods 0.000 claims description 6
- 230000014509 gene expression Effects 0.000 description 90
- 210000004027 cell Anatomy 0.000 description 80
- 235000018102 proteins Nutrition 0.000 description 74
- 229920002678 cellulose Polymers 0.000 description 60
- 239000001913 cellulose Substances 0.000 description 60
- 230000015572 biosynthetic process Effects 0.000 description 51
- 235000001014 amino acid Nutrition 0.000 description 49
- 229940024606 amino acid Drugs 0.000 description 47
- 241000219194 Arabidopsis Species 0.000 description 46
- 238000011161 development Methods 0.000 description 46
- 150000001413 amino acids Chemical class 0.000 description 45
- 230000018109 developmental process Effects 0.000 description 44
- 230000000694 effects Effects 0.000 description 44
- 229920002101 Chitin Polymers 0.000 description 40
- 210000001519 tissue Anatomy 0.000 description 37
- 238000003786 synthesis reaction Methods 0.000 description 34
- 238000000034 method Methods 0.000 description 32
- 102000004190 Enzymes Human genes 0.000 description 23
- 108090000790 Enzymes Proteins 0.000 description 23
- 244000061176 Nicotiana tabacum Species 0.000 description 23
- 235000002637 Nicotiana tabacum Nutrition 0.000 description 23
- 229940088598 enzyme Drugs 0.000 description 23
- 230000009466 transformation Effects 0.000 description 23
- 230000006870 function Effects 0.000 description 22
- YGSDEFSMJLZEOE-UHFFFAOYSA-N salicylic acid Chemical compound OC(=O)C1=CC=CC=C1O YGSDEFSMJLZEOE-UHFFFAOYSA-N 0.000 description 22
- 239000013598 vector Substances 0.000 description 21
- 230000006872 improvement Effects 0.000 description 20
- 239000004753 textile Substances 0.000 description 20
- 230000009261 transgenic effect Effects 0.000 description 20
- 230000003197 catalytic effect Effects 0.000 description 17
- 238000012545 processing Methods 0.000 description 17
- OVRNDRQMDRJTHS-FMDGEEDCSA-N N-acetyl-beta-D-glucosamine Chemical group CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-FMDGEEDCSA-N 0.000 description 16
- OVRNDRQMDRJTHS-UHFFFAOYSA-N N-acelyl-D-glucosamine Natural products CC(=O)NC1C(O)OC(CO)C(O)C1O OVRNDRQMDRJTHS-UHFFFAOYSA-N 0.000 description 15
- 230000003993 interaction Effects 0.000 description 15
- 230000037039 plant physiology Effects 0.000 description 15
- 238000006467 substitution reaction Methods 0.000 description 15
- 241000490494 Arabis Species 0.000 description 14
- MBLBDJOUHNCFQT-LXGUWJNJSA-N N-acetylglucosamine Natural products CC(=O)N[C@@H](C=O)[C@@H](O)[C@H](O)[C@H](O)CO MBLBDJOUHNCFQT-LXGUWJNJSA-N 0.000 description 14
- 229950006780 n-acetylglucosamine Drugs 0.000 description 14
- 230000027455 binding Effects 0.000 description 13
- 239000000758 substrate Substances 0.000 description 13
- 241000233866 Fungi Species 0.000 description 12
- 230000008166 cellulose biosynthesis Effects 0.000 description 12
- 230000000977 initiatory effect Effects 0.000 description 12
- 244000000003 plant pathogen Species 0.000 description 12
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 11
- 230000008859 change Effects 0.000 description 11
- 238000012512 characterization method Methods 0.000 description 11
- 239000012634 fragment Substances 0.000 description 11
- 230000002538 fungal effect Effects 0.000 description 11
- 230000012010 growth Effects 0.000 description 11
- FJKROLUGYXJWQN-UHFFFAOYSA-N papa-hydroxy-benzoic acid Natural products OC(=O)C1=CC=C(O)C=C1 FJKROLUGYXJWQN-UHFFFAOYSA-N 0.000 description 11
- 229960004889 salicylic acid Drugs 0.000 description 11
- 108010054251 arabinogalactan proteins Proteins 0.000 description 10
- 230000001580 bacterial effect Effects 0.000 description 10
- 108010040093 cellulose synthase Proteins 0.000 description 10
- 230000007123 defense Effects 0.000 description 10
- 230000001965 increasing effect Effects 0.000 description 10
- 108020004999 messenger RNA Proteins 0.000 description 10
- 210000001938 protoplast Anatomy 0.000 description 10
- 239000000523 sample Substances 0.000 description 10
- 238000012163 sequencing technique Methods 0.000 description 10
- 241000894007 species Species 0.000 description 10
- 230000007704 transition Effects 0.000 description 10
- 102000009572 RNA Polymerase II Human genes 0.000 description 9
- 108010009460 RNA Polymerase II Proteins 0.000 description 9
- 239000002299 complementary DNA Substances 0.000 description 9
- 238000011534 incubation Methods 0.000 description 9
- 230000035772 mutation Effects 0.000 description 9
- 230000035479 physiological effects, processes and functions Effects 0.000 description 9
- 239000013612 plasmid Substances 0.000 description 9
- 230000001131 transforming effect Effects 0.000 description 9
- UDPGUMQDCGORJQ-UHFFFAOYSA-N (2-chloroethyl)phosphonic acid Chemical compound OP(O)(=O)CCCl UDPGUMQDCGORJQ-UHFFFAOYSA-N 0.000 description 8
- 239000005976 Ethephon Substances 0.000 description 8
- 241000238631 Hexapoda Species 0.000 description 8
- 235000007688 Lycopersicon esculentum Nutrition 0.000 description 8
- 238000000636 Northern blotting Methods 0.000 description 8
- 240000003768 Solanum lycopersicum Species 0.000 description 8
- 108010050949 chitinase C Proteins 0.000 description 8
- 230000000875 corresponding effect Effects 0.000 description 8
- 230000009025 developmental regulation Effects 0.000 description 8
- 230000004048 modification Effects 0.000 description 8
- 238000012986 modification Methods 0.000 description 8
- 229920001542 oligosaccharide Polymers 0.000 description 8
- 239000002245 particle Substances 0.000 description 8
- 101710134123 Chitin-binding lectin Proteins 0.000 description 7
- 241000218922 Magnoliophyta Species 0.000 description 7
- 108700006291 Sucrose-phosphate synthases Proteins 0.000 description 7
- 230000033228 biological regulation Effects 0.000 description 7
- 230000000052 comparative effect Effects 0.000 description 7
- 238000010353 genetic engineering Methods 0.000 description 7
- 150000002632 lipids Chemical class 0.000 description 7
- 238000002703 mutagenesis Methods 0.000 description 7
- 231100000350 mutagenesis Toxicity 0.000 description 7
- 229920000642 polymer Polymers 0.000 description 7
- 230000004044 response Effects 0.000 description 7
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 7
- 241000219195 Arabidopsis thaliana Species 0.000 description 6
- 241000894006 Bacteria Species 0.000 description 6
- 235000002767 Daucus carota Nutrition 0.000 description 6
- 244000000626 Daucus carota Species 0.000 description 6
- 230000004988 N-glycosylation Effects 0.000 description 6
- 244000061456 Solanum tuberosum Species 0.000 description 6
- 108010043934 Sucrose synthase Proteins 0.000 description 6
- 230000019552 anatomical structure morphogenesis Effects 0.000 description 6
- 238000010367 cloning Methods 0.000 description 6
- 230000002950 deficient Effects 0.000 description 6
- 230000004927 fusion Effects 0.000 description 6
- 230000006698 induction Effects 0.000 description 6
- 230000001939 inductive effect Effects 0.000 description 6
- 238000011068 loading method Methods 0.000 description 6
- 210000001161 mammalian embryo Anatomy 0.000 description 6
- 238000004519 manufacturing process Methods 0.000 description 6
- 239000000203 mixture Substances 0.000 description 6
- 150000002482 oligosaccharides Chemical class 0.000 description 6
- 244000052769 pathogen Species 0.000 description 6
- 230000002829 reductive effect Effects 0.000 description 6
- 230000030118 somatic embryogenesis Effects 0.000 description 6
- 230000010474 transient expression Effects 0.000 description 6
- 244000198134 Agave sisalana Species 0.000 description 5
- 108091035707 Consensus sequence Proteins 0.000 description 5
- 240000002024 Gossypium herbaceum Species 0.000 description 5
- 235000009432 Gossypium hirsutum Nutrition 0.000 description 5
- 102000004157 Hydrolases Human genes 0.000 description 5
- 108090000604 Hydrolases Proteins 0.000 description 5
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 5
- 244000046052 Phaseolus vulgaris Species 0.000 description 5
- 235000002595 Solanum tuberosum Nutrition 0.000 description 5
- 108700026226 TATA Box Proteins 0.000 description 5
- 230000015556 catabolic process Effects 0.000 description 5
- 230000003436 cytoskeletal effect Effects 0.000 description 5
- 238000006731 degradation reaction Methods 0.000 description 5
- 238000004520 electroporation Methods 0.000 description 5
- 210000002257 embryonic structure Anatomy 0.000 description 5
- 150000002306 glutamic acid derivatives Chemical class 0.000 description 5
- 230000001717 pathogenic effect Effects 0.000 description 5
- 108010010718 poly(3-hydroxyalkanoic acid) synthase Proteins 0.000 description 5
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 5
- 238000000751 protein extraction Methods 0.000 description 5
- 238000004537 pulping Methods 0.000 description 5
- 230000008929 regeneration Effects 0.000 description 5
- 238000011069 regeneration method Methods 0.000 description 5
- 108091008146 restriction endonucleases Proteins 0.000 description 5
- 230000002441 reversible effect Effects 0.000 description 5
- 238000011282 treatment Methods 0.000 description 5
- LMDZBCPBFSXMTL-UHFFFAOYSA-N 1-ethyl-3-(3-dimethylaminopropyl)carbodiimide Chemical compound CCN=C=NCCCN(C)C LMDZBCPBFSXMTL-UHFFFAOYSA-N 0.000 description 4
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 4
- 229920001503 Glucan Polymers 0.000 description 4
- 108090000288 Glycoproteins Proteins 0.000 description 4
- 102000003886 Glycoproteins Human genes 0.000 description 4
- 229920002488 Hemicellulose Polymers 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 206010028980 Neoplasm Diseases 0.000 description 4
- 108091028043 Nucleic acid sequence Proteins 0.000 description 4
- 102000005877 Peptide Initiation Factors Human genes 0.000 description 4
- 108010044843 Peptide Initiation Factors Proteins 0.000 description 4
- 235000010627 Phaseolus vulgaris Nutrition 0.000 description 4
- 239000002202 Polyethylene glycol Substances 0.000 description 4
- 101710156592 Putative TATA-binding protein pB263R Proteins 0.000 description 4
- 108700008625 Reporter Genes Proteins 0.000 description 4
- 241000589180 Rhizobium Species 0.000 description 4
- 229930006000 Sucrose Natural products 0.000 description 4
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 4
- 102100040296 TATA-box-binding protein Human genes 0.000 description 4
- 101710145783 TATA-box-binding protein Proteins 0.000 description 4
- 102000040945 Transcription factor Human genes 0.000 description 4
- 108091023040 Transcription factor Proteins 0.000 description 4
- HSCJRCZFDFQWRP-JZMIEXBBSA-N UDP-alpha-D-glucose Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@@H]1OP(O)(=O)OP(O)(=O)OC[C@@H]1[C@@H](O)[C@@H](O)[C@H](N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-JZMIEXBBSA-N 0.000 description 4
- HSCJRCZFDFQWRP-UHFFFAOYSA-N Uridindiphosphoglukose Natural products OC1C(O)C(O)C(CO)OC1OP(O)(=O)OP(O)(=O)OCC1C(O)C(O)C(N2C(NC(=O)C=C2)=O)O1 HSCJRCZFDFQWRP-UHFFFAOYSA-N 0.000 description 4
- 230000009471 action Effects 0.000 description 4
- 238000004458 analytical method Methods 0.000 description 4
- 230000008436 biogenesis Effects 0.000 description 4
- 210000000170 cell membrane Anatomy 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 210000000349 chromosome Anatomy 0.000 description 4
- 238000001514 detection method Methods 0.000 description 4
- 230000013020 embryo development Effects 0.000 description 4
- 210000001339 epidermal cell Anatomy 0.000 description 4
- 239000000284 extract Substances 0.000 description 4
- 238000003306 harvesting Methods 0.000 description 4
- 229920000140 heteropolymer Polymers 0.000 description 4
- 230000007062 hydrolysis Effects 0.000 description 4
- 238000006460 hydrolysis reaction Methods 0.000 description 4
- 230000002779 inactivation Effects 0.000 description 4
- 230000009545 invasion Effects 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 230000001404 mediated effect Effects 0.000 description 4
- 230000004060 metabolic process Effects 0.000 description 4
- 210000001724 microfibril Anatomy 0.000 description 4
- 239000013642 negative control Substances 0.000 description 4
- 210000000056 organ Anatomy 0.000 description 4
- 230000037361 pathway Effects 0.000 description 4
- 229920001223 polyethylene glycol Polymers 0.000 description 4
- 239000005720 sucrose Substances 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 230000002103 transcriptional effect Effects 0.000 description 4
- 238000012546 transfer Methods 0.000 description 4
- 229960004441 tyrosine Drugs 0.000 description 4
- 238000011144 upstream manufacturing Methods 0.000 description 4
- 108020004463 18S ribosomal RNA Proteins 0.000 description 3
- 241000589155 Agrobacterium tumefaciens Species 0.000 description 3
- 102100037084 C4b-binding protein alpha chain Human genes 0.000 description 3
- 108091026890 Coding region Proteins 0.000 description 3
- 102100024342 Contactin-2 Human genes 0.000 description 3
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 3
- 235000009438 Gossypium Nutrition 0.000 description 3
- 235000004341 Gossypium herbaceum Nutrition 0.000 description 3
- 206010020649 Hyperkeratosis Diseases 0.000 description 3
- 101710144007 Mannose-1-phosphate guanyltransferase Proteins 0.000 description 3
- 240000004713 Pisum sativum Species 0.000 description 3
- 235000010582 Pisum sativum Nutrition 0.000 description 3
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 3
- 101710136733 Proline-rich protein Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 101000690440 Solanum lycopersicum Floral homeotic protein AGAMOUS Proteins 0.000 description 3
- 238000002105 Southern blotting Methods 0.000 description 3
- 102000048175 UTP-glucose-1-phosphate uridylyltransferases Human genes 0.000 description 3
- 241000700605 Viruses Species 0.000 description 3
- 235000007244 Zea mays Nutrition 0.000 description 3
- 235000016383 Zea mays subsp huehuetenangensis Nutrition 0.000 description 3
- 108091000039 acetoacetyl-CoA reductase Proteins 0.000 description 3
- 230000002378 acidificating effect Effects 0.000 description 3
- 230000004913 activation Effects 0.000 description 3
- 238000013459 approach Methods 0.000 description 3
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 3
- 229910052799 carbon Inorganic materials 0.000 description 3
- 238000004113 cell culture Methods 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 102000034356 gene-regulatory proteins Human genes 0.000 description 3
- 108091006104 gene-regulatory proteins Proteins 0.000 description 3
- 235000013922 glutamic acid Nutrition 0.000 description 3
- 239000004220 glutamic acid Substances 0.000 description 3
- 239000001963 growth medium Substances 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 229920005610 lignin Polymers 0.000 description 3
- 235000009973 maize Nutrition 0.000 description 3
- 239000003550 marker Substances 0.000 description 3
- 230000007246 mechanism Effects 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 229920001282 polysaccharide Polymers 0.000 description 3
- 239000005017 polysaccharide Substances 0.000 description 3
- 150000004804 polysaccharides Chemical class 0.000 description 3
- 230000008521 reorganization Effects 0.000 description 3
- QEVHRUUCFGRFIF-MDEJGZGSSA-N reserpine Chemical compound O([C@H]1[C@@H]([C@H]([C@H]2C[C@@H]3C4=C(C5=CC=C(OC)C=C5N4)CCN3C[C@H]2C1)C(=O)OC)OC)C(=O)C1=CC(OC)=C(OC)C(OC)=C1 QEVHRUUCFGRFIF-MDEJGZGSSA-N 0.000 description 3
- 230000000717 retained effect Effects 0.000 description 3
- 238000012216 screening Methods 0.000 description 3
- 230000019491 signal transduction Effects 0.000 description 3
- 230000000392 somatic effect Effects 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 3
- 239000002023 wood Substances 0.000 description 3
- CNGYZEMWVAWWOB-VAWYXSNFSA-N 5-[[4-anilino-6-[bis(2-hydroxyethyl)amino]-1,3,5-triazin-2-yl]amino]-2-[(e)-2-[4-[[4-anilino-6-[bis(2-hydroxyethyl)amino]-1,3,5-triazin-2-yl]amino]-2-sulfophenyl]ethenyl]benzenesulfonic acid Chemical compound N=1C(NC=2C=C(C(\C=C\C=3C(=CC(NC=4N=C(N=C(NC=5C=CC=CC=5)N=4)N(CCO)CCO)=CC=3)S(O)(=O)=O)=CC=2)S(O)(=O)=O)=NC(N(CCO)CCO)=NC=1NC1=CC=CC=C1 CNGYZEMWVAWWOB-VAWYXSNFSA-N 0.000 description 2
- 102000007469 Actins Human genes 0.000 description 2
- 108010085238 Actins Proteins 0.000 description 2
- 241000589158 Agrobacterium Species 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 108700003860 Bacterial Genes Proteins 0.000 description 2
- 241001610429 Boechera microphylla Species 0.000 description 2
- 235000011299 Brassica oleracea var botrytis Nutrition 0.000 description 2
- 240000003259 Brassica oleracea var. botrytis Species 0.000 description 2
- 229920000018 Callose Polymers 0.000 description 2
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 2
- 241000701489 Cauliflower mosaic virus Species 0.000 description 2
- 241000819038 Chichester Species 0.000 description 2
- 235000009854 Cucurbita moschata Nutrition 0.000 description 2
- 240000001980 Cucurbita pepo Species 0.000 description 2
- 102000012410 DNA Ligases Human genes 0.000 description 2
- 108010061982 DNA Ligases Proteins 0.000 description 2
- 241000588724 Escherichia coli Species 0.000 description 2
- VGGSQFUCUMXWEO-UHFFFAOYSA-N Ethene Chemical compound C=C VGGSQFUCUMXWEO-UHFFFAOYSA-N 0.000 description 2
- 239000005977 Ethylene Substances 0.000 description 2
- 206010017533 Fungal infection Diseases 0.000 description 2
- 102000030782 GTP binding Human genes 0.000 description 2
- 108091000058 GTP-Binding Proteins 0.000 description 2
- 235000010469 Glycine max Nutrition 0.000 description 2
- 244000068988 Glycine max Species 0.000 description 2
- 240000000047 Gossypium barbadense Species 0.000 description 2
- 240000005979 Hordeum vulgare Species 0.000 description 2
- 235000007340 Hordeum vulgare Nutrition 0.000 description 2
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 2
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 2
- 108090001060 Lipase Proteins 0.000 description 2
- 102000004882 Lipase Human genes 0.000 description 2
- 239000004367 Lipase Substances 0.000 description 2
- 108010014251 Muramidase Proteins 0.000 description 2
- 102000016943 Muramidase Human genes 0.000 description 2
- 208000031888 Mycoses Diseases 0.000 description 2
- 108010062010 N-Acetylmuramoyl-L-alanine Amidase Proteins 0.000 description 2
- ZRWPUFFVAOMMNM-UHFFFAOYSA-N Patulin Chemical compound OC1OCC=C2OC(=O)C=C12 ZRWPUFFVAOMMNM-UHFFFAOYSA-N 0.000 description 2
- 108700001094 Plant Genes Proteins 0.000 description 2
- 101710167959 Putative UTP-glucose-1-phosphate uridylyltransferase Proteins 0.000 description 2
- 241000589157 Rhizobiales Species 0.000 description 2
- 244000007853 Sarothamnus scoparius Species 0.000 description 2
- 235000002597 Solanum melongena Nutrition 0.000 description 2
- 244000061458 Solanum melongena Species 0.000 description 2
- 240000006394 Sorghum bicolor Species 0.000 description 2
- 235000011684 Sorghum saccharatum Nutrition 0.000 description 2
- 235000009337 Spinacia oleracea Nutrition 0.000 description 2
- 244000300264 Spinacia oleracea Species 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 229930183415 Suberin Natural products 0.000 description 2
- 101710156615 Sucrose synthase 1 Proteins 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- 102000006290 Transcription Factor TFIID Human genes 0.000 description 2
- 108010083268 Transcription Factor TFIID Proteins 0.000 description 2
- 108090000941 Transcription factor TFIIB Proteins 0.000 description 2
- 102000004408 Transcription factor TFIIB Human genes 0.000 description 2
- 108700019146 Transgenes Proteins 0.000 description 2
- 102000011731 Vacuolar Proton-Translocating ATPases Human genes 0.000 description 2
- 108010037026 Vacuolar Proton-Translocating ATPases Proteins 0.000 description 2
- 108010046516 Wheat Germ Agglutinins Proteins 0.000 description 2
- 230000006578 abscission Effects 0.000 description 2
- 230000000692 anti-sense effect Effects 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 230000009286 beneficial effect Effects 0.000 description 2
- 230000008901 benefit Effects 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 238000006555 catalytic reaction Methods 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 239000013078 crystal Substances 0.000 description 2
- 210000004292 cytoskeleton Anatomy 0.000 description 2
- 230000009274 differential gene expression Effects 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 238000009826 distribution Methods 0.000 description 2
- VHJLVAABSRFDPM-QWWZWVQMSA-N dithiothreitol Chemical compound SC[C@@H](O)[C@H](O)CS VHJLVAABSRFDPM-QWWZWVQMSA-N 0.000 description 2
- 235000013399 edible fruits Nutrition 0.000 description 2
- 230000002708 enhancing effect Effects 0.000 description 2
- 238000000605 extraction Methods 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 125000003147 glycosyl group Chemical group 0.000 description 2
- 229920001519 homopolymer Polymers 0.000 description 2
- 229920002674 hyaluronan Polymers 0.000 description 2
- 229940099552 hyaluronan Drugs 0.000 description 2
- KIUKXJAPPMFGSW-MNSSHETKSA-N hyaluronan Chemical compound CC(=O)N[C@H]1[C@H](O)O[C@H](CO)[C@@H](O)C1O[C@H]1[C@H](O)[C@@H](O)[C@H](O[C@H]2[C@@H](C(O[C@H]3[C@@H]([C@@H](O)[C@H](O)[C@H](O3)C(O)=O)O)[C@H](O)[C@@H](CO)O2)NC(C)=O)[C@@H](C(O)=O)O1 KIUKXJAPPMFGSW-MNSSHETKSA-N 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 2
- 239000000411 inducer Substances 0.000 description 2
- 208000015181 infectious disease Diseases 0.000 description 2
- 230000005764 inhibitory process Effects 0.000 description 2
- 235000019421 lipase Nutrition 0.000 description 2
- 230000004807 localization Effects 0.000 description 2
- 229960000274 lysozyme Drugs 0.000 description 2
- 239000004325 lysozyme Substances 0.000 description 2
- 235000010335 lysozyme Nutrition 0.000 description 2
- 239000012528 membrane Substances 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 238000002887 multiple sequence alignment Methods 0.000 description 2
- 230000007498 myristoylation Effects 0.000 description 2
- 230000024121 nodulation Effects 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 230000007170 pathology Effects 0.000 description 2
- 229920001277 pectin Polymers 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- 230000008121 plant development Effects 0.000 description 2
- 230000008635 plant growth Effects 0.000 description 2
- 108010004568 plant pathogenesis-related proteins Proteins 0.000 description 2
- 229920003023 plastic Polymers 0.000 description 2
- 239000004033 plastic Substances 0.000 description 2
- 230000004983 pleiotropic effect Effects 0.000 description 2
- 229920002401 polyacrylamide Polymers 0.000 description 2
- 238000006116 polymerization reaction Methods 0.000 description 2
- 239000013641 positive control Substances 0.000 description 2
- 230000001323 posttranslational effect Effects 0.000 description 2
- 238000002203 pretreatment Methods 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000002035 prolonged effect Effects 0.000 description 2
- 238000000746 purification Methods 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000022869 regulation of cellulose biosynthetic process Effects 0.000 description 2
- 230000001850 reproductive effect Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 238000012552 review Methods 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000001568 sexual effect Effects 0.000 description 2
- 238000000638 solvent extraction Methods 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 230000004960 subcellular localization Effects 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 238000004114 suspension culture Methods 0.000 description 2
- 230000002194 synthesizing effect Effects 0.000 description 2
- 230000002123 temporal effect Effects 0.000 description 2
- 238000004809 thin layer chromatography Methods 0.000 description 2
- 230000014616 translation Effects 0.000 description 2
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 2
- 239000001993 wax Substances 0.000 description 2
- 239000011701 zinc Substances 0.000 description 2
- 108010070892 1,3-beta-glucan synthase Proteins 0.000 description 1
- MVMSCBBUIHUTGJ-UHFFFAOYSA-N 10108-97-1 Natural products C1=2NC(N)=NC(=O)C=2N=CN1C(C(C1O)O)OC1COP(O)(=O)OP(O)(=O)OC1OC(CO)C(O)C(O)C1O MVMSCBBUIHUTGJ-UHFFFAOYSA-N 0.000 description 1
- MSWZFWKMSRAUBD-IVMDWMLBSA-N 2-amino-2-deoxy-D-glucopyranose Chemical compound N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O MSWZFWKMSRAUBD-IVMDWMLBSA-N 0.000 description 1
- UHPMCKVQTMMPCG-UHFFFAOYSA-N 5,8-dihydroxy-2-methoxy-6-methyl-7-(2-oxopropyl)naphthalene-1,4-dione Chemical compound CC1=C(CC(C)=O)C(O)=C2C(=O)C(OC)=CC(=O)C2=C1O UHPMCKVQTMMPCG-UHFFFAOYSA-N 0.000 description 1
- OPIFSICVWOWJMJ-AEOCFKNESA-N 5-bromo-4-chloro-3-indolyl beta-D-galactoside Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1OC1=CNC2=CC=C(Br)C(Cl)=C12 OPIFSICVWOWJMJ-AEOCFKNESA-N 0.000 description 1
