ZA200306933B - Modified interleukin-1 receptor antagonist (IL-1RA) with reduced immunogenicity. - Google Patents
Modified interleukin-1 receptor antagonist (IL-1RA) with reduced immunogenicity. Download PDFInfo
- Publication number
- ZA200306933B ZA200306933B ZA200306933A ZA200306933A ZA200306933B ZA 200306933 B ZA200306933 B ZA 200306933B ZA 200306933 A ZA200306933 A ZA 200306933A ZA 200306933 A ZA200306933 A ZA 200306933A ZA 200306933 B ZA200306933 B ZA 200306933B
- Authority
- ZA
- South Africa
- Prior art keywords
- amino acid
- molecule
- peptide
- modified
- molecule according
- Prior art date
Links
- 101001076407 Homo sapiens Interleukin-1 receptor antagonist protein Proteins 0.000 title claims description 69
- 102000051628 Interleukin-1 receptor antagonist Human genes 0.000 title claims description 64
- 229940119178 Interleukin 1 receptor antagonist Drugs 0.000 title claims description 63
- 239000003407 interleukin 1 receptor blocking agent Substances 0.000 title claims description 63
- 230000005847 immunogenicity Effects 0.000 title claims description 12
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 93
- 210000001744 T-lymphocyte Anatomy 0.000 claims description 60
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 47
- 102000004169 proteins and genes Human genes 0.000 claims description 43
- 108090000623 proteins and genes Proteins 0.000 claims description 43
- 125000000539 amino acid group Chemical group 0.000 claims description 38
- 238000000034 method Methods 0.000 claims description 34
- 230000027455 binding Effects 0.000 claims description 32
- 150000001413 amino acids Chemical class 0.000 claims description 24
- 108091054438 MHC class II family Proteins 0.000 claims description 21
- 238000006467 substitution reaction Methods 0.000 claims description 19
- 230000004071 biological effect Effects 0.000 claims description 17
- 102000043131 MHC class II family Human genes 0.000 claims description 16
- 229920001184 polypeptide Polymers 0.000 claims description 16
- 102000018713 Histocompatibility Antigens Class II Human genes 0.000 claims description 15
- 125000003275 alpha amino acid group Chemical group 0.000 claims description 13
- 230000004075 alteration Effects 0.000 claims description 12
- 230000001225 therapeutic effect Effects 0.000 claims description 11
- 108010027412 Histocompatibility Antigens Class II Proteins 0.000 claims description 10
- 238000001727 in vivo Methods 0.000 claims description 10
- 230000002163 immunogen Effects 0.000 claims description 9
- 238000004519 manufacturing process Methods 0.000 claims description 8
- 238000007792 addition Methods 0.000 claims description 7
- 238000012217 deletion Methods 0.000 claims description 7
- 230000037430 deletion Effects 0.000 claims description 7
- 230000000694 effects Effects 0.000 claims description 7
- 238000000126 in silico method Methods 0.000 claims description 7
- 230000009467 reduction Effects 0.000 claims description 6
- 108020004511 Recombinant DNA Proteins 0.000 claims description 5
- 210000004027 cell Anatomy 0.000 claims description 5
- 230000006870 function Effects 0.000 claims description 5
- 239000003446 ligand Substances 0.000 claims description 5
- 238000004166 bioassay Methods 0.000 claims description 4
- 230000002209 hydrophobic effect Effects 0.000 claims description 4
- 238000000338 in vitro Methods 0.000 claims description 4
- 230000004048 modification Effects 0.000 claims description 4
- 238000012986 modification Methods 0.000 claims description 4
- 230000009149 molecular binding Effects 0.000 claims description 4
- 239000008194 pharmaceutical composition Substances 0.000 claims description 3
- 238000012360 testing method Methods 0.000 claims description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 2
- 230000008859 change Effects 0.000 claims description 2
- 239000003085 diluting agent Substances 0.000 claims description 2
- 239000003937 drug carrier Substances 0.000 claims description 2
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 2
- 238000005070 sampling Methods 0.000 claims description 2
- 230000028993 immune response Effects 0.000 description 10
- 101000599048 Homo sapiens Interleukin-6 receptor subunit alpha Proteins 0.000 description 5
- 102100037792 Interleukin-6 receptor subunit alpha Human genes 0.000 description 5
- 108091008874 T cell receptors Proteins 0.000 description 5
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 description 5
- 230000004913 activation Effects 0.000 description 5
- 102000046824 human IL1RN Human genes 0.000 description 5
- 241000282412 Homo Species 0.000 description 4
- 102000015636 Oligopeptides Human genes 0.000 description 4
- 108010038807 Oligopeptides Proteins 0.000 description 4
- 230000008030 elimination Effects 0.000 description 4
- 238000003379 elimination reaction Methods 0.000 description 4
- 230000003213 activating effect Effects 0.000 description 3
- 210000003719 b-lymphocyte Anatomy 0.000 description 3
- 108020001756 ligand binding domains Proteins 0.000 description 3
- 108700028369 Alleles Proteins 0.000 description 2
- 108010078049 Interferon alpha-2 Proteins 0.000 description 2
- 102100039350 Interferon alpha-7 Human genes 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 206010028980 Neoplasm Diseases 0.000 description 2
- 230000005867 T cell response Effects 0.000 description 2
- 230000005875 antibody response Effects 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 201000011510 cancer Diseases 0.000 description 2
- 229910052799 carbon Inorganic materials 0.000 description 2
- 201000010099 disease Diseases 0.000 description 2
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 2
- 230000002068 genetic effect Effects 0.000 description 2
- 238000010353 genetic engineering Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 125000002924 primary amino group Chemical group [H]N([H])* 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 102000005962 receptors Human genes 0.000 description 2
- 108020003175 receptors Proteins 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 241000283690 Bos taurus Species 0.000 description 1
- 108010041397 CD4 Antigens Proteins 0.000 description 1
- 241000282465 Canis Species 0.000 description 1
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- 108010017213 Granulocyte-Macrophage Colony-Stimulating Factor Proteins 0.000 description 1
- 102100039620 Granulocyte-macrophage colony-stimulating factor Human genes 0.000 description 1
