WO2025253079A1 - Anticorps monoclonal d'isotype igm anti-hla-dr potentialisant l'activite d'anticorps d'isotype igg1 ou igm anti-cd20 - Google Patents
Anticorps monoclonal d'isotype igm anti-hla-dr potentialisant l'activite d'anticorps d'isotype igg1 ou igm anti-cd20Info
- Publication number
- WO2025253079A1 WO2025253079A1 PCT/FR2025/050510 FR2025050510W WO2025253079A1 WO 2025253079 A1 WO2025253079 A1 WO 2025253079A1 FR 2025050510 W FR2025050510 W FR 2025050510W WO 2025253079 A1 WO2025253079 A1 WO 2025253079A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- igm
- hla
- cell
- cells
- monoclonal antibody
- Prior art date
- Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
- Pending
Links
Classifications
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2803—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily
- C07K16/2833—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against the immunoglobulin superfamily against MHC-molecules, e.g. HLA-molecules
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K16/00—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
- C07K16/18—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
- C07K16/28—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
- C07K16/2887—Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against CD20
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K2039/505—Medicinal preparations containing antigens or antibodies comprising antibodies
- A61K2039/507—Comprising a combination of two or more separate antibodies
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
- A61P35/02—Antineoplastic agents specific for leukemia
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/30—Immunoglobulins specific features characterized by aspects of specificity or valency
- C07K2317/35—Valency
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/50—Immunoglobulins specific features characterized by immunoglobulin fragments
- C07K2317/52—Constant or Fc region; Isotype
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/73—Inducing cell death, e.g. apoptosis, necrosis or inhibition of cell proliferation
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2317/00—Immunoglobulins specific features
- C07K2317/70—Immunoglobulins specific features characterized by effect upon binding to a cell or to an antigen
- C07K2317/76—Antagonist effect on antigen, e.g. neutralization or inhibition of binding
Definitions
- the present invention relates to a new anti-HLA-DR IgM isotype monoclonal antibody and its use alone or in addition to anti-CD20 IgG1 or IgM isotype antibodies, in the treatment of malignant B-cell lymphoid hemopathies, such as chronic lymphocytic leukemia (CLL) and B-cell non-Hodgkin lymphomas.
- malignant B-cell lymphoid hemopathies such as chronic lymphocytic leukemia (CLL) and B-cell non-Hodgkin lymphomas.
- the present invention has applications in human health, for example in immuno-hematology, hemato-oncology and oncology, and malignant B-cell lymphoid hemopathies.
- references in brackets ([ ]) refer to the list of references at the end of the text.
- immunotherapy has become one of the most remarkable advances in the field of cancer treatment, particularly for lymphoid malignancies, primarily of B-cell phenotype.
- lymphoid malignancies primarily of B-cell phenotype.
- immunotherapy harnesses the power of the immune system to fight the disease.
- humanized or divalent human lgG1 monoclonal antibodies represent the majority (80%) of approved antibodies for various oncological and hematological indications.
- CD20 protein a transmembrane glycoprotein primarily expressed on the surface of mature B lymphocytes. Its main role is to act as a crucial regulator of B lymphocyte proliferation and differentiation, as well as their activation and immune function.
- CD20 acts as a calcium channel, sharing structural similarities with certain ion channels (CD20: a B-cell-specific tetraspan protein).
- the membrane protein CD20 regulates a calcium channel that acts synergistically with the B-cell receptor (BCR).
- B-cell lymphoproliferative disorders such as B-cell non-Hodgkin lymphoma and chronic lymphocytic leukemia.
- B-cell lymphoid malignancies involves the use of anti-CD20 monoclonal antibodies that allow for the elimination of pathological and clonal B lymphocytes while preserving the functions of other immune cells, especially T and NK cells.
- rituximab (a type I anti-CD20 monoclonal antibody) has demonstrated significant clinical activity against the majority of B-cell neoplasms, such as diffuse large B-cell lymphoma (DLBCL), follicular lymphoma (FL), and mantle cell lymphoma (MCL).