- 241000589156 Agrobacterium rhizogenes Species 0.000 description 1
- 244000291564 Allium cepa Species 0.000 description 1
- 235000002732 Allium cepa var. cepa Nutrition 0.000 description 1
- 240000002234 Allium sativum Species 0.000 description 1
- 244000099147 Ananas comosus Species 0.000 description 1
- 235000007119 Ananas comosus Nutrition 0.000 description 1
- 102000000412 Annexin Human genes 0.000 description 1
- 108050008874 Annexin Proteins 0.000 description 1
- 240000007087 Apium graveolens Species 0.000 description 1
- 235000015849 Apium graveolens Dulce Group Nutrition 0.000 description 1
- 235000010591 Appio Nutrition 0.000 description 1
- 101100112410 Arabidopsis thaliana LHCB1.3 gene Proteins 0.000 description 1
- 235000017060 Arachis glabrata Nutrition 0.000 description 1
- 244000105624 Arachis hypogaea Species 0.000 description 1
- 235000010777 Arachis hypogaea Nutrition 0.000 description 1
- 235000018262 Arachis monticola Nutrition 0.000 description 1
- 102100023927 Asparagine synthetase [glutamine-hydrolyzing] Human genes 0.000 description 1
- 229930192334 Auxin Natural products 0.000 description 1
- 235000000832 Ayote Nutrition 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 240000002791 Brassica napus Species 0.000 description 1
- 235000011293 Brassica napus Nutrition 0.000 description 1
- 240000007124 Brassica oleracea Species 0.000 description 1
- 235000003899 Brassica oleracea var acephala Nutrition 0.000 description 1
- 235000011301 Brassica oleracea var capitata Nutrition 0.000 description 1
- 235000017647 Brassica oleracea var italica Nutrition 0.000 description 1
- 235000001169 Brassica oleracea var oleracea Nutrition 0.000 description 1
- 235000000540 Brassica rapa subsp rapa Nutrition 0.000 description 1
- 235000002566 Capsicum Nutrition 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 101000767750 Carya illinoinensis Vicilin Car i 2.0101 Proteins 0.000 description 1
- 108010059892 Cellulase Proteins 0.000 description 1
- 240000006740 Cichorium endivia Species 0.000 description 1
- 235000007542 Cichorium intybus Nutrition 0.000 description 1
- 244000298479 Cichorium intybus Species 0.000 description 1
- 101000767759 Corylus avellana Vicilin Cor a 11.0101 Proteins 0.000 description 1
- 241000219112 Cucumis Species 0.000 description 1
- 235000015510 Cucumis melo subsp melo Nutrition 0.000 description 1
- 240000008067 Cucumis sativus Species 0.000 description 1
- 235000010799 Cucumis sativus var sativus Nutrition 0.000 description 1
- 235000009852 Cucurbita pepo Nutrition 0.000 description 1
- 235000009804 Cucurbita pepo subsp pepo Nutrition 0.000 description 1
- 241000219130 Cucurbita pepo subsp. pepo Species 0.000 description 1
- 235000003954 Cucurbita pepo var melopepo Nutrition 0.000 description 1
- 229920000832 Cutin Polymers 0.000 description 1
- NBSCHQHZLSJFNQ-GASJEMHNSA-N D-Glucose 6-phosphate Chemical compound OC1O[C@H](COP(O)(O)=O)[C@@H](O)[C@H](O)[C@H]1O NBSCHQHZLSJFNQ-GASJEMHNSA-N 0.000 description 1
- 101150074155 DHFR gene Proteins 0.000 description 1
- 230000004568 DNA-binding Effects 0.000 description 1
- 230000005901 DNA-dependent transcriptional open complex formation Effects 0.000 description 1
- 241000255581 Drosophila <fruit fly, genus> Species 0.000 description 1
- 101150105978 EP3 gene Proteins 0.000 description 1
- 101100437498 Escherichia coli (strain K12) uidA gene Proteins 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108050000194 Expansin Proteins 0.000 description 1
- 101710129170 Extensin Proteins 0.000 description 1
- 101710145505 Fiber protein Proteins 0.000 description 1
- 235000016623 Fragaria vesca Nutrition 0.000 description 1
- 240000009088 Fragaria x ananassa Species 0.000 description 1
- 235000011363 Fragaria x ananassa Nutrition 0.000 description 1
- 229930091371 Fructose Natural products 0.000 description 1
- 239000005715 Fructose Substances 0.000 description 1
- RFSUNEUAIZKAJO-ARQDHWQXSA-N Fructose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O RFSUNEUAIZKAJO-ARQDHWQXSA-N 0.000 description 1
- 241000223218 Fusarium Species 0.000 description 1
- MVMSCBBUIHUTGJ-GDJBGNAASA-N GDP-alpha-D-mannose Chemical compound C([C@H]1O[C@H]([C@@H]([C@@H]1O)O)N1C=2N=C(NC(=O)C=2N=C1)N)OP(O)(=O)OP(O)(=O)O[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@@H]1O MVMSCBBUIHUTGJ-GDJBGNAASA-N 0.000 description 1
- 102000013446 GTP Phosphohydrolases Human genes 0.000 description 1
- 108091006109 GTPases Proteins 0.000 description 1
- 102100033840 General transcription factor IIF subunit 1 Human genes 0.000 description 1
- 102100032863 General transcription factor IIH subunit 3 Human genes 0.000 description 1
- 229920002581 Glucomannan Polymers 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 108010060309 Glucuronidase Proteins 0.000 description 1
- 102000053187 Glucuronidase Human genes 0.000 description 1
- 229940121672 Glycosylation inhibitor Drugs 0.000 description 1
- 240000001814 Gossypium arboreum Species 0.000 description 1
- 244000020551 Helianthus annuus Species 0.000 description 1
- 235000003222 Helianthus annuus Nutrition 0.000 description 1
- 102000005548 Hexokinase Human genes 0.000 description 1
- 108700040460 Hexokinases Proteins 0.000 description 1
- 101100380329 Homo sapiens ASNS gene Proteins 0.000 description 1
- 101000666405 Homo sapiens General transcription factor IIH subunit 1 Proteins 0.000 description 1
- 101000655398 Homo sapiens General transcription factor IIH subunit 2 Proteins 0.000 description 1
- 101000655391 Homo sapiens General transcription factor IIH subunit 3 Proteins 0.000 description 1
- 101000655406 Homo sapiens General transcription factor IIH subunit 4 Proteins 0.000 description 1
- 101000655402 Homo sapiens General transcription factor IIH subunit 5 Proteins 0.000 description 1
- 235000002678 Ipomoea batatas Nutrition 0.000 description 1
- 244000017020 Ipomoea batatas Species 0.000 description 1
- 241001527806 Iti Species 0.000 description 1
- 101000622316 Juglans regia Vicilin Jug r 2.0101 Proteins 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 235000003228 Lactuca sativa Nutrition 0.000 description 1
- 240000008415 Lactuca sativa Species 0.000 description 1
- 241000446313 Lamella Species 0.000 description 1
- 240000006568 Lathyrus odoratus Species 0.000 description 1
- 108090001090 Lectins Proteins 0.000 description 1
- 102000004856 Lectins Human genes 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 241000209510 Liliopsida Species 0.000 description 1
- 102000001845 Lipid-Linked Proteins Human genes 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- 241000220225 Malus Species 0.000 description 1
- 235000011430 Malus pumila Nutrition 0.000 description 1
- 235000015103 Malus silvestris Nutrition 0.000 description 1
- 240000004658 Medicago sativa Species 0.000 description 1
- 235000017587 Medicago sativa ssp. sativa Nutrition 0.000 description 1
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 1
- OVRNDRQMDRJTHS-RTRLPJTCSA-N N-acetyl-D-glucosamine Chemical compound CC(=O)N[C@H]1C(O)O[C@H](CO)[C@@H](O)[C@@H]1O OVRNDRQMDRJTHS-RTRLPJTCSA-N 0.000 description 1
- 125000003686 N-acetyl-D-glucosaminyl group Chemical group C(C)(=O)N[C@H]1C(O[C@@H]([C@H]([C@@H]1O)O)CO)* 0.000 description 1
- MNLRQHMNZILYPY-MDMHTWEWSA-N N-acetyl-alpha-D-muramic acid Chemical compound OC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@H](O)[C@@H]1NC(C)=O MNLRQHMNZILYPY-MDMHTWEWSA-N 0.000 description 1
- 108700020796 Oncogene Proteins 0.000 description 1
- 108700026244 Open Reading Frames Proteins 0.000 description 1
- 101710149663 Osmotin Proteins 0.000 description 1
- 241000222291 Passalora fulva Species 0.000 description 1
- 239000006002 Pepper Substances 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 108010013639 Peptidoglycan Proteins 0.000 description 1
- 102000003992 Peroxidases Human genes 0.000 description 1
- 240000007377 Petunia x hybrida Species 0.000 description 1
- IHPVFYLOGNNZLA-UHFFFAOYSA-N Phytoalexin Natural products COC1=CC=CC=C1C1OC(C=C2C(OCO2)=C2OC)=C2C(=O)C1 IHPVFYLOGNNZLA-UHFFFAOYSA-N 0.000 description 1
- 240000000020 Picea glauca Species 0.000 description 1
- 235000008127 Picea glauca Nutrition 0.000 description 1
- 241000364051 Pima Species 0.000 description 1
- 101000767757 Pinus koraiensis Vicilin Pin k 2.0101 Proteins 0.000 description 1
- 235000016761 Piper aduncum Nutrition 0.000 description 1
- 240000003889 Piper guineense Species 0.000 description 1
- 235000017804 Piper guineense Nutrition 0.000 description 1
- 235000008184 Piper nigrum Nutrition 0.000 description 1
- 101000767758 Pistacia vera Vicilin Pis v 3.0101 Proteins 0.000 description 1
- 101710096706 Poly(3-hydroxyalkanoate) polymerase Proteins 0.000 description 1
- 101710159749 Poly(3-hydroxyalkanoate) polymerase subunit PhaC Proteins 0.000 description 1
- 101710159752 Poly(3-hydroxyalkanoate) polymerase subunit PhaE Proteins 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 102000001253 Protein Kinase Human genes 0.000 description 1
- 108010076504 Protein Sorting Signals Proteins 0.000 description 1
- 102000009609 Pyrophosphatases Human genes 0.000 description 1
- 108010009413 Pyrophosphatases Proteins 0.000 description 1
- 235000014443 Pyrus communis Nutrition 0.000 description 1
- 240000001987 Pyrus communis Species 0.000 description 1
- 108091030071 RNAI Proteins 0.000 description 1
- 238000011529 RT qPCR Methods 0.000 description 1
- 244000088415 Raphanus sativus Species 0.000 description 1
- 235000006140 Raphanus sativus var sativus Nutrition 0.000 description 1
- 108091081062 Repeated sequence (DNA) Proteins 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 240000007651 Rubus glaucus Species 0.000 description 1
- 235000011034 Rubus glaucus Nutrition 0.000 description 1
- 235000009122 Rubus idaeus Nutrition 0.000 description 1
- 241000209056 Secale Species 0.000 description 1
- 235000007238 Secale cereale Nutrition 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 101710172711 Structural protein Proteins 0.000 description 1
- 108010022394 Threonine synthase Proteins 0.000 description 1
- 241000723873 Tobacco mosaic virus Species 0.000 description 1
- 108010083262 Transcription Factor TFIIA Proteins 0.000 description 1
- 102000006289 Transcription Factor TFIIA Human genes 0.000 description 1
- 108700009124 Transcription Initiation Site Proteins 0.000 description 1
- 235000021307 Triticum Nutrition 0.000 description 1
- 244000098338 Triticum aestivum Species 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- YJQCOFNZVFGCAF-UHFFFAOYSA-N Tunicamycin II Natural products O1C(CC(O)C2C(C(O)C(O2)N2C(NC(=O)C=C2)=O)O)C(O)C(O)C(NC(=O)C=CCCCCCCCCC(C)C)C1OC1OC(CO)C(O)C(O)C1NC(C)=O YJQCOFNZVFGCAF-UHFFFAOYSA-N 0.000 description 1
- 108700023183 UTP-glucose-1-phosphate uridylyltransferases Proteins 0.000 description 1
- 241001106462 Ulmus Species 0.000 description 1
- 241001123668 Verticillium dahliae Species 0.000 description 1
- 235000009754 Vitis X bourquina Nutrition 0.000 description 1
- 235000012333 Vitis X labruscana Nutrition 0.000 description 1
- 240000006365 Vitis vinifera Species 0.000 description 1
- 235000014787 Vitis vinifera Nutrition 0.000 description 1
- 229920002522 Wood fibre Polymers 0.000 description 1
- 229920002000 Xyloglucan Polymers 0.000 description 1
- HCHKCACWOHOZIP-UHFFFAOYSA-N Zinc Chemical compound [Zn] HCHKCACWOHOZIP-UHFFFAOYSA-N 0.000 description 1
- FJJCIZWZNKZHII-UHFFFAOYSA-N [4,6-bis(cyanoamino)-1,3,5-triazin-2-yl]cyanamide Chemical compound N#CNC1=NC(NC#N)=NC(NC#N)=N1 FJJCIZWZNKZHII-UHFFFAOYSA-N 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 230000010933 acylation Effects 0.000 description 1
- 238000005917 acylation reaction Methods 0.000 description 1
- 230000006978 adaptation Effects 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N adenyl group Chemical group N1=CN=C2N=CNC2=C1N GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- HXXFSFRBOHSIMQ-RWOPYEJCSA-L alpha-D-mannose 1-phosphate(2-) Chemical compound OC[C@H]1O[C@H](OP([O-])([O-])=O)[C@@H](O)[C@@H](O)[C@@H]1O HXXFSFRBOHSIMQ-RWOPYEJCSA-L 0.000 description 1
- 230000004075 alteration Effects 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 230000000843 anti-fungal effect Effects 0.000 description 1
- 239000002363 auxin Substances 0.000 description 1
- MSWZFWKMSRAUBD-UHFFFAOYSA-N beta-D-galactosamine Natural products NC1C(O)OC(CO)C(O)C1O MSWZFWKMSRAUBD-UHFFFAOYSA-N 0.000 description 1
- 108010051210 beta-Fructofuranosidase Proteins 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- 230000003115 biocidal effect Effects 0.000 description 1
- 238000006065 biodegradation reaction Methods 0.000 description 1
- 230000007321 biological mechanism Effects 0.000 description 1
- 229960000074 biopharmaceutical Drugs 0.000 description 1
- 229920001222 biopolymer Polymers 0.000 description 1
- 230000001851 biosynthetic effect Effects 0.000 description 1
- 238000009395 breeding Methods 0.000 description 1
- 230000001488 breeding effect Effects 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 239000003054 catalyst Substances 0.000 description 1
- 150000001768 cations Chemical class 0.000 description 1
- 230000011712 cell development Effects 0.000 description 1
- 230000032823 cell division Effects 0.000 description 1
- 230000010261 cell growth Effects 0.000 description 1
- 229940106157 cellulase Drugs 0.000 description 1
- 239000012707 chemical precursor Substances 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 235000003733 chicria Nutrition 0.000 description 1
- 230000001794 chitinolytic effect Effects 0.000 description 1
- 229930002868 chlorophyll a Natural products 0.000 description 1
- ATNHDLDRLWWWCB-AENOIHSZSA-M chlorophyll a Chemical compound C1([C@@H](C(=O)OC)C(=O)C2=C3C)=C2N2C3=CC(C(CC)=C3C)=[N+]4C3=CC3=C(C=C)C(C)=C5N3[Mg-2]42[N+]2=C1[C@@H](CCC(=O)OC\C=C(/C)CCC[C@H](C)CCC[C@H](C)CCCC(C)C)[C@H](C)C2=C5 ATNHDLDRLWWWCB-AENOIHSZSA-M 0.000 description 1
- 229930002869 chlorophyll b Natural products 0.000 description 1
- NSMUHPMZFPKNMZ-VBYMZDBQSA-M chlorophyll b Chemical compound C1([C@@H](C(=O)OC)C(=O)C2=C3C)=C2N2C3=CC(C(CC)=C3C=O)=[N+]4C3=CC3=C(C=C)C(C)=C5N3[Mg-2]42[N+]2=C1[C@@H](CCC(=O)OC\C=C(/C)CCC[C@H](C)CCC[C@H](C)CCCC(C)C)[C@H](C)C2=C5 NSMUHPMZFPKNMZ-VBYMZDBQSA-M 0.000 description 1
- 239000013611 chromosomal DNA Substances 0.000 description 1
- 239000011248 coating agent Substances 0.000 description 1
- 238000000576 coating method Methods 0.000 description 1
- 238000010835 comparative analysis Methods 0.000 description 1
- 230000002153 concerted effect Effects 0.000 description 1
- 230000021615 conjugation Effects 0.000 description 1
- 230000008094 contradictory effect Effects 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 230000001054 cortical effect Effects 0.000 description 1
- 238000012272 crop production Methods 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- 210000004748 cultured cell Anatomy 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- UQHKFADEQIVWID-UHFFFAOYSA-N cytokinin Natural products C1=NC=2C(NCC=C(CO)C)=NC=NC=2N1C1CC(O)C(CO)O1 UQHKFADEQIVWID-UHFFFAOYSA-N 0.000 description 1
- 239000004062 cytokinin Substances 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000003247 decreasing effect Effects 0.000 description 1
- 230000004665 defense response Effects 0.000 description 1
- 230000003413 degradative effect Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000000539 dimer Substances 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 238000006073 displacement reaction Methods 0.000 description 1
- 235000005489 dwarf bean Nutrition 0.000 description 1
- 239000000975 dye Substances 0.000 description 1
- 230000005684 electric field Effects 0.000 description 1
- 238000001962 electrophoresis Methods 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000007613 environmental effect Effects 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 238000001952 enzyme assay Methods 0.000 description 1
- 210000002615 epidermis Anatomy 0.000 description 1
- 241001233957 eudicotyledons Species 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 239000004744 fabric Substances 0.000 description 1
- 125000001924 fatty-acyl group Chemical group 0.000 description 1
- 244000037666 field crops Species 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 108010060641 flavanone synthetase Proteins 0.000 description 1
- 230000004883 flower formation Effects 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 239000004459 forage Substances 0.000 description 1
- 235000004611 garlic Nutrition 0.000 description 1
- 230000035784 germination Effects 0.000 description 1
- 229960002442 glucosamine Drugs 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- 125000000291 glutamic acid group Chemical group N[C@@H](CCC(O)=O)C(=O)* 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- PCHJSUWPFVWCPO-UHFFFAOYSA-N gold Chemical compound [Au] PCHJSUWPFVWCPO-UHFFFAOYSA-N 0.000 description 1
- 101150054900 gus gene Proteins 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 230000003301 hydrolyzing effect Effects 0.000 description 1
- 238000007901 in situ hybridization Methods 0.000 description 1
- 238000000338 in vitro Methods 0.000 description 1
- 238000010249 in-situ analysis Methods 0.000 description 1
- 238000010348 incorporation Methods 0.000 description 1
- SEOVTRFCIGRIMH-UHFFFAOYSA-N indole-3-acetic acid Chemical compound C1=CC=C2C(CC(=O)O)=CNC2=C1 SEOVTRFCIGRIMH-UHFFFAOYSA-N 0.000 description 1
- 229910052500 inorganic mineral Inorganic materials 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 235000011073 invertase Nutrition 0.000 description 1
- 238000011835 investigation Methods 0.000 description 1
- 238000002955 isolation Methods 0.000 description 1
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- GSXOAOHZAIYLCY-HSUXUTPPSA-N keto-D-fructose 6-phosphate Chemical compound OCC(=O)[C@@H](O)[C@H](O)[C@H](O)COP(O)(O)=O GSXOAOHZAIYLCY-HSUXUTPPSA-N 0.000 description 1
- 230000002147 killing effect Effects 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 239000002523 lectin Substances 0.000 description 1
- 108010053156 lipid transfer protein Proteins 0.000 description 1
- 108091005630 lipid-anchored proteins Proteins 0.000 description 1
- 150000002634 lipophilic molecules Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 230000033001 locomotion Effects 0.000 description 1
- 210000003712 lysosome Anatomy 0.000 description 1
- 230000001868 lysosomic effect Effects 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000011159 matrix material Substances 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 230000023409 microsporogenesis Effects 0.000 description 1
- 239000011707 mineral Substances 0.000 description 1
- 238000007479 molecular analysis Methods 0.000 description 1
- 238000001823 molecular biology technique Methods 0.000 description 1
- 238000012544 monitoring process Methods 0.000 description 1
- 230000000877 morphologic effect Effects 0.000 description 1
- 229940105132 myristate Drugs 0.000 description 1
- 229920005615 natural polymer Polymers 0.000 description 1
- 108091027963 non-coding RNA Proteins 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 108010058731 nopaline synthase Proteins 0.000 description 1
- 235000015097 nutrients Nutrition 0.000 description 1
- 230000035764 nutrition Effects 0.000 description 1
- 235000016709 nutrition Nutrition 0.000 description 1
- 239000002674 ointment Substances 0.000 description 1
- 230000025342 organ morphogenesis Effects 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 230000002018 overexpression Effects 0.000 description 1
- 238000012261 overproduction Methods 0.000 description 1
- 235000020232 peanut Nutrition 0.000 description 1
- 239000001814 pectin Substances 0.000 description 1
- 235000010987 pectin Nutrition 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- 230000008447 perception Effects 0.000 description 1
- 230000035699 permeability Effects 0.000 description 1
- 108040007629 peroxidase activity proteins Proteins 0.000 description 1
- 239000000280 phytoalexin Substances 0.000 description 1
- 150000001857 phytoalexin derivatives Chemical class 0.000 description 1
- 239000008104 plant cellulose Substances 0.000 description 1
- 239000003375 plant hormone Substances 0.000 description 1
- 238000002264 polyacrylamide gel electrophoresis Methods 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 230000004481 post-translational protein modification Effects 0.000 description 1
- 230000001124 posttranscriptional effect Effects 0.000 description 1
- 238000012794 pre-harvesting Methods 0.000 description 1
- 244000062645 predators Species 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000000644 propagated effect Effects 0.000 description 1
- 230000004224 protection Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000004853 protein function Effects 0.000 description 1
- 230000006916 protein interaction Effects 0.000 description 1
- 108060006633 protein kinase Proteins 0.000 description 1
- 238000000734 protein sequencing Methods 0.000 description 1
- 238000000575 proteomic method Methods 0.000 description 1
- 235000015136 pumpkin Nutrition 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 1
- 102000037983 regulatory factors Human genes 0.000 description 1
- 108091008025 regulatory factors Proteins 0.000 description 1
- 230000002787 reinforcement Effects 0.000 description 1
- 230000003252 repetitive effect Effects 0.000 description 1
- 230000010076 replication Effects 0.000 description 1
- 230000029058 respiratory gaseous exchange Effects 0.000 description 1
- 230000003938 response to stress Effects 0.000 description 1
- 238000010839 reverse transcription Methods 0.000 description 1
- 230000014639 sexual reproduction Effects 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 238000002741 site-directed mutagenesis Methods 0.000 description 1
- 239000002689 soil Substances 0.000 description 1
- 210000001082 somatic cell Anatomy 0.000 description 1
- 239000007921 spray Substances 0.000 description 1
- 235000020354 squash Nutrition 0.000 description 1
- 230000010473 stable expression Effects 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 150000008163 sugars Chemical class 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 229920001059 synthetic polymer Polymers 0.000 description 1
- 229920001864 tannin Polymers 0.000 description 1
- 235000018553 tannin Nutrition 0.000 description 1
- 239000001648 tannin Substances 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 238000012731 temporal analysis Methods 0.000 description 1
- TUNFSRHWOTWDNC-UHFFFAOYSA-N tetradecanoic acid Chemical compound CCCCCCCCCCCCCC(O)=O TUNFSRHWOTWDNC-UHFFFAOYSA-N 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 108010014677 transcription factor TFIIE Proteins 0.000 description 1
- 108010014678 transcription factor TFIIF Proteins 0.000 description 1
- 230000005026 transcription initiation Effects 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 238000010361 transduction Methods 0.000 description 1
- 230000026683 transduction Effects 0.000 description 1
- 238000005918 transglycosylation reaction Methods 0.000 description 1
- 230000001052 transient effect Effects 0.000 description 1
- 238000013519 translation Methods 0.000 description 1
- 230000005068 transpiration Effects 0.000 description 1
- ZHSGGJXRNHWHRS-VIDYELAYSA-N tunicamycin Chemical compound O([C@H]1[C@@H]([C@H]([C@@H](O)[C@@H](CC(O)[C@@H]2[C@H]([C@@H](O)[C@@H](O2)N2C(NC(=O)C=C2)=O)O)O1)O)NC(=O)/C=C/CC(C)C)[C@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1NC(C)=O ZHSGGJXRNHWHRS-VIDYELAYSA-N 0.000 description 1
- MEYZYGMYMLNUHJ-UHFFFAOYSA-N tunicamycin Natural products CC(C)CCCCCCCCCC=CC(=O)NC1C(O)C(O)C(CC(O)C2OC(C(O)C2O)N3C=CC(=O)NC3=O)OC1OC4OC(CO)C(O)C(O)C4NC(=O)C MEYZYGMYMLNUHJ-UHFFFAOYSA-N 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000005167 vascular cell Anatomy 0.000 description 1
- 230000009105 vegetative growth Effects 0.000 description 1
- 108700026220 vif Genes Proteins 0.000 description 1
- 230000003313 weakening effect Effects 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 229920001221 xylan Polymers 0.000 description 1
- 150000004823 xylans Chemical class 0.000 description 1
- 229910052725 zinc Inorganic materials 0.000 description 1
- 230000004572 zinc-binding Effects 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Landscapes
- Breeding Of Plants And Reproduction By Means Of Culturing (AREA)
Description
CHITINASE ENCODING DNA MOLECULE FROM COTTON
EXPRESSED PREFERENTIALLY IN FIBERS DURING SECONDARY
CELL WALL DEPOSITION AND THE CORRESPONDING PROMOTER
[0001] The present invention relates to a gene that is expressed in fibers during secondary cell wall deposition and the promoter of the corresponding gene.