- 108010010378 HLA-DP Antigens Proteins 0.000 description 1
- 102000015789 HLA-DP Antigens Human genes 0.000 description 1
- 108010062347 HLA-DQ Antigens Proteins 0.000 description 1
- 102000019223 Interleukin-1 receptor Human genes 0.000 description 1
- 108050006617 Interleukin-1 receptor Proteins 0.000 description 1
- 150000008575 L-amino acids Chemical class 0.000 description 1
- 230000024932 T cell mediated immunity Effects 0.000 description 1
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 description 1
- 239000002253 acid Substances 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 238000004364 calculation method Methods 0.000 description 1
- 150000001721 carbon Chemical group 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 210000000170 cell membrane Anatomy 0.000 description 1
- 239000003795 chemical substances by application Substances 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 150000001875 compounds Chemical class 0.000 description 1
- 238000012790 confirmation Methods 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 238000006731 degradation reaction Methods 0.000 description 1
- 210000004443 dendritic cell Anatomy 0.000 description 1
- 230000001419 dependent effect Effects 0.000 description 1
- 238000009795 derivation Methods 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 229940079593 drug Drugs 0.000 description 1
- 239000003814 drug Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 210000002443 helper t lymphocyte Anatomy 0.000 description 1
- 239000000833 heterodimer Substances 0.000 description 1
- 229910052739 hydrogen Inorganic materials 0.000 description 1
- 239000001257 hydrogen Substances 0.000 description 1
- 125000001165 hydrophobic group Chemical group 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 230000002998 immunogenetic effect Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- 210000000265 leukocyte Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 102000035118 modified proteins Human genes 0.000 description 1
- 108091005573 modified proteins Proteins 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 229940044551 receptor antagonist Drugs 0.000 description 1
- 239000002464 receptor antagonist Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000004044 response Effects 0.000 description 1
- 230000000717 retained effect Effects 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 238000010189 synthetic method Methods 0.000 description 1
- 238000002560 therapeutic procedure Methods 0.000 description 1
- 238000002054 transplantation Methods 0.000 description 1
Description
MODIFIED INTERLEUKIN-1 RECEPTOR ANTAGONIST (IL-1RA)
WITH REDUCED IMMUNOGENICITY
The present invention relates to polypeptides to be administered especially to humans and “ ~ in particular for therapeutic use. The polypeptides are modified polypeptides whereby the modification results in a reduced propensity for the polypeptide to elicit an immune response upon administration to the human subject. The invention in particular relates to the modification of human interleukin-1 receptor antagonist (IL-1RA) to result in IL-1RA protein variants that are substantially non-immunogenic or less immunogenic than any non-modified counterpart when used in vivo. The invention relates furthermore to T-cell epitope peptides derived from said non-modified protein by means of which it is possible to create modified IL-1RA variants with reduced immunogenicity.
There are many instances whereby the efficacy of a therapeutic protein is limited by an unwanted immune reaction to the therapeutic protein. Several mouse monoclonal : antibodies have shown promise as therapies in a number of human disease settings but in certain cases have failed due to the induction of significant degrees of a human anti- © 20 murine antibody (HAMA) response [Schroff, R. W. et al (1985) Cancer Res. 45: 879-885;
Shawler, D.L. et al (1985) J. Immunol. 135: 1530-1535]. For monoclonal antibodies, a number of techniques have been developed in attempt to reduce the HAMA response [WO 89/09622; EP 0239400; EP 0438310; WO 91/06667]. These recombinant DNA approaches have generally reduced the mouse genetic information in the final antibody construct whilst increasing the human genetic information in the final construct.
Notwithstanding, the resultant “humanized” antibodies have, in several cases, still elicited an immune response in patients [Issacs J.D. (1990) Sem. Immunol. 2: 449, 456; Rebello,
PR. et al (1999) Transplantation 68: 1417-1420]. ®
Antibodies are not the only class of polypeptide molecule administered as a therapeutic “ agent against which an immune response may be mounted. Even proteins of human origin and with the same amino acid sequences as occur within humans can still induce an immune response in humans. Notable examples include the therapeutic use of granulocyte-macrophage colony stimulating factor [Wadhwa, M. et al (1999) Clin. ,
CONFIRMATION COPY
Cancer Res. 5: 1353-1361] and interferon alpha 2 [Russo, D. et al (1996) Bri. J. Haem. 94: 300-305; Stein, R. et al (1988) New Engl. J. Med. 318: 1409-1413] amongst others.
A principal factor in the induction of an immune response is the presence within the . protein of peptides that can stimulate the activity of T-cell via presentation on MHC class
II molecules, so-called "T-cell epitopes. Such potential T-cell epitopes are commonly : defined as any amino acid residue sequence with the ability to bind to MHC Class II molecules. Such T-cell epitopes can be measured to establish MHC binding. Implicitly, a "T-cell epitope” means an epitope which when bound to MHC molecules can be recognized by a T-cell receptor (TCR), and which can, at least in principle, cause the activation of these T-cells by engaging a TCR to promote a T-cell response. It is, however, usually understood that certain peptides which are found to bind to MHC Class
II molecules may be retained in a protein sequence because such peptides are recognized as "self" within the organism into which the final protein is administered.
It is known, that certain of these T-cell epitope peptides can be released during the degradation of peptides, polypeptides or proteins within cells and subsequently be presented by molecules of the major histocompatability complex (MHC) in order to trigger the activation of T-cells. For peptides presented by MHC Class II, such activation of T-cells can then give rise, for example, to an antibody response by direct stimulation of
B-cells to produce such antibodies.