- RTX can be used alone in indolent B-cell non-Hodgkin lymphomas such as FL in immunotherapy or in combination with chemotherapy in aggressive B-cell non-Hodgkin lymphomas in the form of immunochemotherapy.
- the reference anti-CD20 monoclonal antibody is Obinutuzumab (OBZ) (type II anti-CD20 monoclonal antibody), used, according to current clinical recommendations (FILO-LYSA 2025 recommendations), in combination with an inhibitor of the B-cell lymphoma 2 oncogene, Bcl-2 (Venetoclax).
- OBZ Obinutuzumab
- FILO-LYSA 2025 recommendations current clinical recommendations
- Bcl-2 Bcl-2
- Today, "chemo-free" approaches are becoming the norm in clinical practice and clinical research protocols, as well as the preferred option for patients, compared to immunochemotherapy.
- an anti-CD20 monoclonal antibody for example, rituximab (RTX)
- RTX rituximab
- measurable residual disease persists after treatment (incidence of 67%) [1-3].
- chemo-free therapeutic approach requires enhancing the bioactivity of anti-CD20 mAbs or other anti-B-cell mAbs (anti-CD19, anti-CD38 (daratumumab and isatuximab), anti-CD47, etc.) without causing toxicity.
- the current approach involves considering their combination with a therapy targeting a B-lymphocyte tumor protein, such as venetoclax (targeted therapy), or potentially in the future, with a chromatin modulator or another agent (alisertib, TGF-P inhibitor, FOXO1, or farnesyltransferase) [4-10].
- a therapy targeting a B-lymphocyte tumor protein such as venetoclax (targeted therapy)
- a chromatin modulator or another agent alisertib, TGF-P inhibitor, FOXO1, or farnesyltransferase
- immunotherapy presents challenges, including the variability in patient response, the identification of predictive biomarker(s) of clinical response to an immunotherapeutic agent and/or targeted therapy, and the possible emergence of biological resistance (e.g., epitope downregulation).
- MRD status is a major factor in ensuring a favorable clinical outcome for the patient, which is crucial for progression-free survival (PFS) and overall survival (OS).
- MRD status is a good predictor of PFS and the quality of remission of the hematological malignancy. In cases of complete hematological remission, but with an MRD positivity > 10 ⁇ 4 (i.e., intermediate MRD: 10 ⁇ 4 – 10 ⁇ 2 ; or high MRD: > 10 ⁇ 2 ), treatment intensification is currently considered beneficial.
- monitoring MRD progression is advised when a low or undetectable MRD ⁇ 10 ⁇ 4 is achieved, which should prompt consideration of treatment if MRD becomes detectable again, before clinical relapse occurs.
- RTX resistance also involves the overexpression of Bcl-2 or Bcl-xL molecules, which act as anti-apoptotic factors.
- OBZ is the standard antibody treatment used, according to the FILO-LYSA 2025 clinical guidelines, as first -line therapy (in first relapse, RTX is recommended).
- OBZ (or RTX in first relapse) is prescribed in combination with venetoclax, an anti-Bcl2 targeted therapy.
- This treatment is limited to 1-2 years, and measurable minimal residual disease (MRD) is achievable (MDR-negative: 62% for the RTX + venetoclax combination in the MURANO clinical trial; 76% for the OBZ + venetoclax combination in the CLL14 study).
- MDR-negative 62% for the RTX + venetoclax combination in the MURANO clinical trial; 76% for the OBZ + venetoclax combination in the CLL14 study.
- MDR-negative 62% for the RTX + venetoclax combination in the MURANO clinical trial
- 76% for the OBZ + venetoclax combination in the CLL14 study This combination of immunotherapy and targeted therapy
- BTK inhibitor continuous lifelong treatment, with detectable residual disease persisting in 90% of cases for ibrutinib monotherapy
- a BTK inhibitor can also be combined with venetoclax, but the risk of cardiological complications is real: hypertension, atrial fibrillation. Indeed, this combination is associated with competition for cytochrome P450, CYP3A4, for the hepatic catabolism of both molecules and may increase or alter their plasma concentrations.