[0002] Fiber cells of cotton (Gossypium hirsutum L. and other Gossypium species including G. barbadense L., G. arboreum L., and G. herbaceous L.), a crop of enormous economic importance to world-wide agriculture, are differentiated epidermal cells of the seed coat. At maturity the fiber cell, considered from inside to outside, consists of a cell lumen, secondary cell wall, primary cell wall, and thin waxy cuticle. The primary cell wall is made up of pectic compounds, hemicellulose components, cellulose, and protein. The secondary cell wall consists mainly (about 95%) of cellulose with small percentages of other components not yet conclusively identified.
[0003] Cotton fiber development is characterized by the stages of initiation, primary cell wall deposition, secondary cell wall deposition, and dessication. During the primary wall stage of fiber development, primary wall deposition occurs to facilitate fiber elongation. During the secondary wall stage of fiber development, secondary wall deposition occurs to accomplish fiber thickening. Primary and secondary wall deposition involve the synthesis of all the cell wall components characteristic of each stage and the assembly of the molecules into an organized cell wall outside the plasma membrane. Many hundred of genes are required for the differentiation and development of plant fiber. Work on in vitro translated fiber proteins (Delmer et al., “New Approaches to the Study of Cellulose Biosynthesis,” J. Cell Sci. Suppl., 2:33-50 (1985), protein isolated from fiber (Graves and Stewart, “Analysis of the Protein
Constituency of Developing Cotton Fibers,” J. Exp. Bot., 39:59-69 (1988)), and analysis of particular genes (Wilkins et al., “ Molecular Genetics of Developing
Cotton Fibers,” in Basra, ed., Cotton Fibers: Developmental Biology, Quality
Improvement. and Textile Processing, Haworth Press:New York, p. 231-270 : (1999)) clearly suggests differential gene expression during various developmental stages of the cell. However, only a few of the genes involved in the biosynthesis of the large numbers of fiber-specific or fiber-enhanced structural proteins, enzymes, polysaccharides, or waxes have been identified (John et al., “Gene Expression in Cotton (Gossypium hirsutum L.) Fiber: Cloning of the mRNAs,” Proc. Natl. Acad. Sci. USA, 89:5769-5773 (1992); John, “Characterization of a Cotton (Gossypium hirsutumn L.) Fiber mRNA (Fb-B6),”
Plant Physiol., 107:1477-1478 (1995)). Since these genes and their interactions with environment determine the quality of fiber, their identification and characterization is considered to be an important aspect of cotton crop improvement.
[0004] In particular, how secondary cell walls are synthesized, how they aid plant function, adaptation, and defense, and how their properties translate into industrial utility are important questions related to basic biological mechanisms, ecology, and plant improvement. Plant secondary cell walls are synthesized in some specialized cell types to facilitate particular functions, such as long-range conduction of water (tracheary elements), control of transpiration (guard cells), and dispersal of seeds (cotton fibers). These secondary cell walls have a higher content of high tensile strength cellulose, usually exceeding 40% by weight, and are much thicker than primary cell walls. Consequently, their hemicellulose, pectin, and protein content is reduced, with the most extreme reduction occurring in the case of cotton fiber secondary cell walls which are about 95% cellulose. On the other hand, during primary wall deposition, the cellulose content is typically 9- 30% (w/w) (Meinert et al., “Changes in Biochemical Composition of the Cell
Wall of the Cotton Fiber During Development,” Plant Physiol., 59:1088-1097 (1977); Darvill et al., “The Primary Cell Walls of Flowering Plants,” The
Biochemistry of Plants, 1:91-162 (1980); Smook, Handbook for Pulp and Paper
Technologists, Vancouver, Canada:Angus Wilde Publications, p. 15 (1992)).
Because secondary cell walls are strong and represent a bulk source of chemical cellulose, they have been exploited as important renewable resources, for example in wood and cotton fibers.
[0005] Cotton fiber cells have two distinct developmental stages that include secondary wall deposition. Many studies of fiber length and weight increase, morphology, cell wall composition, cellulose synthesis rates, and gene expression have confirmed the summary of the stages of fiber development presented below, and recent reviews contain many primary references to confirm these facts (Delmer, “Cellulose Biosynthesis in Developing Cotton Fibers,” in
Basra, ed., Cotton Fibers: Developmental Biology. Quality Improvement. and : 10 Textile Processing,” New York, New York:Haworth Press, pp. 85-112 (1999),
Ryser, “Cotton Fiber Initiation and Histodifferentiation,” in Basra ed., Cotton
Fibers: Developmental Biology, Quality Improvement, and Textile Processing,”
New York, New York:Haworth Press, pp. 1-46 (1999); Wilkins et al., “Molecular
Genetics of Developing Cotton Fibers, in Basra, ed., Cotton Fibers:
Developmental Biology, Quality Improvement, and Textile Processing,” New
York, New York:Haworth Press, pp. 231-270 (1999)). Following fiber initiation by bulging of an epidermal cell above the surface, fiber elongation begins.
Primary wall deposition is required to facilitate fiber elongation, and primary wall deposition continues alone for at least 12 days after fiber initiation. This period. represents exclusively the primary wall stage of fiber development. Then “secondary wall deposition begins while primary wall deposition continues, albeit usually at a slower rate. This stage of fiber development represents the transition between primary and secondary wall deposition, and it typically begins in G. hirsutum L. between 14 - 17 days post anthesis (DPA). Subsequently, fiber elongation and primary wall deposition cease, typically between 18 - 24 DPA, and “secondary wall deposition persists exclusively until 34 - 50 DPA. Variation in the time of initiation and duration of each phase of fiber development depends on the cotton cultivar and the temperature conditions (DeLanghe, “Lint Development” in
Mauney, eds., Cotton Physiology, Memphis, Tennessee: The Cotton Foundation, pp. 325-349 (1986); Haigler et al., “Cultured Cotton Ovules as Models for Cotton
Fiber Development Under Low Temperatures,” Plant Physiol., 95:88-96 (1991);
Thaker et al., “Genotypic Variation and Influence of Diurnal Temperature on
Cotton Fiber Development,” Field Crops Research, 22:129-141 (1989)). For example, in field-grown G. barbadense L., extensive secondary wall deposition did not occur until after 20 DPA, elongation continued until 39 DPA, and secondary wall deposition ceased at 48 DPA (Schubert et al., “Growth and
Development of the Lint Fibers of Pima S-4 Cotton,” Crop Sci., 16:539-543 (1976)).
[0006] The rates of cellulose synthesis change from low, to medium, to high, respectively, at the primary wall, transition, and secondary wall stages of fiber development (Meinert et al., “Changes in Biochemical Composition of the
Cell Wall of the Cotton Fiber During Development,” Plant Physiol., 59:1088-1097 (1977); Martin, “Cool-Temperature-Induced Changes in Metabolism Related to
Cellulose Synthesis in Cotton Fibers, Ph.D. dissertation, Texas Tech University,
Lubbock, TX, U.S.A. (1999)). An example is found in fibers developing on cultured cotton ovules at an optimum temperature of constant 34°C, which maximizes the rate of progression through the stages of fiber development.
Combining results from fibers on ovules of two cotton cultivars of G. hirsutum L. cultured under this condition, primary wall deposition along with a low rate of "cellulose synthesis occurs until 12 - 14 DPA, the transition between primary and secondary wall deposition and an intermediate rate of cellulose synthesis begins at 14 - 16 DPA, and secondary wall deposition continues along with a high rate of cellulose synthesis beginning at 16 - 21 DPA (Martin, “Cool-Temperature-
Induced Changes in Metabolism Related to Cellulose Synthesis in Cotton Fibers,
Ph.D. dissertation, Texas Tech University, Lubbock, TX, U.S.A. (1999)). Other biochemical features demonstrate that the initiation of secondary wall deposition via an intermediate rate of cellulose synthesis at the transition stage marks a distinct developmental event: the cellulose content of new wall material rises sharply so that the overall percentage of cellulose in the whole fiber wall doubles in one day (Meinert et al., “Changes in Biochemical Composition of the Cell Wall of the Cotton Fiber During Development,” Plant Physiol., 59:1088-1097 (1977)), the respiration rate transiently declines, and the intercellular pools in the fiber of
UDP-glucose and glucose-6-P begin to rise (Martin, “Cool-Temperature-Induced
Changes in Metabolism Related to Cellulose Synthesis in Cotton Fibers, Ph.D. dissertation, Texas Tech University, Lubbock, TX, U.S.A. (1999)). These are signs of an abrupt onset of secondary wall deposition (DeLanghe, “Lint
Development” in Mauney, eds., Cotton Physiology, Memphis, Tennessee: The
Cotton Foundation, pp. 325-349 (1986)).
[0007] Primary and secondary wall deposition appear to be controlled by different genetic factors (Kohel et al., “Fiber Elongation and Dry Weight Changes in Mutant Lines of Cotton,” Crop Sci., 14:471-474 (1974)), and both stages can likely be manipulated independently by genetic engineering to achieve the longer, stronger, finer (smaller diameter), and more mature (as related to the secondary wall thickness) fiber that the textile industry desires. However, this goal can only ~ be achieved by knowing more about the genes that control and contribute to each stage of fiber development.
[0008] ‘After the fibers mature, the protective boll opens and the dried fiber often hangs for several weeks on the plant until the whole crop matures (unless stopped by killing cold temperatures) and vegetative growth dies or is killed chemically to allow harvest. During this period, fibers are subject to degradation by enzymatic activity of fungi, which is often enhanced by wet fall weather (Simpson et al., “ The Geographical Distribution of Certain Pre-Harvest Microbial
Infections of Cotton Fiber in the U.S. Cotton Belt,” Plant Disease Reporter, 55:714-718 (1971)). In some years, this field-waiting time causes substantial deterioration of the grade of the fiber so that the producer receives a discounted price and the production of quality yarns and fabrics is jeopardized. Therefore, cotton production efficiency will be improved by more knowledge of how to bring the fibers undamaged from the field to textile plant. Relevant to achieving this goal is a better understanding of endogenous protections against fungal degradation that could be introduced or enhanced in the fiber.
[0009] Particularly because of their defensive role in plants (Gooday, « Aggressive and Defensive Roles for Chitinases,” in Jolles, eds., Chitin and
Chitinases, Birkhiduser Verlag:Basel, pp. 157-170 (1999)), numerous chitinase genes and proteins have been characterized in diverse plant species. The chitinase gene and protein family has been the subject of many reviews (including Graham etal, “Cellular Coordination of Molecular Responses in Plant Defense,”
Molecular Plant-Microbe Interactions: MPMI, 4:415-422 (1991); Cutt et al., “Ppathogenesis-Related Proteins,” in Boller, eds., Genes Involved in Plant
Defense, Springer Verlag/New York. pp. 209-243 (1992); Meins et al., “The
Primary Structure of Plant Pathogenesis-Related Glucanohydrolases and Their
Genes,” in Boller, eds., Genes Involved in Plant Defense, Springer Verlag/New
York, p. 245-282 (1992); Collinge et al., “Plant Chitinases,” Plant J., 3:31- 40 (1993); Sahai et al., “ Chitinases of Fungi and Plants: Their Involvement in
Morphogenesis and Host-Parasite Interaction,” FEMS Microbiology Rev., 11:317-338 (1993); Meins et al., “Plant Chitinase Genes,” Plant Molecular
Biology Reporter, 12:522-528 (1994); Hamel et al., “ Structural and Evolutionary
Relationships Among Chitinases of Flowering Plants,” Journal of Molecular
Evolution, 44:614-624 (1997)) and of an edited book (Jolles, eds. Chitin and
Chitinases, Birkhiuser Verlag:Basel, 340 pp (1999)). These sources contain many primary references to the well known facts summarized below. Chitinases are among a group of genes that are inducible in plants by pathogen attack, corresponding to the frequent occurrence of chitin in fungal cell walls and insect exoskeletons. In their defensive role, chitinases catalyze the hydrolysis of chitin.
Structural chitin occurs as crystalline microfibrils composed of a linear homopolymer of 8-1,4-linked N-acetyl-D-glucosamine residues, (GlcNAc).
Chitin hydrolysis defends the plant against predators or pathogens, particularly invading fungi, by weakening or dissolving their body structure. Especially in combination with 8-1,3-glucanases that serve to uncoat the chitin microfibrils, chitinases can inhibit the growth of many fungi by causing hyphal tip lysis due to a weakened hyphal wall. This has been shown by inhibition of fungal growth in cultures as well as in transgenic plants that exhibit reduced pathogen damage in correlation with increased chitinase activity. Gene expression or activity of chitinases with a probable defensive function have previously been characterized in cotton leaves and roots (Liu et al., “ Detection of Pathogenesis-Related Proteins in Cotton Plants,” Physiological and Molecular Plant Pathology, 47:357-363 (1995); Hudspeth et al., “ Characterization and Expression of Chitinase and 1,3-8-
Glucanase Genes in Cotton,” Plant Molecular Biology, 31:911-916 (1996); Dubery et al., “Induced Defence Responses in Cotton Leaf Disks by Elicitors
From Verticillium dahliae,” Phytochemistry, 44: 1429-1434 (1997)).
[0010] Some chitinases are induced upon fungal invasion, accumulating around invading fungal hyphae (Benhamou et al., “ Subcellular Localization of
Chitinase and Its Potential Substrate in Tomato Root Tissues Infected With
Fusarium Oxysporium F.Sp. Radicislycopersici,” Plant Physiology, 92:1108-1120 (1990); Wubben et al., “ Subcellular Localization of Plant Chitinases and 1,3-B-
Glucanases in Cladosporium Fulvum (Syn. Fulvia Fulva) —Infected Tomato
Leaves,” Physiological and Molecular Plant Pathology 41:23 — 32 (1992)). Other chitinases apparently occur constitutively in plant parts that are particularly susceptible to invasion such as epidermal cells, root cortical cells, stomates, flower parts, and vascular cells. These conclusions arise from both localization of : chitinase mRNA by in situ hybridization and analysis of patterns of expression of the GUS reporter gene under control of chitinase promoters (Samac et al., “Developmental and Pathogen-Induced Activation of the Arabidopsis Acidic
Chitinase Promoter,” The Plant Cell, 3:1063-1072 (1991); Zhu et al., * Stress
Induction and Developmental Regulation of a Rice Chitinase Promoter in
Transgenic Tobacco,” The Plant Journal, 3:203-212 (1993); Biichter et al., “Primary Structure and Expression of Acidic (Class II) Chitinase in Potato,” Plant
Molecular Biology, 35:749-761 (1997); Ancillo et al., “ A Distinct Member of the
Basic (Class I) Chitinase Gene Family in Potato is Specifically Expressed in
Epidermal Cells,”. Plant Molecular Biology, 39:1137-1151 (1999)). In another * case of possible anticipation of fungal invasion in disrupted tissues, ethylene : induces chitinase in bean abscission zones (del Campillo et al., “Identification and
Kinetics of Accumulation of Proteins Induced by Ethylene in Bean Abscission
Zones,” Plant Physiology, 98:955-961 (1991)). None of these studies included ‘analysis of cotton fibers or showed the presence of chitinase activity or chitinase- related proteins in cotton fibers.
[0011] Other studies show that some chitinases have a developmental role in plants, although authentic structural chitin is not a natural part of the plant body (Meins et al., “ The Primary Structure of Plant Pathogenesis-Related Glucanohydrolases and Their Genes,” In Boller, eds., Genes Involved in Plant
Defense, Springer Verlag/New York, p. 245-282 ( 1992). It has been shown that chitinase isoforms with developmental roles are at least sometimes distinct from those with roles in stress responses and defense (Mauch et al., “ Antifungal
Hydrolases in Pea Tissue. I. Purification and Characterization of Two Chitinases and Two B-1,3-Glucanases Differentially Regulated During Development and in
Response to Fungal Infection,” Plant Physiology, 87:325-333 (1988)). Defensive chitinases bind to short stretches (probably 3-6 residues) of a single N-acetyl- glucosamine chain prior to cleaving the inter-sugar bond (Robertus et al., “The
Structure and Action of Chitinases,” in Jolles, eds., Chitin and Chitinases,
Birkhauser Verlag:Basel, pp. 125-136 (1999)). Therefore, enzymes in the chitinase family can also bind to oligomers of N-acetyl-glucosamine within other molecules such as glycoproteins or signalling molecules. Such molecules may have roles in signal transduction to regulate gene expression cascades required for developmental transitions or in the biosynthetic processes that implement the developmental program.
[0012] Previous research on the regulation of secondary wall deposition or function at the molecular level focused on a few genes involved in cellulose, hemicellulose, lignin, or protein biosynthesis. Among these pathways, lignin synthesis has been most fully explored and manipulated in transgenic plants (Merkle et al., “Forest Biotechnology,” Current Opinion in Biotechnology, 11:298-302 (2000)). However, cotton fibers contain no lignin (Haigler, “ The
Functions and Biogenesis of Native Cellulose,” in Zeronian, eds., Cellulose
Chemistry and Its Applications, Ellis Horwood:Chichester, England, pp. 30-83 (1985)). Hemicellulose polysaccharides within some secondary walls include xylans and glucomannans, but cotton fiber secondary walls do not contain significant quantities of any similar molecule (Haigler, “ The Functions and biogenesis of Native Cellulose,” in Zeronian, eds., Cellulose Chemistry and Its
Applications, Ellis Horwood: Chichester, England, pp. 30-83 (1985)). Only two proteins with possible structural roles in the cotton fiber secondary wall have been identified. One of these, H6, is an arabinogalactan-type protein that accumulates to detectable levels during secondary wall deposition although the expression of its gene begins during rapid elongation including primary wall deposition (John et al., “ Characterization of mRNA for a Proline-Rich Protein of Cotton Fiber,” Plant
Physiology, 108:669-676 (1995)). The second, FbL2A, lacks homology to any known protein, but its highly repetitive sequence and high hydrophilicity suggest that it may have a structural role or protect cotton fibers during dessication. The expression of its gene begins weakly at the primary to secondary wall transition (15 DPA) and is stronger by 20 DPA (Rinehart et al., “ Tissue-Specific and
Developmental Regulation of Cotton Gene FbL2A,” Plant Physiology, 112:1331- 1341 (1996)).