MHC Class II molecules are a group of highly polymorphic proteins which play a central role in helper T-cell selection and activation. The human leukocyte antigen group DR (HLA-DR) are the predominant isotype of this group of proteins and are thc major focus of the present invention. However, isotypes HLA-DQ and HLA-DP perform similar functions, hence the resent invention is equally applicable to these. The MHC class II DR molecule is made of an alpha and a beta chain which insert at their C-termini through the cell membrane. Each hetero-dimer possesses a ligand binding domain which binds to * peptides varying between 9 and 20 amino acids in length, although the binding groove can accommodate a maximum of 11 amino acids. The ligand binding domain is comprised of amino acids 1 to 85 of the alpha chain, and amino acids 1 to 94 of the beta chain. DQ molecules have recently been shown to have an homologous structure and the
DP family proteins are also expected to be very similar. In humans approximately 70 different allotypes of the DR isotype are known, for DQ there are 30 different allotypes and for DP 47 different allotypes are known. Each individual bears two to four DR alleles, two DQ and two DP alleles. The structure of a number of DR molecules has been o solved and such structures point to an open-ended peptide binding groove with a number of hydrophobic pockets which engage hydrophobic residues (pocket residues) of the . peptide [Brown et al Nature (1993) 364: 33; Stern et al (1994) Nature 368: 215].
Polymorphism identifying the different allotypes of class II molecule contributes to a wide diversity of different binding surfaces for peptides within the peptide binding grove and at the population level ensures maximal flexibility with regard to the ability to recognize foreign proteins and mount an immune response to pathogenic organisms. ‘There is a considerable amount of polymorphism within the ligand binding domain with distinct “families” within different geographical populations and ethnic groups. This polymorphism affects the binding characteristics of the peptide binding domain, thus different “families” of DR molecules will have specificities for peptides with different sequence properties, although there may be some overlap. This specificity determines : recognition of Th-cell epitopes (Class II T-cell response) which are ultimately responsible : for driving the antibody response to B-cell epitopes present on the same protein from : which the Th-cell epitope is derived. Thus, the immune response to a protein in an
L individual is heavily influenced by T-cell epitope recognition which is a function of the : 20 peptide binding specificity of that individual’s HLA-DR allotype. Therefore, in order to identify T-cell epitopes within a protein or peptide in the context of a global population, it is desirable to consider the binding properties of as diverse a set of HLA-DR allotypes as possible, thus covering as high a percentage of the world population as possible.
An immune response to a therapeutic protein such as the protein which is object of this invention, proceeds via the MHC class II peptide presentation pathway. Here exogenous proteins are engulfed and processed for presentation in association with MHC class II molecules of the DR, DQ or DP type. MHC Class II molecules are expressed by ® professional antigen presenting cells (APCs), such as macrophages and dendritic cells amongst others. Engagement of a MHC class II peptide complex by a cognate T-cell : receptor on the surface of the T-cell, together with the cross-binding of certain other co- receptors such as the CD4 molecule, can induce an activated state within the T-cell.
Activation leads to the release of cytokines further activating other lymphocytes such as B cells to produce antibodies or activating T killer cells as a full cellular immune response.
The ability of a peptide to bind a given MHC class II molecule for presentation on the surface of an APC is dependent on a number of factors most notably its primary sequence. This will influence both its propensity for proteolytic cleavage and also its affinity for binding within the peptide binding cleft of the MHC class II molecule. The .
MHC class IT / peptide complex on the APC surface presents a binding face to a particular
T-cell receptor (TCR) able to recognize determinants provided both by exposed residues : of the peptide and the MHC class II molecule.
In the art there are procedures for identifying synthetic peptides able to bind MHC class II molecules (e.g. W0O98/52976 and WOO00/34317). Such peptides may not function as T- cell epitopes in all situations, particularly, in vivo due to the processing pathways or other phenomena. T-cell epitope identification is the first step to epitope elimination. The identification and removal of potential T-cell epitopes from proteins has been previously disclosed. In the art methods have been provided to enable the detection of T-cell epitopes usually by computational means scanning for recognized sequence motifs in experimentally determined T-cell epitopes or alternatively using computational techniques to predict MHC class II-binding peptides and in particular DR-binding peptides.
W098/52976 and W(O00/34317 teach computational threading approaches to identifying polypeptide sequences with the potential to bind a sub-set of human MHC class II DR allotypes. In these teachings, predicted T-cell epitopes are removed by the use of judicious amino acid substitution within the primary sequence of the therapeutic antibody or non-antibody protein of both non-human and human derivation.
Other techniques exploiting soluble complexes of recombinant MHC molecules in combination with synthetic peptides and able to bind to T-cell clones from peripheral blood samples from human or experimental animal subjects have been used in the art [Kem, F. et al (1998) Nature Medicine 4:975-978; Kwok, W.W. et al (2001) TRENDS in
Immunology 22: 583-588] and may also be exploited in an epitope identification strategy. :
As depicted above and as consequence thereof, it would be desirable to identify and to remove or at least to reduce T-cell epitopes from a given in principal therapeutically valuable but originally immunogenic peptide, polypeptide or protein.
One of these therapeutically valuable molecules is "interleukin-1 receptor antagonist (IL-
IRA)". The protein can be produced by recombinant technologies using a number of different host cell types. The amino acid sequence of interleukin-1 receptor antagonist (IL-1RA) (depicted as one-letter code) is as follows: ’ 5 RPSGRKS SKMQAFRIWDVNQKTFYLRNNQLVAGYLQGPNVNLEEKIDVVPIEPHALFLGI HGGKMCL SCVK
SGDETRLQLEAVNITDLSENRKQDKRF AF IRSDSGPT TSFESAACPGWFLCTAMEADQPVSLTNMPD EGVM
VTKFYFQEDE
Others have provided IL-1Ra molecules [e.g. US 5,075,222], but none have recognized the importance of T-cell epitopes to the immunogenic properties of the protein nor have 10 been conceived to directly influence said properties in a specific and controfled way according to the scheme of the present invention.
