ZA200207001B - Vaccine for the treatment of artherosclerosis. - Google Patents
Vaccine for the treatment of artherosclerosis. Download PDFInfo
- Publication number
- ZA200207001B ZA200207001B ZA200207001A ZA200207001A ZA200207001B ZA 200207001 B ZA200207001 B ZA 200207001B ZA 200207001 A ZA200207001 A ZA 200207001A ZA 200207001 A ZA200207001 A ZA 200207001A ZA 200207001 B ZA200207001 B ZA 200207001B
- Authority
- ZA
- South Africa
- Prior art keywords
- apolipoprotein
- peptide
- inhibition
- present
- atherosclerosis
- Prior art date
Links
- 229960005486 vaccine Drugs 0.000 title claims description 39
- 238000011282 treatment Methods 0.000 title claims description 24
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 88
- 102000007592 Apolipoproteins Human genes 0.000 claims description 79
- 108010071619 Apolipoproteins Proteins 0.000 claims description 79
- 238000000034 method Methods 0.000 claims description 49
- 201000001320 Atherosclerosis Diseases 0.000 claims description 48
- 230000000694 effects Effects 0.000 claims description 36
- 230000002163 immunogen Effects 0.000 claims description 36
- 102000004895 Lipoproteins Human genes 0.000 claims description 33
- 108090001030 Lipoproteins Proteins 0.000 claims description 33
- 241000282414 Homo sapiens Species 0.000 claims description 32
- 239000012634 fragment Substances 0.000 claims description 26
- 238000011321 prophylaxis Methods 0.000 claims description 23
- 102000018616 Apolipoproteins B Human genes 0.000 claims description 22
- 108010027006 Apolipoproteins B Proteins 0.000 claims description 22
- 230000005764 inhibitory process Effects 0.000 claims description 22
- 239000003446 ligand Substances 0.000 claims description 22
- 230000027455 binding Effects 0.000 claims description 21
- 108010013563 Lipoprotein Lipase Proteins 0.000 claims description 20
- 239000000203 mixture Substances 0.000 claims description 20
- 102000004169 proteins and genes Human genes 0.000 claims description 19
- 108090000623 proteins and genes Proteins 0.000 claims description 19
- 239000002671 adjuvant Substances 0.000 claims description 15
- 239000003795 chemical substances by application Substances 0.000 claims description 10
- 230000028993 immune response Effects 0.000 claims description 10
- 230000002401 inhibitory effect Effects 0.000 claims description 10
- 230000000923 atherogenic effect Effects 0.000 claims description 9
- 101710095342 Apolipoprotein B Proteins 0.000 claims description 6
- 102100040202 Apolipoprotein B-100 Human genes 0.000 claims description 6
- 102000007079 Peptide Fragments Human genes 0.000 claims description 4
- 108010033276 Peptide Fragments Proteins 0.000 claims description 4
- 102000004882 Lipase Human genes 0.000 claims description 3
- 108090001060 Lipase Proteins 0.000 claims description 3
- 239000004367 Lipase Substances 0.000 claims description 3
- 235000019421 lipase Nutrition 0.000 claims description 3
- 230000001404 mediated effect Effects 0.000 claims description 3
- 102100022119 Lipoprotein lipase Human genes 0.000 claims 1
- 230000001939 inductive effect Effects 0.000 claims 1
- 102000004196 processed proteins & peptides Human genes 0.000 description 42
- 108010056301 Apolipoprotein C-III Proteins 0.000 description 38
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 37
- 102000030169 Apolipoprotein C-III Human genes 0.000 description 35
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 25
- 239000002953 phosphate buffered saline Substances 0.000 description 25
- 101000650578 Salmonella phage P22 Regulatory protein C3 Proteins 0.000 description 24
- 101001040920 Triticum aestivum Alpha-amylase inhibitor 0.28 Proteins 0.000 description 24
- 108010062497 VLDL Lipoproteins Proteins 0.000 description 23
- 150000001413 amino acids Chemical class 0.000 description 23
- 235000001014 amino acid Nutrition 0.000 description 21
- 108091003079 Bovine Serum Albumin Proteins 0.000 description 18
- 102000043296 Lipoprotein lipases Human genes 0.000 description 18
- 229940098773 bovine serum albumin Drugs 0.000 description 18
- 235000012000 cholesterol Nutrition 0.000 description 18
- 235000018102 proteins Nutrition 0.000 description 17
- 108010007622 LDL Lipoproteins Proteins 0.000 description 15
- 102000007330 LDL Lipoproteins Human genes 0.000 description 14
- 210000004027 cell Anatomy 0.000 description 12
- 239000003814 drug Substances 0.000 description 10
- 239000002609 medium Substances 0.000 description 10
- 108020003175 receptors Proteins 0.000 description 10
- 102000005962 receptors Human genes 0.000 description 10
- 239000000872 buffer Substances 0.000 description 9
- 201000010099 disease Diseases 0.000 description 9
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 9
- 238000002560 therapeutic procedure Methods 0.000 description 9
- 102000014914 Carrier Proteins Human genes 0.000 description 8
- 108010078791 Carrier Proteins Proteins 0.000 description 8
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 8
- 230000006870 function Effects 0.000 description 8
- 239000002245 particle Substances 0.000 description 8
- 239000011347 resin Substances 0.000 description 8
- 229920005989 resin Polymers 0.000 description 8
- 210000002966 serum Anatomy 0.000 description 8
- 101000793223 Homo sapiens Apolipoprotein C-III Proteins 0.000 description 7
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 7
- 230000004087 circulation Effects 0.000 description 7
- 150000002632 lipids Chemical class 0.000 description 7
- 238000004519 manufacturing process Methods 0.000 description 7
- 239000000243 solution Substances 0.000 description 7
- QMMFVYPAHWMCMS-UHFFFAOYSA-N Dimethyl sulfide Chemical compound CSC QMMFVYPAHWMCMS-UHFFFAOYSA-N 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 239000000427 antigen Substances 0.000 description 6
- 108091007433 antigens Proteins 0.000 description 6
- 102000036639 antigens Human genes 0.000 description 6
- 238000011161 development Methods 0.000 description 6
- 230000018109 developmental process Effects 0.000 description 6
- 208000037260 Atherosclerotic Plaque Diseases 0.000 description 5
- 102100037840 Dehydrogenase/reductase SDR family member 2, mitochondrial Human genes 0.000 description 5
- 241000283973 Oryctolagus cuniculus Species 0.000 description 5
- 101710188053 Protein D Proteins 0.000 description 5
- 101710132893 Resolvase Proteins 0.000 description 5
- 210000001744 T-lymphocyte Anatomy 0.000 description 5
- 239000007983 Tris buffer Substances 0.000 description 5
- 238000006243 chemical reaction Methods 0.000 description 5
- 238000011534 incubation Methods 0.000 description 5
- JJAHTWIKCUJRDK-UHFFFAOYSA-N succinimidyl 4-(N-maleimidomethyl)cyclohexane-1-carboxylate Chemical compound C1CC(CN2C(C=CC2=O)=O)CCC1C(=O)ON1C(=O)CCC1=O JJAHTWIKCUJRDK-UHFFFAOYSA-N 0.000 description 5
- LENZDBCJOHFCAS-UHFFFAOYSA-N tris Chemical compound OCC(N)(CO)CO LENZDBCJOHFCAS-UHFFFAOYSA-N 0.000 description 5
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 4
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 4
- 241001465754 Metazoa Species 0.000 description 4
- 241001529936 Murinae Species 0.000 description 4
- 241000699670 Mus sp. Species 0.000 description 4
- HEMHJVSKTPXQMS-UHFFFAOYSA-M Sodium hydroxide Chemical compound [OH-].[Na+] HEMHJVSKTPXQMS-UHFFFAOYSA-M 0.000 description 4
- UZQJVUCHXGYFLQ-AYDHOLPZSA-N [(2s,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-4-[(2r,3r,4s,5r,6r)-4-[(2s,3r,4s,5r,6r)-3,5-dihydroxy-6-(hydroxymethyl)-4-[(2s,3r,4s,5s,6r)-3,4,5-trihydroxy-6-(hydroxymethyl)oxan-2-yl]oxyoxan-2-yl]oxy-3,5-dihydroxy-6-(hydroxymethyl)oxan-2-yl]oxy-3,5-dihydroxy-6-(hy Chemical compound O([C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1[C@H](O)[C@@H](CO)O[C@H]([C@@H]1O)O[C@H]1CC[C@]2(C)[C@H]3CC=C4[C@@]([C@@]3(CC[C@H]2[C@@]1(C=O)C)C)(C)CC(O)[C@]1(CCC(CC14)(C)C)C(=O)O[C@H]1[C@@H]([C@@H](O[C@H]2[C@@H]([C@@H](O[C@H]3[C@@H]([C@@H](O[C@H]4[C@@H]([C@@H](O[C@H]5[C@@H]([C@@H](O)[C@H](O)[C@@H](CO)O5)O)[C@H](O)[C@@H](CO)O4)O)[C@H](O)[C@@H](CO)O3)O)[C@H](O)[C@@H](CO)O2)O)[C@H](O)[C@@H](CO)O1)O)[C@@H]1O[C@H](CO)[C@@H](O)[C@H](O)[C@H]1O UZQJVUCHXGYFLQ-AYDHOLPZSA-N 0.000 description 4
- 238000007792 addition Methods 0.000 description 4
- 230000002788 anti-peptide Effects 0.000 description 4
- 239000000969 carrier Substances 0.000 description 4
- 230000001413 cellular effect Effects 0.000 description 4
- 230000021615 conjugation Effects 0.000 description 4
- 238000005859 coupling reaction Methods 0.000 description 4
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 4
- 230000002255 enzymatic effect Effects 0.000 description 4
- 230000014509 gene expression Effects 0.000 description 4
- 230000002209 hydrophobic effect Effects 0.000 description 4
- 230000003902 lesion Effects 0.000 description 4
- 239000002502 liposome Substances 0.000 description 4
- 108020004707 nucleic acids Proteins 0.000 description 4
- 102000039446 nucleic acids Human genes 0.000 description 4
- 150000007523 nucleic acids Chemical class 0.000 description 4
- IWDCLRJOBJJRNH-UHFFFAOYSA-N p-cresol Chemical compound CC1=CC=C(O)C=C1 IWDCLRJOBJJRNH-UHFFFAOYSA-N 0.000 description 4
- 239000000126 substance Substances 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 238000012360 testing method Methods 0.000 description 4
- 238000002255 vaccination Methods 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 102100030970 Apolipoprotein C-III Human genes 0.000 description 3
- 108091016585 CD44 antigen Proteins 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- 102000008055 Heparan Sulfate Proteoglycans Human genes 0.000 description 3
- 229920002971 Heparan sulfate Polymers 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 229920002684 Sepharose Polymers 0.000 description 3
- 108090000054 Syndecan-2 Proteins 0.000 description 3
- 238000009825 accumulation Methods 0.000 description 3
- 210000001367 artery Anatomy 0.000 description 3
- 230000015572 biosynthetic process Effects 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- 230000017531 blood circulation Effects 0.000 description 3
- 230000008878 coupling Effects 0.000 description 3
- 238000010168 coupling process Methods 0.000 description 3
- 230000034994 death Effects 0.000 description 3
- 231100000517 death Toxicity 0.000 description 3
- 229940079593 drug Drugs 0.000 description 3
- 239000000839 emulsion Substances 0.000 description 3
- 230000001227 hypertriglyceridemic effect Effects 0.000 description 3
- 238000002649 immunization Methods 0.000 description 3
- 230000005847 immunogenicity Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 238000010348 incorporation Methods 0.000 description 3
- 230000001965 increasing effect Effects 0.000 description 3
- 238000002347 injection Methods 0.000 description 3
- 239000007924 injection Substances 0.000 description 3
- 238000002955 isolation Methods 0.000 description 3
- 229940035032 monophosphoryl lipid a Drugs 0.000 description 3
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 230000007505 plaque formation Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 238000000163 radioactive labelling Methods 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 238000003259 recombinant expression Methods 0.000 description 3
- 229930182490 saponin Natural products 0.000 description 3
- 150000007949 saponins Chemical class 0.000 description 3
- 235000017709 saponins Nutrition 0.000 description 3
- 239000011780 sodium chloride Substances 0.000 description 3
- 239000007790 solid phase Substances 0.000 description 3
- -1 succinimide ester Chemical class 0.000 description 3
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 3
- WLHCBQAPPJAULW-UHFFFAOYSA-N 4-methylbenzenethiol Chemical compound CC1=CC=C(S)C=C1 WLHCBQAPPJAULW-UHFFFAOYSA-N 0.000 description 2
- 102000009027 Albumins Human genes 0.000 description 2
- 108010088751 Albumins Proteins 0.000 description 2
- 206010002383 Angina Pectoris Diseases 0.000 description 2
- 102000012336 Cholesterol Ester Transfer Proteins Human genes 0.000 description 2