[0013] Enzymes that increase in gene expression and/or activity during cotton fiber secondary wall deposition and that relate to the regulation of cellulose synthesis include cellulose synthase, sucrose synthase, sucrose phosphate synthase, and UDP-glucose pyrophosphorylase (Basra et al., “ Sucrose Hydrolysis in Relation to Development of Cotton (Gossypium spp.) Fibres,” Indian Journal of
Experimental Botany, 28:985-988 (1990); Wifler et al., “ Enzyme Activities in
Developing Cotton Fibres,” Plant Physiology and Biochemistry, 32:697-702 (1994); Amor et al., “ A Membrane-Associated Form of Sucrose Synthase and its
Potential Role in Synthesis of Cellulose and Callose in Plants,” Proc. Nat’l. Acad.
Sci. U.S.A., 92:9353-9357 (1995); Pear et al., “ Higher Plants Contain Homologs of the Bacterial celA Genes Encoding the Catalytic Subunit of Cellulose
Synthase,” Proc. Nat’l. Acad. Sci. U.S.A., 93:12637-12642 (1996); Tummala, “Response of Sucrose Phosphate Synthase Activity to Cool Temperatures in
Cotton,” M.S. thesis, Texas Tech University, Lubbock, TX (1996)). UDP- glucose pyrophosphorylase converts glucose-1-P to UDP-glucose or mediates the reverse reaction. In the context of cellulose synthesis, sucrose synthase is thought to degrade sucrose and supply UDP-glucose to cellulose synthase. Cellulose synthase transfers the glucose to the elongating 8-1,4-linked cellulose polymer while free UDP is recycled to sucrose synthase. Sucrose phosphate synthase may use fructose-6-P (e.g. that derived from the fructose released by the degradative action of sucrose synthase) and UDP-glucose to synthesize additional sucrose to support cellulose synthesis (Delmer, “Cellulose Biosynthesis in Developing
Cotton Fibers,” in Basra, ed., Cotton Fibers: Developmental Biology. Quality
Improvement. and Textile Processing, Haworth Press:New York, pp. 85-112
[0014] All of the enzymes just discussed operate within the pathways of sugar metabolism leading to the formation of the 3-1,4-linked glucan polymer.
Evidence from other systems and cotton fibers implicates other possible points of regulation of cellulose synthesis coincident with or after formation of the glucan polymer, although the relevant pathways and proteins are incompletely understood. Examples of other relevant proteins include B-1,4-glucanase that may act as a glucan chain editor or in some other role (Delmer, “Cellulose
Biosynthesis: Exciting Times For a Difficult Field of Study,” Ann. Rev. Plant
Physiol. Mol. Biol., 50:245-276 (1999 b)) and glycoproteins that may act as primers for cellulose biosynthesis (Lukowitz et al., “ Arabidopsis cyt] Mutants are
Deficient in a Mannose-1-Phosphate Guanyltransferase and Point to a
Requirement of N-Linked Glycosylation for Cellulose Biosynthesis,” Proc. Nat'l.
Acad. Sci. U.S.A. 98:2262-2267 (2001)). Mutations that down-regulate 3-1,4- glucanase or glycoprotein synthesis cause reduced cellulose content in other _ systems (Nicol et al., “Plant Cell Expansion: Scaling the Wall,” Current Opinion in Cell Biology, 1:12-17 (1998); Lukowitz et al., “ Arabidopsis cyt] Mutants are
Deficient in a Mannose-1-Phosphate Guanyltransferase and Point to a
Requirement of N-Linked Glycosylation for Cellulose Biosynthesis,” Proc. Nat'l,
Acad. Sci. U.S.A, 98:2262-2267 (2001)). In Arabidopsis, mutation of xylem secondary wall specific cellulose synthase genes causes reduced cellulose content and weak xylem walls (Turner et al., “ Collapsed Xylem Phenotype of Arabidopsis
Identifies Mutants Deficient in Cellulose Deposition in the Secondary Cell Wall,”
Plant Cell, 9:689 — 701 (1997)). In cotton, increased expression of spinach sucrose phosphate synthase causes increased cellulose content in fiber walls of plants growing under a cool night cycle (Haigler et al., “ Transgenic Cotton Over-
Expressing Sucrose Phosphate Synthase Produces Higher Quality Fibers With
Increased Cellulose Content and Has Enhanced Seed Cotton Yield,” Abstract 477.
In: Proceedings of Plant Biology 2000, July 15 — 19, San Diego, CA. American
Society of Plant Physiologists, Rockville, MD, (2000)). These findings indicate that it is possible to manipulate the quantity of cellulose in secondary walls, but presently there is insufficient identification of target genes that might be beneficially manipulated. :
[0015] Studies that identify genes that are under tissue-specific and developmental regulation are important in understanding the roles of proteins in fiber development and cell-wall architecture (John, “Structural Characterization of
Genes Corresponding to Cotton Fiber mRNA, E6: Reduced E6 Protein in
Transgenic Plants by Antisense Gene,” Plant Mol. Biol., 30:297-306 (1996)). In addition, such genes and their regulatory elements are important tools for fiber modification through genetic engineering (John, “Prospects for Modification of
Fibers Through Genetic Engineering of Cotton,” in Gebelein, eds., Industrial
Biotechnological Polymers, Lancaster, PA: Technomic, pp. 69-79 (1995); John, “Genetic Engineering Strategies for Cotton Fiber Modification. In: A.S. Basra (ed.), Cotton Fibers: Developmental Biology. Quality Improvement, and Textile
Processing, The Haworth Press, New York, pp. 271 — 289 (1999)).
[0016] In many instances, it would be desirable for a transgene to be developmentally regulated to have exclusive or preferential expression in fiber cells at a proper developmental stage. This regulation can be most expeditiously accomplished by a promoter capable of preferential promotion.
[0017] Promoters are DNA elements that direct the transcription of RNA in cells. Together with other regulatory elements that specify tissue and temporal specificity of gene expression, promoters control the development of organisms.
Thus, there has been a concerted effort in identifying and isolating promoters from a wide variety of plants and animals.
[0018] Many promoters function properly in heterologous systems. For ‘example, promoters taken from plant genes such as rbcS, Cab, chalcone synthase, and protease inhibitor from tobacco and Arabidopsis are functional in heterologous transgenic plants. (Benfey et al., “Regulated Genes in Transgenic
Plants,” Science, 244:174-181, (1989)). Specific examples of transgenic plants include tissue-specific and developmentally regulated expression of soybean 7s seed storage protein gene in transgenic tobacco plants (Chen et al., “A DNA
Sequence Element That Confers Seed-Specific Enhancement to a Constitutive
Promoter,” EMBO J., 7:297-302, (1988)) and light-dependent organ-specific expression of Arabidopsis thaliana chlorophyll a/b binding protein gene promoter in transgenic tobacco (Ha et al., “Identification of Upstream Regulatory Elements
Involved in the Developmental Expression of the Arabidopsis-thaliana Cab-1
Gene,” Proc. Natl. Acad. Sci. USA, 85:8017-8021, (1988)). Similarly, anaerobically inducible maize sucrose synthase-1 promoter activity was demonstrated in transgenic tobacco (Yang et al., “Maize Sucrose Synthase-1
Promoter Directs Phloem Cell-Specific Expression of Gus Gene in Transgenic
Tobacco Plants,” Proc. Natl. Acad. Sci. USA, 87: 4144-4148, (1990)). Tomato pollen promoters were found to direct tissue-specific and developmentally regulated gene expression in transgenic Arabidopsis and tobacco (Twell et al., “Pollen-Specific Gene Expression in Transgenic Plants Coordinate Regulation of
Two Different Tomato Gene Promoters During Microsporogenesis,”
Development, 109:705-714, 1990). Thus, some plant promoters can be utilized to express foreign proteins in plant tissues in a developmentally regulated fashion.
[0019] Tissue-specific and developmentally regulated expression of genes has also been shown in fiber cells. Several of these, such as E6, vacuolar ATPase, and lipid transfer-type proteins, have strong expression in cotton fibers during primary wall deposition (Wilkins et al., “Molecular Genetics of Developing
Cotton Fibers,” in Basra, ed., Cotton Fibers: Developmental Biology. Quality
Improvement, and Textile Processing, Haworth Press:New York, p. 231-270 (1999); Orford et al., “Expression of a Lipid Transfer Protein Gene Family
During Cotton Fibre Development,” Biochimica and Biophysica Acta, 1483:275- 284 (2000)). Other genes show transient expression during fiber development.
For example, Rac is transiently expressed at the primary to secondary wall stage transition (Delmer et al., “ Genes Encoding Small GTP-Binding Proteins
Analogous to Mammalian Rac are Preferentially Expressed in Developing Cotton
Fibers,” Mol. Gen. Genet., 248:43-51 (1995)) and another lipid transfer-type protein, FS18A (Orford et al., Characterization of a Cotton Gene Expressed Late in Fibre Cell Elongation,” Theoretical and Applied Genetics, 98:757-764 (1999)), is transiently expressed at 24 DPA during secondary wall deposition. Another gene, Hb, is expressed between 10 — 24 DPA, which includes both primary and early secondary wall deposition, but H6 protein accumulates only during secondary wall deposition at 15 — 40 DPA (John et al., “ Characterization of mRNA for a Proline-Rich Protein of Cotton Fiber,” Plant Physiology, 108:669- 676 (1995)). At the level of gene expression, only certain cellulose synthase genes have been previously shown to have preferential and prolonged expression in cotton fibers during secondary wall deposition, although there were lower levels of expression during primary wall deposition and in other parts of the plant.
In addition, cellulose synthase did not show strong expression until 20 DPA, with only weak expression observed at 17 DPA (Pear et al., “Higher Plants Contain
Homologs of the Bacterial cel A Genes Encoding the Catalytic Subunit of
Cellulose Synthase,” Proc. Nat’l. Acad. Sci. U.S.A., 93:12637-12642 (1996)).
Another gene, FbL2A, is up-regulated at the primary to secondary wall transition (weakly at 15 DPA and strongly at 20 DPA), but data on gene expression during later stages of fiber development were not shown (Rinehart et al., “ Tissue-
Specific and Developmental Regulation of Cotton Gene FbL.2A,” Plant
Physiology, 112:1331-1341 (1996)). : [0020] It would be useful to have a promoter that would drive gene expression preferentially and strongly in fibers throughout secondary wall deposition, i.e., strongly and continuously (e.g. at > 50% of its maximal activity) from the Initiation of secondary wall deposition to its termination. The initiation of secondary wall deposition is defined as the time when the dry weight/unit length of a cotton fiber begins to increase or when the dry weight/unit surface area of any cell begins to increase via synthesis of new wall material containing more than 40% (w/w) of cellulose. In the case of cotton fiber of G. hirsutum L., this is expected to occur between 14 — 17 DPA when cotton plants are grown under typical conditions in the greenhouse or the field (day temperature of 26 — 34°C, night temperature of 20 — 26°C, li ght intensity greater than or equal to 1000 peinsteins/m?/s, with adequate water and mineral nutrition). Furthermore, it would be useful to have a promoter that would drive gene expression only or preferentially in fibers while excluding or minimizing expression in other tissues.
[0021] The present invention is directed to achieving these objectives.
[0022] The present invention relates to an isolated nucleic acid molecule from cotton encoding an endogenous cotton protein related to chitinase, where the nucleic acid molecule is expressed preferentially in fibers during secondary wall deposition. A polypeptide encoded by the isolated nucleic acid molecule is also disclosed.
[0023] Another aspect of the present invention relates to a DNA construct comprising a DNA promoter operably linked 5° to a second DNA, which is the isolated nucleic acid molecule, and a 3’ regulatory region operably linked to the second DNA. The DNA construct can be incorporated in an expression system, a host cell, a plant, or a plant seed.
[0024] Another aspect of the present invention relates to an isolated DNA promoter suitable for inducing expression of a protein encoded by a second DNA operably associated with the DNA promoter. The DNA promoter is isolated from cotton and drives expression preferentially in fibers during secondary wall deposition.
[0025] Another aspect of the present invention relates to a DNA construct comprising the isolated DNA promoter, a second DNA, and a 3’ regulatory region. The DNA construct may be incorporated in an expression system, a host cell, a plant, or a plant seed.
[0026] Also disclosed is a method of imparting resistance to plants against insects and fungi comprising transforming a plant with the DNA construct comprising the isolated nucleic acid molecule of the present invention.
[0027] Another aspect of the present invention relates to a method of regulating the cellulose content of a plant fiber comprising transforming a plant with the DNA construct comprising the isolated nucleic acid molecule of the present invention.
[0028] A further aspect of the present invention is directed to a method of expressing a gene preferentially in fibers during secondary wall deposition in a plant comprising transforming a plant with the DNA construct comprising the isolated DNA promoter of the present invention.
[0029] The finding that the isolated nucleic acid molecule disclosed in the present invention is expressed preferentially in fibers during secondary wall deposition when cellular activity is strongly skewed toward cellulose synthesis is consistent with a developmental role for the corresponding chitinase-related protein in cellulose synthesis. Alternatively, the protein could be “stored” in the cotton fiber cell wall awaiting fungal attack after boll opening. However, any chitinase with this defensive function in cotton fibers may be relatively ineffective because cotton fibers can be infected and greatly damaged by several fungal species (Simpson et al., “ The Geographical Distribution of Certain Pre-Harvest
Microbial Infections of Cotton Fiber in the U.S. Cotton Belt,” Plant Disease
Reporter, 55:714-718 (1971)). Whether acting developmentally or defensively, manipulating the expression of these chitinase-related proteins in fibers could have important consequences for fiber crop production and quality. For example, fiber cellulose content could be enhanced or diminished during biosynthesis and/or protected from fungal degradation during crop harvesting and processing.
[0030] In addition, a promoter of a gene that is expressed preferentially in fibers during secondary wall deposition of normal plants can be valuable for genetic engineering of fiber to achieve: (1) improved agricultural productivity under normal and stressed conditions and (2) improved fiber properties that depend on modification during secondary wall deposition. Although the promoter for the FbL2A gene has been tested by fusion to two reporter genes (polyhydroxyalkanoic acid synthase or PHA synthase, an enzyme that was detected with a specific antibody, and acetoacetyl-CoA reductase, an enzyme with activity that was monitored by enzyme assay) and transformation of cotton (Rinehart et al., “ Tissue-Specific and Developmental Regulation of Cotton Gene
FbL2A,” Plant Physiology, 112:1331-1341 (1996)), expression of the gene
FbL2A was shown in cotton fibers weakly at 15 DPA and strongly at 20 DPA with no data provided for the duration of secondary wall deposition until 30 DPA or later. By use of the two promoter/reporter gene constructs, somewhat contradictory data were provided on the utility of the promoter of FbL2A. When the acetoacetyl-CoA reductase gene was under control of the FbL2A promoter, acetoacetyl-CoA reductase activity was detected in cotton fibers during primary wall deposition at 5— 10 DPA, and there was consistent, substantial activity by 20
DPA during secondary wall deposition, peak activity at 35 DPA, and continued activity until 45 DPA among a family of independently transformed plants (Rinehart et al., “ Tissue-Specific and Developmental Regulation of Cotton Gene
FbL2A,” Plant Physiology, 112:1331-1341 (1996)). However, the enzyme activity after 20 DPA could be due to long-lived messenger RNA or protein synthesized at 15 —20 DPA, which is the period when the data directly show
FbL2A gene expression under control of its own promoter. In contrast, when the
PHA synthase gene was under the control of the FbL2A promoter, Western blotting to detect PHA synthase immunologically in a transformed plant showed only very weak signal during secondary wall deposition at 20 DPA, a trace signal at 25 DPA, and no signal at 30 or 35 DPA (Rinehart et al., “ Tissue-Specific and
Developmental Regulation of Cotton Gene FbL2A,” Plant Physiology, 112:1351- 1341 (1996)). Furthermore, the PHA synthase gene under the control of the putatively consitutive 35S promoter from CaMV virus correlated with detection of
PHA synthase protein strongly during primary wall deposition at 10 DPA and weakly continuing through 35 DPA of secondary wall deposition. The comparative patterns during secondary wall deposition are consistent with © transient expression of the FbL2A promoter around 20 DPA of secondary wall deposition. The data also show that the FbL.2A promoter will drive weak foreign gene expression in cotton fibers during primary wall deposition (Rinehart et al., “ Tissue-Specific and Developmental Regulation of Cotton Gene FbL2A,” Plant
Physiology, 112:1331-1341 (1996)). Therefore, there is no known gene that encodes a functional protein that is preferentially and strongly expressed in fibers throughout secondary wall deposition. Correspondingly, there is no promoter to drive foreign gene expression preferentially and strongly throughout the whole duration of fiber secondary wall deposition. The promoter disclosed in the present invention allows these goals to be met while avoiding or minimizing pleiotropic effects on plant growth and development or other stages of fiber development that could reduce the benefit of the targeted effects.
[0031] Figure 1 is an autoradiographic image on film of a gel of labeled cDNA fragments arising through the technique of differential display from RNA isolated from 18 and 12 DPA cotton fibers, respectively, of Gossypium hirsutum cv. Coker 312. The arrow points to the band unique to 18 DPA cotton fibers that corresponds to the gene subsequently named F285 and shown to have homology to chitinases.
[0032] Figure 2 shows a Northern blot exposed to film overnight showing total RNA isolated from various cotton tissues. The top frame shows incubation with a probe to F285, and the bottom frame shows incubation with a probe to 18S
RNA to show the comparative level of RNA loading in each lane, which was intended to be 15 pg/lane.
[0033] Figure 3 shows a Northern blot, illustrating a more detailed time- course of fiber development. The top frame shows incubation with a probe to
F285, and the bottom frame shows incubation with a probe to 18S RNA to show the comparative level of RNA loading in each lane.
[0034] Figure 4 illustrates the detection of chitinase activity in protein extracts of various tissues as follows:
Areal: $DPA greenhouse-grown fibers, untreated before protein extraction
Area 2: 17 DPA greenhouse-grown fibers, untreated before protein extraction
Area 3: 24 greenhouse-grown fibers, untreated before protein extraction
Area 4: 31 greenhouse-grown fibers, untreated before protein extraction
Area 5: 18 day old leaves, untreated before protein extraction.
Area 6: 18 day old leaves, water-treated at 16 days after planting
Area 7: 18 day old leaves, salicylic acid (SA)-treated at 16 days after planting
Area 8: Negative control (Water)
Area 9: 8 DPA cultured fibers, water-treated
Area 10: 8 DPA cultured fibers, SA-treated on 6 DPA -
Area 11: Negative control (BSA solution)
Area 12: Positive control (Commercial bacterial chitinase) ~
[0035] | Figure 5 shows a Northern blot, testing for induction by SA or ethephon (ETH) of expression of F285. The top frame shows incubation with a probe to F285, and the bottom frame shows incubation with a probe to 18S RNA to show the comparative level of RNA loading in each lane. The tissue and pre- treatment, if any, are indicated above each lane. Treatments, if any, were applied to seedlings 16 days after planting, and organs were harvested two days later.
Treatments, if any, were applied to ovules at 6 DPA with harvest occurring at 8
DPA.
[0036] Figure 6 shows a Southern blot of cotton genomic DNA digested with EcoRI and Hind III restriction enzymes and probed with the F285 full-length cDNA and, subsequently, with a fragment of another member of its gene family,
TAGI.
[0037] Figure 7 shows a Northern blot testing the expression of TAG1.
The top frame shows incubation with a probe to TAG], and the bottom frame shows incubation with a probe to 18S RNA to show the comparative level of RNA loading in each lane. Tissues tested, including roots, stems, and leaves, and . stripped ovules at 18 DPA, fibers at 8 DPA, and fibers at 24 DPA, are indicated above each lane.
[0038] The present invention relates to an isolated nucleic acid molecule from cotton encoding an endogenous cotton chitinase. The nucleic acid molecule is expressed preferentially in fibers during secondary wall deposition. Typically, the fiber is cotton fiber.
[0039] Preferential expression in fibers during secondary wall deposition means gene expression in the fiber cell during secondary wall deposition at a level more than 100 times higher than in other cell types or at other stages of cell development. Comparative levels of gene expression can be assessed by various standard molecular biological techniques including semi-quantitative Northern blotting and real-time quantitative PCR.
[0040] The word “fiber” is often used to unify a diverse group of plant cell types that share in common the features of having an elongated shape and abundant cellulose in thick cell walls, usually, but not always, described as secondary walls. Such walls may or may not be lignified, and the protoplast of such cells may or may not remain alive at maturity. Such fibers have many industrial uses, for example in lumber and manufactured wood products, paper, textiles, sacking and boxing material, cordage, brushes and brooms, filling and stuffing, caulking, reinforcement of other materials, and manufacture of cellulose derivatives. In some industries, the term “fiber” is usually inclusive of thick- walled conducting cells such as vessels and tracheids and to fibrillar aggregates of - many individual fiber cells. Here the term “fiber” is used in its most inclusive sense, for example including: (a) thick-walled conducting and non-conducting cells of the xylem; (b) fibers of extraxylary origin, including those from phloem, bark, ground tissue, and epidermis; and (c) fibers from stems, leaves, roots, seeds, and flowers or inflorescences (such as those of Sorghum vulgare used in the manufacture of brushes and brooms). In addition to wood from trees, cotton, and forage crops, the invention is applicable to all fibers, including, but not exclusively, those in agricultural residues such as com, sugar cane, and rice stems that can be used in pulping, flax, hemp, ramie, jute, kenaf, kapok, coir, bamboo, spanish moss, abaca, and Agave spp. (e.g. sisal).