However, there is a continued need for interleukin-1 receptor antagonist (IL-1RA) analogues with enhanced properties. Desired enhancements include alternative schemes 15 and modalities for the expression and purification of the said therapeutic, but also and especially, improvements in the biological properties of the protein. There is a particular - need for enhancement of the in vivo characteristics when administered to the human subject. In this regard, it is highly desired to provide interleukin-1 receptor antagonist (IL-1RA) with reduced or absent potential to induce an immune response in the human 20 subject.
The present invention provides for modified forms of "interleukin-1 receptor antagonist (IL-1RA)", in which the immune characteristic is modified by means of reduced or 25 removed numbers of potential T-cell epitopes. The invention discloses sequences identified within the IL-1Ra primary sequence that are potential T-cell epitopes by virtue of MHC class II binding potential. This disclosure specifically pertains a human IL-1Ra protein being of 152 amino acid residues [Eisenburg, S.P. et al (1991) Proc. Natl. Acad.
Sci. U.S.A. 88: 5232-5236]. : 30 The invention may be applied to any IL-1Ra species of molecule with substantially the same primary amino acid sequences as those disclosed herein and would include therefore } IL-1Ra molecules derived by genetic engineering means or other processes and may not contain 152 amino acid residues.
IL-1Ra proteins such as identified from murine, bovine, canine and other mammalian 35 sources have in common many of the neptide sequences of the present disclosure and have in common many peptide sequences with substantially the same sequence as those of the disclosed listing. Such protein sequences equally therefore fall under the scope of the present invention.
The invention discloses sequences identified within the interleukin-1 receptor antagonist . (IL-1RA) primary sequence that are potential T-cell epitopes by virtue of MHC class II binding potential. This disclosure specifically pertains the human interleukin-1 receptor ) antagonist (IL-1RA) protein being the 152 amino acid residues.
The invention discloses also specific positions within the primary sequence of the molecule according to the invention which has to be altered by specific amino acid substitution, addition or deletion without affecting the biological activity in principal. In cases in which the loss of immunogenicity can be achieved only by a simultaneous loss of biological activity it is possible to restore said activity by further alterations within the amino acid sequence of the protein.
The invention discloses furthermore methods to produce such modified molecules, above all methods to identify said T-cell epitopes which have to be altered in order to reduce or remove immunogenetic sites.
The protein according to this invention would expect to display an increased circulation time within the human subject and would be of particular benefit in chronic or recurring disease settings such as is the case for a number of indications for interleukin-1 receptor antagonist (IL-1RA). The present invention provides for modified forms of human IL- 1RA proteins that are expected to display enhanced properties in vivo. These modified IL- 1RA molecules can be used in pharmaceutical compositions.
In summary the invention relates to the following issues: e amodified molecule having the biological activity of interleukin-1 receptor antagonist (IL-1RA) and being substantially non-immunogenic or less immunogenic than any non-modified molecule having the same biological activity when used in vivo, e an accordingly specified molecule, wherein said loss of immunogenicity is achieved by removing one or more T-cell epitopes derived from the originally non-modified ) molecule; ] e an accordingly specified molecule, wherein said loss of immunogenicity is achieved by reduction in numbers of MHC allotypes able to bind peptides derived from said molecule; e an accordingly specified molecule, wherein one T-cell epitope is removed,
e an accordingly specified molecule, wherein said originally present T-cell epitopes are
MHOC class II ligands or peptide sequences which show the ability to stimulate or bind
T-cells via presentation on class II; t e an accordingly specified molecule, wherein said peptide sequences are selected from the group as depicted in Table 1; ¢ an accordingly specified molecule, wherein 1 — 9 amino acid residues, preferably one amino acid residue in any of the originally present T-cell epitopes are altered; e an accordingly specified molecule, wherein the alteration of the amino acid residues 1s substitution, addition or deletion of originally present amino acid(s) residue(s) by other amino acid residue(s) at specific position(s); e an accordingly specified molecule, wherein one or more of the amino acid residue substitutions are carried out as indicated in Table 2; an accordingly specified molecule, wherein (additionally) one or more of the amino acid residue substitutions are carried out as indicated in Table 3 for the reduction in the number of MHC allotypes able to bind peptides derived from said molecule; e an accordingly specified molecule, wherein, if necessary, additionally further alteration usually by substitution, addition or deletion of specific amino acid(s) is conducted to : restore biological activity of said molecule; o a DNA sequence or molecule which codes for any of said modified molecule as specified above and below; e a pharmaceutical composition comprising a modified molecule having the biological activity of interleukin-1 receptor antagonist (IL-1RA) as defined above and / or in the claims, optionally together with a pharmaceutically acceptable carrier, diluent or excipient; e a method for manufacturing a modified molecule having the biological activity of interleukin-1 receptor antagonist (IL-1RA) as defined in any of the claims of the above-cited claims comprising the following steps: (1) determining the amino acid . sequence of the polypeptide or part thereof; (ii) identifying one or more potential T- cell epitopes within the amino acid sequence of the protein by any method including . 30 determination of the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays; (iii) designing new sequence variants with one or more amino acids within the identified potential T-cell epitopes modified in such a way to substantially reduce or eliminate the activity of the T-cell epitope as determined by the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays; (1v) constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties; and (v) optionally repeating steps (ii) — (iv); eo an accordingly specified method, wherein step (iit) is carried out by substitution, : addition or deletion of 1 — 9 amino acid residues in any of the originally present T-cell epitopes; . e an accordingly specified method, wherein the alteration is made with reference to a homologues protein sequence and / or in silico modeling techniques; e an accordingly specified method, wherein step (ii) of above is carried out by the following steps: (a) selecting a region of the peptide having a known amino acid residue sequence; (b) sequentially sampling overlapping amino acid residue segments of predetermined uniform size and constituted by at least three amino acid residues from the selected region; (c) calculating MHC Class II molecule binding score for each said sampled segment by summing assigned values for each hydrophobic amino acid residue side chain present in said sampled amino acid residue segment; and (d) identifying at least one of said segments suitable for modification, based on the calculated MHC Class II molecule binding score for that segment, to change overall