- the combination of a BTK inhibitor and venetoclax considerably increases the cost of this combined targeted therapy.
- BTK inhibitor Treatment with a BTK inhibitor as monotherapy is effective but leads to measurable residual disease, most often detectable, requiring long-term treatment and resulting in a significant medical and economic cost.
- the combination of a BTK inhibitor (ibrutinib) and obozoolitinib (OBZ) leads to to a negative MRD in 30% of cases (ILLUMINATE study).
- the combination of a BTK inhibitor (Ibrutinib) and Venetoclax leads to a negative MRD in 75% of cases at 12 treatment cycles (CAPTIVATE study).
- IgG isotype of monoclonal antibody to use at the bedside.
- IgG1 antibodies with their divalent structure, represent the majority (80%) of approved and authorized antibodies for various hematological and oncological indications.
- IgM monoclonal antibodies have entered the therapeutic arena. Due to their natural format, which can be either pentameric or hexameric, their bioactivity and anti-tumor potency can be considered potentially superior to those of IgG, due to their greater complement-dependent cytotoxicity (CDC) and multivalence, as they offer the advantage of numerous binding sites for their target (10 or 12 sites, respectively).
- CDC complement-dependent cytotoxicity
- IgM This multivalence of IgM is capable of inducing strong multimerization of epitope targets on the cell surface, cellular and molecular agglutination capabilities, and thus inducing intracellular signal transduction pathways (such as the ERK1/2 pathway) and/or cytokine responses (interferon-gamma, TNF-alpha, IL-12, etc.), leading to a significant reduction in the viability of tumor cells and their eventual death.
- intracellular signal transduction pathways such as the ERK1/2 pathway
- cytokine responses interferon-gamma, TNF-alpha, IL-12, etc.
- the IgM isotype has thus been introduced into the generation of monospecific and bispecific antibodies against solid and hematological malignancies (IgM-8444, DR5 receptor crosslinking agonist) and against refractory and resistant non-Hodgkin lymphomas and CLL (anti-CD20 x CD3 IgM) (IgM BioSciences).
- PAT-SM6 has also been evaluated in a phase 1 trial in relapsed or refractory multiple myeloma [11-15].
- RTX or OBZ B lymphocyte pathologies resistant to anti-CD20 monoclonal antibodies
- OBZ B lymphocyte pathologies resistant to anti-CD20 monoclonal antibodies
- an unmet medical need such as: • P53 gene deletion CLL and doubly refractory (2R CLL) (high genetic risk and high risk of Richter transformation) or patients not tolerating reference treatments and/or having experienced major adverse effects, and elderly patients who cannot tolerate them and/or at risk of complications with these treatments (cardiac, infectious%), also referred to as "unfit" patients.
- Double or triple hit (DHL/THL) and dual expression (DEL) non-Hodgkin lymphomas, both of which lead to an amplification of the expression of the c-Myc oncogene (a proliferation factor with Ki-67 > 70%), as well as elderly patients with relapsed, refractory or resistant diffuse large B-cell lymphoma.
- DHL/THL Double or triple hit
- DEL dual expression
- allogeneic bone marrow transplantation may be considered:
- bispecific antibodies BsAbs
- CAR-T cells chimeric antigen receptor T cells
- BsAbs are antibodies with two binding sites directed against two different antigens or two different epitopes of the same antigen.
- CRS is observed in 90% of patients (40% grade 1 and 50% grade 2).
- epcoritamab bispecific IgG 1 anti-CD3xanti-CD20
- scFv-based anti-CD3/anti-CD19 BsAb (BiTE, blinatumomab) has received marketing authorization, but this molecule has a very short half-life (must be administered by continuous infusion) and can cause significant side effects.
- Neurological events including tremors, seizures, and changes in mental status, can be observed in 52% of patients, primarily grade 1 or 2, with 11% grade 3 and 4 (2%) grade 4 [17-19].
- CAR-T cells represent another promising area of investigation in adoptive cell therapies, combining the strengths of T cells and antibodies to stimulate the anti-tumor activity of T cells.