[0041] The isolated nucleic acid molecule of the present invention can have a nucleotide sequence of SEQ. ID. No. 1 as follows:
ATG GAG GCC AAA TGG CTG CTA TGT TTT ACA ATG GCA GCA CTA ATG GCA
95 GTG TCA AAT GGC CAG GAA TCA GTG AAG CCA TTG GTG AAG ATA GTT ARA .GGC AAG AAA CTT TGT GAT AAA GGG TGG GAA TGT ARA GGG TGG TCA CAG
TTT TGT TGT AAC CAA ACC ATT TCT GAT TAT TTC CGA ACT TAT CAA TTT
GAG AAC CTT TTC GCT AAA CGT AAT ACA CCG GTG GCA CAT GCG GTT GGG
TTC TGG GAT TAC CAT TCT TTC ATT ACG GCG GCG GCT CAG TAT CAG CCT
CAT GGT TTT GGT ACC ACC GGC GGT AAG CTG CAG AGC ATG AAG GAA GTG
GCA GCT TTT CTT GGA CAT GTC GGC AGC AAA ACT TCA TGT GGT TAT GGA
GTG GCA ACT GGG GGA CCA TTG GCT TGG GGT CTA TGC TAC AAC AAG GAA
ATG AGT CCT AGC AAA TTG TAT TGT GAT GAT TAC TAC AAA TAC ACC TAC
COT TGC ACT CCT GGA GTT TCT TAC CAT GGC CGT GGT GCC TTG CCT ATC
TAT TGG AAC TAC RAC TAT GGA GAA ACA GGC GAC GCA TTG AAG GTG, GAC
TTA TTG AAC CAC CCT GAA TAC ATA GAA AAC AAT GCA ACC TTA GCT TTC
CAG GCA GCA CTC TGG AGA TGG ATG ACA CCG GTG ARG AAA CAC CAR CCG
TCG GCC CAC GAC GTG TTT GTC GGC AGC TGG AAA CCG ACC AAG AAC GAC
ACG TTG GCC AAG CGG GTC CCG GGG TTT GGA GCC ACC ATG AAT GTG CTC
TAT GGA GAT CAA GTT TGT GGG CGA GGT GAT GIT GAC ACC ATG AAC AAC
ATC ATC TCT CAT TAC CTT TCT TAC CTT GAC CTA ATG GGA GTT GGG AGA
GAA GAG GCA GGA CCC CAT GAA GTG CTC ACA TGT GAA GAA CAA AAG CCT
TTC ACT GTA TCT CCT TCT TCT GCA TCA TCA TCA TCA TCA TCT TGA
[0042] The isolated nucleic acid molecule of the present invention also comprises a nucleotide sequence which hybridizes to a DNA molecule having a sequence according to SEQ. ID. No. 1 under stringent conditions characterized by a hybridization buffer comprising 1 x SSC at a temperature of 61°C.
[0043] The isolated nucleic acid molecule of SEQ. ID. No. 1 encodes a protein or polypeptide having a deduced amino acid sequence of SEQ. ID. No. 2 as follows:
MEAKWLLCFTMAALMAVSNGQESVKPLVKIVKGKKLCDKGWECKGWS QF CCNQTISDYFRTYQFEN
LFAKRNTPVAHAVGFWDYHSFITAAAQYQPHGFGTTGGKLQSMKEVAAFLGHVGSKTSCGYGVATG
GPLAWGLCYNKEMSPSKLYCDDYYKYTYPCTPGVSYHGRGALPIYWNYNYGETGDALKVDLLNHPE
YIENNATLAFQAALWRWMTPVKKHQPS AHDVFVGSWKPTKNDTLAKRVPGFGATMNVLYGDQVCGR
GDVDTMNNIISHYLSYLDLMGVGREEAGPHEVLTCEEQKPFTVSPSSASSSSSS
[0044] This amino acid sequence shows homology to plant chitinases that are important in the defense or in the development of the cotton fiber. The present invention also relates to a polypeptide which is encoded by the isolated nucleic acid molecule of the present invention and has an amino acid sequence corresponding to SEQ. ID. No. 2.
[0045] The isolated nucleic acid molecule of the present invention is preferentially expressed in cotton fibers beginning at 14 to 17 DPA, preferably extending through to the termination of secondary wall deposition. Most preferably, the isolated nucleic acid molecule of the present invention is preferentially expressed in cotton fibers beginning at 14 to 17 DPA up to 31 DPA.
The isolated nucleic acid molecule of the present invention is the first cotton gene with homology to chitinase that is known to be expressed preferentially in fibers during secondary wall deposition. The gene’s precise temporal regulation with : secondary wall deposition suggests that the gene could be manipulated to change fiber development or defensive properties.
[0046] In a preferred form of the present invention, the isolated nucleic acid molecule of the invention is in a DNA construct comprising a DNA promoter operably linked 5° to a second DNA encoding a protein or polypeptide to induce transcription of the second DNA. The second DNA comprises the isolated nucleic acid molecule of the invention. A 3’ regulatory region is operably linked to the second DNA.
[0047] In another embodiment, the present invention is an expression system that includes a suitable vector containing the DNA construct of the invention. The expression system contains the necessary elements for the transcription and translation of the inserted protein-coding sequences. In preparing the DNA construct for expression, the various DNA sequences may normally be inserted or substituted into a bacterial plasmid. Any convenient plasmid may be employed, which will be characterized by having a bacterial replication system, a marker which allows for selection in a bacterium, and generally one or more unique, conveniently located restriction sites. Numerous plasmids, referred to as transformation vectors, are available for plant transformation. The selection of a vector will depend on the preferred transformation technique and target species for transformation. A variety of vectors are available for stable transformation using Agrobacterium tumefaciens, a soilborne bacterium that causes crown gall. Crown gall is characterized by tumors or galls that develop on the lower stem and main roots of the infected plant.
These tumors are due to the transfer and incorporation of part of the bacterium plasmid DNA into the plant chromosomal DNA. This transfer DNA (T-DNA) is expressed along with the normal genes of the plant cell. The plasmid DNA, pTI, or Ti-DNA., for “tumor inducing plasmid,” contains the vir genes necessary for movement of the T-DNA into the plant. The T-DNA carries genes that encode proteins involved in the biosynthesis of plant regulatory factors, and bacterial: nutrients (opines). The T-DNA is delimited by two 25 bp imperfect direct repeat sequences called the “border sequences.” By removing the oncogene and opine genes, and replacing them with a gene of interest, it is possible to transfer foreign
DNA into the plant without the formation of tumors or the multiplication of 4. tumefaciens (Fraley et al., “Expression of Bacterial Genes in Plant Cells,” Proc.
Nat’]l Acad. Sci. USA, 80: 4803-4807 (1983), which is hereby incorporated by reference in its entirety).
[0048] Further improvement of this technique led to the development of the binary vector system (Bevan, M., “Binary Agrobacterium Vectors for Plant
Transformation,” Nucleic Acids Res., 12:8711-8721 (1984), which is hereby incorporated by reference in its entirety). In this system, all the T-DNA sequences (including the borders) are removed from the pTi, and a second vector containing T-
DNA is introduced into A. tumefaciens. This second vector has the advantage of being replicable in E. coli as well as 4. tumefaciens and contains a multiple cloning site that facilitates the cloning of a transgene. An example of a commonly used vector is pBin19 (Frisch, et al., “Complete Sequence of the Binary Vector Bin19,”
Plant Molec. Biol., 27:405-409 (1995), which is hereby incorporated by reference in its entirety). Any appropriate vectors now known or later described for plant transformation are suitable for use with the present invention.
[0049] U.S. Patent No. 4,237,224 issued to Cohen and Boyer, which is hereby incorporated by reference in its entirety, describes the production of expression systems in the form of recombinant plasmids using restriction enzyme cleavage and ligation with DNA ligase. These recombinant plasmids are then introduced by means of transformation and replicated in unicellular cultures, including prokaryotic organisms and eukaryotic cells grown in tissue culture.
[0050] Once the DNA construct of the present invention has been cloned into an expression system, as described above, they are ready to be incorporated into a host cell. Recombinant molecules can be introduced into cells via transformation, particularly transduction, conjugation, mobilization, or electroporation. The DNA sequences are cloned into the vector using standard cloning procedures in the art, as described by Sambrook et al., Molecular Cloning:
A Laboratory Manual, Second Edition, Cold Springs Laboratory, Cold Springs
Harbor, New York (1989), which is hereby incorporated by reference in its entirety. Suitable host cells include, but are not limited to, bacteria, virus, yeast, mammalian cells, insect, plant, and the like. Preferably, the host cells are either a bacterial cell (e.g., Agrobacterium) or a plant cell. Examples of plant cells include cells from cotton, corn, sugar cane, and rice stems that can be used in pulping, flax, hemp, ramie, jute, kenaf, kapok, coir, bamboo, spanish moss, abaca, and
Agave spp. (e.g. sisal). Most preferably, the plant cell is from cotton.
[0051] In other embodiments of the present invention, plants or seeds are produced by transformation with the DNA construct of the present invention.
[0052] The present invention also relates to a method of imparting resistance to insects and fungi involving transforming a plant with the DNA construct that contains the chitinase-encoding nucleic acid molecule of the present invention. The DNA construct of the present invention can be utilized to impart resistance to insects and fungi for a wide variety of fiber-producing plants such as cotton, corn, sugar cane, and rice stems that can be used in pulping, flax, hemp, ramie, jute, kenaf, kapok, coir, bamboo, spanish moss, abaca, and Agave spp. (e.g. sisal). The DNA construct is particularly well suited to imparting resistance to cotton.
[0053] One approach to transforming plant cells with the nucleic acid molecule of the present invention is particle bombardment (also known as biolistic transformation) of the host cell. This can be accomplished in one of several ways.
The first involves propelling inert or biologically active particles at cells. This technique is disclosed in U.S. Patent Nos. 4,945,050, 5,036,006, and 5,100,792, all to Sanford, et al., which are hereby incorporated by reference in their entirety.
Generally, this procedure involves propelling inert or biologically active particles at the cells under conditions effective to penetrate the outer surface of the cell and to be incorporated within the interior thereof. When inert particles are utilized, : the vector can be introduced into the cell by coating the particles with the vector containing the heterologous DNA. Alternatively, the target cell can be surrounded by the vector so that the vector is carried into the cell by the wake of the particle.
Biologically active particles (e.g., dried bacterial cells containing the vector and heterologous DNA) can also be propelled into plant cells. Other variations of particle bombardment, now known or hereafter developed, can also be used.
[0054] Transient expression in protoplasts allows quantitative studies of gene expression since the population of cells is very high (on the order of 10%).
To deliver DNA inside protoplasts, several methodologies have been proposed, but the most common are electroporation (Fromm et al., “Expression of Genes
Transferred Into Monocot and Dicot Plants by Electroporation,” Proc. Natl. Acad.
Sci. USA 82:5824-5828 (1985), which is hereby incorporated by reference in its entirety) and polyethylene glycol (PEG) mediated DNA uptake (Krens et al., “In
Vitro Transformation of Plant Protoplasts with Ti-Plasmid DNA,” Nature 296:72- 74 (1982), which is hereby incorporated by reference in its entirety). During electroporation, the DNA is introduced into the cell by means of a reversible change in the permeability of the cell membrane due to exposure to an electric field. PEG transformation introduces the DNA by changing the elasticity of the membranes. Unlike electroporation, PEG transformation does not require any special equipment and transformation efficiencies can be equally high. Another appropriate method of introducing the gene construct of the present invention into a host cell is fusion of protoplasts with other entities, either minicells, cells, lysosomes, or other fusible lipid-surfaced bodies that contain the chimeric gene (Fraley, et al., “Liposome-Mediated Delivery of Tobacco Mosaic-Virus RNA Into
Tobacco Protoplasts - A Sensitive Assay for Monitoring Liposome-Protoplast
Interactions,” Proc. Natl. Acad. Sci. USA, 79:1859-1863 (1982), which is hereby incorporated by reference in its entirety).
[0055] Stable transformants are preferable for the methods of the present invention. An appropriate method of stably introducing the DNA construct into plant cells is to infect a plant cell with Agrobacterium tumefaciens or
Agrobacterium rhizogenes previously transformed with the DNA construct.
Under appropriate conditions known in the art, the transformed plant cells are grown to form shoots or roots, and develop further into plants. In one embodiment of the present invention, transformants are generated using the method of Frary et al, Plant Cell Reports 16: 235 (1996), which is hereby incorporated by reference in its entirety, to transform seedling explants.
[0056] Plant tissues suitable for transformation include, but are not limited to, floral buds, leaf tissue, root tissue, hypocotyl tissue, meristems, zygotic and somatic embryos, megaspores, and anthers.
[0057] After transformation, the transformed plant cells can be selected and regenerated. Preferably, transformed cells are first identified using a selection marker simultaneously introduced into the host cells along with the DNA construct of the present invention. The most widely used reporter gene for gene fusion experiments has been uidA, a gene from Escherichia coli that encodes the
B-glucuronidase protein, also known as GUS. Jefferson et al., “GUS Fusions: PB
Glucuronidase as a Sensitive and Versatile Gene Fusion Marker in Higher Plants,”
EMBO Journal 6:3901-3907 (1987), which is hereby incorporated by reference in its entirety. GUS is a 68.2 kd protein that acts as a tetramer in its native form. It does not require cofactors or special ionic conditions, although it can be inhibited by divalent cations like Cu" or Zn**. GUS is active in the presence of thiol reducing agents like B-mercaptoethanol or dithiothreitol (DTT). 10058] Other suitable selection markers include, without limitation, markers encoding for antibiotic resistance, such as the nptIl gene which confers kanamycin resistance (Fraley, et al., “Expression of Bacterial Genes in Plant
Cells, Proc. Natl. Acad. Sci. USA, 80:4803-4807 (1983), which is hereby incorporated by reference in its entirety) and the dhfr gene, which confers resistance to methotrexate (Bourouis et al., “Vectors Containing a Prokaryotic
Dihydrofolate Reductase Gene Transform Drosophila Cells to Methotrexate-
Resistance,” EMBO J. 2:1099-1104 (1983), which is hereby incorporated by reference in its entirety).
[0059] Once a recombinant plant cell or tissue has been obtained, it is possible to regenerate a full-grown plant therefrom. Means for regeneration vary : from species to species of plants, but generally a suspension of transformed protoplasts or a petri plate containing transformed explants is first provided.
Callus tissue is formed and shoots may be induced from callus and subsequently rooted. Alternatively, embryo formation can be induced in the callus tissue.
These embryos germinate as natural embryos to form plants. The culture media will generally contain various amino acids and hormones, such as auxin and cytokinins. It is also advantageous to add glutamic acid and proline to the medium, especially for such species as corn and alfalfa. Efficient regeneration will depend on the medium, on the genotype, and on the history of the culture. If these three variables are controlled, then regeneration is usually reproducible and repeatable.
[0060] Plant regeneration from cultured protoplasts is described in Evans, et al., Handbook of Plant Cell Cultures, Vol. 1: (MacMillan Publishing Co., New
York, 1983); and Vasil L.R. (ed.), Cell Culture and Somatic Cell Genetics of
Plants, Acad. Press, Orlando, Vol. I, 1984, and Vol. III (1986), which are hereby incorporated by reference in their entirety.
[0061] It is known that practically all plants can be regenerated from cultured cells or tissues, including but not limited to, all major species of cotton, rice, wheat, barley, rye, sunflower, peanut, corn, potato, sweet potato, bean, pea, chicory, lettuce, endive, cabbage, cauliflower, broccoli, turnip, radish, spinach, onion, garlic, eggplant, pepper, celery, carrot, squash, pumpkin, zucchini, cucumber, apple, pear, melon, strawberry, grape, raspberry, pineapple, soybean, tobacco, tomato, sorghum, and sugarcane.
[0062] After the nucleic acid molecule of the present invention is stably incorporated in transgenic plants, it can be transferred to other plants by sexual crossing or by preparing cultivars. With respect to sexual crossing, any of a number of standard breeding techniques can be used depending upon the species to be crossed. Cultivars can be propagated in accord with common agricultural procedures known to those in the field. Alternatively, transgenic seeds are recovered from the transgenic plants. The seeds can then be planted in the soil and cultivated using conventional procedures to produce transgenic plants.
[0063] The present invention also relates to a method of regulating the cellulose content of a plant fiber involving transforming a plant with the DNA construct that contains the chitinase-encoding nucleic acid molecule of the present invention. Same approaches to transforming plant cells with the nucleic acid molecule of the present invention mentioned above could be used. The DNA construct of the present invention can be utilized to modulate fiber development by regulating cellulose synthesis for a wide variety of fiber-producing plants such as cotton, corn, sugar cane, and rice stems that can be used in pulping, flax, hemp, ramie, jute, kenaf, kapok, coir, bamboo, spanish moss, abaca, and Agave spp. (e.g. sisal). The DNA construct is particularly well suited to modulating fiber development of cotton.
[0064] Several kinds of evidence suggest that chitinases are located in healthy plant organs, and one developmental role of a chitinase in embryogenesis has been well-characterized. A carrot mutant defective in somatic embryogenesis can be rescued by addition of an acidic, glycosylated, extracellular, chitinase (EP3) to the culture medium (de Jong et al., “ A Carrot Somatic Embryo Mutant is
Rescued by Chitinase,” Plant Cell, 4:425-433 (1992), which is hereby incorporated by reference in its entirety). The rescue could be duplicated by addition of lipochitin oligosaccharides (Schmidt et al., “ Signal Molecules
Involved in Plant Embryogenesis,” Plant Molecular Biology, 26:1305-1313 (1994), which is hereby incorporated by reference in its entirety) and by some but not all other chitinases (Kragh et al., “ Characterization of Chitinases Able to
Rescue Somatic Embryos of the Temperature-Sensitive Carrot Variant TS11,”
Plant Molecular Biology, 31:631-645 (1996), which is hereby incorporated by reference in its entirety). The EP3 gene was expressed in a small subset of cells of young fruits and mature seeds, suggesting that the chitinase acts to release chitin oligomers as developmental signals (possibly to reintiate cell division) for developing zygotic embryos (van Hengel, “ Expression Patterns of the Carrot EP3
Endochitinase Genes in Suspension Cultures and in Developing Seeds,” Plant
Physiology, 117:43-53 (1998), which is hereby incorporated by reference in its entirety). Chitinase gene expression has also been associated with somatic embryogenesis in other species (Dong et al., “ Endochitinase and 8-1,3-Glucanase
Genes are Developmentally Regulated During Somatic Embryogenesis in Picea glauca,” Planta, 201:189-194 (1997), which is hereby incorporated by reference in its entirety). Arabinogalactan proteins (AGPs) are another class of molecules required for somatic embryogenesis, and some carrot AGPs contain glucosamine and N-acetyl-D-glucosaminyl and are sensitive to cleavage by chitinases.
Pretreatment of AGPs with chitinase made them more active in promoting embryogenesis of carrot protoplasts, implying that embryo rescue by chitinase may be mediated by their hydrolytic action on AGPs (van Hengel et al., “N- Acetylglucosamine and Glucosamine-Containing Arabinogalactan Proteins
Control Somatic Embryogenesis,” Plant Physiology, 125:1880-1890 (2001), which is hereby incorporated by reference in its entirety). In this case, AGPs would be one endogenous substrate for chitinases. It has been found that an AGP- type protein accumulates during cotton fiber secondary wall deposition (John et al, “Characterization of mRNA for a Proline-Rich Protein of Cotton Fiber,” Plant
-08 -
Physiology, 108:669-676 (1995), which is hereby incorporated by reference in its entirety).
[0065] Chitinases have been associated with several other healthy plant tissues, including germinating seeds (Petruzzelli et al. “Distinct Ethylene- and
Tissue-Specific Regulation of B-1,3-Glucanases and Chitinases During Pea Seed
Germination,” Planta, 209:195-201 (1999), which is hereby incorporated by reference in its entirety). Chitinase gene expression is associated with formation of flowers de novo from tobacco cell explants (Neale et al., “ Chitinase, B-1,3-
Glucanase, Osmotin, and Extensin are Expressed in Tobacco Explants During
Flower Formation,” Plant Cell, 2:673-684 (1990), which is hereby incorporated by reference in its entirety). Chitinase enzyme activity has been found in healthy
Petunia flowers, being particularly high in the stigma after the anthers dehisce (Leung, “Involvement of Plant Chitinases in Sexual Reproduction of Higher
Plants,” Phytochemistry, 31:1899-1900 (1992), which is hereby incorporated by reference in its entirety). Similarly, a protein immunologically related to basic chitinase was identified in both the anthers and the upper portion of bean pistils (containing the stigma) (del Campillo et al., “ Occurrence of 9.5 Cellulase and
Other Hydrolases in Flower Reproductive Organs Undergoing Major Cell Wall
Disruption,” Plant Physiology, 99:1015-1020 (1992), which is hereby incorporated by reference in its entirety). In flowers, chitinase might havea developmental role or a defensive role in anticipation of possible fungal invasion of fragile tissues that are essential for reproductive success. Some proteins extracted from primary and secondary cell walls of various plant species in suspension culture and sequenced at their N-terminus have homology to chitinase sequences in the databases from French bean (P80800, P80808, P80792, P§2432) and tobacco (P80783, P8233) (Robertson et al., “ Differential Extraction and
Protein Sequencing Reveals Major Differences in Patterns of Primary Cell Wall
Proteins from Plants,” The Journal of Biological Chemistry, 272:15841-15848 (1997); Blee et al., “ Proteomic Analysis Reveals a Novel Set of Cell Wall
Proteins in a Transformed Tobacco Cell Culture That Synthesizes Secondary
Walls as Determined by Biochemical and Morphological Parameters,” Planta,
212:404-415 (2001), which are hereby incorporated by reference in their entirety).
However, since only short peptide sequences were available after N-terminal sequencing (maximum of eighteen amino acids), definite conclusions about the presence of authentic chitinases in these cell walls cannot be made.
[0066] Other than the N-acetyl-glucosamine-containing AGPs associated with embryo rescue (van Hengel et al., “ N-Acetylglucosamine and Glucosamine-
Containing Arabinogalactan Proteins Control Somatic Embryogenesis,” Plant
Physiology, 125:1880-1890 (2001), which is hereby incorporated by reference in its entirety), endogenous substrates of plant chitinases have not been characterized at the structural or functional levels. However, there is evidence that endogenous chitinase substrates of diverse molecular types exist in healthy plants. For example, a chitin-binding lectin, wheat germ agglutinin (WGA), or chitinase tagged with electron-dense colloidal gold labeled the vascular secondary cell walls very densely in healthy elm, tomato, eggplant, and potato plants. Adjacent primary walls or middle lamella regions were not labeled, which supports the specificity of the reaction (Benhamou et al., “ Attempted Localization of Substrate for Chitinases in Plant Cells Reveals Abundant N-Acetyl-D-Glucosamine
Residues in Secondary Walls,” Biologie Cellulaire, 67:341- 350 (1989), which is hereby incorporated by reference in its entirety). This labeling could not be abolished by pre-treatment with protease to digest protein or a microbial chitinase, but it was abolished by pretreatment with lipase to digest lipids. The absence of label after lipase treatment would appear to place these secondary wall molecules in a different class than the N-acetyl-glucosamine-containing AGPs that have been associated with embryo rescue. Rather, the data suggest that chitin oligomers exist within or in association with a lipid-containing molecule in secondary cell walls.
[0067] Molecules containing both chitin oligomers and lipid (a single fatty acyl group varying from C16:0 to C20:4)) are known in the form of lipochitin oligosaccharides (LCOs), which are synthesized and secreted by nodulating bacteria (Rhizobium) to induce the formation of the symbiotic root nodule by their plant host (Bakkers et al., “Function of Chitin Oligosaccharides in Plant and
Animal Development,” in Jolles, eds., Chitin and Chitinases, Birkhauser Verlag:
Basel, pp.71-84 (1999), which is hereby incorporated by reference in its entirety).
This indicates that plants have capacity to recognize such molecules supplied from an exogenous organism as developmental signals, in this case to initiate nodule formation. Furthermore, similar molecules may exist endogenously within plants.
Thin layer chromatography (TLC) of lipophilic compounds in extracts from
S flowers of the plant Lathyrus odoratus showed that they migrated similarly to
LCOs and that some of them were susceptible to chitinase digestion (Spaink et al., “Rhizobial Lipo-Oligosaccharide Signals and Their Role in Plant Morphogenesis:
Are Analogous Lipophilic Chitin Derivatives Produced by the Plant?,” Australian
Journal of Plant Physiology, 20:381-392 (1993), which is hereby incorporated by reference in its entirety).