MHC Class II binding score for the peptide without substantially reducing therapeutic utility of the peptide; step (c) is preferably carried out by using a Bohm scoring function modified to include 12-6 van der Waal's ligand-protein energy repulsive term and ligand conformational energy term by (1) providing a first data base of MHC Class
II molecule models; (2) providing a second data base of allowed peptide backbones for said MHC Class II molecule models; (3) selecting a model from said first data base; (4) selecting an allowed peptide backbone from said second data base; (5) identifying amino acid residue side chains present in each sampled segment; (6) determining the binding affinity value for all side chains present in each sampled segment; and repeating steps (1) through (5) for each said model and each said backbone; e a 13mer T-cell epitope peptide having a potential MHC class II binding activity and created from immunogenetically non-modified interleukin-1 receptor antagonist (IL- ) 1RA), selected from the group as depicted in Table 1 and its use for the manufacture of . interleukin-1 receptor antagonist (IL-1RA) having substantially no or less immunogenicity than any non-modified molecule with the same biological activity when used in vivo;
e a peptide sequence consisting of at least 9 consecutive amino acid residues of a 13mer
T-cell epitope peptide as specified above and its use for the manufacture of interleukin-1 receptor antagonist (IL-1RA) having substantially no or less 3 immunogenicity than any non-modified molecule with the same biological activity when used in vivo;
The term "T-cell epitope” means according to the understanding of this invention an amino acid sequence which is able to bind MCH II, able to stimulate T-cells and / or also to bind (without necessarily measurably activating) T-cells in complex with MHC IL.
The term "peptide" as used herein and in the appended claims, is a compound that includes two or more amino acids. The amino acids are linked together by a peptide bond (defined herein below). There are 20 different naturally occurring amino acids involved int eh biological production of peptides, and any number of them may be linked in any order to form a peptide chain or ring. The naturally occurring amino acids employed in the biological production of peptides all have the L-configuration. Synthetic peptides can be prepared employing conventional synthetic methods, utilizing L-amino acids, D-amino oo acids, or various combinations of amino acids of the two different configurations. Some : peptides contain only a few amino acid units. Short peptides, e.g., having less than ten - amino acid units, are sometimes referred to as "oligopeptides". Other peptides contain a : 20 large number of amino acid residues, e.g. up to 100 ore more, and are referred to as “polypeptides”. By convention, a "polypeptide” may be considered as any peptide chain containing three or more amino acids, whereas a “oligopeptide” is usually considered as a particular type of "short" polypeptide. Thus, as used herein, it is understood that any reference to a "polypeptide" also includes an oligopeptide. Further, any reference to a "peptide" includes polypeptides, oligopeptides, and proteins. Each different arrangement of amino acids forms different polypeptides or proteins. The number of polypeptides—and hence the number of different proteins—that can be formed is practically unlimited. "Alpha carbon (Ca)" is the carbon atom of the carbon-hydrogen (CH) component that is ‘ in the peptide chain. A "side chain" is a pendant group to Ca that can comprise a simple . 30 or complex group or moiety, having physical dimensions that can vary significantly compared to the dimensions of the peptide.
The invention may be applied to any interleukin-1 receptor antagonist (IL-1RA) species of molecule with substantially the same primary amino acid sequences as those disclosed herein and would include therefore interleukin-1 receptor antagonist (IL-1RA) molecules derived by genetic engineering means or other processes and may not contain either 152 amino acid residues. interteukin-1 receptor antagonist (IL-1RA) proteins such as identified from other mammalian sources have in common many of the peptide sequences of the present . disclosure and have in common many peptide sequences with substantially the same sequence as those of the disclosed listing. Such protein sequences equally therefore fall ) under the scope of the present invention.
The invention is conceived to overcome the practical reality that soluble proteins introduced into autologous organisms can trigger an immune response resulting in development of host antibodies that bind to the soluble protein. One example amongst others, is interferon alpha 2 to which a proportion of human patients make antibodies despite the fact that this protein is produced endogenously [Russo, D. et al (1996) ibid,
Stein, R. et al (1988) ibid]. It is likely that the same situation pertains to the therapeutic use of interleukin-1 receptor antagonist (IL-1RA) and the present invention seeks to address this by providing interleukin-1 receptor antagonist (IL-1RA) proteins with altered propensity to elicit an immune response on administration to the human host.
The general method of the present invention leading to the modified interleukin-1 receptor antagonist (IL-1RA) comprises the following steps: (a) determining the amino acid sequence of the polypeptide or part thereof; (b) identifying one or more potential T-cell epitopes within the amino acid sequence of the protein by any method including determination of the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays; (c) designing new sequence variants with one or more amino acids within the identified potential T-cell epitopes modified in such a way to substantially reduce or eliminate the activity of the T-cell epitope as determined by the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays. Such sequence variants are created in such a way to avoid creation of new potential T-cell epitopes by the sequence variations unless such new potential T-cell epitopes are, in turn, modified in such a way to substantially reduce or eliminate the activity of the T -cell epitope; and (d) constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties according to well known recombinant techniques.