- 108010061846 Cholesterol Ester Transfer Proteins Proteins 0.000 description 2
- 108010004103 Chylomicrons Proteins 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- YCAGGFXSFQFVQL-UHFFFAOYSA-N Endothion Chemical compound COC1=COC(CSP(=O)(OC)OC)=CC1=O YCAGGFXSFQFVQL-UHFFFAOYSA-N 0.000 description 2
- KRHYYFGTRYWZRS-UHFFFAOYSA-N Fluorane Chemical compound F KRHYYFGTRYWZRS-UHFFFAOYSA-N 0.000 description 2
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N Glutamine Chemical compound OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 2
- 239000004471 Glycine Substances 0.000 description 2
- 108010010234 HDL Lipoproteins Proteins 0.000 description 2
- 102000015779 HDL Lipoproteins Human genes 0.000 description 2
- 241000606768 Haemophilus influenzae Species 0.000 description 2
- 108010046315 IDL Lipoproteins Proteins 0.000 description 2
- 206010022562 Intermittent claudication Diseases 0.000 description 2
- 102000000853 LDL receptors Human genes 0.000 description 2
- 108010001831 LDL receptors Proteins 0.000 description 2
- 241000124008 Mammalia Species 0.000 description 2
- 241000712079 Measles morbillivirus Species 0.000 description 2
- JGFZNNIVVJXRND-UHFFFAOYSA-N N,N-Diisopropylethylamine (DIPEA) Chemical compound CCN(C(C)C)C(C)C JGFZNNIVVJXRND-UHFFFAOYSA-N 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 208000006011 Stroke Diseases 0.000 description 2
- 238000002835 absorbance Methods 0.000 description 2
- 238000001042 affinity chromatography Methods 0.000 description 2
- 238000013459 approach Methods 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- 230000036523 atherogenesis Effects 0.000 description 2
- 230000003143 atherosclerotic effect Effects 0.000 description 2
- 230000001580 bacterial effect Effects 0.000 description 2
- RIIWUGSYXOBDMC-UHFFFAOYSA-N benzene-1,2-diamine;hydron;dichloride Chemical compound Cl.Cl.NC1=CC=CC=C1N RIIWUGSYXOBDMC-UHFFFAOYSA-N 0.000 description 2
- 210000004204 blood vessel Anatomy 0.000 description 2
- 244000309466 calf Species 0.000 description 2
- 208000026106 cerebrovascular disease Diseases 0.000 description 2
- 238000007385 chemical modification Methods 0.000 description 2
- 150000001840 cholesterol esters Chemical class 0.000 description 2
- 208000037516 chromosome inversion disease Diseases 0.000 description 2
- 239000000562 conjugate Substances 0.000 description 2
- 230000000875 corresponding effect Effects 0.000 description 2
- 235000018417 cysteine Nutrition 0.000 description 2
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 2
- 238000000502 dialysis Methods 0.000 description 2
- 238000010790 dilution Methods 0.000 description 2
- 239000012895 dilution Substances 0.000 description 2
- 239000006627 dpm medium Substances 0.000 description 2
- 235000021588 free fatty acids Nutrition 0.000 description 2
- 230000004927 fusion Effects 0.000 description 2
- 229940047650 haemophilus influenzae Drugs 0.000 description 2
- 229910000040 hydrogen fluoride Inorganic materials 0.000 description 2
- 230000008105 immune reaction Effects 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 238000009169 immunotherapy Methods 0.000 description 2
- 208000021156 intermittent vascular claudication Diseases 0.000 description 2
- 108010045069 keyhole-limpet hemocyanin Proteins 0.000 description 2
- 210000003734 kidney Anatomy 0.000 description 2
- 239000010410 layer Substances 0.000 description 2
- 230000004130 lipolysis Effects 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- 230000004060 metabolic process Effects 0.000 description 2
- 208000010125 myocardial infarction Diseases 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 238000010647 peptide synthesis reaction Methods 0.000 description 2
- 102000013415 peroxidase activity proteins Human genes 0.000 description 2
- 108040007629 peroxidase activity proteins Proteins 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- 239000012071 phase Substances 0.000 description 2
- 239000007981 phosphate-citrate buffer Substances 0.000 description 2
- 229920001184 polypeptide Polymers 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 229940070741 purified protein derivative of tuberculin Drugs 0.000 description 2
- 239000001397 quillaja saponaria molina bark Substances 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 230000002829 reductive effect Effects 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 229920006395 saturated elastomer Polymers 0.000 description 2
- 238000010532 solid phase synthesis reaction Methods 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 238000006467 substitution reaction Methods 0.000 description 2
- 239000000725 suspension Substances 0.000 description 2
- 238000003786 synthesis reaction Methods 0.000 description 2
- 230000009885 systemic effect Effects 0.000 description 2
- 239000003053 toxin Substances 0.000 description 2
- 231100000765 toxin Toxicity 0.000 description 2
- 108700012359 toxins Proteins 0.000 description 2
- 150000003626 triacylglycerols Chemical class 0.000 description 2
- UFTFJSFQGQCHQW-UHFFFAOYSA-N triformin Chemical compound O=COCC(OC=O)COC=O UFTFJSFQGQCHQW-UHFFFAOYSA-N 0.000 description 2
- 238000005199 ultracentrifugation Methods 0.000 description 2
- JWDFQMWEFLOOED-UHFFFAOYSA-N (2,5-dioxopyrrolidin-1-yl) 3-(pyridin-2-yldisulfanyl)propanoate Chemical compound O=C1CCC(=O)N1OC(=O)CCSSC1=CC=CC=N1 JWDFQMWEFLOOED-UHFFFAOYSA-N 0.000 description 1
- ONOURAAVVKGJNM-SCZZXKLOSA-N (2s,3r)-2-azaniumyl-3-phenylmethoxybutanoate Chemical compound [O-]C(=O)[C@@H]([NH3+])[C@@H](C)OCC1=CC=CC=C1 ONOURAAVVKGJNM-SCZZXKLOSA-N 0.000 description 1
- YYGNTYWPHWGJRM-UHFFFAOYSA-N (6E,10E,14E,18E)-2,6,10,15,19,23-hexamethyltetracosa-2,6,10,14,18,22-hexaene Chemical compound CC(C)=CCCC(C)=CCCC(C)=CCCC=C(C)CCC=C(C)CCC=C(C)C YYGNTYWPHWGJRM-UHFFFAOYSA-N 0.000 description 1
- JMTMSDXUXJISAY-UHFFFAOYSA-N 2H-benzotriazol-4-ol Chemical compound OC1=CC=CC2=C1N=NN2 JMTMSDXUXJISAY-UHFFFAOYSA-N 0.000 description 1
- 108010068327 4-hydroxyphenylpyruvate dioxygenase Proteins 0.000 description 1
- 108010042708 Acetylmuramyl-Alanyl-Isoglutamine Proteins 0.000 description 1
- 241000415078 Anemone hepatica Species 0.000 description 1
- 101150102415 Apob gene Proteins 0.000 description 1
- 108010024284 Apolipoprotein C-II Proteins 0.000 description 1
- 102100029470 Apolipoprotein E Human genes 0.000 description 1
- 101710095339 Apolipoprotein E Proteins 0.000 description 1
- 102000018655 Apolipoproteins C Human genes 0.000 description 1
- 108010027070 Apolipoproteins C Proteins 0.000 description 1
- 102000013918 Apolipoproteins E Human genes 0.000 description 1
- 108010025628 Apolipoproteins E Proteins 0.000 description 1
- 206010003210 Arteriosclerosis Diseases 0.000 description 1
- 231100000699 Bacterial toxin Toxicity 0.000 description 1
- 101710132601 Capsid protein Proteins 0.000 description 1
- 206010008190 Cerebrovascular accident Diseases 0.000 description 1
- 241000819038 Chichester Species 0.000 description 1
- 102000001189 Cyclic Peptides Human genes 0.000 description 1
- 108010069514 Cyclic Peptides Proteins 0.000 description 1
- 102000004127 Cytokines Human genes 0.000 description 1
- 108090000695 Cytokines Proteins 0.000 description 1
- QOSSAOTZNIDXMA-UHFFFAOYSA-N Dicylcohexylcarbodiimide Chemical compound C1CCCCC1N=C=NC1CCCCC1 QOSSAOTZNIDXMA-UHFFFAOYSA-N 0.000 description 1
- 238000012286 ELISA Assay Methods 0.000 description 1
- 102000010834 Extracellular Matrix Proteins Human genes 0.000 description 1
- 108010037362 Extracellular Matrix Proteins Proteins 0.000 description 1
- 206010017711 Gangrene Diseases 0.000 description 1
- SXRSQZLOMIGNAQ-UHFFFAOYSA-N Glutaraldehyde Chemical compound O=CCCCC=O SXRSQZLOMIGNAQ-UHFFFAOYSA-N 0.000 description 1
- 101001015673 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) Glycerophosphodiester phosphodiesterase Proteins 0.000 description 1
- 102000019267 Hepatic lipases Human genes 0.000 description 1
- 108050006747 Hepatic lipases Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- 238000012404 In vitro experiment Methods 0.000 description 1
- 206010022657 Intestinal infarction Diseases 0.000 description 1
- 206010022680 Intestinal ischaemia Diseases 0.000 description 1
- 238000005588 Kraus reaction Methods 0.000 description 1
- QEFRNWWLZKMPFJ-YGVKFDHGSA-N L-methionine S-oxide Chemical compound CS(=O)CC[C@H](N)C(O)=O QEFRNWWLZKMPFJ-YGVKFDHGSA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 101710164702 Major outer membrane protein Proteins 0.000 description 1
- PEEHTFAAVSWFBL-UHFFFAOYSA-N Maleimide Chemical compound O=C1NC(=O)C=C1 PEEHTFAAVSWFBL-UHFFFAOYSA-N 0.000 description 1
- 208000004535 Mesenteric Ischemia Diseases 0.000 description 1
- 241001092142 Molina Species 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 108091034117 Oligonucleotide Proteins 0.000 description 1
- 208000031481 Pathologic Constriction Diseases 0.000 description 1
- 208000031816 Pathologic Dilatation Diseases 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 108010081690 Pertussis Toxin Proteins 0.000 description 1
- 241000276498 Pollachius virens Species 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 241001092473 Quillaja Species 0.000 description 1
- 235000009001 Quillaja saponaria Nutrition 0.000 description 1
- 208000004531 Renal Artery Obstruction Diseases 0.000 description 1
- 206010038378 Renal artery stenosis Diseases 0.000 description 1
- 241000219287 Saponaria Species 0.000 description 1
- 208000034189 Sclerosis Diseases 0.000 description 1
- PMZURENOXWZQFD-UHFFFAOYSA-L Sodium Sulfate Chemical compound [Na+].[Na+].[O-]S([O-])(=O)=O PMZURENOXWZQFD-UHFFFAOYSA-L 0.000 description 1
- 206010043376 Tetanus Diseases 0.000 description 1
- 108010055044 Tetanus Toxin Proteins 0.000 description 1
- BHEOSNUKNHRBNM-UHFFFAOYSA-N Tetramethylsqualene Natural products CC(=C)C(C)CCC(=C)C(C)CCC(C)=CCCC=C(C)CCC(C)C(=C)CCC(C)C(C)=C BHEOSNUKNHRBNM-UHFFFAOYSA-N 0.000 description 1
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 1
- 239000004473 Threonine Substances 0.000 description 1
- 208000007536 Thrombosis Diseases 0.000 description 1
- 239000013504 Triton X-100 Substances 0.000 description 1
- 229920004890 Triton X-100 Polymers 0.000 description 1
- 208000027418 Wounds and injury Diseases 0.000 description 1
- 108010021836 Yersinia invasin Proteins 0.000 description 1
- JLCPHMBAVCMARE-UHFFFAOYSA-N [3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[3-[[3-[[3-[[3-[[3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-[[5-(2-amino-6-oxo-1H-purin-9-yl)-3-hydroxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxyoxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(5-methyl-2,4-dioxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(6-aminopurin-9-yl)oxolan-2-yl]methoxy-hydroxyphosphoryl]oxy-5-(4-amino-2-oxopyrimidin-1-yl)oxolan-2-yl]methyl [5-(6-aminopurin-9-yl)-2-(hydroxymethyl)oxolan-3-yl] hydrogen phosphate Polymers Cc1cn(C2CC(OP(O)(=O)OCC3OC(CC3OP(O)(=O)OCC3OC(CC3O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c3nc(N)[nH]c4=O)C(COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3COP(O)(=O)OC3CC(OC3CO)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3ccc(N)nc3=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cc(C)c(=O)[nH]c3=O)n3cc(C)c(=O)[nH]c3=O)n3ccc(N)nc3=O)n3cc(C)c(=O)[nH]c3=O)n3cnc4c3nc(N)[nH]c4=O)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)n3cnc4c(N)ncnc34)O2)c(=O)[nH]c1=O JLCPHMBAVCMARE-UHFFFAOYSA-N 0.000 description 1
- 230000001154 acute effect Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- XAGFODPZIPBFFR-UHFFFAOYSA-N aluminium Chemical compound [Al] XAGFODPZIPBFFR-UHFFFAOYSA-N 0.000 description 1
- 229910052782 aluminium Inorganic materials 0.000 description 1
- 239000004411 aluminium Substances 0.000 description 1
- 159000000013 aluminium salts Chemical class 0.000 description 1
- 229910000329 aluminium sulfate Inorganic materials 0.000 description 1