- CD19 CAR-T cells have been widely used in B-cell lymphoid malignancies, and there is limited experience with their use in chronic lymphocytic leukemia (CLL).
- CLL chronic lymphocytic leukemia
- their efficacy is uncertain and controversial due to the exhausted phenotype of T lymphocytes and the possible loss of CD19 via shaving, creating resistance to CAR-T cell therapy.
- HLA-DR protein is a class II MHC cell surface receptor encoded by the human leukocyte antigen complex on the 6p21.31 region of chromosome 6. Its primary function is to present peptide antigens, potentially of foreign origin, to the immune system in order to induce responses CD4+ T lymphocytes (helper T cells) potentially lead to the production of antibodies against the same peptide antigen.
- the anti-HLA-DR IgG1 antibody has been tested against B-cell malignancies (International Request WO2010145895) [23].
- mice treated with the combination of anti-CD5 + anti-HLA-DR monoclonal antibodies did not develop disease, unlike mice treated with other combinations: anti-HLA-DR x anti-CD71 or anti-CD20, or RTX mAb alone.
- Anti-CD20 antibodies are very effective, but minimal residual disease (MRD) is still detectable and measurable.
- the inventors therefore sought to improve CD20-based immunotherapies by avoiding the formation of disease resistance mechanisms against this type of agent (e.g., resistance to the use of anti-CD20 lgG1 isotype antibodies such as RTX and OBZ) while reducing the risk of disease recurrence, the risk of which can be assessed by measuring minimal residual disease using RT-qPCR (ASO-PCR, or immunophenotyping of the tumor clone by flow cytometry, or more recently, next-generation sequencing, i.e., NGS studies) of blood and/or bone marrow cells.
- RT-qPCR ASO-PCR, or immunophenotyping of the tumor clone by flow cytometry, or more recently, next-generation sequencing, i.e., NGS studies
- the primary objective is to increase the efficacy of type I anti-CD20 IgG1 monoclonal antibodies (e.g., RTX) for non-CLL B-cell lymphoid malignancies and type II monoclonal antibodies (e.g., OBZ, reference antibody) for B-cell CLL and/or anti-CD20 IgM monoclonal antibodies; and to overcome resistance to anti-CD20 antibodies.
- type I anti-CD20 IgG1 monoclonal antibodies e.g., RTX
- type II monoclonal antibodies e.g., OBZ, reference antibody
- Medical applications include: - B-cell lymphoid malignancies in general, but in particular pathologies resistant to anti-CD20 monoclonal antibodies (RTX or OBZ) or presenting an unmet medical need, such as:
- CLL 2R CLL with P53 gene deletion and double-refractory
- Double or triple hit (DHL/THL) and dual expression (DEL) non-Hodgkin lymphomas, both of which lead to an amplification of the expression of the c-Myc oncogene (a proliferation factor with Ki-67 > 70%), as well as elderly patients with relapsed, refractory or resistant diffuse large B-cell lymphoma.
- DHL/THL Double or triple hit
- DEL dual expression
- an anti-HLA-DR IgM monoclonal antibody (heavy chain VHantiHLADR-Cmu, SEQ ID NO: 1; light chain VLantiHLADR-Ck, SEQ ID NO: 2; VHanti-HLADR, SEQ ID NO: 3; VLanti-HLADR, SEQ ID NO: 4) in combination with an anti-CD20 type I (rituximab, RTX) or II (Obinutuzumab, OBZ) IgM monoclonal antibody, or with an anti-CD20 IgM monoclonal antibody, improves the efficacy of anti-CD20 monoclonal antibodies.
- an anti-CD20 type I rituximab, RTX
- II Optuzumab, OBZ
- Anti-HLA-DR IgM even at low doses or isodoses relative to anti-HLA-DR IgG, when combined with anti-CD20, is capable of complementing the anti-tumor B-cell response of anti-CD20 and achieving residual disease that is not measurable in vivo.
- Anti-HLA-DR IgM showed no in vitro toxicity in HLA-DR+ HUVEC cells, unlike other lgG1 anti-HLA-DR isotype antibodies such as IMMU-114 (L243). No toxicity was observed during in vivo experiments in the CLL-PDX NGS mouse model or the chicken embryo.