The identification of potential T-cell epitopes according to step (b) can be carried out according to methods describes previously in the prior art. Suitable methods are disclosed in WO 98/59244; WO 98/52976; WO 00/34317 and may preferably be used to identify binding propensity of interleukin-1 receptor antagonist (IL-1RA)-derived peptides to an MHC class II molecule.
Another very efficacious method for identifying T-cell epitopes by calculation is described in the EXAMPLE which is a preferred embodiment according to this invention.
In practice a number of variant interleukin-1 receptor antagonist (IL-1RA) proteins will be produced and tested for the desired immune and functional characteristic. The variant proteins will most preferably be produced by recombinant DNA techniques although other procedures including chemical synthesis of interleukin-1 receptor antagonist (IL- 1RA) fragments may be contemplated. : 15 The results of an analysis according to step (b) of the above scheme and pertaining to the ) human interleukin-1 receptor antagonist (IL-1RA) protein sequence of 152 amino acid residues is presented in Table 1.
Table 1: Peptide sequences in human interleukin-1 receptor antagonist (IL-1RA) with potential human MHC class II binding activity.
RKSSKMQAFRIWD, SKMQAFRIWDVNQ, QAFRIWDVNQKTF,
FRIWDVNQKTFYL, RIWDVNQKTFYLR, IWDVNQKTFYLRN,
WDVNQKTFYLRNN, KTFYLRNNQLVAG, TFYLRNNQLVAGY,
FYLRNNQLVAGYL, LRNNQLVAGYLQG, RNNQLVAGYLQGP,
NQLVAGYLQGPNV, QLVAGYLQGPNVN, LVAGYLQGPNVNL,
AGYLQGPNVNLEE, GYLQGPNVNLEEK, PNVNLEEKIDVVP,
UNLEEKIDVVPIE, EKIDVVPIEPHAL, IDVVPIEPHALFL,
DVVPIEPHALFLG, VPIEPHALFLGIH, HALFLGIHGGKMC,
ALFLGIHGGKMCL, LFLGIHGGKMCLS, LGIHGGKMCLSCV,
GKMCLSCVKSGDE, MCLSCVKSGDETR, SCVKSGDETRLQL, ‘ 30 ETRLQLEAVNITD, TRLQLEAVNITDL, LQLEAVNITDLSE,
EAVNITDLSENRK, VNITDLSENRKQD, TDLSENRKQDKRE, ’ ENRKQDKRFAFIR, KRFAFIRSDSGPT, FAFIRSDSGPTTS,
AFIRSDSGPTTSF, TSFESAACPGWFL, SFESAACPGWFLC,
PGWFLCTAMEADQ, WFLCTAMEADQPV, TAMEADQPVSLTN,
QPVSLTNMPDEGV, VSLTNMPDEGVMV, TNMPDEGVMVTKF,
PDEGVMVTKFYFQ, EGVMVTKFYFQED. GVMVTKFYFQEDE
Peptides are 13mers, amino acids are identified using single letter code.
The results of a design and constructs according to step (c) and (d) of the above scheme and pertaining to the modified molecule of this invention is presented in Tables 2 and 3. ;
Table 2: Substitutions leading to the elimination of potential T-cell epitopes of human . interleukin-1 receptor antagonist (IL-1RA) (WT = wild type).
M A C DE G H K N P Q R S T
13 F A C D E G H K N P Q R Ss T
I A C DE G H K N P Q R S T
16 Ww A C DE G H K N P Q R S T 18 v A C D E G H K N P Q R 5 T 23 F A C DE G H K N P Q R S T 24 Y A C D E G H K N P Q R S§ T
L A C DE G H K N P Q R S T
L AC DE G H K N P Q R S T
31 v A C DE G H K N P Q R 8S T 34 y A C D E G H K N P OQ R 5S T
L A C D E G H K N P QQ R 5S T 40 Vv A C D E G H K N P Q R S T 42 L A C DE G H K N P Q R S T 46 1 A C DE G H K N P QO R 5 T 48 v A ¢C D E G H K N P Q R S T 49 v A C DE G H K N P Q R S T 51 I1 AC DE G H K N P Q R SS T 56 L AC D E G H K N P Q R S T 57 F A C D E G H K N P Q R S T 58 L A C D E G H K N P Q R S T 60 1 A C D E G H K N P Q R SS T 65 M A C D E G H K N P Q R S§ T 67 L A C D E G H K N P QQ R S T 70 v A C D E G H K N P Q R S T 78 L A C DE G H K N P © R S§ T 80 L A C D E G H K N P Q R Ss T 83 Vv A C D E G H XK N P QQ R S T 85 I A C DE G HH K N P Q R 5 T 88 L A C D E G H K N P Q R § T 98 F A C D E G H XK N P QQ R S T 100 F A C D BE G H K N P QQ R Ss T 101 I A C D E G H K N P Q R S T 119 Ww A C D E G H K N P Q R S§ T 120 F A C D E G H K N P Q R SS T 121 L A C DE G H K N P Q R ST 125 M A C OD E G H K N P Q R S T : 131 v A C D E G H K N P Q R ST 133 L A C D E G H K N P Q R 5s T 136 M A C D E G H K N P Q R ST 141 v A C D E G H K N P QO R 8S T 142 M A C D E G H K N P Q R S T
Table 3: Additional substitutions leading to the removal of a potential T-cell epitope for 1 or more MHC allotypes.