- 230000001668 ameliorated effect Effects 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 238000010171 animal model Methods 0.000 description 1
- 230000005875 antibody response Effects 0.000 description 1
- 210000000709 aorta Anatomy 0.000 description 1
- 208000011775 arteriosclerosis disease Diseases 0.000 description 1
- 239000012298 atmosphere Substances 0.000 description 1
- 210000003719 b-lymphocyte Anatomy 0.000 description 1
- 239000000688 bacterial toxin Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 230000033228 biological regulation Effects 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 239000012888 bovine serum Substances 0.000 description 1
- 239000006227 byproduct Substances 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 159000000007 calcium salts Chemical class 0.000 description 1
- 150000001718 carbodiimides Chemical class 0.000 description 1
- 210000003169 central nervous system Anatomy 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 238000004587 chromatography analysis Methods 0.000 description 1
- 230000001684 chronic effect Effects 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 238000010367 cloning Methods 0.000 description 1
- 239000000470 constituent Substances 0.000 description 1
- 238000007796 conventional method Methods 0.000 description 1
- 208000029078 coronary artery disease Diseases 0.000 description 1
- 210000004351 coronary vessel Anatomy 0.000 description 1
- 230000002596 correlated effect Effects 0.000 description 1
- 239000012043 crude product Substances 0.000 description 1
- 230000006378 damage Effects 0.000 description 1
- 230000007423 decrease Effects 0.000 description 1
- 238000012217 deletion Methods 0.000 description 1
- 230000037430 deletion Effects 0.000 description 1
- 230000008021 deposition Effects 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 235000005911 diet Nutrition 0.000 description 1
- 230000037213 diet Effects 0.000 description 1
- KZNICNPSHKQLFF-UHFFFAOYSA-N dihydromaleimide Natural products O=C1CCC(=O)N1 KZNICNPSHKQLFF-UHFFFAOYSA-N 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 238000002224 dissection Methods 0.000 description 1
- 239000012153 distilled water Substances 0.000 description 1
- PRAKJMSDJKAYCZ-UHFFFAOYSA-N dodecahydrosqualene Natural products CC(C)CCCC(C)CCCC(C)CCCCC(C)CCCC(C)CCCC(C)C PRAKJMSDJKAYCZ-UHFFFAOYSA-N 0.000 description 1
- 238000010828 elution Methods 0.000 description 1
- 239000002158 endotoxin Substances 0.000 description 1
- 238000005516 engineering process Methods 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 238000001704 evaporation Methods 0.000 description 1
- 230000008020 evaporation Effects 0.000 description 1
- 238000002474 experimental method Methods 0.000 description 1
- 210000002744 extracellular matrix Anatomy 0.000 description 1
- 210000000497 foam cell Anatomy 0.000 description 1
- 238000009472 formulation Methods 0.000 description 1
- 238000005194 fractionation Methods 0.000 description 1
- 230000005714 functional activity Effects 0.000 description 1
- 125000002519 galactosyl group Chemical group C1([C@H](O)[C@@H](O)[C@@H](O)[C@H](O1)CO)* 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 230000036252 glycation Effects 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- YMAWOPBAYDPSLA-UHFFFAOYSA-N glycylglycine Chemical compound [NH3+]CC(=O)NCC([O-])=O YMAWOPBAYDPSLA-UHFFFAOYSA-N 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 230000002440 hepatic effect Effects 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 238000004128 high performance liquid chromatography Methods 0.000 description 1
- 210000004408 hybridoma Anatomy 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- NPZTUJOABDZTLV-UHFFFAOYSA-N hydroxybenzotriazole Substances O=C1C=CC=C2NNN=C12 NPZTUJOABDZTLV-UHFFFAOYSA-N 0.000 description 1
- 230000000260 hypercholesteremic effect Effects 0.000 description 1
- 230000003053 immunization Effects 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 230000002480 immunoprotective effect Effects 0.000 description 1
- 230000003308 immunostimulating effect Effects 0.000 description 1
- 238000001727 in vivo Methods 0.000 description 1
- 238000011065 in-situ storage Methods 0.000 description 1
- 208000014674 injury Diseases 0.000 description 1
- 210000000936 intestine Anatomy 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000002372 labelling Methods 0.000 description 1
- 230000000670 limiting effect Effects 0.000 description 1
- 235000019626 lipase activity Nutrition 0.000 description 1
- 230000037356 lipid metabolism Effects 0.000 description 1
- 230000004576 lipid-binding Effects 0.000 description 1
- 229920006008 lipopolysaccharide Polymers 0.000 description 1
- 108010022197 lipoprotein cholesterol Proteins 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000000463 material Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 239000011859 microparticle Substances 0.000 description 1
- 230000003278 mimic effect Effects 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 108091005601 modified peptides Proteins 0.000 description 1
- BSOQXXWZTUDTEL-ZUYCGGNHSA-N muramyl dipeptide Chemical compound OC(=O)CC[C@H](C(N)=O)NC(=O)[C@H](C)NC(=O)[C@@H](C)O[C@H]1[C@H](O)[C@@H](CO)O[C@@H](O)[C@@H]1NC(C)=O BSOQXXWZTUDTEL-ZUYCGGNHSA-N 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 238000004848 nephelometry Methods 0.000 description 1
- 230000009871 nonspecific binding Effects 0.000 description 1
- 230000000444 normolipidemic effect Effects 0.000 description 1
- 238000010899 nucleation Methods 0.000 description 1
- 239000007764 o/w emulsion Substances 0.000 description 1
- 244000052769 pathogen Species 0.000 description 1
- 230000001717 pathogenic effect Effects 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 239000000863 peptide conjugate Substances 0.000 description 1
- 125000001151 peptidyl group Chemical group 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- 230000003836 peripheral circulation Effects 0.000 description 1
- 230000002093 peripheral effect Effects 0.000 description 1
- 238000002823 phage display Methods 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 230000036470 plasma concentration Effects 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 229940051841 polyoxyethylene ether Drugs 0.000 description 1
- 229920000056 polyoxyethylene ether Polymers 0.000 description 1
- 239000013641 positive control Substances 0.000 description 1
- 230000003389 potentiating effect Effects 0.000 description 1
- 238000001556 precipitation Methods 0.000 description 1
- 230000002265 prevention Effects 0.000 description 1
- 230000037452 priming Effects 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 125000006239 protecting group Chemical group 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 238000010791 quenching Methods 0.000 description 1
- 230000000171 quenching effect Effects 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000000241 respiratory effect Effects 0.000 description 1
- 238000004007 reversed phase HPLC Methods 0.000 description 1
- 238000003118 sandwich ELISA Methods 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 125000005629 sialic acid group Chemical group 0.000 description 1
- QZRSVBDWRWTHMT-UHFFFAOYSA-M silver;3-carboxy-3,5-dihydroxy-5-oxopentanoate Chemical compound [Ag+].OC(=O)CC(O)(C([O-])=O)CC(O)=O QZRSVBDWRWTHMT-UHFFFAOYSA-M 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 230000000391 smoking effect Effects 0.000 description 1
- 210000000329 smooth muscle myocyte Anatomy 0.000 description 1
- 229910052938 sodium sulfate Inorganic materials 0.000 description 1
- 235000011152 sodium sulphate Nutrition 0.000 description 1
- VGTPCRGMBIAPIM-UHFFFAOYSA-M sodium thiocyanate Chemical compound [Na+].[S-]C#N VGTPCRGMBIAPIM-UHFFFAOYSA-M 0.000 description 1
- 125000006850 spacer group Chemical group 0.000 description 1
- 230000009870 specific binding Effects 0.000 description 1
- 229940031439 squalene Drugs 0.000 description 1
- TUHBEKDERLKLEC-UHFFFAOYSA-N squalene Natural products CC(=CCCC(=CCCC(=CCCC=C(/C)CCC=C(/C)CC=C(C)C)C)C)C TUHBEKDERLKLEC-UHFFFAOYSA-N 0.000 description 1
- 230000036262 stenosis Effects 0.000 description 1
- 208000037804 stenosis Diseases 0.000 description 1
- 230000002966 stenotic effect Effects 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 229960002317 succinimide Drugs 0.000 description 1
- 230000001629 suppression Effects 0.000 description 1
- 229940118376 tetanus toxin Drugs 0.000 description 1
- 230000001225 therapeutic effect Effects 0.000 description 1
- 230000008719 thickening Effects 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 201000010875 transient cerebral ischemia Diseases 0.000 description 1
- 230000005945 translocation Effects 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- 210000004026 tunica intima Anatomy 0.000 description 1
- 238000000108 ultra-filtration Methods 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 238000007738 vacuum evaporation Methods 0.000 description 1
- 230000002792 vascular Effects 0.000 description 1
- 210000003556 vascular endothelial cell Anatomy 0.000 description 1
- 210000005166 vasculature Anatomy 0.000 description 1
- 230000035899 viability Effects 0.000 description 1
- GVJHHUAWPYXKBD-IEOSBIPESA-N α-tocopherol Chemical compound OC1=C(C)C(C)=C2O[C@@](CCC[C@H](C)CCC[C@H](C)CCCC(C)C)(C)CCC2=C1C GVJHHUAWPYXKBD-IEOSBIPESA-N 0.000 description 1
- DGVVWUTYPXICAM-UHFFFAOYSA-N β‐Mercaptoethanol Chemical compound OCCS DGVVWUTYPXICAM-UHFFFAOYSA-N 0.000 description 1
Landscapes
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Description
RU oo Vaccine
The present invention relates to novel vaccine therapies, and prophylactic treatments of atherosclerotic diseases. Accordingly there is provided, immunogens : 5 comprising apolipoproteins, or fragments or derivatives thereof, which in their native form the whole apolipoprotein has at least one of the following activities: (a) the inhibition of the binding of Apolipoprotein B to its receptor, and, or, (b) the inhibition of lipoprotein lipase. A preferred example of one such apolipoprotein is
Apolipoprotein C-IIT (ApoCIII). The vaccines of the present invention, comprising said immunogens, are potent in the prevention, or reduction, of atherosclerotic plaque formation over prolonged periods of time, thereby reducing the potential of atheroslerosis leading to coronary or cerebrovascular disease. Accordingly, there is provided a novel method of treating atherosclerosis by selectively inhibiting the activity of specific apolipoproteins in a human host, and in a preferred aspect of the . 15 invention the apolipoprotein is ApoClIl, comprising administering an agent which , results in the selective inhibition of the apolipoprotein activity to a human. Also ) provided are methods of treating or preventing atherosclerosis by active vaccination, or passive vaccination through administration to a patient of an antibody that is capable of binding to an apolipoprotein that has at least one of the following activities: (a) the inhibition of the binding of Apolipoprotein B to its receptor, and, or, (b) the inhibition of lipoprotein lipase; and in this aspect of the present invention the antibody preferably binds to and abrogates the activity of ApoCIII. There is further provided the use of the immunogens or vaccines of the present invention in medicine, and methods of their production.
Atherosclerosis is the leading cause of death and disability in the developed world, and is the major cause of coronary and cerebrovascular deaths, with approximately 7.2 and 4.6 million deaths per year worldwide respectively (Atherosclerosis is generally described in Harrison’s Principles of Internal Medicine (14 Edition, McGraw Hill, p1345-1352), Berliner, J. et al., 1995, Circulation, 91:2488-2496; Ross, R., 1993; Nature, 362:801). The name in Greek refers to the thickening (sclerosis) of the arterial intima and accumulation of lipid (athere) in ; lesions.