[0068] Endogenous plant molecules similar to LCOs could contain growth-regulating chitin oligomers that are releasable by endogenous plant chitinases. The data on embryo rescue by chitinase already described provide one example. Also, tomato suspension cells respond to LCOs or chitin oligomers (such as might be released from more complex endogenous molecules by limited chitinase action) by transiently raising the pH of their culture medium (Staehelin et al., “Perception of Rhizobium Nodulation Factors by Tomato Cells and
Inactivation by Root Chitinases,” Proc. Nat’l. Acad. Sci. U.S.A., 91 12196-2200 (1994), which is hereby incorporated by reference in its entirety). Other plant responses associated with chitin oligomers include synthesis of anti-fungal phytoalexins, induction of chitinases, induction of K* and CI release, and H,0, synthesis (Gooday, “ Aggressive and Defensive Roles for Chitinases,” in Jolles, eds., Chitin and Chitinases. Birkhauser Verlag:Basel, pp. 157-170 (1999), which is hereby incorporated by reference in its entirety). Tobacco plants transformed to - over-express LCO-synthesizing genes (NodA and NodB, either separately or in combination) from Rhizobium had reduced growth and altered leaf shape (Schmidt et al., © Alteration of Plant Growth and Development by Rhizobium noda and
Nodb Genes Involved in the Synthesis of Oligosaccharide Signal Molecules,” The
Plant Journal, 4:651-658 (1993), which is hereby incorporated by reference in its entirety), suggesting that NodA and NodB can interfere with plant biosynthetic processes required for morphogenesis (Bakkers et al., “F unction of Chitin
Oligosaccharides in Plant and Animal Development,” in Jolles, eds., Chitin and
Chitinases, Birkh#user Verlag: Basel, pp.71-84 (1999), which is hereby incorporated by reference in its entirety). Such interference could occur at many levels. However, since both overall growth rate and normal plant organ morphogenesis depend heavily on cellulose synthesis, it is possible that NodA and
NodB interfere directly with cellulose synthesis. Perhaps NodA and NodB bind to and process inappropriately an endogenous N-acetyl-glucosamine-containing plant substrate, creating a non-functional analog of an endogenous molecule required for cellulose synthesis.
[0069] Conversely, tobacco plants transformed to over-express a maize acidic class I chitinase showed a positive correlation between chitinase activity and seedling dry weight (Patil et al., “Possible Correlation Between Increased
Vigour and Chitinase Activity Expression in Tobacco,” Journal of Experimental
Botany, 48:1943-1950 (1997), which is hereby incorporated by reference in its entirety), which has a large cellulose component. Although no mechanistic explanation was provided, it is possible that the foreign chitinase activity causes over-production of chitin oligomers that stimulate cellulose synthesis. Chitin oligomers could modulate cellulose synthesis either as developmental signals or as direct participants in the cellulose biosynthetic process. For example, oligomers of the N-acetylglucosamine-containing hyaluronan heteropolymer, (8-1,4-GlcA 8- 1,3-GlcNAC)y, interact with a particular receptor to activate Rho and Racl
GTPases, which lead to reorganization of the actin cytoskeleton (Lee et al., “Hyaluronan: A Multifunctional, Megadalton, Stealth Molecule,” Current
Opinion in Cell Biology, 12:581-586 (2000), which is hereby incorporated by reference in its entirety). Reorganization of the actin cytoskeleton occurs at the primary to secondary wall transition in cotton fibers to mediate the changed orientation of cellulose microfibrils (Seagull, “ Cytoskeletal Involvement in
Cotton Fiber Growth and Development,” Micron, 24:643-660 (1993), which is hereby incorporated by reference in its entirety). A Rac gene is expressed transiently in cotton fibers at the time of this reorganization and (Delmer et al., “Genes Encoding Small GTP-Binding Proteins Analogous to Mammalian Rac are
Preferentially Expressed in Developing Cotton Fibers,” Mol. Gen. Genet.,
248:43-51 (1995), which is hereby incorporated by reference in its entirety) and a related H,O, burst may also mediate this transition (Potikha et al., “ The
Involvement of Hydrogen Peroxide in the Differentiation of Secondary Walls in
Cotton Fibers,” Plant Physiology, 119: 849-858 (1999), which is hereby incorporated by reference in its entirety). However, the prolonged expression of the isolated nucleic acid molecule disclosed in the present invention throughout secondary wall deposition argues for a role beyond transient control of signal transduction cascades and cytoskeletal organization involving Rac and H,0, at the primary to secondary wall transition.
[0070] Other possibilities for the involvement of the isolated nucleic acid ~ molecule disclosed in the present invention in cotton fiber cellulose synthesis can be proposed by analogy with other systems. LCOs or similar molecules such as dolichol-(N-acetyl-glucosamine), could donate chitin-containing oligosaccharides to a protein as primers in a biosynthetic process (Spaink et al., “Rhizobial Lipo- Oligosaccharide Signals and Their Role in Plant Morphogenesis: Are Analogous
Lipophilic Chitin Derivatives Produced by the Plant?,” Australian Journal of Plant
Physiology, 20:381-392 (1993), which is hereby incorporated by reference in its entirety) as exemplified by chitin biosynthesis in insects (Palli et al., “Molecular and Biochemical Aspects of Chitin Synthesis Inhibition,” in Jolles, eds., Chitin and Chitinases, Birkhiuser Verlag:Basel, pp. 85-98 (1999), which is hereby incorporated by reference in its entirety). It has been noted that little attention has been paid to the fact that two fungal chitinases and egg lysozyme act as catalysts in transglycosylation reactions (Collinge et al., “Plant Chitinases,” Plant J., 3:31- 40 (1993), which is hereby incorporated by reference in its entirety). Arabidopsis cyt] mutants lack sufficient mannose-1-phosphate guanyltransferase activity, and consequently they are deficient in production of GDP-mannose as required for N- glycosylation of proteins. They also exhibit 5-fold reduction in cellulose content and cannot proceed through normal embryo development (Lukowitz et al., “ Arabidopsis cyt] Mutants are Deficient in a Mannose-1-Phosphate
Guanyltransferase and Point to a Requirement of N-Linked Glycosylation for
Cellulose Biosynthesis,” Proc. Nat’l. Acad. Sci. U.S.A., 98:2262-2267 (2001),
a. -33- which is hereby incorporated by reference in its entirety). Since the N- glycosylation inhibitor, tunicamycin, also causes cellulose-deficiency, these authors suggest that an N-glycosylated peptide might act as a primer for cellulose synthesis, which is a resurrection of an old and much-debated hypothesis that cellulose synthesis does require a primer (Maclachlan, “Does B-Glucan Synthesis
Need A Primer,” in Brown, Jr., ed., Cellulose and Other Natural Polymer
Systems: Biogenesis, Structure, and Degradation, Plenum Press:NY, pp. 327 —- 339 (1982), which is hereby incorporated by reference in its entirety).
[0071] Another aspect of the present invention relates to an isolated DNA promoter suitable for inducing expression of a protein encoded by a second DNA operably associated with the DNA promoter. The DNA promoter is isolated from cotton and drives expression preferentially in fibers during secondary wall deposition. Typically, the fiber is cotton fiber. The isolated DNA promoter of the present invention can be used to drive the expression of heterologous proteins only or preferentially in fibers during secondary wall deposition. This is especially important if the proteins might have adverse pleiotropic effects if expressed strongly at other stages or in other tissues. This promoter should be similarly useful to others since many critical fiber properties are determined at the secondary wall stage of development and the massive secondary wall represents a potential “storage” point for novel fiber components, including enzymes or structural molecules.
[0072] Gene regulation and expression is a complex interaction of intracellular and extracellular factors. Arabidopsis thaliana, with a genome size of 145 Mb, contains about 25,000 genes (Ausubel, “Arabidopsis Genome: A
Milestone in Plant Biology,” Plant Physiology, 124:1451-1454 (2000), which is hereby incorporated by reference in its entirety). These genes must be expressed in perfect coordination in order to have organized growth and proper responses to the environment. This is achieved by differential gene expression, in which the plant is able to turn different genes on and off depending on the stage of development, the type of tissue, and specific inducers from the environment.
[0073] Plant cells have several mechanisms to control gene expression, and they can be exerted at transcriptional, post-transcriptional, translational, and post-translational levels. However, much of the differential expression can be explained at the transcriptional level when the RNA polymerase II interacts with the DNA and multiple protein factors to initiate the synthesis of mRNA (Roeder, “The Role of Initiation Factors in Transcription by RNA Polymerase II,” Trends in Biochemical Science, 21:327-335 (1996), which is hereby incorporated by reference in its entirety). The region of DNA involved in this pre-transcriptional interaction is called the “promoter.” Promoters are usually located next to the 5° end of the coding region of a gene.
[0074] By sequencing, comparing, and modifying plant promoters, it has been possible to identify functional components in their DNA sequence. All known promoters are made of two general components: the core region and the regulatory region (Komberg, “RNA Polymerase II Transcription Control,” Trends in Biochemical Science, 21:325-326 (1996), which is hereby incorporated by reference in its entirety).
[0075] The core region is located immediately upstream of the 5° end of the coding region and is essential for the transcription process; however, in quantitative terms it is only responsible for a small percentage of the total gene expression. The core region is about 100 bp long and comprises a TATA box and the transcription start site. The TATA box is a sequence of approximately 13 bp, rich in thymidine and adenine residues, with a consensus
TC/GTATAT/AA,5C/TA. The TATA box is present in most, but not all, promoters of genes encoding proteins (Roeder, “The Role of Initiation Factors in
Transcription by RNA Polymerase II,” Trends in Biochemical Science, 21:327- 335 (1996), which is hereby incorporated by reference in its entirety). This is the site of direct interaction with the RNA polymerase II (RNA Pol II) and with ‘universal transcription factors (TAFs), which are a necessary part of the transcription complex (Verrijzer et al., “TAFs Mediated Transcriptional
Activation and Promoter Selectivity,” Trends in Biochemical Science, 21:338-342 (1996), which is hereby incorporated by reference in its entirety). General factors are proteins present in all cells and are very conserved from yeast to man (Guarente et al., “Conservation and Evolution of Transcriptional Mechanisms in
Eukaryotes,” Trends in Genetics, 8:27-32 (1992), which is hereby incorporated by reference in its entirety).
[0076] The regulatory region is located further upstream from the core region and can be as long as 2 kb or even more. This region is responsible for the control of gene expression either suppressing or enhancing the activity of the
RNA polymerase II. The regulatory region is composed of several “boxes” or elements that vary in size from 10 to 300 bp. These elements are the binding sites for specific proteins that are involved in the modulation of differential expression of genes and confer cell-specific or gene-specific expression. Proteins at this level interact with TFIID, increasing its stability in promoter binding, enhancing transcription. The presence of multiple elements and their corresponding factors produces a synergistic effect in transcription.
[0077] The most dynamic part of the promoter system is the interaction of the protein factors with the DNA and with the other proteins in the complex. For these interactions, proteins must contain structural domains that recognize specific surface characteristics of the minor or major grooves and the sugar-phosphate backbone of the DNA (Travers, “DNA-Protein Interactions,” St. Edmundsbury
Press, Bury St. Edmunds, Great Britain (1993) which is hereby incorporated by reference in its entirety). The most common domains associated with this function are the helix-turn-helix (HTH) motif, the Zn-binding domain or Zinc fingers, and the Leucine zipper coiled coil (b-ZIP) (Brunelle et al., “Transcription
Regulatory Proteins in Higher Plants,” Current Opinions in Genetics and
Development, 3:254-258 (1993), which is hereby incorporated by reference in its entirety). Not all transcription regulators bind to DNA. Protein to protein interactions are responsible for the formation of heterodimers or homodimers, which in turn function as positive regulators, or as negative regulators, avoiding formation of active dimers. Synthesis or activation of these factors is induced by particular stimuli and, in some cases, involve phosphorylation cascades (Brunelle et al., “Transcription Regulatory Proteins in Higher Plants,” Current Opinions in
Genetics and Development, 3:254-258 (1993), which is hereby incorporated by reference in its entirety).
[0078] In the current mode! for transcription initiation, TBP binds to the
TATA box through the minor groove of the DNA helix. TFIIA stabilizes the binding that can be debilitated by altered ionic conditions or mutations in the
DNA binding element. TFIIB binds to TBP and orientates its amino terminal domain toward the downstream initiation site. This amino terminal sequence is not conserved among different species which suggests different regulatory pathways (Roeder, “The Role of Initiation Factors in Transcription by RNA polymerase II,” Trends in Biochemical Science, 21 :327-335 (1996), which is hereby incorporated by reference in its entirety). Also, plants like Arabidopsis can contain two different TBPs (Gasch et al., “Arabidopsis Thaliana Contains Two
Genes for TFIID,” Nature, 346:390-394 (1990), which is hereby incorporated by reference in its entirety).
[0079] At the same time as TBP binds to the TATA box, TFIIF binds to
RNA polymerase II to create a complex that then binds to the amino terminal domain of TFIIB, covering a promoter area of about 40 bp. Finally, TFIIE and
TFIIH bind to the complex just upstream of the start site to induce promoter melting (opening of the double strand) and continue with transcription and elongation (Roeder, “The Role of Initiation Factors in Transcription by RNA
Polymerase II,” Trends in Biochemical Science, 21:327-335 (1996), which is hereby incorporated by reference). :
[0080] One suitable DNA promoter molecule in accordance with the present invention has a nucleotide sequence of SEQ. ID. No. 3 as follows:
ATG AAA CAT CTT CGT ACT CAT ATC TGA AAC TCC AGC TTC TTG ATC CTC
AAT GAT AAT TAA ATC CTC ACT ATC ACT CGC ATT CAC CTC GAG CAG CTT
CGC AAA TTG AAA TGT TTC CTT AGC TTC CTT CAC TAT ACT TGC GAT TCC
CAA TGA CAG AGT CAG TAA GGG AAC CAT TAA CAA TAC GAT CAT CCG TTC
TTT GCT TCT TCA CCA GAC ACC ACA CCT TTA GAT ATG ATT GGT TTT CTA
CCT CTA CGT TTT TGC TTC TTT TTT TTT TTT AAC CAA AGT CAT CAC TTT
TTC TTC AAT CTC TGC CAA TGA TCT CAC CTT CTT CTT CAC ACC ATC AAC
AGT AAT TAT CGT CGA ATA GGG ATT ATG CAC TAC AGT GTT TTG CAT TGC
TAC TCC CAT GGA GTC CTC CAC CCT AAC TCT ACT TGT AGG ACT CCT AAC
TAA CGA ATT GCA AAG GGT TTC GCG ACC CGA ATT GTT CCC TTT CTG ACA
ACC CAA GTC CAC TTA GGT TCA ATC ATA TTT AAA TTC GTA TCA ACA ATC
TCC TCA GCC GAC CAA TTC ACA GCT TTC AAA TCT GCT CCG CAA CCC ACC
ATT TGA TCG TGA CCA AAG TGT GAA CTT GCC TTC AAC AAA TCA GGC CCA
GAG CCT CGT TCT AAT CAT TTC TCG AGG CAA TAG CAA TAG TTG GGT CTA
AGT TCT CTG CTA ATT CCT TTG ATT TCC TAG AAC CTC TCG AGC TGC CAT
ATT GGG TTT TTC ACT ACC CAC CTC TTC ATT AAA TGT ATC TTC AAC CTC
TCA ACT CCT TTC ACC ACC AGA CGA ATC TTC TTT AGC AAA ATC AAA ATG
} ACC TTA TGA ARA TTT AGC ACG TCC ACC TCC AGA TTC AAA GGC TGT GAA
TCC CCA ACT TCG GAA ATT GTT CAT CTC CAC ATT CAA GAA TAA TGA GTT
CCT CAA TTT GTT TTA ACT GAT TAG CCG ATA TTA AGC GAG TTA GAC TCC
ATG GAA ATA AAA TCA CCC TAA TAA ATA GCA ACG CTT TTG AAC GTC TCT
AGG TTC CAA GCG TG v
[0081] - The isolated DNA promoter of the present invention can drive expression of operatively coupled DNA molecules in cotton fibers starting at the beginning of secondary wall deposition, usually 14 to 17 DPA, preferably : extending through to the termination of secondary wall deposition. Most preferably, the isolated DNA promoter of the present invention drives expression of operatively coupled DNA molecule in cotton fibers beginning at 14 to 17 DPA up to 31 DPA.
[0082] In a preferred form of the present invention, the isolated DNA promoter of the invention is in a DNA construct comprising the isolated DNA promoter, a second DNA encoding a protein or polypeptide. The DNA promoter is operably linked 5’ to the second DNA to induce transcription of the second
DNA. A 3’ regulatory region is operably linked to the second DNA.
[0083] One form of protein-encoding DNA suitable for use in the DNA construct of the present invention is the isolated nucleic acid molecule of the invention, preferably, the nucleic acid molecule comprising a nucleotide sequence which hybridizes to a DNA molecule having a sequence according to SEQ. ID.
No. 1 under stringent conditions characterized by a hybridization buffer comprising 1 x SSC at a temperature of 61°C, having a nucleotide sequence of
SEQ.ID.No.1,o0r encoding a protein or polypeptide having an amino acid sequence of SEQ. ID. No. 2.
[0084] Protein-encoding DNA suitable for use in the present invention includes DNA which has been amplified, chemically altered, or otherwise modified. Modification of such protein-encoding DNAs may occur, for example, by treating the DNA with a restriction enzyme to generate a DNA fragment which is capable of being operably linked to the promoter. Modification can also occur by techniques such as site-directed mutagenesis. :
[0085] The protein-encoding DNA also includes DNA that is completely synthetic, semi-synthetic, or biologically derived, such as DNA derived by reverse transcription from RNA. Such DNA includes, but is not limited to, non-plant genes such as those from bacteria, yeasts, animals, or viruses; modified genes, portions of genes, chimeric genes, as well as DNA that encodes for amino acids that are chemical precursors or biologics of commercial value, such as polymers or biopolymers (Pool et al., “In Search of the Plastic Potato,” Science, 245:1187- 1189 (1989), which is hereby incorporated by reference in its entirety). Suitable
DNA is any DNA for which expression is beneficial to the transgenic plant or for which it is otherwise beneficial to have the DNA expressed under control of a
DNA promoter that drives expression preferentially during the secondary wall stage of fiber development. :
[0086] Examples of other protein-encoding DNA molecules that could be expressed in the present invention include, but are not limited to, homologous and heterologous cellulose synthases (CesA4 genes), both in normal and mutated form (Arioli et al., “Molecular Analysis of Cellulose Biosynthesis in Arabidopsis,”
Science, 279:717-720 (1998); Holland et al., “A Comparative Analysis of the
Plant Cellulose Synthase (CesA) Gene Family,” Plant Physiol., 123:1313-1324 (2000), which are hereby incorporated by reference in their entirety); genes that may modulate carbon partitioning to cellulose (Delmer, “Cellulose Biosynthesis in
Developing Cotton Fibers” in: A.S. Basra (ed.), Cotton Fibers: Developmental
Biology. Quality Improvement, and Textile Processing, The Haworth Press, New
York, pp. 85-112 (1999), which is hereby incorporated by reference in its entirety) such as sucrose synthase (Amor et al., “A Membrane-Associated Form of Sucrose
Synthase and Its Potential Role Synthesis of Cellulose and Callose in Plants,”
Proc. Natl. Acad. Sci. USA, 92:9353-9357 (1995), which is hereby incorporated by reference in its entirety), sucrose phosphate synthase (Haigler et al., “Transgenic Cotton Over-Expressing Sucrose Phosphate Synthase Produces
Higher Quality Fibers with Increased Cellulose Content and Has Enhanced Seed
Cotton Yield” Abstract 477. In: Proceedings of Plant Biology 2000, July 15 - 19,
San Diego, CA. American Society of Plant Physiologists, Rockville, MD, (2000), whichis hereby incorporated by reference in its entirety), UDPG- pyrophosphorylase (Waffler and Meier, “Enzyme Activities in Developing Cotton
Fibers,” Plant Physiol. Biochem. 32:697-702 (1994), which is hereby incorporated by reference in its entirety), inorganic pyrophosphosphatase (Geigenberger et al.,
“Overexpression of Pyrophosphatase Leads to Increased Sucrose Degradation and
Starch Synthesis, Increased Activities of Enzymes for Sucrose-Starch
Interconversions, and Increased Levels of Nucleotides in Growing Potato Tubers,”
Planta, 205:428-437(1998), which is hereby incorporated by reference in its entirety), hexokinases (Smeekens, “Sugar Regulation of Gene Expression,” Curr.
Op. Plant Biol., 1:230-234(1998), which is hereby incorporated by reference in its entirety), and invertases (Sturm and Tang, “The Sucrose-Cleaving Enzymes of
Plants are Crucial for Development, Growth, and Carbon Partitioning,” Trends
Plant Sci., 4:401-407 (1999), which is hereby incorporated by reference in its entirety); genes that might affect the molecular and biophysical properties of cellulose including degree of polymerization, degree of crystallinity, crystallite : size, and microfibril orientation (i.e. genes for encoding proteins, including co- crystallizing protein polymers or cellulose binding domains, and polysaccharide- synthesizing and other enzymes) (Delmer, “Cellulose Biosynthesis: Exciting
Times for a Difficult Field of Study,” Ann. Rev. Plant Physiol. Mol. Biol. 50:245- 276 (1999); Delmer, “Cellulose Biosynthesis in Developing Cotton Fibers. In:
A.S. Basra (ed.), Cotton Fibers: Developmental Biology, Quality Improvement, and Textile Processing, The Haworth Press, New York, pp. 85—112 (1999);
Hsieh, “Structural Development of Cotton Fibers. In: A.S. Basra (ed.), Cotton
Fibers: Developmental Biology, Quality Improvement, and Textile Processing,
The Haworth Press, New York, pp. 137-166 (1999), which are hereby incorporated by reference in their entirety); transcription factors such as MYB : genes that could prolong elongation growth and/or change the timing or extent of secondary wall deposition (Wilkins and Jernstedt, “Molecular Genetics of
Developing Cotton Fibers. In: A.S. Basra (ed.), Cotton Fibers: Developmental
Biology. Quality Improvement. and Textile Processing, The Haworth Press, New
York, pp. 231-270 (1999), which is hereby incorporated by reference in its entirety); genes to effect the synthesis of plant hormones and change fiber properties (John, “Genetic Engineering Strategies for Cotton Fiber Modification.