Residue WT Lo 4 Residue Substitution
A 13 F WY
I F W Y
18 Vv F I L M W Y ¢ 19 N A C G Pp T
Q A C G H P
21 K Pp T 22 T A C G P 23 FE I
L F I M V W Y
26 R A C G P 27 N A C G P T 28 N A C G H P T 29 Q A C G H P
L IY
31 Vv F I M W Y 32 A H K N P Q S§ T 33 G D E H K N P Q R S T 34 Y M W
L F I M V W Y
36 Q A C G HH P 37 G D E H K N P Q R S T 39 N A C G PT 40 Vv F I M W Y 41 N A C E G P Ss 42 L F I M V W Y 43 E A C G H P T ’ 44 E A C G Pp : 45 K A C G Pp T 46 I M WY 47 D A C G H P 48 v I ¥Y - 50 Pp TT 51 I F WY 52 E A C G P 54 H Pp T 57 F M WY 60 I M V WY 61 H P : 62 G P 63 G P 64 K P 67 L F I M V WY 68 S A C G P T 70 Vv F I M W Y 71 K A C G H N P Q Ss T - 72 Ss A C D E G H N P Q 73 G C DE H K N P QO R Ss T 74 D A C G P 75 E A C D GG H K N P Q §S T 77 R A C G P 78 L F I Vv WwW ¥Y 80 L F I M V W Y 81 E A C G P 84 N A C G P 85 I F W Y 87 D A C G P
Residue WT Substituti # Residue ubstitution 88 L F I MM V W Y 89 Ss A C G P 90 E A C G H P 91 N H T 92 R A C G P 93 K D H T 94 Q T 95 D A C G P ’ 96 K H T 98 F M W 102 R A C G ©P 103 S H P 104 D P T 105 Ss A C G P 106 G D E H K N P Q R S§ T 108 T A C G P 121 L F I M V W Y 122 C H P T 123 T A C G P 124 A C D E G H K N P Q R S T 125 M F I WwW Y 126 E A C D G H P 127 A C D E G H XK N P Q R S T 128 D A C G P T 129 QO A C G H Pp T 130 Pp H P 131 v F I M W Y 132 Ss A C G ©P 133 L F I M V WwW Y 134 T P 135 N A C G P 136 M I WwW 138 D A C G P 139 E H N Pp 0 § T
The invention relates to interleukin-1 receptor antagonist (IL-1RA) analogues in which substitutions of at least one amino acid residue have been made at positions resulting ina substantial reduction in activity of or elimination of one or more potential T-cell epitopes from the protein. One or more amino acid substitutions at particular points within any of the potential MHC class II ligands identified in Table 1 may result in a interleukin-1 receptor antagonist (IL-1RA) molecule with a reduced immunogenic potential when administered as a therapeutic to the human host. Preferably, amino acid substitutions are made at appropriate points within the peptide sequence predicted to achieve substantial - reduction or elimination of the activity of the T-cell epitope. In practice an appropriate point will preferably equate to an amino acid residue binding within one of the hydrophobic pockets provided within the MHC class II binding groove.
Claims (29)
1. A modified molecule having the biological activity of interleukin-1 receptor antagonist (IL-1RA) and being substantially non-immunogenic or less . immunogenic than any non-modified molecule having the same biological activity when used in vivo. ~
2. A molecule according to claim 1, wherein said loss of immunogenicity is achieved by removing one or more T-cell epitopes derived from the originally non-modified molecule.
3. A molecule according to claim 1 or 2, wherein said loss of immunogenicity is achieved by reduction in numbers of MHC allotypes able to bind peptides derived from said molecule.
4. A molecule according to claim 2 or 3, wherein one T-cell epitope is removed. :
5. A molecule according to any of the claims 2 — 4, wherein said originally present T- cell epitopes are MHC class II ligands or peptide sequences which show the ability to stimulate or bind T-cells via presentation on class II.
6. A molecule according to claim 5, wherein said peptide sequences are selected from the group as depicted in Table 1.
7. A molecule according to any of the claims 2 — 6, wherein 1 — 9 amino acid residues in any of the onginally present T-cell epitopes are altered.
8. A molecule according to claim 7, wherein one amino acid residue is altered.
9. A molecule according to claim 7 or §, wherein the alteration of the amino acid : residues is substitution of originally present amino acid(s) residue(s) by other amino acid residue(s) at specific position(s).
10. A molecule according to claim 9, wherein one or more of the amino acid residue substitutions are carried out as indicated in Table 2. .
11. A molecule according to claim 10, wherein additionally one or more of the amino acid residue substitutions are carried out as indicated in Table 3 for the reduction in - the number of MHC allotypes able to bind peptides derived from said molecule.
12. A molecule according to claim 9, wherein one or more amino acid substitutions are carried as indicated in Table 3.
13. A molecule according to claim 7 or 8, wherein the alteration of the amino acid residues is deletion of originally present amino acid(s) residue(s) at specific position(s).
14. A molecule according to claim 7 or 8, wherein the alteration of the amino acid residues is addition of amino acid(s) at specific position(s) to those originally present. :
15. A molecule according to any of the claims 7 to 14, wherein additionally further alteration is conducted to restore biological activity of said molecule.
16. A molecule according to claim 15, wherein the additional further alteration is substitution, addition or deletion of specific amino acid(s).
17. A modified molecule according to any of the claims 7 — 16, wherein the amino acid alteration is made with reference to an homologous protein sequence.
18. A modified molecule according to any of the claims 7 — 16, wherein the amino acid : alteration is made with reference to in silico modeling techniques.
19. A DNA sequence coding for a modified interleukin-1 receptor antagonist (IL-1RA) of any of the claims 1 — 18.
20. A pharmaceutical composition comprising a modified molecule having the biological activity of interleukin-1 receptor antagonist (IL-1RA) as defined in any of the above-cited claims, optionally together with a pharmaceutically acceptable carrier, diluent or excipient. )
21. A method for manufacturing a modified molecule having the biological activity of h interleukin-1 receptor antagonist (IL-1RA) as defined in any of the claims of the above-cited claims comprising the following steps: (i) determining the amino acid sequence of the polypeptide or part thereof. (ii) identifying one or more potential T-cell epitopes within the amino acid sequence of the protein by any method including determination of the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays; (iii) designing new sequence variants with one or more amino acids within the identified potential T-cell epitopes modified in such a way to substantially reduce or eliminate the activity of the T-cell epitope as determined by the binding of the peptides to MHC molecules using in vitro or in silico techniques or biological assays, or by binding of peptide-MHC complexes to T-cells; (iv) constructing such sequence variants by recombinant DNA techniques and testing said variants in order to identify one or more variants with desirable properties; and (v) optionally repeating steps (it) — (iv).