Although many generalised or systemic risk factors predispose to its development, such as a high cholesterol diet and smoking, this disease may affect
© 8 different distinct regions of the circulation. For example, atherosclerosis of the coronary arteries commonly causes angina pectoris and myocardial infarction. Whilst, atherosclerosis of the arteries supplying the central nervous system frequently ) provokes transient cerebral ischemia and strokes. In the peripheral circulation, atherosclerosis can cause intermittent claudication and gangrene and can jeopardise . limb viability. Involvement of the splanchnic circulation can cause mesenteric ischemia and bowel infarction. Atherosclerosis can affect the kidney directly (eg causing renal artery stenosis), and in addition, the kidney is a frequent site of atheroembolic disease.
Atherogenesis in humans typically occurs over many years, usually many decades. The slow build up of atherogenic plaques in the lining of the vasculature can lead to chronic clinical expressions through blood flow restriction (such as stable effort-induced angina pectoris or predictable and reproducible intermittent claudication). Alternatively, a much more dramatic acute clinical event, such as a myocardial infarction or cerebrovascular accident can occur after plaque rupture. The : way in which atherosclerosis affects an arterial segment also varies, an additional - feature of the heterogeneity and complexity of this disease. Atheromas are usually thought of as stenotic lesions, or plaques, which can limit blood flow, however, atherosclerosis can also cause ectasia and development of aneurysmal disease with an increase in lumen caliber. This expression of atherosclerosis frequently occurs in the aorta, creating a predisposition to rupture or dissection rather than to stenosis or occlusion.
The genesis of atherogenic plaques has been studied in depth. In normal human adults, the intimal layer of arteries contains some resident smooth muscle cells embedded in extracellular matrix and is covered with a monolayer of vascular endothelial cells. Initial stages of atherogenesis involve the development of “fatty streaks” in the walls of the blood vessel resulting from accumulation and deposit of lipoproteins in regions of the intimal layer of the artery. Low-density lipoprotein (LDL) particles, rich in cholesterol, is an example of an atherogenic lipoprotein which . 30 is capable of deposition in the vessel walls to form such fatty streaks.
Once deposited within the vessel wall, the lipoprotein particles undergo : chemical modification, including both oxidation and non-enzymatic glycation. These oxidised and glycated lipoproteins then contribute to many of the subsequent events of lesion development. The chemical modifications attract macrophages within the
I vessel walls, which internalise the oxidised LDL and become foam cells which initiate lesions called plaques. It is the atherosclerotic plaques which are responsible for the clinical manifestations of atherosclerosis, either they limit blood flow, or allow i aneurism, or may even rupture provoking the coronary or cerebrovascular attacks.
The development of atherosclerosis is a long process which may occur over v decades, which is initiated by an imbalance between atherogenic and protective lipoproteins. For example, cholesterol associated with high-density lipoproteins or
HDL (so called “good” cholesterol) and low-density lipoproteins or LDL (so called “bad” cholesterol) levels in the circulation are thought to be markers of increased probability of atherosclerosis (Harrison’s Principles of Internal Medicine (14™
Edition, McGraw Hill, p1345-1352)).
Cholesterol, cholesterol esters, triacylglycerols and other lipids are transported in body fluids by a series of lipoproteins classified according to their increasing density: chylomicrons, Very Low, Low, Intermediate and High density lipoproteins (CM, VLDL, LDL, IDL and HDL respectively). These lipoprotein-complexes consist of a core of hydrophobic lipids surrounded by polar lipids and then by a shell of
Apolipoproteins. Currently, there are ten types of apolipoproteins known, A-I, A-II,
B, CI, CII, CIII, D, E, H and J. There are at least two functions of these apolipoproteins which are common to all lipoprotein complexes, first they are responsible for the solubilisation of the hydrophobic lipid cores that they carry, and second they are also involved in the regulation of cholesterol lipoprotein uptake by specific cells. The different different types of lipoproteins may have different functions, for example LDL are rich in cholesterol esters are thought to be associated with the transport of cholesterol to peripheral tissues for new membrane synthesis.
One of these apolipoproteins, apolipoprotein C-11I (ApoClIl), is a 79 amino acid protein produced in the liver and intestine (Brewer et al., J. Biol. Chem. (1974), 249 : 4975-4984; Protter, A.A., et al., 1984, DNA, 3:449-456; Fruchart, J.C. et al, 1996, Drugs Affecting Lipid Metabolism, (Eds. Gotto, A.M. et al.), Kluwer Academic
Publishers and Fordazione Giovanni Lorenzini, Netherlands, p631-638; Claveny, V. etal., Arteriosclerosis, Thrombosis and Vascular Biology, 15, 7, 963-971; US patent
No. 4,801,531; McConathy, W.J. et al. 1992, Journal of Lipid Research, 33, 995- 1003). Apo CIII is a component of CM, VLDV and LDL (Lenich et al., C., J. Lip.
Res. (1988) 29, 755-764) which exists as three isoforms : apo CIII0, apo CIIII and apo CIII2. Apo CIII is not glycosylated, however apo CIII1 and apo CIII2 are
¢ & glycosylated and have respectively one and two sialic acid residues (Ito et al., 1989
Jlipd. Res. Nov 30:11 1781-1787). The sugar moiety consists of disaccharide B-D galactosyl (1-3) a-N-Acetyl-D-Galactosamine attached to threonine 74 of protein } chain by O-glycosidic binding (Assman ez al., 1989, BBA 541:234-240). In human normolipidemic plasma apo CIII0, apo CIII1 and apo CIII2 represent 14%, 59% and
A 27% of total apo CIII respectively. Mutagenesis of the glycosylation site of human apo CIII doesn't affect its secretion and lipid binding (Roghani et al., 1988 JBC 34:17925-32).
Human ApoCIII has the following amino acid sequence:
SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLK
DYWSTVKDKFSEFWDLDPEVRPTSAVAA (SEQ ID.NO. 1)
Plasma concentration of apo CIII is positively correlated with levels of plasma triglycerides (Schonfeld ef al., Metabolism (1979) 28 : 1001-1010; Kaslyap et al, J.
Lip. Res. (1981) 22 : 800-810). Liver perfusion studies demonstrate that apo CII inhibits the hepatic uptake of triglyceride-rich lipoproteins (TRL) and their remnants (Shelburne ez al., J. Clin. Inves., (1980) 65 : 652-658, Windler er al., J. Lip. Res. (1985) 26 : 556-563). Also in vitro experiments show that apo CIII inhibit the activity of both lipoprotein lipase (LPL) and hepatic lipase (Brown and Bakinsky, Biochim.
Biophs. Acta. (1972) 46 : 375-382; Krauss ef al., Circ. Res. (1973) 33 : 403-411;
Wanget al., J. Clin. Inves. (1985) 75 : 384-390; Mc Conathy er al., J. Lip. Res. (1972) 33: 995-1003; Kinnemen and Enholm, FEBS (1976) 65 : 354-357). Moreover,
ApoClIII is said to be involved in inhibition of LDL binding to LDL receptors (Fruchart et al. supra), via ApoB.
The role of apo CIII in plasma TRL metabolism has been more defined by the results of recent studies in transgenic animals (Aalto-Setild er al., J. Clin. Invest. (1992) 90:5 1889-1900.). Plasma accumulation of TRL in mice overexpressing apo
CIII has been shown to be associated with reduced plasma VLDL and chylomicron clearance (Harrold ef al., J. Lip. Res. (1996) 37 : 754-760) also the inhibitory effect of
C apolipoproteins on the LDL receptor of apo B-containing lipoproteins was , 30 demonstrated (Clavey et al., Arth. Thromb. and Vasc. Biol. (1995) 15: 963-971).
Previous vaccines in the field of immunotherapy of atherosclerosis have . focused on the use of cholesterol as an immunogen to reduce serum cholesterol levels (Bailey, JM. et al., 1994, Biochemical Society Transactions, 22, 433S; Alving, C.and
Swartz, G.M., 1991, Crit. Rev. Immunol., 10, 441-453; Alving, C. and Wassef, N.M.,
& # 1999, Immunology Today, 20, 8, 362-366). Others have attempted to alter the activity of the Cholesterol Ester Transfer Protein (CETP) by vaccination (WO 99/15655).
Alternatively, some authors have described vaccines using oxidised LDL as the . immunogen, in order to inhibit plaque formation after balloon injury in hypercholesterolemic rabbits (Nilsson, J. et al., 1997, JACC, 30, 7, 1886-1891). . It has been found, surprisingly, that atherosclerosis may be prevented or ameliorated by active or passive immunotherapy, by reducing or blocking the function of certain atherosclerosis promoting apolipoproteins.
The present invention provides immunogens effective in the prophylaxis or therapy of atherosclerosis, and also provides for methods of treatment of atherosclerosis by the administration of the immunogens of the present invention to individuals in need thereof.
The immunogens of the present invention comprise apolipoproteins selected from those apolipoproteins which promote the formation of atherosclerotic plaques in individuals suffering from.or disposed towards atherosclerosis. The apolipoproteins which are selected to form the basis of preferred immunogens of the present invention are apolipoproteins which have at least one of the following two properties: the native apolipoprotein is capable of (a) inhibiting the binding of Apolipoprotein B to its receptor, and/or (b) the inhibition of the enzyme lipoprotein lipase.
The apolipoproteins which may be used as immunogens of the present invention may have either one of the above activities, but most preferably have both activities. The most preferred immunogen which has both activities comprises Apolipoprotein CIII (ApoCIII).
The activity of any given apolipoprotein in the inhibition of apo B containing lipoproteins binding to its receptor, or in the enzymatic activity of lipoprotein lipase, may be investigated using techniques that are known in the art. Examples of these techniques are described in Fruchart ef al, supra; McConathy et al., supra; Shelburne et. al. supra and Windler er. al. supra.
The immunogens of the present invention may comprise the whole length native apolipoprotein, or may alternatively comprise fragments, peptides or mimotopes thereof, which retain the functional activity of the therapy or prophylaxis of atherosclerosis.
. -
For example, the immunogen may be full length, or may comprise fragments of the native apolipoprotein which are shorter than the whole length of the native apolipoprotein. Preferably the fragments of the whole length proteins are less than 80 amino acids in length, more preferably less than 50 amino acids, more preferably less than 40 amino acids and most preferably within the range of . 4 to 25 amino acids long.
The apolipoprotein fragments which may be used as immunogens of the present invention share the function of the whole length apolipoprotein, of being able (when suitably presented to the immune system) to induce anti-
Apolipoprotein antibodies. Moreover, the antibodies induced by the fragments are functional in the treatment of atherosclerosis, and in a preferred form of the present invention they abrogate the inhibition exerted by the apolipoprotein on the binding of ApoB to its receptor, and/or the activity of lipoprotein lipase.
Peptides, which may be formulated into immunogens of the present invention may be isolated from surface exposed epitopes of the apolipoproteins. The present inventors have found that the peptides useful in the present invention, are also found to be highly surface exposed epitopes. From this observation the present inventors have designed a method for providing other suitable epitopes, those being epitopes having highly accessible regions calculated over a sliding window of five residues.
The inventors have found that preferred regions of the apolipoproteins have an accessible surface calculated over a sliding window of 5 residues using the Molecular
Simulations Software (MSI) of greater than 50 A? and preferably greater than 80A2.
Peptides incorporating the amino acid sequence of such surface exposed epitopes form an aspect of the present invention. Mimotopes which have the same characteristics as these peptides, and immunogens comprising such mimotopes which generate an immune response which cross-react with the apolipoprotein, also form part of the present invention.
The immunogens of the present invention may, therefore, comprise the isolated peptides encompassing the apolipoprotein epitopes themsclves, and any , 30 mimotope thereof. The meaning of mimotope is defined as an entity which is sufficiently similar to the apolipoprotein epitope so as to be capable of being : recognised by antibodies which recognise the apolipoprotein; (Gheysen, H.M., et al., 1986, Synthetic peptides as antigens. Wiley, Chichester, Ciba foundation symposium 119, p130-149; Gheysen, H.M., 1986, Molecular Immunology, 23,7, 709-715); or are capable of raising antibodies, when coupled to a suitable carrier, which antibodies cross-react with the native apolipoprotein.
Peptide mimotopes of the above-identified apolipoprotein epitopes may be designed for a particular purpose by addition, deletion or substitution of elected amino acids. Thus, the peptides of the present invention may be modified for the purposes of ‘ ease of conjugation to a protein carrier. For example, it may be desirable for some chemical conjugation methods to include a terminal cysteine to the apolipoprotein epitope. In addition it may be desirable for peptides conjugated to a protein carrier to include a hydrophobic terminus distal from the conjugated terminus of the peptide, such that the free unconjugated end of the peptide remains associated with the surface of the carrier protein. This reduces the conformational degrees of freedom of the peptide, and thus increases the probability that the peptide is presented in a conformation which most closely resembles that of the apolipoprotein peptide as found in the context of the whole apolipoprotein. For example, the peptides may be altered to have an N-terminal cysteine and a C-terminal hydrophobic amidated tail.