- the inventors are therefore proposing a new treatment for CLL and B-cell malignant lymphoid hematological disorders (non-Hodgkin B-cell lymphomas), particularly in clinical situations involving B-cell malignant lymphoid hematological disorders.
- presenting an unmet medical need (see above), based on a combination of two antibodies, anti-CD20 (e.g. OBZ or RTX) and anti-HLA-DR IgM, which leads to residual disease that is no longer measurable, unlike the reference treatment with anti-CD20 IgG 1 (OBZ or RTX) and better management of B lymphoid malignancies and patients, especially when the disease progresses and the patient becomes resistant to OBZ/RTX IgG 1.
- anti-CD20 e.g. OBZ or RTX
- anti-HLA-DR IgM anti-HLA-DR IgM
- the present invention relates to an anti-HLA-DR IgM monoclonal antibody in pentameric or hexameric form.
- the IgM anti-HLA-DR IgM monoclonal antibody recognizes the same epitope or epitope fragment as the murine IgG1 monoclonal antibody IMMU357 (Beckman Coulter), but with a higher affinity for the HLA-DR molecule.
- IgG1 Isotype IMMU357 is a monoclonal antibody used in diagnostics.
- the monoclonal antibody disotype IgM anti-HLA-DR is in pentameric or hexameric form, preferably pentameric, and exhibits greater efficacy than lisotype lgG1 anti-HLA-DR.
- the monoclonal antibody disotype IgM anti-HLA-DR according to the present invention has the function of potentiating the activity of monoclonal antibodies disotype lgG1 anti-CD20 and/or disotype IgM anti-CD20.
- the present invention further relates to a pharmaceutical composition
- a pharmaceutical composition comprising the anti-HLA-DR IgM monoclonal antibody according to the present invention, at least one anti-CD20 IgG1 monoclonal antibody and/or at least one anti-CD20 IgM monoclonal antibody, and a pharmaceutically acceptable excipient.
- said at least one monoclonal antibody disotype lgG1 anti-CD20 is an anti-CD20 of type I.
- said at least one monoclonal antibody disotype lgG1 anti-CD20 is an anti-CD20 type II.
- the present invention further relates to an anti-HLA-DR IgM monoclonal antibody according to the present invention or a pharmaceutical composition according to the present invention, for use as a medicinal product.
- the present invention further relates to an anti-HLA-DR IgM isotype monoclonal antibody according to the present invention or a pharmaceutical composition according to the present invention, for use in the treatment of lymphoma, for example of B lymphoid malignancy, non-Hodgkin lymphoma (of B phenotype) or chronic lymphocytic leukemia of the B lineage (CLL) and also in clinical situations of B lymphoid malignancy presenting an unmet medical need (see above).
- lymphoma for example of B lymphoid malignancy, non-Hodgkin lymphoma (of B phenotype) or chronic lymphocytic leukemia of the B lineage (CLL) and also in clinical situations of B lymphoid malignancy presenting an unmet medical need (see above).
- Figure 1 represents the epitope map of the anti-HLA-DR Isotype IgM monoclonal antibody. Residues predicted to belong to the epitope are indicated on the sequence and on the structure of the target, the alpha (HLA-DRA) and beta (HLA-DRB) subunits of the HLA-DR molecule (SEQ ID NO: 5). They are divided into four categories according to their crude probability of belonging to the epitope, using a gray gradient from lightest to darkest, corresponding to low to high probability. Regions of weak (0, light gray) to strong (3, dark gray) interactions are represented by lines below the amino acid sequences.
- Figure 2 compares the antigenic recognition specificity of the anti-HLA-DR monoclonal antibody IgM with four commercial anti-HLA-DR IgG antibodies used for diagnosis.
- the histograms represent the overlay of MFIs obtained by flow cytometry analysis for Daudi cell line B cells (HLA-DR positive) labeled with commercial anti-HLA-DR IgG I antibodies (LN3 and L243 from Biolegend; and IM1638U and IMMU-357 from Beckman) coupled to FITC.