In: A.S. Basra (ed.), Cotton Fibers: Developmental Biology. Quality
Improvement, and Textile Processing, The Haworth Press, New York, pp. 271 - 289 (1999), which is hereby incorporated by reference in its entirety); genes for cytoskeletal elements or cytoskeletal-associated proteins that might affect fiber properties (Seagull, “Cytoskeletal Involvement in Cotton Fiber Growth and
Development,” Micron, 24:643-660 (1993), which is hereby incorporated by reference in its entirety); genes for lipid synthesizing or modifying enzymes that might change membrane properties and thereby improve fiber quality, including under stressful environmental conditions (Haigler, “The Crystallinity of Cotton
Cellulose in Relation to Cotton Improvement,” Proc. Cotton Fiber Cellulose:
Structure, Function, and Utilization Conference, National Cotton Council of
America: Memphis, TN., p. 211-225 (1992), which is hereby incorporated by : reference in its entirety); enzymes such as xyloglucan endotransferase, peroxidase, expansin, or vacuolar ATPase that might, through increased or decreased activity, prolong or increase extension growth during secondary wall deposition (Wilkins and Jernstedt, “Molecular Genetics of Developing Cotton Fibers. In: A.S. Basra (ed.), Cotton Fibers: Developmental Biology, Quality Improvement, and Textile
Processing, The Haworth Press, New York, pp. 231-270 (1999), which is hereby incorporated by reference in its entirety); genes for protein or plastic polymers that might be retained in the fiber lumen or integrated into the cell wall to increase fiber strength or change its textile properties (John, “Genetic Engineering
Strategies for Cotton Fiber Modification,” In: A.S. Basra (ed.), Cotton Fibers:
Developmental Biology, Quality Improvement, and Textile Processing, The
Haworth Press, New York, pp. 271 — 289 (1999); Guda et al., “Hyperexpression of an Environmentally Friendly Synthetic Polymer Gene,” Biotechnology Letters, 17:745-750 (1995), which are hereby incorporated by reference in their entirety); genes for plant cell wall matrix biosynthetic enzymes or their regulatory proteins so that other carbohydrates could be integrated into the cell wall and change fiber properties (Haigler, “The Relationship Between Polymerization and
Crystallization in Cellulose Biogenesis,” in C. H. Haigler and P. Weimer, eds.,
Biosynthesis and Biodegradation of Cellulose, New York: Marcel Dekker, pp. 99-124 (1991); Andrawis et al., “Cotton Fiber Annexins: A Potential Role in the
Regulation of Callose Synthase,” Plant J., 3: 763-772 (1993), which are hereby incorporated by reference in their entirety); genes for molecules such as tannins, suberins, or dyes that might confer valuable color to fibers (Ryser, “Cotton Fiber
Initiation and Histodifferentiation,” In: A.S. Basra (ed.), Cotton Fibers:
Developmental Biology. Quality Improvement. and Textile Processing, The
Haworth Press, New York, pp. 1-46 (1999), which is hereby incorporated by reference in its entirety); genes for molecules such as cutin, suberin, or wax that might change the absorptivity and strength of cotton fibers (May, “Genetic
Variation in Fiber Quality,” In: A.S. Basra (ed.), Cotton Fibers: Developmental
Biology, Quality Improvement. and Textile Processing, The Haworth Press, New
York, pp. 183-230 (1999); Ryser, “Cotton Fiber Initiation and
Histodifferentiation,” In: A.S. Basra (ed.), Cotton Fibers: Developmental Biology,
Quality Improvement. and Textile Processing, The Haworth Press, New York, pp. 1—46 (1999), which are hereby incorporated by reference in their entirety); and genes for signal transduction molecules such as Rac that may regulate shifts between fiber developmental stages (Delmer et al., “Genes Encoding Small GTP-
Binding Proteins Analogous to Mammalian rac are Preferentially Expressed in
Developing Cotton Fibers,” Mol. Gen. Genet., 248: 43-51 (1995), which is hereby incorporated by reference in its entirety).
[0087] The DNA construct of the present invention also includes an operable 3’ regulatory region, selected from among those which are capable of providing correct transcription termination and polyadenylation of mRNA for expression in plant cells, operably linked to the a DNA molecule which encodes for a protein of choice. A number of 3° regulatory regions are known to be operable in plants. Exemplary 3’ regulatory regions include, without limitation, the nopaline synthase 3’ regulatory region (Fraley, et al., “Expression of Bacterial -
Genes in Plant Cells,” Proc. Natl Acad. Sci. USA, 80:4803-4807 (1983), which is hereby incorporated by reference in its entirety) and the cauliflower mosaic virus 3’ regulatory region (Odell, et al., “Identification of DNA Sequences Required for
Activity of the Cauliflower Mosaic Virus 35S Promoter,” Nature, 313(6005):810- 812 (1985), which is hereby incorporated by reference in its entirety). . Virtually any 3’ regulatory region known to be operable in plants would suffice for proper expression of the coding sequence of the DNA construct of the present invention.
[0088] The protein-encoding DNA molecule, the promoter of the present invention, and a 3’ regulatory region can be ligated together using well known molecular cloning techniques as described in Sambrook et al., Molecular Cloning:
A Laboratory Manual, Second Edition, Cold Spring Harbor Press, NY (1989), which is hereby incorporated by reference in its entirety.
[0089] In another embodiment, the present invention is an expression system that includes a suitable vector containing the above DNA construct of the invention. The present invention also includes host cells which include the DNA construct of the invention described above, transgenic plants and seeds produced by transformation with the DNA construct.
[0090] The present invention also relates to a method of expressing a gene preferentially in fiber during secondary wall deposition in a plant involving transforming a plant with the DNA construct containing the isolated DNA promoter of the present invention. The DNA construct of the present invention can be utilized to express a gene during the secondary wall deposition in a wide variety of fiber-producing plants such as cotton, corn, sugar cane, and rice stems that can be used in pulping, flax, hemp, ramie, jute, kenaf, kapok, coir, bamboo, spanish moss, abaca, and Agave spp. (e.g. sisal). The DNA construct is particularly well suited to expressing a gene during the secondary wall deposition in cotton. Basically, this method is carried out by transforming a plant cell with a
DNA construct of the present invention, as described above, under conditions effective to yield transcription of the DNA molecule in response to the promoter.
Methods of transformation may result in transient or stable expression of the DNA under control of the promoter. Preferably, the DNA construct of the present invention is stably inserted into the genome of the recombinant plant cell as a , result of the transformation, although transient expression can serve an important purpose, particularly when the plant under investigation is slow-growing. [0091}) The gene fusion system that generates chimeric molecules is a very powerful tool to study promoter activity. However, although many transformation and regeneration protocols have been developed for plants, it still takes at least : 3 months (in the case of tobacco) or as long as 6-12 months (in the case of cotton) to obtain stable transformant plants that can be evaluated. Even then, more time is required to evaluate expression in tissues like flowers or fruits. As an alternative methodology, transient expression in tissue or protoplasts offers a fast and often reliable way to generate information before proceeding with stable transformation.
In addition, this method circumvents possible negative “position effects” due to the insertion of the introduced DNA into non-expressing regions of the chromosome.
[0092] The following examples are provided to illustrate embodiments of the present invention but are by no means intended to limit its scope.
Example 1 — Identification of F285, a cDNA Clone Preferentially Expressed in Fibers During Secondary Wall Deposition
[0093] By differential display comparing 12 and 18 DPA cotton fibers (as well as stripped ovules and fibers at several other ages), a cDNA fragment (F285) that appeared to be preferentially expressed in fibers during secondary wall deposition was identified (Figure 1). In the differential display procedure, d(T)2-
GA was used as the anchored primer and GTCCTGGGTT as the random 10-mer.
After cloning and partial sequencing, the cDNA fragment was found to be homologous to known chitinases as described later.
Example 2 — Expression of F285 in Fibers During Secondary Wall Deposition
[0094] Northern blot analysis (overnight exposure to film) of cotton tissues indicated that the gene F285 is expressed in greenhouse-grown fibers only at the secondary wall stage at 18, 24, and 27 DPA (Figure 2). There was no evidence of expression in fibers during primary wall deposition at 8 DPA, or in leaves, stems, roots, or ovules stripped of fiber at 8, 18, and 24 DPA. (The data from stripped ovules at 8 and 18 DPA was not as good because of the lower level of RNA loading. However, any strong expression similar to that shown for 18, 24, and 27 DPA fiber would have been apparent even with the lower loading.)
[0095] More detailed temporal analysis indicated that expression in greenhouse-grown fiber had not begun by 12 DPA, but was strong by 15 DPA and : remained strong through 31 DPA (Figure 3). Therefore, the transcription of F285 is initiated at 13-15 DPA, which is near the onset of secondary wall deposition in cotton fiber when cotton plants are grown under greenhouse conditions (approximately 32°C day/22°C night).
Example 3 - Sequencing of F285 and Comparison of its Translated Amino
Acid Sequence to Other Proteins
[0096] PCR screening of a cDNA library from 21 DPA Acala-SJ2 cotton fibers (kindly provided by Dr. Deborah P. Delmer and The Hebrew University of
Jerusalem) identified 3 similar length clones. Complete and repeated sequencing of these resolved them to one full-length sequence with 957 nucleotides and one open reading frame. The deduced amino acid sequence of 318 residues has a predicted pl of 7.98 and a predicted molecular weight of 35,246 Da. The translated protein has a diverse mix of amino acids, a predicted N-terminal signal sequence, and sites for post-translational modification by: N-glycosylation, phosphorylation by four different types of protein kinases; amidation; and N- myristoylation. The F285 protein has a mix of hydrophilic and hydrophobic regions, extensive regions of alpha helix, extended strand, and random coil, and : no predicted transmembrane alpha helices.
[0097] BLASTX searches that translated the F285 nucleotide sequence in all possible reading frames and checked for homology with other amino acid sequences showed homology with numerous chitinases. The most recent
BLASTX search (4/9/01) confirmed that there are only two close homologs of © 20 F285 that were discovered through sequencing of the Arabidopsis thaliana genome, one on chromosome 3 (BAA94976.1) and one on chromosome 1 (AAF29391.1). Hereafter, these are referred to as the Arabidopsis homologs of
F285. The next closest match was to a chitinase from Arabis microphylla (AAF69789.1) (Bishop et al., “Rapid Evolution in Plant Chitinases: Molecular
Targets of Selection in Plant-Pathogen Coevolution, Proc. Nat’l. Acad. Sci.
U.S.A., 97:5322-5327 (2000), which is hereby incorporated by reference in its entirety). The BLAST search also confirmed that F285 was similar to but distinct from full-length or nearly full-length cotton chitinases (Q39799, Q39785,
AAD11255, and $72528, where the first three sequences listed are very closely related) in the databases (see TABLE I). A BLASTP search with the F285 translated amino acid sequence did not reveal any additional highly similar sequences, except that another Arabis sequence closely related to AAF69789.1 (Bishop et al., “Rapid Evolution in Plant Chitinases: Molecular Targets of
Selection in Plant-Pathogen Coevolution, Proc. Nat'l. Acad, Sci. U.S.A., 97:5322-
5327 (2000), which is hereby incorporated by reference in its entirety) was placed as the third highest match.
[0098] The amino acid sequences of BAA94976.1, AAF69789.1, and
Q39799 were subjected individually to CLUSTAL W multiple sequence alignment with the F285 amino acid sequence to compare the identity, similarity, or difference of amino acids at each position (TABLE 1). F285 is much more similar to its Arabidopsis homolog (BLAST score 542; 76.28% identical amino acids) than to the chitinase from Arabis (BLAST score 212; 35.22% identical amino acids) or cotton (BLAST score 196; 31.66% identical amino acids). Since the genus Arabis contains the nearest relatives of Arabidopsis thaliana (Bishop et al., “Rapid Evolution in Plant Chitinases: Molecular Targets of Selection in Plant-
Pathogen Coevolution, Proc. Nat’l. Acad. Sci. U.S.A., 97:5322-5327 (2000), which is hereby incorporated by reference in its entirety), the comparative distance between these four sequences is the first indication that F285 and its
Arabidopsis homolog represent a new type of chitinase-related protein.
TABLE 1
Results from CLUSTAL W multiple sequence alignment and BLASTX data
CLUSTAL W amino acid comparisons BLASTX data
Strongly ~~ Weakly
F285 (318 aa) compared to: Identical Similar Similar Different Score E
Best Match, .
Arabidopsis/BAA94976.1 (333 aa) 76.28% 9.91% 3.60% 10.21% 542 e-153
Closest other genus,
Arabis microphyllal/
AAF69789.1 (299 aa; partial sequence) 35.22% 19.18% 11.01% 34.59% 212 6e-54
Closest cotton, :
Gossypium hirsutum/Q39799 (338 aa) 31.66% 20.12% 11.54% 36.69% 196 4e-49
[0099] F285 has homology with chitinases in regions corresponding to the active site (within 0.6 nm of bound substrate; Brameld et al., “The Role of
Enzyme Distortion in the Single Displacement Mechanism of Family 19
Chitinases,” Proc. Nat'l. Acad. Sci. U.S.A.,95:4276-4281 (1998), which is hereby incorporated by reference in its entirety), including at a site (near NYNY) that is important for chitin binding in many chitinases (Verburg et al., “Identification of an Essential Tyrosine Residue in the Catalytic Site of a Chitinase Isolated From
Zea mays That is Selectively Modified During Inactivation With 1-ethyl-3-(3- dimethylaminopropyl)-carbodiimide,” J. Biol. Chem., 267:3886-3893 (1992);
Hamel et al., “ Structural and Evolutionary Relationships Among Chitinases of
Flowering Plants,” J. Mol. Evol., 44:614-624 (1997); Bishop et al., “Rapid
Evolution in Plant Chitinases: Molecular Targets of Selection in Plant-Pathogen
Coevolution, Proc. Nat'l. Acad. Sci. U.S.A., 97:5322-5327 (2000), which are hereby incorporated by reference in their entirety; TABLE 2). Chitinisa structural polysaccharide, a homopolymer of B-1,4-linked N-acetyl glucosamine, that is found in the exoskeletons of insects and the cell wall of fungi (Hamel et al, “Structural and Evolutionary Relationships Among Chitinases of Flowering
Plants,” J. Mol. Evol., 44:614-624 (1997), which is hereby incorporated by reference in its entirety). However, here ‘chitin binding’ refers to binding of the enzyme with the short stretches (probably 3 — 6 sugars) of N-acetyl-glucosamine residues that interact with the enzyme during chitin hydrolysis (Robertus et al., “The Structure and Action of Chitinases,” in Jolles, eds., Chitin and Chitinases,
Birkhduser Verlag:Basel, pp. 125-136 (1999), which is hereby incorporated by reference in its entirety). Therefore, an enzyme with similar active site topology could bind with N-acetyl-glucosamine oligomers found in other molecules or in isolation. Also, it could interact with other molecules containing N-acetyl- glucosamine within heteropolymers or glycoproteins. As an example, some chitinases have lysozyme activity (Sahai et al., “ Chitinases of Fungi and Plants:
Their Involvement in Morphogenesis and Host-Parasite Interaction,” FEMS
Microbiol. Rev., 11:317-338 (1993), which is hereby incorporated by reference in its entirety), meaning the ability to degrade bacterial peptidoglycan, which contains a heteropolymer of N-acetylglucosamine and N-acetylmuramic acid.
TABLE 2
Comparison between F285 and other related sequences 159 217
F285 TYPCTPGVSYHGRGALPIYWNYNYGETGDALKVDLLNHPEYIENNATLAFQAALWRWMT
Coml .. iii ities eter eneeteetecernertieeet ee iiiiieeeatornns (SEQ. ID. No. 4)
Com2 .+..+..KR.+...++Q+S......LC.R.+G.... cH FLA +E 4..+.F... (SEQ. ID. No. 5)
Com3 +...+..K+.+...+40+S......4+C.R.4+..... +. +L+++++. ++. ++.+.F... (SEQ. ID. No. 6) * kk * ’ Coml: Comparison between F285 (amino acid number 159-217 of SEQ. ID. No. 2) and its closest
Arabidopsis thaliana homolog (BAA94976; SEQ. ID. No. 4), which it matches best among similar proteins revealed by BLASTX search.
Com2: Comparison between F285 and an Arabis microphylla chitinase (AAF69789; SEQ. ID.
No. 5). This is the closest match found in a species other than Arabidopsis and the third best match revealed by BLASTX search.
Com3: Comparison between F285 and the Gossypium hirsutum (cotton) chitinase (Q39799; SEQ.
ID. No. 6), which it matches best among all cotton chitinases revealed by BLASTX search. This is the thirty seventh best match revealed.
Symbols: . dot (.): sites of identical amino acids between sequences : plus (+): sites of substitution of weakly or strongly similar amino acids letters in Com1 — Com3: single letter codes for dissimilar amino acids substituted at that position, which defines a ‘different’ substitution—see TABLE 3. underlines in Com3: regions in the active site of authentic chitinases asterisks (*) in Com3: residues proven by mutagenesis to be critical for function in authentic chitinases (Verburg et al., “Identification of an Essential Tyrosine
Residue in the Catalytic Site of a Chitinase Isolated From Zea mays That is
Selectively Modified During Inactivation With 1-ethyl-3-(3- dimethylaminopropyl)-carbodiimide,” J. Biol. Chem., 267:3886-3893 (1992);
Bishop et al., “Rapid Evolution in Plant Chitinases: Molecular Targets of
Selection in Plant-Pathogen Coevolution, Proc. Nat’]l. Acad. Sci. U.S.A, 97:5322-5327 (2000), which are hereby incorporated by reference in their entirety) 40
[0100] The Arabis protein listed in TABLES 1 and 2 is homologous to
Arabidopsis class I chitinase, which has proven chitinolytic activity and defensive activity against fungi (Bishop et al., “Rapid Evolution in Plant Chitinases:
Molecular Targets of Selection in Plant-Pathogen Coevolution, Proc, Nat’l. Acad. 45 Sci. U.S.A., 97:5322-5327 (2000), which is hereby incorporated by reference in its entirety). However, no function has been proven for F285 or its Arabidopsis homologs. After appearing in the database as part of the completely-sequenced
Arabidopsis genome, the Arabidopsis homologs of F285 were categorized with chitinases in Family 19 of glycosyl hydrolases (CAZy, Carbohydrate-Active 50 Enzymes; http://afmb.cnrs-mrs.fr/~pedro/CAZY/db.html). Enzymes in Family 19 configuration (Henrissat, “Classification of Chitinase Modules,” in Jolles, eds.,
Chitin and Chitinases, Basel:Birkhaiiser Verlag, pp. 137-156 (1999), which is hereby incorporated by reference in its entirety). However, in the context of overall similarity to chitinases, specific differences in functional domains can be identified between F285 and its two Arabidopsis homologs vs. authentic ~~ chitinases. For example, F285 and its Arabidopsis homologs lack features that are typical of some, but not all, chitinases: (a) a cysteine-rich N-terminal chitin binding domain that would facilitate interaction with chitin; (b) a P (proline)/T (threonine)-rich hinge region before the catalytic region; and (c) a C-terminal vacuolar targeting domain (Meins et al., “ The Primary Structure of Plant
Pathogenesis-Related Glucanohydrolases and Their Genes,” in Boller, eds., Genes
Involved in Plant Defense, Springer Verlag/New York, p. 245-282 (1992), which is hereby incorporated by reference in its entirety). In the absence of the vacuolar targetting domain, F285 is expected to be secreted outside the plasma membrane.
Its myristoylation site also confers potential for acylation by the covalent addition of myristate (a C14-saturated fatty acid), which could facilitate reversible interaction with the plasma membrane (Thompson et al., “Lipid-Linked Proteins of Plants,” Prog. Lipid Res., 39:19 — 39 (2000), which is hereby incorporated by reference in its entirety).
[0101] In addition, F285 and its Arabidopsis homologs have non- conservative amino acid substitutions (i.e. with a different or dissimilar chemical type of amino acid) in regions proved by mutagenesis to be critical for the function of typical chitinases (Iseli-Gamboni et al., “Mutation of Either of Two
Essential Glutamates Converts the Catalytic Domain of Tobacco Class I Chitinase
Into a Chitin-Binding Lectin,” Plant Sci., 134:45-51 (1998), which is hereby incorporated by reference in its entirety and references therein) and in other regions predicted by crystal structure to be important for catalysis, active site geometry, or substrate binding (Hart et al., “The Refined Crystal Structure of an
Endochitinase From Hordeum vulgare L. Seeds at 1.8 A Resolution,” J. Mol.
Biol, 248:402-413 (1995); Hamel et al., “ Structural and Evolutionary
Relationships Among Chitinases of Flowering Plants,” J. Mol. Evol., 44:614-624 (1997); Bishop et al., “Rapid Evolution in Plant Chitinases: Molecular Targets of
Selection in Plant-Pathogen Coevolution, Proc. Nat’l. Acad. Sci. U.S.A, 97:5322- 5327 (2000), which are hereby incorporated by reference in their entirety). For example, of eleven amino acids in an Arabis chitinase that are putative substrate ‘binding sites (Bishop et al., “Rapid Evolution in Plant Chitinases: Molecular
Targets of Selection in Plant-Pathogen Coevolution, Proc. Nat’l. Acad. Sci.
U.S.A, 97:5322-5327 (2000), which is hereby incorporated by reference in its entirety), two are unchanged, three are substituted with similar amino acids, and six are substituted with dissimilar amino acids in F285. This suggests that F285, while related to chitinases, might have unique protein structure allowing a unique cellular role. Some of these non-conservative changes and, conversely, amino acids that were retained as expected for chitinases in the sequences of F285 and its
Arabidopsis homologs, are summarized in TABLE 3 (compiled from Hamel et al., “Structural and Evolutionary Relationships Among Chitinases of Flowering
Plants,” J. Mol. Evol., 44:614-624 (1997); Bishop et al., “Rapid Evolution in
Plant Chitinases: Molecular Targets of Selection in Plant-Pathogen Coevolution,
Proc. Nat’l. Acad. Sci. U.S.A., 97:5322-5327 (2000), which are hereby incorporated by reference in their entirety). Amino acids with asterisks (*) have been proven by mutagenesis to be important for the function of authentic chitinases (Iseli-Gamboni et al., “Mutation of Either of Two Essential Glutamates
Converts the Catalytic Domain of Tobacco Class I Chitinase Into a Chitin-Binding
Lectin,” Plant Sci., 134:45-51 (1998), which is hereby incorporated by reference in its entirety and references therein). The sequence of an Arabis chitinase has been used for the reference amino acid number system because of its prior annotation in the literature (Bishop et al., “Rapid Evolution in Plant Chitinases:
Molecular Targets of Selection in Plant-Pathogen Coevolution, Proc. Nat'l. Acad.
Sci. U.S.A., 97:5322-5327 (2000), which is hereby incorporated by reference in its entirety). When amino acid substitutions are shown, the same ones were found at that position in F285 and its Arabidopsis homologs, except for an exception for
AAF29391.1 as noted in the footnotes. ‘Type of substitution’ is as defined in the
CLUSTAL W multiple sequence alignment program.
TABLE 3
Comparison of functional amino acids in chitinases to the F285 protein sequence
Arabis F285 Expected Amino acid Type of
Location Location Amino acid Found Substitution 141 122 *Glutamic acid (E) Lysine (K) Strongly similar 142 123 Threonine (T) Same 163 144 *Glutamic Acid (E) Same 177. 160 Tryptophan (Ww)! Tyrosine (Y) Strongly similar 192 175 *Glutamine (Q) Proline (P) Different 194 177 *Serine (S) Tyrosine (Y) Different 197 180 *Tyrosine (Y)? Same (in NYNY) 198 181 Asparagine (N) Same (in NYNY) 273 257 * Asparagine (N) Tyrosine (Y) Different * Amino acids proven by mutagenesis to be required for chitinase activity (Iseli-Gamboni et al., “Mutation of Either of Two Essential Glutamates Converts the Catalytic Domain of
Tobacco Class I Chitinase Into a Chitin-Binding Lectin,” Plant Sci., 134:45-51 (1998), which is hereby incorporated by reference in its entirety). 'Retained as W in AAF29391.1 and found as Y in 3 of 4 cotton chitinases (Q39799, Q39785, and
AAD11255). Other comparisons of F285 with all 4 cotton chitinases in the databases are consistent with the table.