Alternatively, the addition or substitution of a D-stercoisomer form of one or more of the amino acids may be performed to create a beneficial derivative, for example to enhance stability of the peptide. Those skilled in the art will realise that such modified peptides, or mimotopes, could be a wholly or partly non-peptide mimotope wherein the constituent residues are not necessarily confined to the 20 naturally occurring amino acids. In addition, these may be cyclised by techniques known in the art to constrain the peptide into a conformation that closely resembles its shape when the peptide sequence is in the context of the whole apolipoprotein.
The peptide mimotopes may also be retro sequences of the natural apolipoprotein peptide sequences, in that the sequence orientation is reversed; or alternatively the sequences may be entirely or at least in part comprised of D-stereo isomer amino acids (inverso sequences). Also, the peptide sequences may be retro- inverso in character, in that the sequence orientation is reversed and the amino acids are of the D-stereoisomer form. Such retro or retro-inverso peptides have the . 30 advantage of being non-self, and as such may overcome problems of self-tolerance in the immune system. ) Alternatively, peptide mimotopes may be identified using antibodies which are capable themselves of binding to the apolipoprotein, using techniques such as phage display technology (EP 0 552 267 B1). This technique, generates a large number of
. w peptide sequences which mimic the structure of the native peptides and are, therefore, capable of binding to anti-native peptide antibodies, but may not necessarily themselves share significant sequence homology to the native apolipoprotein.
The most preferred immunogens of the present invention comprise ApoCIII or . fragment, peptide or mimotope thereof.
The ApoCIIl the immunogen may be the full length native protein: Human ApoCIIl 1-79, : 10 SEAEDASLLSFMQGYMKHATKTAKDALSSVQESQVAQQARGWVTDGFSSLK
DYWSTVKDKFSEFWDLDPEVRPTSAVAA (SEQ ID NO. 1).
Alternatively, the immunogen may comprise fragments of the whole ApoCIII which are 78 amino acids long or less, preferably 50 amino acids long or less, more preferably 40 amino acids or less, and most preferably within the range of 4 to 25 amino acids long. Particularly preferred fragments or peptides will include the region defined by amino acids 1-17, 1-40, 12-35, 41-79, 45-65, or 45-76 in the mature
ApoClIl. The peptide sequences for some of the preferred peptides are:
Human ApoClIII 1-17, SEAEDASLLSFMQGYMK (SEQ ID NO. 2)
Human ApoCIIl 1-40, SEAEDASLLSFMQGYMKHATKTAKDALSSV
QESQVAQQAR (SEQ ID NO. 3)
Human ApoCIII 12-35, MQGYMKHATKTAKDALSSVQESQV (SEQ ID NO. 4)
Human ApoClIII 41-79, GWVTDGFSSLKDYWSTVKDKFSEFWDLD
PEVRPTSAVAA (SEQ ID NO. 5)
Human ApoClIII 45-65, DGFSSLKDYWSTVKDKFSEFW (SEQ ID NO. 6)
Human ApoCIIl 45-76, DGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSA (SEQ ID
NO. 7)
An immunologically equivalent fragment of ApoCIll may be defined as a smaller polypeptide than ApoClII itself, which is capable of generating immune responses . 30 that recognise native ApoClIIl, and which function in the therapy or prophylaxis of atherosclerosis. : Other apolipoproteins which may be used in the immunogens of the present invention are Apolipoprotein CII or Apolipoprotein E.
In one particularly preferred embodiment of the present invention the apolipoprotein or fragment thereof is linked to a carrier molecule to enhance the immunogenicity of the apolipoprotein or fragment thereof. Accordingly, the peptides or mimotopes may be linked via chemical covalent conjugation or by expression of genetically engineered fusion partners, optionally via a linker sequence. The peptides . may have two or more Glycine residues as a linker sequence, and often have a terminal exposed cystein residue for linkage purposes. For example, some of these preferred peptides are listed below:
MQGYMKHATKTAKDALSSVQESQVGGC (SEQ ID NO. 8)
CGGMQGYMKHATKTAKDALSSVQESQV (SEQ ID NO. 9)
DGFSSLKDYWSTVKDKFSEFWGGC (SEQ ID NO. 10)
CGGDGFSSLKDYWSTVKDKFSEFW (SEQID NO. 11)
The covalent coupling of the apolipoprotein, such as ApoClll, to the carrier protein can be carried out in a manner well known in the art. Thus, for example, for direct covalent coupling it is possible to utilise a carbodiimide, glutaraldehyde or (N-[y- maleimidobutyryloxy]) succinimide ester, utilising common commercially available heterobifunctional linkers such as CDAP and SPDP (using manufacturers instructions). After the coupling reaction, the immunogen can easily be isolated and purified by means of a dialysis method, a gel filtration method, a fractionation method etc.
The types of carriers used in the immunogens of the present invention will be readily known to the man skilled in the art. The function of the carrier is to provide cytokine help in order to enhance the immune response against the apolipoprotein or apolipoprotein peptide. A non-exhaustive list of carriers which may be used in the present invention include: Keyhole limpet Haemocyanin (KLH), serum albumins such as bovine serum albumin (BSA), inactivated bacterial toxins such as tetanus or diptheria toxins (TT and DT), or recombinant fragments thereof (for example, ’ 30 Domain 1 of Fragment C of TT, or the translocation domain of DT), or the purified protein derivative of tuberculin (PPD). Alternatively the apolipoprotein or mimotopes or epitopes may be linked to the carrier in a non-covalent fashion such as association via a liposome carrier or by co-adsorbtion onto an aluminium salt, which may additionally comprise immunogens capable of providing T-cell help or additional adjuvant immunostimulators. Preferably the ratio of the number of apolipoprotein, or fragment or peptide thereof, to carrier protein is in the order of 1:1 to 20:1, and preferably each carrier should carry between 3-15 apolipoproteins, or peptide or fragment thereof. , In an embodiment of the invention the carrier is Protein D from Haemophilus influenzae (EP 0 594 610 Bl). Protein D is an IgD-binding protein from Haemophilus influenzae and has been patented by Forsgren (WO 91/18926, granted EP 0 594 610
B1). In some circumstances, for example in recombinant immunogen expression systems it may be desirable to use fragments of protein D, for example Protein D 1/3" (comprising the N-terminal 100-110 amino acids of protein D (WO 99/10375; WO 00/50077)).
Another preferred method of presenting apolipoprotein, such as ApoCIIl, or the peptides of the present invention, is in the context of a recombinant fusion molecule. For example, EP 0421 635 B describes the use of chimeric hepadnavirus core antigen particles to present foreign peptide sequences in a virus-like particle. As such, immunogens of the present invention may comprise apolipoprotein or - apolipoprotein peptides presented in chimeric particles consisting of hepatitis B core (HepB core) antigen. Additionally, the recombinant fusion proteins may comprise the mimotopes of the present invention and a carrier protein, such as NS1 of the influenza virus. For any recombinantly expressed protein which forms part of the present invention, the nucleic acid which encodes said immunogen also forms an aspect of the present invention.
Accordingly, preferred immunogens of the present invention comprise the peptide SEQ ID NO. 1 or SEQ ID NO. 2-7, presented in a recombinant expression system (such as HepB core) or conjugated to a carrier protein, such that the recombinant expression system or the carrier protein provide T-cell help for generation of an immune response to SEQ ID NO. 1 or SEQ ID NO. 2-7. Particularly preferred immunogens comprise SEQ ID NO. 4 alone, or conjugated or fused to a . 30 carrier protein to provide T-cell help for generation of an immune response to SEQ ID
NO. 4. - In an alternative embodiment of the present invention the immunogenicity of the peptides is enhanced by the addition of T-helper (Th) epitopes. The immunogens of the present invention may, therefore, comprise the peptides as described previously and promiscuous Th epitopes either as chemical conjugates or as purely synthetic peptide constructs. The apolipoprotein peptides are preferably joined to the Th epitopes via a spacer (e.g., Gly-Gly) at either the N- or C-terminus of the apolipoprotein peptide. The immunogens may comprise 1 or more promiscuous Th epitopes, and more preferably between 2 to 5 Th epitopes. . A Th epitope is a sequence of amino acids that comprise a Th epitope. A Th epitope can consist of a continuous ir discontinuous epitope. Hence not every amino acid of
Th is necessarily part of the epitope. Th-epitopes that are promiscuous are highly and broadly reactive in animal and human populations with widely divergent MHC types (Partidos et al. (1991) "Immune Responses in Mice Following Immunization with
Chimeric Synthetic Peptides Representing B and T Cell Epitopes of Measles Virus
Proteins” J. of Gen. Virol. 72:1293-1299
US 5,759,551). The Th domains that may be used in accordance with the present invention have from about 10 to about 50 amino acids, and preferably from about 10 to about 30 amino acids. When multiple Th epitopes are present, each Th epitope is independently the same or different.
Th epitopes include as examples, pathogen derived epitopes such as Hepatitis surface or core (peptide 50-69, Ferrari ef al., J.Clin.Invest, 1991, 88, 214-222) antigen Th epitopes, Pertussis toxin Th epitopes, tetanus toxin Th epitopes (such as P2 (EP 0 378 881 B1) and P30 (WO 96/34888, WO 95/31480, WO 95/26365), measles virus F protein Th epitopes, Chlamidia trachomatis major outer membrane protein Th epitopes (such as P11, Stagg et al., Immunology, 1993, 79, 1-9), Yersinia invasin and diptheria toxin Th epitopes. Other Th epitopes are described in US 5,759,551 and
Cease et al., 1987, Proc. Natl. Acad. Sci. 84, 4249-4253; and Partidos et al.,
J.Gen.Virol, 1991, 72, 1293-1299; WO 95/26365 and EP 0 752 886 B.
Peptides used in the present invention can be readily synthesised by solid phase procedures well known in the art. Suitable syntheses may be performed by utilising “T-boc” or “F-moc” procedures. Cyclic peptides can be synthesised by the solid phase procedure employing the well-known “F-moc” procedure and polyamide . 30 resin in the fully automated apparatus. Alternatively, those skilled in the art will know the necessary laboratory procedures to perform the process manually. Techniques and i procedures for solid phase synthesis are described in 'Solid Phase Peptide Synthesis:
A Practical Approach’ by E. Atherton and R.C. Sheppard, published by IRL at Oxford
University Press (1989). Alternatively, the peptides may be produced by recombinant methods, including expressing nucleic acid molecules encoding the mimotopes in a bacterial or mammalian cell line, followed by purification of the expressed mimotope.
Techniques for recombinant expression of peptides and proteins are known in the art, and are described in Maniatis, T., Fritsch, E.F. and Sambrook et al., Molecular . cloning, a laboratory manual, 2nd Ed.; Cold Spring Harbor Laboratory Press, Cold
Spring Harbor, New York (1989).
Also forming part of the present invention are portions of nucleic acid which encode the immunogens of the present invention or peptides, mimotopes or derivatives thereof, or recombinant fusion proteins comprising the immunogens. In particular isolated nucleic acid molecules which encode SEQ ID. NO. 1-7, or immunogens comprising SEQ ID NOs. 1-7 are provided.
The immunogens of the present invention are provided for use in medicine, for use in the treatment of atherosclerosis, and for formulation into immunogenic compositions or vaccines of the present invention.
The immunogens of the present invention may be formulated into immunogenic compositions or vaccines, which are effective in the prophylaxis or therapy of atherosclerosis. The immunogenic compositions and vaccines comprise one or more immunogens of the present invention as previously described.
Accordingly the vaccines comprise apolipoproteins selected from those apolipoproteins which promote the formation of artherosclerotic plaques. Preferred vaccines comprise immunogens comprising apolipoproteins, which have at least one of the following two properties: the native apolipoprotein is active in the suppression of ApoB binding to its receptor, and/or is capable of inhibiting the enzymatic activity of lipoprotein lipase.
The most preferred vaccines or immunogenic compositions of the present invention comprise ApoCIll, or fragment or peptide thereof. Most preferably, the vaccine comprises ApoClIII or fragment thereof, conjugated or fused to a carrier protein to provide T-cell help for generation of an immune response against the . 30 ApoClIIl or fragment thereof.