- FITC fluorescent binding
- FIG. 3 shows the comparative membrane distribution of the HLA-DR epitope, according to the isotype of the anti-HLA-DR agonist monoclonal antibody, IgM or IgG.
- CLL cells are incubated with FITC-conjugated anti-HLA-DR IgG1 and IgM monoclonal antibodies at 2 pg/ml for 4 hours on glass coverslips in serum-free RPMI medium. After fixation, the cells are covered of a mounting medium containing DAPI (nuclear labeling) and analyzed by fluorescence microscopy.
- the figure shows representative images obtained with anti-HLA-DR IgG or IgM mAbs, the nuclei (DAPI), and the fusion of the two fluorescences (MERGE). Scale bar 10 ⁇ m.
- Figure 4A represents the comparative B cell mortality of primary and patient-derived clonal B lymphocytes, observed after 6 hours (H6) of treatment with anti-HLA-DR IgG and IgM isotypes.
- CLL cells were incubated for 6 hours with anti-HLA-DR IgG and IgM monoclonal antibodies at an isodose concentration of 2 pg/ml.
- B cell cytotoxicity was then analyzed by flow cytometry using an anti-CD19-AF700 antibody for specific B cell detection and annexin V coupled to FITC for dead cell detection. Normalized B cell mortality is shown for each condition. Bars represent mean ⁇ SEM. Statistical significance of differences between groups was determined using the unpaired t-test (*p ⁇ 0.05).
- Figure 4B represents the comparative B cell mortality of primary and patient-derived clonal B lymphocytes, observed after 6 hours (H6) of treatment with anti-CD20 lgG1 alone or in combination with the anti-HLA-DR IgM isotype.
- CLL cells were incubated for 6 hours with anti-CD20 lgG1 mAbs, anti-HLA-DR IgM, or the combination of both, all at an isodose concentration of 2 pg/ml.
- FIG. 5A illustrates the impact of the tumor microenvironment on the bioactivity of IgG1 or IgM anti-CD20 and IgM anti-HLA-DR monoclonal antibodies.
- Autologous serum reflects the immunosuppressive activity of the tumor microenvironment (TM).
- AS contains molecules with activity Immunosuppressive agents (soluble HLA-DR molecules that induce immunological tolerance, TGF-beta, soluble CD48, etc.) and survival factors derived from nurse-like cells were used.
- RTX anti-CD20 rituximab
- B cell cytotoxicity was then analyzed by flow cytometry (FC) using an anti-CD19-AF700 antibody for specific B cell detection and annexin V coupled to FITC for dead cell detection. Normalized B cell mortality is shown for each condition. Bars represent mean ⁇ SEM.
- Figure 5B illustrates the impact of the tumor microenvironment on the bioactivity of anti-CD20 IgG1 or IgM monoclonal antibodies.
- CLL PBMCs were pre-incubated for 16 hours, with or without CpG ODN (1.5 pg/ml) and CD40 ligand (CD40L) (1 pg/ml), to induce a microenvironment conducive to B cell survival, mirroring the in vivo survival effect of the tumor microenvironment. Following this, the cells were treated with the monoclonal antibodies for 5 hours at a dose of 2 pg/ml. B cell death was assessed by annexin V staining.
- Figure 6A illustrates the study of the impact of the chronobiology of treatment with anti-CD20 IgG1 and anti-HLA-DR IgM on the synergistic activity of the IgG-plus-IgM combination.
- Cell death induced by the anti-CD20 RTX and OBZ monoclonal antibodies of the lgG1 isotype in combination with anti-HLA-DR IgM was determined after incubating CLL cells for 6 hours with the monoclonal antibodies at 2 pg/ml, with IgG applied 30 minutes before IgM or vice versa.
- Figure 7A illustrates the impact of in vivo treatment with rituximab (RTX) on minimal residual disease (MRD) compared with its combination with anti-HLA-DR IgM.
- RTX rituximab
- MRD minimal residual disease
- Figure 7B illustrates the impact of in vivo treatment with the antibody obinutuzumab (OBZ) on MRD, compared to its combination with anti-HLA-DR IgM.