22. A method of claim 21, wherein step (iii) is carried out by substitution, addition or deletion of 1 — 9 amino acid residues in any of the originally present T-cell epitopes.
23. A method of claim 22, wherein the alteration is made with reference to a homologues protein sequence and / or in silico modeling techniques.
24. A method of any of the claims 21 — 23, wherein step (i1) 1s carried out by the ’ following steps: (a) selecting a region of the peptide having a known amino acid residue sequence; (b) sequentially sampling overlapping amino acid residue segments of predetermined uniform size and constituted by at least three amino acid residues from the selected region; (c) calculating MHC Class II molecule binding score for each said sampled segment by summing assigned values for each hydrophobic amino acid residue side chain present in said sampled amino acid residue segment; and (d) identifying at least one of said segments suitable for modification, based on the calculated MHC Class IT molecule binding score for that segment, to change overall MHC Class II binding score for the peptide without 5 substantially reducing therapeutic utility of the peptide.
25. A method of claim 24, wherein step (c) is carried out by using a Bshm scoring function modified to include 12-6 van der Waal's ligand-protein energy repulsive term and ligand conformational energy term by (1) providing a first data base of MHC Class II molecule models; (2) providing a second data base of allowed peptide backbones for said MHC Class II molecule models; (3) selecting a model from said first data base; (4) selecting an allowed peptide backbone from said second data base; (5) identifying amino acid residue side chains present in each sampled segment; (6) determining the binding affinity value for all side chains present in each sampled segment; and repeating steps (1) through (5) for each said model and each said backbone.
26. A 13mer T-cell epitope peptide having a potential MHC class II binding activity and created from immunogenically non-modified interleukin-1 receptor antagonist (IL-1RA), selected from the group as depicted in Table 1.
27. A peptide sequence consisting of at least 9 consecutive amino acid residues of a 13mer T-cell epitope peptide according to claim 26.
28. Use ofa 13mer T-cell epitope peptide according to claim 26 for the manufacture of interleukin-1 receptor antagonist (IL-1RA) having substantially no or less immunogenicity than any non-modified molecule with the same biological activity when used in vivo.
29. Use of a peptide sequence according to claim 27 for the manufacture of interleukin- 1 receptor antagonist (IL-1RA) having substantially no or. less immunogenicity than any non-modified molecule with the same biological activity when used in vivo.
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
EP01102573 | 2001-02-06 |
Publications (1)
Publication Number | Publication Date |
---|---|
ZA200306933B true ZA200306933B (en) | 2004-09-09 |
Family
ID=34112440
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
ZA200306933A ZA200306933B (en) | 2001-02-06 | 2003-09-04 | Modified interleukin-1 receptor antagonist (IL-1RA) with reduced immunogenicity. |
Country Status (1)
Country | Link |
---|---|
ZA (1) | ZA200306933B (en) |
-
2003
- 2003-09-04 ZA ZA200306933A patent/ZA200306933B/en unknown
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US20040072291A1 (en) | Modified human brain-derived neutrophic factor (bdnf) with reduced immunogenicity | |
CA2437265A1 (en) | Modified leptin with reduced immunogenicity | |
US20040063917A1 (en) | Modified erythropoietin (epo) with reduced immunogenicity | |
ZA200307678B (en) | Modified ciliary neurotrophic factor (CNTF) with reduced immunogenicity. | |
US20040076991A1 (en) | Modified interleukin-1 receptor antagonist(il-1ra) with reduced immunogenicity | |
EP1366074B1 (en) | Modified granulocyte macrophage colony stimulating factor (gm-csf) with reduced immunogenicity | |
JP2004535173A (en) | Modified interferon alpha with reduced immunogenicity | |
US20040121443A1 (en) | Modified protamine with reduced immunogenicity | |
US7392141B2 (en) | Method of preparing a modified granulocyte colony stimulating factor (G-CSF) with reduced immunogenicity | |
ZA200306933B (en) | Modified interleukin-1 receptor antagonist (IL-1RA) with reduced immunogenicity. | |
CA2437270A1 (en) | Modified keratinocyte growth factor (kgf) with reduced immunogenicity | |
ZA200307468B (en) | Modified thrombopoietin with reduced immunogenicity. | |
ZA200308061B (en) | Modified insulin with reduced immunogenicity. | |
ZA200306930B (en) | Modified erythropoietin (EPO) with reduced immunogenecity. | |
ZA200306931B (en) | Modified granulocyte colony stimulating factor (G-CSF) with reduced immunogenicity. | |
ZA200306934B (en) | Modified Keratinocyte growth factor (KGF) with reduced immunogenicity. | |
ZA200306926B (en) | Modified leptin with reduced immunogenicity. | |
ZA200306924B (en) | Modified human brain-derived neutrophic factor (BDNF) with reduced immunogenicity. | |
AU2002257579A1 (en) | Modified granulocyte colony stimulating factor (G-CSF) with reduced immunogenicity | |
AU2002242715A1 (en) | Modified protamine with reduced immunogenicity | |
AU2002229744A1 (en) | Modified interleukin-1 receptor antagonist (IL-1RA) with reduced immunogenicity | |
AU2002238530A1 (en) | Modified human brain-derived neutrophic factor (BDNF) with reduced immunogenicity | |
AU2002250889A1 (en) | Modified erythropoietin (EPO) with reduced immunogenicity | |
AU2002249180A1 (en) | Modified keratinocyte growth factor (KGF) with reduced immunogenicity |