Vaccines or immunogenic compositions of the present invention, may : advantageously also include an adjuvant. Suitable adjuvants for vaccines of the present invention comprise those adjuvants that are capable of enhancing the antibody responses against the apolipoprotein immunogen. Adjuvants are well known in the art
(Vaccine Design — The Subunit and Adjuvant Approach, 1995, Pharmaceutical
Biotechnology, Volume 6, Eds. Powell, M.F., and Newman, M.J., Plenum Press, New
York and London, ISBN 0-306-44867-X). Preferred adjuvants for use with } immunogens of the present invention include aluminium or calcium salts (for example hydroxide or phosphate salts). Preferred adjuvants for use with immunogens of the . present invention include: aluminium or calcium salts (hydroxide or phosphate), oilin water emulsions (WO 95/17210, EP 0 399 843), or particulate carriers such as liposomes (WO 96/33739). Immunologically active saponin fractions (e.g. Quil A) having adjuvant activity derived from the bark of the South American tree Quillaja
Saponaria Molina are particularly preferred. Derivatives of Quil A, for example Qs21 (an HPLC purified fraction derivative of Quil A), and the method of its production is disclosed in US Patent No.5,057,540. Amongst QS21 (known as QA21) other fractions such as QA17 are also disclosed. 3 De-O-acylated monophosphoryl lipid A (3D-MPL) is a well known adjuvant manufactured by Ribi Inmunochem, Montana. ['t can be prepared by the methods taught in GB 2122204B. A preferred form of 3D-
MPL is in the form of an emulsion wherein the 3D-MPL has a small particle size of less than 0.2pm in diameter (EP 0 689 454 B1).
Adjuvants also include, but are not limited to, muramyl dipeptide and saponins such as Quil A, bacterial lipopolysaccharides such as 3D-MPL (3-O-deacylated monophosphoryl lipid A), or TDM. As a further exemplary alternative, the protein can be encapsulated within microparticles such as liposomes, or in non-particulate suspensions of polyoxyethylene ether (WO 99/52549). Particularly preferred adjuvants are combinations of 3D-MPL and QS21 (EP 0 671 948 B1), oil in water emulsions comprising 3D-MPL and QS21 (WO 95/17210, PCT/EP98/05714), 3D-
MPL formulated with other carriers (EP 0 689 454 B1), or QS21 formulated in cholesterol containing liposomes (WO 96/33739), or immunostimulatory oligonucleotides (WO 96/02555).
The vaccines of the present invention will be generally administered for both priming and boosting doses. It is expected that the boosting doses will be adequately . 30 spaced, or preferably given yearly or at such times where the levels of circulating antibody fall below a desired level. Boosting doses may consist of the peptide in the ’ absence of the original carrier molecule. Such booster constructs may comprise an alternative carrier or may be in the absence of any carrier.
In a further aspect of the present invention there is provided a vaccine or immunogenic composition as herein described for use in medicine.
The immunogenic composition or vaccine preparations of the present invention may be used to protect or treat a mammal susceptible to, or suffering from atherosclerosis, by means of administering said vaccine via systemic or mucosal , route. These administrations may include injection via the intramuscular, intraperitoneal, intradermal or subcutaneous routes; or via mucosal administration to the oral/alimentary, respiratory, genitourinary tracts.
The amount of protein in each vaccine or immunogenic composition dose is selected as an amount which induces an immunoprotective response without significant, adverse side effects in typical vaccinees. Such amount will vary depending upon which specific immunogen is employed and how it is presented.
Generally, it is expected that each dose will comprise 1-1000 pug of protein, preferably 1-500 pg, preferably 1-100 pg, of which 1 to 50ug is the most preferable range. An optimal amount for a particular vaccine can be ascertained by standard studies involving observation of appropriate immune responses in subjects. Following an initial vaccination, subjects may receive one or several booster immunisations adequately spaced.
Vaccine preparation is generally described in New Trends and Developments in Vaccines, edited by Voller et al., University Park Press, Baltimore, Maryland,
U.S.A. 1978. Conjugation of proteins to macromolecules is disclosed by Likhite, U.S.
Patent 4,372,945 and by Armor et al., U.S. Patent 4, 474,757.
Ligands which are capable of binding to the same apolipoproteins which form the basis for the immunogens of the present invention form an important embodiment part of the present invention. Such ligands are capable of being used in passive prophylaxis or therapy, by administration of the ligands into a patient, for the amelioration of atherogenic disease.
Accordingly, the preferred ligands of the present invention are capable of binding to, and limiting the activity of, apolipoproteins which have at least one of . 30 the following two properties: the native apolipoprotein is capable of suppressing the binding of Apolipoprotein B to its receptor, and/or is capable of inhibiting the : enzymatic activity of lipoprotein lipase.
The ligands of the present invention preferably bind to apolipoproteins which may have either one of the above activities, but most preferably have both activities. A particularly preferred ligand is one that binds to Apolipoprotein CIII (ApoCIII).
Preferred examples of such useful ligands include monoclonal or polyclonal antibodies. For example, antibodies induced in one animal may be purified and passively administered to another animal for the prophylaxis or therapy of . atherosclerosis. The immunogens of the present invention may also be used for the generation of monoclonal antibody hybridomas (using known techniques e.g. Kohler and Milstein, Nature, 1975, 256, p495), humanised monoclonal antibodies or CDR grafted monoclonals, by techniques known in the art.
The term “antibody” herein is used to refer to a molecule having a useful antigen binding specificity. Those skilled in the art will readily appreciate that this term may also cover polypeptides which are fragments of or derivatives of antibodies yet which can show the same or a closely similar functionality. Such antibody ' fragments or derivatives are intended to be encompassed by the term antibody as used herein.
Accordingly there is provided by the present invention, an isolated antibody generated against the isolated immunogens of the present invention.
There is also provided by the present invention a poly or monoclonal antibody preparation, that binds to ApoCIII. Particularly preferred poly or monoclonal antibodies recognise fragments of the whole native ApoCIIl, such as Human ApoCIII 1-17, SEAEDASLLSFMQGYMK (SEQ ID NO. 2)
Human ApoCIII 1-40, SEAEDASLLSFMQGYMKHATKTAKDALSSV
QESQVAQQAR (SEQ ID NO. 3)
Human ApoCIII 12-35, MQGYMKHATKTAKDALSSVQESQV (SEQ ID NO. 4)
Human ApoClIII 41-79, GWVTDGFSSLKDYWSTVKDKFSEFWDLD
PEVRPTSAVAA (SEQ ID NO. 5)
Human ApoClII 45-65, DGFSSLKDYWSTVKDKFSEFW (SEQ ID NO. 6)
Human ApoCIII 45-76, DGFSSLKDYWSTVKDKFSEFWDLDPEVRPTSA (SEQ ID
NO. 7). - 30 Hybrodomas secreting the monoclonal antibody ligands of the present invention are also provided.
Pharmaceutical compositions comprising the ligands, described above, also form an aspect of the present invention. Also provided are the use of the ligands in w . medicine, and in the manufacture of medicaments for the treatment of atherosclerosis.
In the passive treatments of atherosclerosis as provided herein, the administration of the ligands or antibodies of the present invention will be administered intra-venously to the patients in need thereof. The frequency of ] ~~ administration may be determined clinically by following the decline of antibody titres in the serum of patients over time, but in any event may be at a frequency of 1 to 52 times per year, and most preferably between 1 and 12 times per year.
Quantities of antibody or ligand may vary according to the severity of the disease, or half-life of the antibody in the serum, but preferably will be in the range of 1 to 10 mg/kg of patient, and preferably within the range of 1 to 5 mg/kg of patient, and most preferably 1 to 2 mg/kg of patient.
The immunogens, immunogenic compositions, vaccines or ligands of the present invention may be administered to a patient who is suffering from, or is at risk to, atherosclerotic disease, and are effective in re-establishing the correct equilibrium of the “bad” lipoproteins (apo B containing lipoproteins) to the "good " lipoproteins (apo A-l containing lipoproteins) balance, and minimise the circulation time of apoB containing lipoproteins. Not wishing to be bound by theory, the inventors believe that these functions minimise the possibility of deposit and oxidation of apo B containing lipoproteins within the blood vessel walls, and hence, reduce the risk of atherosclerotic plaque formation or growth.
The present invention, therefore, provides the use of the apolipoprotein immunogens of the present invention (as defined above), in the manufacture of pharmaceutical compositions for the prophylaxis or therapy of atherosclerosis.
Immunogens comprising apolipoprotein or peptides of the present invention, and carrier molecules are also provided for use in the manufacture of vaccines for the immunoprophylaxis or therapy of atherosclerosis. Accordingly, the apolipoprotein immunogens of the present invention are provided for use in medicine, and in the medical treatment or prophylaxis of atherosclerosis. . 30 There is also provided a method of treatment or prophylaxis of atherosclerosis comprising the administration to a patient suffering from or : susceptible to atherosclerosis, of an immunogenic composition or vaccine or ligand of the present invention.
«©
A method of prophylaxis or treatment of atherosclerosis is provided which comprises a reduction of total circulating triglyceride levels in a patient, by the administration of a vaccine of the present invention to the patient. In particular there is provided a method of reducing the amount of circulating VLDL and LDL 5S ina patient, by the administration of the vaccine or ligands of the present invention . to the patient.
Also provided is a method of prophylaxis or treatment of atherosclerosis by the administration to a patient of a vaccine which is capable of reducing the average circulation time of ApoB containing lipoproteins. In this regard the average circulation time of ApoB containing lipoproteins, may be investigated in an in vivo animal model by the measuring the clearance rate of labelled ApoB containing lipoproteins from the plasma of the mammal (half-life of labelled ApoB containing lipoproteins).
A preferred immunogen for these method of treatment aspects of the present invention comprises ApoCIIl. Surprisingly, the targetting of ApoCIII by the vaccine or the ligand downregulates the negative effects of the “bad” cholesterol (LDL), whilst not having a negative effect on the “good” cholesterol (HDL).
There is provided by the present invention a method of treatment or prophylaxis of atherosclerosis by selectively inhibiting the activity of an atherogenic apolipoprotein in a human host, comprising administering an agent which results in the inhibition of at least one of the following activities of said atherogenic apolipoprotein in the human host in need of such treatment or prophylaxis, (a) the inhibition of the binding of Apolipoprotein B to its receptor, and, or (b) the inhibition of hpoprotein lipase. In a related aspect of the present invention there is provided a method of treatment or prophylaxis of atherosclerosis by selectively inhibiting
ApoClII activity in a human host, comprising administering an agent which results in the selective inhibition of ApoClIII activity to a human host in need of such treatment or prophylaxis. In this regard, the agent may be an immunogenic composition or vaccine comprising ApoClIl, or fragment thereof, as the immunogen, or alternatively the agent may be a ligand that is capable of blocking the activity of ApoCIII (in that it abrogates the ApoClIl-mediated inhibition of lipoprotein lipase and the binding of
ApoB to its receptor). The preferred ligands in this aspect of the present invention are poly- or monoclonal antibodies.
Preferred methods of treating individuals suffering from Atherosclerosis having elevated levels of circulating ApoCIlII in their plasma comprise reducing the levels of circulating ApoCIIL, by the administration of a vaccine comprising ApoCI], or fragment thereof, as an immunogen to said individual. Alternatively, in a related aspect of the present invention there is provided a method of treatment or prophylaxis . of atherosclerosis by reducing the levels of circulating ApoCIll in the plasma of a patient, by administration of a ligand that is capable of blocking the activity of
ApoClIl, in that it abrogates the ApoCIII-mediated inhibition of lipoprotein lipase and the binding of ApoB to its receptor, to said patient. The preferred ligands in this aspect of the present invention are poly or monoclonal antibodies.
Also provided by the present invention is a method of treatment or prophylaxis of atherosclerosis by reducing the number of ApoCIII molecules which are associated with an ApoB molecule in situ in the context of a lipoprotein. In a normal individual there is approximately one ApoB present in an LDL particle, the ApoB being associated with between 1-5 ApoCIII molecules. In diseased individuals the number of ApoCIlI molecules may increase to up to 25. Accordingly, there is provided by the present invention a method of treatment or prophylaxis of atherosclerosis by reducing the ratio of ApoCIII molecules per ApoB molecules in the LDL in an individual with atherosclerosis from a high disease state level (approximately 20 to 25:1) to a reduced therapeutic level preferably below 15:1, more preferably below 10:1 and more preferably below 5:1, preferably below 3:1, and most preferably approximately 1:1
ApoC:ApoB. Levels of ApoCIII contined within ApoB-containing lipoproteins may be measured by nephelometry or electro-immunodiffusion (normal range is 2 to 3 mg/dL).
Also provided by the present invention is synthetic or recombinantly produced
ApoClIII for use in medicine.