Changed to F in AAF29391.1, the other Arabidopsis homolog of F285. ‘
[0102] The difference between F285, its closest Arabidopsis homolog, and other chitinases is emphasized by comparing their similar sequences near NYNY (a substrate binding site) to a putative consensus sequence described for several classes of chitinases (Hamel et al., “ Structural and Evolutionary Relationships
Among Chitinases of Flowering Plants,” J. Mol. Evol., 44:614-624 (1997), which is hereby incorporated by reference in its entirety) and with the Arabis chitinase (AAF69789.1) as a representative of the consensus-type sequence (Bishop et al., “Rapid Evolution in Plant Chitinases: Molecular Targets of Selection in Plant- ‘Pathogen Coevolution, Proc. Nat’l. Acad. Sci. U.S.A., 97:5322-5327 (2000), which is hereby incorporated by reference in its entirety). In this case, gaps inserted in all the sequences, including the putative consensus sequence, may create the best mutual alignment. As seen in TABLE 4, the sequence of F285 and its Arabidopsis homolog could be viewed in comparison to the consensus and the
Arabis sequence as: (a) adding Y with the result that the hydrophobic domain containing NYNY is lengthened; (b) deleting QLS with the result that a conserved
P (in 38 of 39 listed chitinase sequences, Hamel et al., “ Structural and
Evolutionary Relationships Among Chitinases of Flowering Plants,” J. Mol.
Evol., 44:614-624 (1997), which is hereby incorporated by reference in its entirety) is nearer the NYNY domain; and (c) adding AL with the result that the conserved GRG (in 38 of 39 listed chitinase sequences, Hamel et al., “ Structural and Evolutionary Relationships Among Chitinases of Flowering Plants,” J. Mol.
Evol., 44:614-624 (1997), which is hereby incorporated by reference in its entirety) remains 5 residues from the NYNY domain. Although this reasoning is hypothetical, it emphasizes the difference between the sequences of F285 and its
Arabidopsis homolog compared to previously described chitinase sequences. Both the Q and the S are proven to be essential for catalysis in some chitinases (Hamel et al., “ Structural and Evolutionary Relationships Among Chitinases of Flowering
Plants,” J. Mol. Evol., 44:614-624 (1997); Bishop et al., “Rapid Evolution in
Plant Chitinases: Molecular Targets of Selection in Plant-Pathogen Coevolution,
Proc. Nat’l. Acad. Sci. U.S A., 97:5322-5327 (2000), which are hereby incorporated by reference in their entirety), and either their substitution with different amino acids (TABLE 2 and 3) or hypothetical deletion (TABLE 4) may cause the function of F285 and its Arabidopsis homolog to diverge from that typically expected of chitinases. Alternatively, F285 and its Arabidopsis homologs could be a previously unrecognized type of chitinase with a unique cellular role.
TABLE 4
Optimized alignment between a chitinase consensus sequence, Arabis chitinase, F285, and the closest Arabidopsis homolog to F285 * * %* . Consensus GRG--PIQLS-WNYNYGpAGrAI (SEQ. ID. No. 7) ’ ARF635789 cee==.M...-......LC.... ’
F285 170 ...AL..---Y......ET.D.L 189
BAR94976 ...AL.V---¥......QT.E.L + X+ X +
Symbols: —-: gap in the sequence inserted here for purposes of best mutual alignment dot (.): sites of identical amino acids between sequences plus (+): sites of substitution of weakly or strongly similar amino acids compared to the consensus sequence. . x: sites of different amino acids compared to the consensus sequence (SEQ. ID. No. 7). letters in AAF69789 (amino acid number 170-189 of SEQ. ID. No. 5), F285 (amino acid number 170-189 of SEQ. ID. No. 2), BAA94976 (amino acid number 170-189 of SEQ. ID. No. 4): single letter codes for the amino acid substituted at that position
Co underline in BAA94976: region in the active site of authentic chitinases asterisks (*) above Consensus: residues proven to be critical for function in authentic chitinases (Verburg et al., “Identification of an Essential Tyrosine Residue in the Catalytic Site of a Chitinase Isolated From Zea mays That is Selectively
Modified During Inactivation With 1-ethyl-3-(3-dimethylaminopropyl)- a carbodiimide,” J. Biol. Chem., 267:3886-3893 (1992); Bishop et al., “Rapid
Evolution in Plant Chitinases: Molecular Targets of Selection in Plant-
Pathogen Coevolution, Proc. Nat’l. Acad. Sci. U.S.A, 97:5322-5327 (2000), which are hereby incorporated by reference in their entirety)
[0103] A similar divergence between F285 and its Arabidopsis homolog with other Family 19 chitinases is observed in a region previously defining part of a ‘Signature’ containing regions of putatively unchanging amino acids (underlined) in this family of glycosyl hydrolases (Robertus et al., “The Structure and Action of Chitinases,” in Jolles, eds., Chitin and Chitinases, pp. 125-136 (1999), which is hereby incorporated by reference in its entirety; TABLE 5). The
Signature contains two glutamic acid residues (E; at positions 122 and 144 of 40 F285) that have been proven by mutagenesis to be catalytic residues (Iseli-
Gamboni et al., “Mutation of Either of Two Essential Glutamates Converts the
Catalytic Domain of Tobacco Class I Chitinase Into a Chitin-Binding Lectin,”
Plant Sci., 134:45-51 (1998), which is hereby incorporated by reference in its entirety). In F285 and its Arabidopsis homolog, the putatively conserved catalytic 45 E at position 122 is substituted with K, which is a very similar amino acid although it is positively charged at pH 6 whereas E is negatively charged and it has an amino terminus of its R group whereas E has a carboxy terminus.
Substitution by targeted mutagenesis of this E with A (a different type of amino acid) abolishes catalytic activity in some chitinases, changing the protein into a chitin-binding lectin (Iseli-Gamboni et al., “Mutation of Either of Two Essential Glutamates Converts the Catalytic Domain of Tobacco Class I Chitinase Into a
Chitin-Binding Lectin,” Plant Sci., 134:45-51 (1998), which is hereby incorporated by reference in its entirety). However, the effect of change to K in
F285 is unknown, although substitution with similar amino acids can cause changes in binding interactions of chitinases (Bishop et al., “Rapid Evolution in
Plant Chitinases: Molecular Targets of Selection in Plant-Pathogen Coevolution,
Proc. Nat’l. Acad. Sci. U.S.A., 97:5322-5327 (2000), which is hereby incorporated by reference in its entirety). There are also many other examples of substitution of similar amino acids within the putatively unchanging signature residues. In addition, within the putatively unchanging signature residues, there are three sites (denoted by x) of substitution of different amino acids in F285 and its Arabidopsis homolog. These are more likely to have major functional consequences than the substitutions of similar amino acids. Note that the : sequence of F285 and its Arabidopsis homolog are identical in this region, suggesting that the changes they both show compared to the Signature are important for their particular function. In contrast, the sequence of the Arabis chitinase (AAF69789) with a defensive role (Bishop et al., “Rapid Evolution in
Plant Chitinases: Molecular Targets of Selection in Plant-Pathogen Coevolution,
Proc. Nat’l. Acad. Sci. U.S.A., 97:5322-5327 (2000), which is hereby incorporated by reference in its entirety) matches the regions of unchanging amino acids in the Signature exactly and has only similar substitutions at other locations.
TABLE 5 :
Comparison between part of a Family 19 Signature sequence, Arabis chitinase, F285, and the closest Arabidopsis homolog to F285 * *
Signature KREVAAFLAQTSHETTGGWATAPDGAFAWGYCFKQERGA (SEQ. ID. No. 8)
AAF69789 K.I...FG...-v2.....5....P.S........QNP (SEQ. ID. No. 9)
F285 109 MK......GHVGSK.SC.YGV.TG.PL...L.YNK.MSP 133
BAR94976 MK......GHVGSK.SC.YGV.TG.PL. ..L.YNK.MSP (SEQ. ID. No. 10) + + +t+++X+ +X +++ ++ H+ X +++ X44
Symbols: underlines in Signature (SEQ. ID. No. 8): regions of amino acids previously defined as invariable asterisks (*) above Signature: residues proven by mutagenesis to be catalytic sites in authentic chitinases (Iseli-Gamboni et al., “Mutation of Either of Two Essential
Glutamates Converts the Catalytic Domain of Tobacco Class I Chitinase Into a
Chitin-Binding Lectin,” Plant Sci., 134:45-51 (1998), which is hereby incorporated by reference in its entirety) dot (): sites of identical amino acids between sequences plus (+): sites of substitution of weakly or strongly similar amino acids compared to the signature sequence. xX: sites of substitution of different amino acids compared to the signature sequence. letters in AAF69789 (SEQ. ID. No. 9), F285 (amino acid number 109-133 of SEQ. ID.
No. 2), and BAA94976 (SEQ. ID. No. 10): single letter codes for the amino acid substituted at that position
[0104] In summary, the data show that F285 and its closest Arabidopsis homolog are much more similar to each other than to the many chitinases in the sequence databases. The data allow the possibility that F285 and its Arabidopsis homologs have a function somewhat different than previously described for chitinases. The change in protein structure near the substrate binding sites and in 40 the catalytic region are likely to be important for the special function and/or optimal function of F285 and its Arabidopsis homologs. For example, these proteins might interact with N-acetyl-glucosamine oligomers or heteropolymers found in as yet unidentified substrate molecules. Possible substrate molecules could include signaling molecules or glycoproteins containing homo- or hetero- 45 oligomers of N-acetylglucosamine, not only structural chitin in insects or fungi (Sahai et al., “ Chitinases of Fungi and Plants: Their Involvement in
Morphogenesis and Host-Parasite Interaction,” FEMS Microbiology Rev., 11:317-338 (1993), which is hereby incorporated by reference in its entirety).
[0105] The fact that F285 was discovered by analyzing changes in gene expression in the context of a particular developmental event (the initiation and continuation of secondary wall deposition in cotton fibers) and the Arabidopsis homologs of F285 were discovered only by complete sequencing of the
Arabidopsis genome suggest that these chitinase-related proteins are more rarely expressed in the plant. This possibility is consistent with data from Northern blots of various cotton tissues (Figure 2). The high, cross-species, amino acid identity of F285 and its closest Arabidopsis homolog (76% identical; TABLE 1) intuitively suggest that these proteins have a critical role, possibly a developmental role, in the life of the plant. In contrast, chitinases such as are encoded by Arabis AAF69789.1 and Gossypium Q39799, which are more dissimilar to F285, have been most clearly associated with defensive roles. The existence of the Arabidopsis homologs of F285 opens efficient avenues to test the protein function via screening stocks of Arabidopsis insertional mutants be standard molecular biological techniques. In addition, gene expression could be down-regulated in Arabidopsis or cotton by anti-sense or RNAI technology that are standard molecular biology techniques.
Example 4 — Assay of Chitinase Activity
[0106] To begin to explore the biological role of the cognate protein of
F285, chitinase activity was assayed in greenhouse-grown and cultured cotton fibers and seedling leaf blades in the presence and absence of salicylic acid (SA) and ethephon (ETH), an ethylene- producing compound. SA and ETH were used to spray leaves or cultured cotton fibers, because these compounds induce chitinases in many other systems (Cutt et al., “Pathogenesis-Related Proteins,” in
Boller eds., Genes Involved in Plant Defense, New York, New York:Springer-
Verlag/Wien, pp. 209-243 (1992), which is hereby incorporated by reference in its entirety). Seedlings were sprayed with SA, ETH, or water (as a control) 16 days after planting and leaves and stems were harvested 2 days later. Ovules cultured on 1 DPA were removed from culture flasks on 6 DPA, sprayed similarly, and replaced in flasks, followed by fiber harvesting on 8 DPA. Droplets of tissue extracts (10 pg total protein; extracted per methods of Mauch et al., “Antifungal
Hydrolases in Pea Tissue. I. Purification and Characterization of Two Chitinases and Two B-1,3-Glucanases Differentially Regulated During Development and in
Response to Fungal Infection,” Plant Physiology, 87: 325-333 (1988), which is hereby incorporated by reference in its entirety, or control solutions were applied to areas (indicated by 1-12 in Figure 4) on a polyacrylamide gel containing suspended glycol chitin, and incubation to allow enzyme activity was carried out for 1 hat 37°C. A fluorescent brightener, Tinopal LPW, with high affinity for polymeric chitin was applied, and the gel was excited with UV light.
Subsequently, chitinase activity in tissue extracts was detected by measuring the ability to clear (degrade) water-soluble glycol chitin suspended in the polyacrylamide gel (Trudel et al., “Detection of Chitinase Activity After
Polyacrylamide Gel Electrophoresis,” Anal. Biochem., 178:362-366 (1989), which is hereby incorporated by reference in its entirety). Dark areas indicate that the polymeric chitin in that location was degraded so that the fluorescent dye no longer bound to it. Therefore, dark areas demonstrate chitinase activity in the applied solution.
[0107] The positive control (area 12) showed strong chitinase activity.
The negative controls (areas 8 and 11) showed no chitinase activity. All the cotton tissues tested showed chitinase activity, and no SA-induction of enzyme activity was observed by this qualitative test.
Example 5 — Induction of F285 Expression in Fibers by SA ‘{0108] Northern blots were performed to indicate whether or not the F285 promoter was responsive to the same inductive signals of many other plant chitinases (Figure 5). Treatment with water was used as a negative control. Fiber was tested at 8 and 24 DPA as indicated by the lane labels, and stem and leaf tissue was harvested at 18 days after treatment, if any, at 16 days. No induction of
F285 expression was found in the leaves treated with SA or ETH or in seedling stems treated with ETH. However, weak expression was detected in SA-treated, but not in ETH- or H,O-treated, 8 DPA fibers from cultured ovules (the blot was exposed to film for 4 days). These data suggest that the F285 promoter is only weakly responsive to inducers of other defense genes, and this may argue for a developmental role of F285.
Example 6 — Identification of a Possible F285 Gene Family :
[0109] Figure 6 shows a Southern blot of cotton genomic DNA (prepared from leaves of 18 day old seedlings) digested with EcoR1 and Hind III restriction enzymes and probed with the F285 full-length cDNA; the banding pattern suggests 4-5 family members. In order to begin to understand the genomic and functional diversity of a possible F285 gene family, a primer from a distinctive region (6 TAG repeats) near the 3’ untranslated end of the F285 sequence was used in PCR screening of the fiber cDNA library, followed by cloning of the amplified PCR products. Three colonies were chosen for insert-end sequencing, + 15 one of which was found to be different from the other two. This clone, designated
TAG], was used for Southern (Figure 6) and Northern hybridization (Figure 7).
The genomic DNA blot used for F285 hybridization was stripped and reprobed with TAG1, which hybridized to a similar set of fragments with different hybridization intensities. Therefore, F285 and TAG] are related at the DNA level
[0110] TAG] was expressed in greenhouse-grown fibers at 8 DPA (primary wall stage) and up-regulated in fibers at 24 DPA (secondary wall stage).
Weak expression was also detected in ovules stripped of fibers (although some contaminating fiber parts cannot be excluded) and in roots and stems. Expression was not detected in leaves. Therefore, TAG1 had a broader expression pattern than F285.
Example 7 — Identification of the Promoter of F285
[0111] Using the *?P labeled F285 cDNA fragment as the probe, six plaques from a lambda Fix II library (custom library, Stratagene, La Jolla, CA) were isolated after three rounds of selection. The DNA was isolated from the culture of five plaques and digested with restriction enzyme Xbal. The restriction pattern revealed that there were at least four bands in the DNA from each plaques. )
Southern hybridization showed that only one band, 4.3 kb in size, hybridized with the probe of F285 fragment. The 4.3 kb fragment was cut out of the gel and purified by Jetsorb gel extraction kit (PGC Scientific, Gaithersburg, MD) for subcloning.
[0112] The vector, pBS, was digested with Xbal and dephosphorylated.
Ligation with 4.3 Kb fragment was conducted with T4 DNA ligase at 15°C overnight in a total volume of 5 pul. The competent cells of DH-a5 were transformed and the transformants were selected on X-gal/IPTG plates.
[0113] A PCR product, using the T3 promoter sequence and a reverse primer designed from nucleotide number 159 to 178 of the F285 sequence as the primers, showed a 2.3 kb fragment, indicating it may cover the promoter, the 5’ untranslated sequence, and possibly intron(s). The sequencing was carried out with an automated oligo DNA synthesizer (Beckman Instruments Inc., Fullerton,
CA). More primers were designed as chromosome walking went on until the T3 promoter sequence of the vector was passed through. A reverse sequencing of the entire sequenced region was performed to ensure the right reading of the printout of the electropherogram.
[0114] Although the invention has been described in detail for the purpose of illustration, it is understood that such detail is solely for that purpose, and variations can be made therein by those skilled in the art without departing from the spirit and scope of the invention which is defined by the following claims.
Claims (15)
1. An isolated nucleic acid molecule from cotton encoding an endogenous cotton chitinase, wherein the nucleic acid molecule is expressed preferentially in fibers during secondary wall deposition.
2. The isolated nucleic acid molecule according to claim 1, wherein the fiber is cotton fiber.
3. The isolated nucleic acid molecule according to claim 2, wherein the nucleic acid molecule is expressed in cotton fibers beginning at 14 to 17 days post anthesis (DPA).
4. The isolated nucleic acid molecule according to claim 3, wherein the nucleic acid molecule is expressed in cotton fibers through to the termination of secondary wall deposition.
5. The isolated nucleic acid molecule according to claim 3, wherein the nucleic acid molecule is expressed in cotton fibers up to 31 DPA.
6. The isolated nucleic acid molecule according to claim 1, wherein the nucleic acid molecule comprises a nucleotide sequence which hybridizes to a DNA molecule having a sequence according to SEQ. ID. No. 1 under stringent conditions characterized by a hybridization buffer comprising 1 x 25 SSC at a temperature of 61°C; has a nucleotide sequence of SEQ. ID. No. 1; or encodes a protein or polypeptide having an amino acid sequence of SEQ. ID. No. 2.
7. A polypeptide encoded by the nucleic acid molecule according to any one of claims 1 to 6.
8. The polypeptide according to claim 7, wherein the polypeptide comprises an amino acid sequence of SEQ. ID. No. 2. Amended sheet 28/08/2006
\
9. A DNA construct comprising: a DNA promoter operably linked 5' to a second DNA encoding a protein or polypeptide to induce transcription of the second DNA; the second DNA comprising a nucleic acid molecule according to any one of claims 1 to 6; and a 3’ regulatory region operably linked to the second DNA.
10. A plant cell comprising a DNA construct according to claim 9.
11. A plant cell according to claim 10, wherein the plant is selected from the group consisting of cotton, corn, sugar cane, rice, flax, hemp, ramie, jute, kenaf, kapok, coir, bamboo, spanish moss, abaca, and Agave spp. :
12. A plant comprising in its cells, a DNA construct according to claim 9.
13. A plant according to claim 12, wherein the plant is selected from the group consisting of cotton, corn, sugar cane, rice, flax, hemp, ramie, jute, kenaf, kapok, coir, bamboo, spanish moss, abaca, and Agave spp.
14. A plant seed comprising a DNA construct according to claim 9.
15. A plant seed according to claim 14, wherein the plant is selected from the group consisting of cotton, corn, sugar cane, rice, flax, hemp, ramie, jute, kenaf, kapok, coir, bamboo, spanish moss, abaca, and Agave spp. Amended sheet 28/08/2006
Priority Applications (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
ZA200501688A ZA200501688B (en) | 2005-02-25 | 2005-02-25 | Chitinase encoding DNA molecule from cotton expressed preferentially in fibers during secondary cell wall deposition and the corresponding promoter |
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
ZA200501688A ZA200501688B (en) | 2005-02-25 | 2005-02-25 | Chitinase encoding DNA molecule from cotton expressed preferentially in fibers during secondary cell wall deposition and the corresponding promoter |
Publications (1)
Publication Number | Publication Date |
---|---|
ZA200501688B true ZA200501688B (en) | 2006-08-30 |
Family
ID=38293455
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
ZA200501688A ZA200501688B (en) | 2005-02-25 | 2005-02-25 | Chitinase encoding DNA molecule from cotton expressed preferentially in fibers during secondary cell wall deposition and the corresponding promoter |
Country Status (1)
Country | Link |
---|---|
ZA (1) | ZA200501688B (en) |
-
2005
- 2005-02-25 ZA ZA200501688A patent/ZA200501688B/en unknown
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2002329867B2 (en) | Chitinase encoding DNA molecule from cotton expressed preferentially in fibers during secondary cell wall deposition and the corresponding promoter | |
US7674956B2 (en) | Chitinase encoding DNA molecules from cotton expressed preferentially in secondary walled cells during secondary wall deposition and a corresponding promoter | |
US20210254115A1 (en) | Plants expressing cell wall degrading enzymes and expression vectors | |
Josè-Estanyol et al. | Plant cell wall glycoproteins and their genes | |
Dong et al. | Endochitinase and β-1, 3-glucanase genes are developmentally regulated during somatic embryogenesis in Picea glauca | |
US6326470B1 (en) | Enhancement of accessibility of cellulose by expansins | |
CN102884195B (en) | Increasing plant growth by modulating omega-amidase expression in plants | |
Harikrishna et al. | An endochitinase gene expressed at high levels in the stylar transmitting tissue of tomatoes | |
AU680935B2 (en) | Chitinase, DNA coding therefor and plants containing same | |
Hayashi et al. | Cellulose metabolism in plants | |
WO1995005467A9 (en) | Chitinase, dna coding therefor and plants containing same | |
WO1996035442A1 (en) | Purified expansin proteins | |
JP3538428B2 (en) | Plant promoter and gene expression method using the promoter | |
Arie et al. | Characterization of a basic chitinase which is secreted by cultured pumpkin cells | |
US10988788B2 (en) | Plants expressing cell wall degrading enzymes and expression vectors | |
ZA200501688B (en) | Chitinase encoding DNA molecule from cotton expressed preferentially in fibers during secondary cell wall deposition and the corresponding promoter | |
Wang et al. | An extracellular β‐N‐acetylhexosaminidase of Medicago truncatula hydrolyzes chitooligosaccharides and is involved in arbuscular mycorrhizal symbiosis but not required for nodulation | |
US8227588B2 (en) | Compositions and methods for modifying gene expression using the promoter of ubiquitin conjugating protein coding gene of cotton plants | |
US7157280B2 (en) | Nucleic acids coding for vacuolar invertases, vegetal cells and plants containing said nucleic acids and the use thereof | |
Brandon | Reducing Xylan and Improving Lignocellulosic Biomass through Antimorphic and Heterologous Enzyme Expression | |
US20020069431A1 (en) | Effect of endochitinase and chitobiosidase and their encoding genes on plant growth and development | |
Hayashi et al. | Enhancing primary raw materials for biofuels | |
Rogers et al. | Cell and Molecular Biology, Biochemistry and Molecular Physiology. A β-galactosidase-like gene is expressed during tobacco pollen development. | |
MX2014012167A (en) | Compositions and methods for modifying the expression of genes of interest. |