The present invention is illustrated by the following examples:
Example 1, Peptide synthesis
The ApoCllIl peptides (1-79, 1-17, 12-35, 45-65 and 45-76 (SEQID NOs 1,2, 4, 6 and 7 respectively)) were synthesised by the solid phase method (Merrifield, 1986) on : an automated synthesiser Model ABI 433A (Applied Biosystems Inc.) using Boc/Bzl strategy on a Boc-Ala-PAM resin for total apo CIII and MBHA resin for the others fragments. Each amino acid was coupled twice by dicyclohexylcarbodiimide/hydroxybenzotriazole without capping. Side chain protecting groups were as follows: Arg(Ts), Asp(Ochex), Glu(Ochex), Lys(2-C1-Z),
His(Dnp), Ser(Bzl), Thr(Bzl), Met(O)and Tyr(Br-Z). According to the sequence, the group Dnp on His was removed from the peptide, prior to the cleavage from its support by treatment with 10% B-mercaptoethanol, 5% diisopropylethylamine in . DCM for 2 h and in NMP for 2 h. The peptidyl resin was then treated with 50% TFA in DCM for 20 min to remove the amino-terminal Boc. The peptide was cleaved from the resin and simultaneously deprotected according to a low and high HF procedure: the resin (1g) was treated with anhydrous HF (2.5 mL) in the presence of p-cresol (0.75 g), p-thiocresol (0.25 g) and dimethylsulfide (6.5 mL) at 0°C. After 3 h hydrogen fluoride and dimethylsulfide were removed by vacuum evaporation and the residual scavengers and by products were extracted with diethyl ether. The reaction vessel was recharged with p-cresol (0.75 g), p-thiocresol (0.25 g) and 10 ml of anhydrous HF and the mixture was allowed to react at 0°C for 1.5 h. Hydrogen fluoride was removed by evaporation and the residue was triturated with diethy] ether.
The residue was filtered off, washed with diethyl ether and extracted with 200 mi of 10% aqueous acetic acid and lyophilised. The crude product was analysed by reversed-phase HPLC on a Vydac C18 column (4,6 x 250 mm, 5p, 100 A) using 6( min linear gradient from 0 to 100% Buffer B (Buffer A: 0.05% TFA in H,O and
Buffer B: 0.05% TFA, 60% CH3;CN in H,0) at flow rate of 0.7 ml/min and detection was performed at 215 nm. Synthetic peptide were purified by RP-HPLC and were characterised and analysed by HPLC, the molecular mass determined by spectrometry.
Example 2, Antibody production
The synthetic whole ApoCllI synthesised in Example | was used to generate polyclonal antibodies in rabbits. The reactivity of this polyclonal anti-whole ApoCII1 antiserum against the other shorter synthetic peptides was then assayed, and fractions - 30 of antibody specific for each peptide were purified from the antiserum. : Immunisation : Peptide ApoCIII (1-79) was emulsified in complete Freund's adjuvant (CFA) and injected intra-dermally using 500ug peptide per injection for the two first injections followed at 15 day intervals with boosters in the same adjuvant but using
250 pg of peptide. The immune response is monitored by taking test bleeds and
ELISA system was used to screen for the anti-peptide activity. } Isolation of the antibodies from serum: The positive bleeds are pooled and the polyclonal antibodies were isolated by precipitation with 27% sodium sulfate. Peptide . specific antibodies were purified from this antibody pool by affinity chromatography.
The peptides produced in example 1 were coupled to CH activated sepharose 4B affinity column chromatography (Pharmacia, Uppsala, Sweden) (Axen and al, 1967) and the whole purified antibody pool was passed through these columns. Non retained proteins on the antigen gel were washed off with phosphate-buffered isotonic saline (PBS: Phosphate 50 mmol/L, pH 7.2, NaCl 150 mmol/L). Non specifically bound fractions on the peptide gel were removed with 25 mmol/L PBS. Elution of polyclonal specific IgG was accomplished using 0.2 M glycine, pH 2.8. Purified antibodies are immediately dialysed against 10 mmol/l PBS and concentrated by ultrafiltration using
Amicon system (cut-off 100 kD) (Amicon, Beverly, USA), assayed in terms of proteins content (Lowry and al, 1951), then stored as 1 ml aliquots (0,5 mg) at -30°C.
Example 3, Epitope mapping of ApoCIII
ELISA. : Microtiter plates (flat-bottom 96-well EIA; Costar, Dutscher) were washed with 0.1 mol/L phosphate-buffered saline (PBS, pH 7,2) before being coated with 100 pl/well of free peptide (5 pg/ml) (1-17, 12-35, 45-65, 45-76 and ApoCIII (1-79)) and incubated overnight at room temperature. The plates were washed four times with buffer and to minimise the non-specific binding to the microtiter wells, the plates were saturated with 250 plL/well of bovine serum albumin at 3% in 0.1 M PBS buffer and incubated for 1 h at 37°C. The plates were washed four times again and incubated for 2 h at 37°C with 100 pL of the purified anti-whole ApoCIII antibody (produced in example 2), diluted in 1% of bovine serum albumin in 0.1 M PBS buffer, then washed three four times with PBS. To assess the immunological reaction, 100 ul of 10 000- . 30 fold diluted, anti-rabbit IgG labelled with peroxidase, in 0.1% of BSA in PBS buffer (Sanofi-Diagnostics Pasteur, Marnes-La-Coquette, France) were added to each well. : After an incubation for 2 h at 37°C, the plates were washed four times with PBS and 100 pL of substrate solution was added. The substrate solution was prepared as follows: 30 mg of o-Phenylenediamine dihydrochloride were dissolved in 20 ml of
0.1 mmol/L phosphate-citrate buffer, pH 5.5 containing 20 pL of 30% hydrogen peroxide. After 30 min at room temperature in the dark, the reaction was stopped by adding to each well 100 pl of 1 mmol/L HCL. The absorbance was measured at 49? nm.
The purified polyclonal antibody generated against the total synthetic apo CIII was used to test its reactivity with the peptides in the ELISA, and also against whole
ApoCIII (“ApoClIlI totale”). For the results see FIG 1. The results showed that the antibody generated against total ApoCIII recognises all the peptides 1-17, 12-35, 45- 65 and 45-76.
Example 4, Affinity of the antibodies to ApoCIII present in lipoproteins
The objective was to check if the different epitopes corresponding to the peptides are accessible in the lipoproteins and to determine the affinity of each antibody fraction to human plasma-purified lipoproteins (HDL, VLDL) and against whole ApoCIII.
Materials and methods
The peptide specific antibody fractions were prepared by immunoaffinity to different peptides coupled to CH sepharose as described in Example 2.
Sandwich ELISA: Microtiter plates (flat-bottom 96-well EIA; Costar, Dutscher) were washed with 0.1 mol/L phosphate-buffered saline (PBS, pH 7.2) before being coated with 100 pL/well of the affinity purified peptide specific antibodies (10 mg/L) and incubated overnight at room temperature. The plates were then washed four times with buffer and incubated for 2 h at 37°C with 100 pL of dilutions of a sample (4 different samples were sed 1. a standard protein of purified human plasma ApoCll], 2. human HDL, 3. human VLDL and 4. synthetic ApoCIII (1-79)). To minimise the non- . 30 specific binding to the microtiter wells, the dilutions of antigen were performed in 1% of bovine serum albumin in 0.1 M PBS buffer. To assess the immunological reaction, : 100 pL of 2 500-fold diluted, polyclonal anti-whole ApoClII antibody labelled with peroxidase, in 0.1% of BSA in PBS buffer were added to each well. After an incubation for 2 h at 37°C, the plates were washed four times with PBS and 100 pL of substrate solution was added. The substrate solution was prepared as follows: 30 mg of o-Phenylenediamine dihydrochloride (Sigma Chemical Co., St Louis, MO) were dissolved in 20 mL of 0.1 mmol/L phosphate-citrate buffer, pH 5.5 containing 20 pL of 30% hydrogen peroxide. After 30 min at room temperature in the dark, the reaction was stopped by adding to each well 100 nL of 1 mol/L HCI. The absorbance was read . at 492 nm.
The results show that all the antibodies anti-12-35 (FIG. 2), anti-45-65 (FIG. 3) and anti-45-76 (FIG. 4) recognise the free synthetic ApoCIII in solution (Graph A) with approximately the same affinity as the polyclonal antibody generated against the total
ApoCIII (“Ac total” - whole rabbit immunoglobulin). Graph B shows recognition of
VLDL, Graph C shows recognition of HDL and graph D shows recognition of
ApoClII (1-79). Of the peptide specific antibodies, anti-12-335 has the highest affinity for ApoClIll in the plasma standard and HDL. Also the reactivity of anti(12-35) with
VLDL similar to that obtained with the whole anti-apo CIII rabbit polyclonal antibody.
Example 5, Effect of different antibodies on the incorporation of apo CII into VLDL.
The objective is to determine the capacity of each antibody to inhibit the association of Apo CIII with VLDL. The VLDL fractions were prepared by ultracentrifugation from normotriglyceridemic (NTG) and hypertriglyceridemic (HTG) patients using conventional techniques. A third fraction of VLDL was prepared from the NTG group, where additional ApoCIIi was loaded in vitro into the VLDL particles (VLDL enriched or VLDL E-CIII).
Radiolabelling: The purified Apo CIII was radioiodinated by Bilheimer’s modification of McFarlane’s method (Bilheimer et al. 1972. Biochim. Biophys. Acta, . 30 260, 212-221). Resin AG 2-X8 is regenerated with NaOH 1M (5 minutes), washed with distilled water, then saturated with PBS 0.01 M BSA 1% (w/v). Apo CII is . dialysed against PBS-EDTA 0.01M. 0.5 mCi '®I are added to 0.1 ml radiolabeled buffer (glycine 1M, NaCl 1M) containing Sul 0.033 M ICI solution. The amount of the prepared solution is mixed to 50 pul of the washed resin. Resin with free ‘>’ is then removed by centrifugation (1 minute at 62200 rpm), then recovered apo CIII are dialysed against PBS-ADTA 0.01M.
Incorporation of apo CII in VLDL (in the presence or not of anti apo CII): 20 ug of each anti-apo CIII antibody is incubated 2 h at 37°C with equivalent amount of '¥I- . apo CIII. Lipoproteins (VLDL NTG, VLDL HTG or VLDL E-CIII) and antibody- '%[-apo CII are mixed (w/w); incubated for 1 h at 37 °C, the non-bound '*I -apo CIII is dialysed. Measurements of '*°] radioactivity in '*’I-apo CII bound to lipoparticles and in non bound '*I-apo CII is performed to have the rate of the capacity of antibodies to inhibit the association between apo CIII and lipoproteins.
Results
The results in FIG 5, show that all the antibodies (anti-whole ApoCIII or peptide specific) have an effect on the incorporation of apo CII in the VLDL comparable to the anti-apo CIII polyclonal antibody.
Example 6, The effect of the ApoClIlIl specific antibodies on lipoprotein lipase activity
The objective is to test the ability of the antibodies to protect the lipoprotein lipase from the inhibitory eftect by the apo CIII.
Assay of lipolysis with heparan sulfate proteoglycan-bound lipoprotein lipase
The assay was performed in 96-well microtiter plates. Wells were incubated with 0.5 pg of heparan sulfate proteoglycan (HSPG) in 100 pl of PBS 0.1M NaCl 0.15 M pH 7.2-7.4 for 18 h at 4°C, washed 3 times with PBS and subsequently blocked for 1 hour 37°C with PBS containing 1% (w/v) essentially free fatty acid bovine serum albumin (BSA). Then, the wells were incubated with 2 pg of lipoprotein lipase (LPL) in 100 pl of 0.1 M Tris 20% glycerol (v/v), pH 8.5 for 2 h at 4°C. Non fixed LPL was washed 3 times with Tris buffer (0.1M Tris, pH 8.5). } 4 fractions of VLDL were then prepared: P1 comprised human plasma-purified
VLDL which was enriched in vitro with ApoB; P2 comprised human plasma-purified
VLDL which was enriched in vitro with ApoB and ApoE. Other fractions were prepared from P1 and P2 by enrichment with ApoCIII (P1/ApoClII enriched and
P2/ApoClll enriched). Some of these 4 fractions were then incubated with the rabbit anti-whole ApoCIIL.
Lipolysis was then started by adding of 100 ul of the lipoproteins fractions to the
LPL coated plates (0.055 to 0.5 mg/ml of 0.1M Tris, pH 8.4 and 1.5 % BSA (w/v), 3 and the incubation was performed at 37°C. The reaction was stopped after 20 min by the addition of 100 pl of Tris buffer, Triton X-100 (2% (v/v), final concentration). 100 pl of lipolysed lipoproteins was sampled from each well, cooled at —20°C then the concentration of free fatty acid was measured using NEFA-C kit (Wako chemicals
Neuss, Germany) according to the instructions of manufacture.
Results
The results are shown in FIG 6., in all cases the activity of the lipoprotein lipase was increased in the presence of the anti-ApoCIII antibodies.
Example 7, Effect of the antibodies on cholesterol efflux.
The objective is to test for possible negative effects of anti-ApoCIII antibodies on
HDL. 1. Isolation of lipoproteins : HDL was isolated from fresh normolipemic human plasma at density 1,063-1,21 by sequential ultracentrifugation using Kbr for density adjustments, washed by reflotation at d=1,21 and dialyzed against 0,01 M phosphate buffered saline, pH 7.4. 2. Isolation of Apo-CIlI containing lipoproteins by immunaffinity chromatographie :
Apo-CIII containing HDL and Apo-ClII non containing HDL were prepared by immunoaffinity chromatography , using anti-CIII antibodies coupled to activated sepharose 4B. Apo-CIII containing HDLare eluted by using 0,01 M phosphate buffered saline ,pH 7.4, EDTA 0.1 g/L and the Apo-CIII non containing HDL are . 30 eluted by using 3M Sodium thiocyanate. Apo CIII containing HDL are dialysed against 0,01 M phosphate buffered saline, pH 7.4, EDTA 0.1 g/L. The pure fraction of : HDL was called HDL, the retained fraction of ApoCIII containing HDL was called
HDL CIII, and the non-adsorbed HDL fraction was called “HDL non CIII”.
3. Seeding conditions : FuSAH which are rat hepatica cells were seeded in 12-well plates at 25000 cells/mL and 2 mL in each well, and cultured in minimal essential medium 95% (GIBCOBRL) supplemented with Penicillin (100 pg/mL), Streptomycin (100 g/mL), Glutamin (2ZmM) and 5% (vol/vol) new born calf serum. Cells were grown for 2 days at 37°C in a humidified 5% CO, atmosphere before the cellular lipid ] radiolabelling.
We used 3 wells per sample and to control the efflux validity we used : - anegative control : 1 mL of minimal essential medium - a positive control : HDL; at 100 pg/mL - an internal control : human normolipemic plasma pool stored at -20°C and used at 2,5% (vol/vol) - a control of labelled cholesterol loading : The radioactivity of cells was measured before incubation with the samples. 4. Radiolabeling of Fu5AH cells : - Radiolabelled cholesterol [1o,2a,(n)- *H]cholesterol was added to the cells to have a final concentration of | uCi/well : - Evaporate X pCi under N, - Add 1 mL of ethanol and incubate 45 to 60 minutes at 60°C. - Evaporate under N, - Add 50 pL of ethanol and incubate 15 to 30 minutes at 60 °C. - Add an equal volume of minimal essential medium (MEM) and of new born calf serum to have a final concentration of 5% in MEM and incubate 30 minutes at 37°C. - Add MEM to have the final volume. - Cells were grown during 3 days in the presence of radiolabel (2 mL/well) 5. Cholesterol efflux : To ensure that the label was evenly distributed among cellular pools, the labelling medium was replaced with MEM containing 0,5% bovine serum . 30 albumin (BSA) 24 hours before the efflux. -Washed one time with cellular phosphate-buffered saline (PBS) and incubate ’ during 3 hours at 37°C, 5% CO, the HDL to a final concentration of 50 pg/mL (500 nL/well). Before the incubation with cells, HDL were preincubated with the different antibodies at 15 pg/mL during 2 hours at 37°C.
- The efflux phase was ended by removing the serum-containing medium from each well and then we washed 3 times the cells with PBS Cells were remove in 500 uL of sodium hydroxyde (0,1 mol/L) per well. - The counting is realised on 250 pL of medium or cellular suspension which we added 4 mL of a scintillation cocktail (Optiphase ‘Hisafe’ 3, WALLAC) ; with a ) liquid scintillation counter (WALLAC 1410) during one minute.
The efflux percentage is calculated like shown : [dpm medium / (dpm medium+dpm cells)]*100
The ApoClIII containing HDL were separated from the non-ApoClIl containing HDL by immunoaffinity. The cholesterol efflux was measured in different fractions (total
HDL, HDL-CIII and HDH non CIII) with and without the anti-whole ApoCIII or anti 12-35 antibody at different concentrations. The results are show in FIGs 7 and 8. It was confirmed with all the experiments that the antibodies do not affect HDL function in terms of cholesterol efflux.
Example 8, Manufacture and immunogenicity of peptide conjugates
Immunogens comprising peptides 12-35 and 45-65 conjugated to bovine serum albumin (BSA) were prepared, formulated into vaccines, and administered intramuscularly in mice.
Four peptides were synthesised, a pair of peptides based on the sequence 12-35 and another pair based on the sequence 45-65 of ApoCIII. Each pair of peptides had a
GGC linker incorporated onto either the N- or C- terminus of the peptide: 12-35coon MQGYMKHATKTAKDALSSVQESQVGGC (SEQ ID NO. 8) 12-35nm2 CGGMQGYMKHATKTAKDALSSVQESQV (SEQ ID NO. 9) 45-65coon DGFSSLKDYWSTVKDKFSEFWGGC (SEQ ID NO. 10) ‘ 45-65n12 CGGDGFSSLKDYWSTVKDKFSEFW (SEQ ID NO. 11)
The peptides were conjugated to a BSA as a protein carrier by Maleimide chemistry.
BSA was purchased from Pierce, which was pre-activated with a succinimidyl 4-(N- maleimidomethyl)-cyclohexane-1-carboxylate (SMCC) linker. SMCC may also be bought from any major manufacturer and used following the manufacturers instructions. The coupling of the BSA to the carrier via the SMCC was carried out . over 2 hr at room temperature with an excess of peptide, before quenching with the reaction with excess cystein, followed by dialysis against phosphate buffer.
SMCC
0
NL
H, + N-OC- N / 0) | O 1 + <<» ne ET, Cys-peptide 10] protein —NH-C- ET — peptide 6)
Analysis of the resultant soluble conjugate immunogens showed that there were around 19 peptides conjugated onto each BSA carrier molecule.
The immunogens were all formulated into vaccines by admixture with an adjuvant system comprising the saponin QS21, 3-de-O-acylated monophosphoryl lipid A (3D- . MPL) and an oil in water emulsion (with squalene and a-tocopherol oil phase) as described in WO 95/17210. The vaccines were then administered to groups of 10
BalbC mice, containing 25 pg of immunogen, intramuscularly on days 0, 14 and 28;
and serum samples were taken on day 28 and day 42. The sera were then analysed for anti-whole ApoClIl titres and anti-peptide titres by ELISA assay (where the plates were coated with either whole ApoCIIl or corresponding peptide), and the results expressed as Mid point titres. i Results
The results showed that the peptide immunogens produced were highly immunogenic, and induced antibodies that cross reacted strongly with native whole ApoCIII. The results obtained in the groups were highly homogenous, and showed a strong boost after the third admistration. The results for each mouse in the groups of 10 are shown in table 1.
Table 1. Murine anti-peptide IgG titres responses post 1 (day 28).
I cl
RL LN A EN
I cA ES EN
EL EC NE J
A i LL EN 2A
EL
Standard 23013 11673 777 4232 = i A
Table 2. Murine anti-peptide IgG titres post III (day 42).
I Lidell
A iE CN iI CTR
A EL ES J EC
A CC LC CR ER
RN EI EX CI EN
EE EA I I CN
Standard 37501 5940 6208 8666
FE a A
Table 3, Murine anti-whole ApoCIII IgG titres post II (day 28).
I Cee Cot
EE EL NO Cz
EE (2: JO EN
I 1 Ci LAN ELL
RL 2 J CL
Standard 2225 1075 5334
Fl wl
. o
Table 4, Murine anti-whole ApoCIII IgG titres post III (day 42).
I de oil a
EE EI CN LN EN
A EEC EN 1
CCN
Standard 18547 12092 8817
FE Ce in
Claims (1)
- C 27.05-0002 AY 182 17:39 FROM oo | oo IU JUagEe3554465 wor Loo 0232: Amended Claims: | :L. An immunogen composition ita for administration to a human host for the treatment or prebeition of atherosclerosi, having an immunogen comprising an i : apolipoprotein or peptide or fragment thereof, which in its full length native form the apolipoprotein has at least one of the following activities (a) the inhibition of the binding of Apolipoprotein B to its receptor, sndlor (b) the inhibition of lipoprotein ’ lipase, and wherein the immunogenic composition is capable of inducing an immune response in 8 human host. | : 2, The immunogenic composition as claimed in claim 1; wherein the full length * native form of the apolipoprotein has both ofithe activities.3. The immunofzenic composition as clajmed in claim 1, wherein the : "apolipoprotein is ApoCTI] or fragment, peptide, or mimotope thereof. i : 4, The immunogenic composition as claimed in claim 3 wherein the ApoCIII or fragment, peptide, of mimotope thereof is conjugated or fused to a protein carrier.SE . 3. The immunogenic composition as claimed in any one of claims 1 to 4, wherein "the immunogen is any one of the sequences sélécted from SEQ ID NO.1-7. :6. A vaccine comprising the immunogenic composition as claimed in any one of claims 1 to 5, and an adjuvant. CT A method of treatment or prophylaxis lof atherosclerosis by selectively inhibiting the activi ty of an atherogenic apol ipoprotein in a human host, comprising administering an agent which results in the inhibition of at least one of the following activities of said atherogenic apolipoprotein in the human host in need of such . SE treatment or prophylaxis, (a) the inhibition of the binding of Apolipoprotein Btoits receptor, and/or (b) the inhibition of lipoproteis lipase. Co oo 8. A method of treatment or prophylaxis of atherosclerosis by selectively inhibiting ApoCIIl activity in a human host, comprising administering an agent which . X results in the selective inhibition of ApoCIIl abivity to a human host in need of such treatment or prophylaxis. :: 0. A method as claimed in claim 7 or 8, wherein the agent is a vaccine comprising ApoCIIl, br fragment thereof, as a immunogen,Co . 10. A method as claimed in claim 7 or 8, wherein the agent is a ligand of ApoClIL.11. . ‘A method as claimed in claim 10, wher the ligand is an antibody. Lo. . Lo ~ AMENDED SHEET Fomofangs7elt £1-md1. 10.1%: LC os aoe i | IU JygassSzs9saans r.0isil ." 27-05-2002 "AY '82 17:39 FROY | | EP010232 lo ¢ : | : : 12. A method as claimed in claims 7 to 11, whérein the agent blocks the ApoCIII- , : ) . mediated inhibition of lipoprotein lipase and the binding of ApoB to its receptor. oo I SR = oo . . A ! : . ne i Lo] . . - ] Co : ’ 1 od : Cd | a i i ] ; SE oo _- i | ol Co Co] - , AMENDED SHEET Fmofangsvesl Z1 Mat. 10-4% !
Applications Claiming Priority (1)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
GB0005240A GB0005240D0 (en) | 2000-03-03 | 2000-03-03 | Vaccine |
Publications (1)
Publication Number | Publication Date |
---|---|
ZA200207001B true ZA200207001B (en) | 2003-12-01 |
Family
ID=9886966
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
ZA200207001A ZA200207001B (en) | 2000-03-03 | 2002-08-30 | Vaccine for the treatment of artherosclerosis. |
Country Status (2)
Country | Link |
---|---|
GB (1) | GB0005240D0 (en) |
ZA (1) | ZA200207001B (en) |
-
2000
- 2000-03-03 GB GB0005240A patent/GB0005240D0/en not_active Ceased
-
2002
- 2002-08-30 ZA ZA200207001A patent/ZA200207001B/en unknown
Also Published As
Publication number | Publication date |
---|---|
GB0005240D0 (en) | 2000-04-26 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
EP1267908B1 (en) | Vaccine for the treatment of atherosclerosis | |
US20040052809A1 (en) | Vaccine | |
KR101983685B1 (en) | Vaccine | |
JP2005508900A6 (en) | vaccine | |
US20140179900A1 (en) | Treatment of atherosclerosis with cholesterol ester transport protein mimotopes | |
JP2018048177A (en) | PCSK9 peptide vaccine | |
WO2004080375A2 (en) | Vaccine therapy of atherosclerosis | |
WO2004081045A2 (en) | Vaccine related to modified apolipoprotein c-iii | |
WO2004081046A2 (en) | Human monoclonal antibodies against apociii and their use in the therapy of atherosclerosis | |
ZA200207001B (en) | Vaccine for the treatment of artherosclerosis. | |
KR20050093280A (en) | Anti-obese immuogenic hybrid polypeptides and anti-obese vaccine composition comprising the same | |
US20050287137A1 (en) | Novel composition | |
EP2532359A1 (en) | CETP fragments | |
TW201420112A (en) | Peptide, pharmaceutical compound and use of the pharmaceutical compound thereof |