- OBZ antibody obinutuzumab
- Detection of human tumor cells (CLL PBMCs) in the mouse xenograft model was evaluated in CLL-PDX NGS mice (n 5 per group).
- Group 1 control (0.9% NaCl).
- Group 2 obinutuzumab OBZ.
- Group 3 anti-HLA-DR IgM.
- Group 4 obinutuzumab OBZ/anti-HLA-DR IgM. Animals were sacrificed 5 days after treatment with the mAbs (Day 5).
- FIG. 8A represents post-treatment (at H6) B cell viability with therapeutic anti-CD20, IgG, and IgM anti-HLA-DR monoclonal antibodies, used alone or in combination. Viability is identified by B lymphocyte depletion (% B cell) for combinations of type I or II anti-CD20 IgG (RX and OBZ antibodies) and anti-HLA-DR IgM, the same combinations with inverted isotypes, and "double IgM" combinations; compared to the antibodies used alone or to a negative control without antibodies.
- Figure 8B represents cell death of "remaining" B cells (identified by a size/structure remaining normal), for anti-CD20 IgG type I or II combinations (RX and OBZ antibodies) and anti-HLA-DR IgM, the same combinations with reversed isotypes, and "double IgM” combinations, compared to antibodies used alone or a negative control without antibodies.
- FIG. 8C represents the importance of epitopes in the bio-activity of anti-CD20 IgG antibodies on primary tumor B cells from patients with CLL.
- IgG and IgM isotypes in anti-CD20 and anti-HLA-DR antibody combinations were evaluated using PBMCs from chronic lymphocytic leukemia (CLL). CLL cells were suspended at 1 million per milliliter in RPMI culture medium, 10% freshwater salt (FWS). The anti-HLA-DR and anti-CD20 IgG and IgM isotype antibodies RTX and OBZ were incubated with the cells at a concentration of 2 pg/ml.
- mAbs monoclonal antibodies
- RX or OBZ anti-CD20
- OBZ anti-HLA-DR combinations
- the percentage (%) of target B cells [Fig. 8A], B cell death [Fig. 8B], and the effect of control isotypes [Fig. 8C] were assessed after 6 hours (H6) of incubation by flow cytometry using an anti-CD19-AF700 antibody for specific detection of B lymphocytes and annexin V coupled to FITC for detection of dead cells (Excitation: 488 nm; Emission: 350 nm). Data were collected and analyzed using Kaluza software.
- Figure 10 shows the comparative anti-tumor response of hexameric and pentameric IgM by the Incucyte technique after 48 hours in 7 patients with CLL.
- Kinetic analysis of cytotoxicity and oxidative stress was performed using the Incucyte® Live-Cell Analysis System (Essen BioScience, Ann Arbor, ML, USA) at 37°C with 5% CO2 .
- Peripheral blood mononuclear cells (PBMCs) were seeded in 96-well culture plates (300,000 cells/well in 200 pL of complete RPMI medium). For cell viability analysis, the medium was supplemented with 5 pM of Incucyte® Cytotox Green reagent, which specifically penetrates dead cells.
- PBMCs Peripheral blood mononuclear cells
- Intracellular oxidative stress was quantified using the CelIROXTM Deep Red probe (5 pM). The mortality rate was calculated by cross-referencing cytotoxicity and oxidative stress signals, normalized by the detected cell surface area. Antibodies were tested in duplicate on PBMCs. Acquisitions were performed hourly for 48 to 72 hours using a 20x objective. Four images were collected per well at each time point. Phase-contrast imaging was used to monitor the morphological dynamics of cell populations during treatment.
- Figure 11 presents a comparative dose-response curve analysis of B-cell depletion in three CLL patients (CLL1, CLL2, CLL3).
- the cytotoxicity of hexameric and pentameric IgM was evaluated as a dose effect (1–5–10 pg/ml) on PBMCs from three CLL patients.
- CLL cells were suspended at 1 million per milliliter in RPMI culture medium, 10% FBS. Monoclonal antibodies were added in increasing doses and incubated for 6 hours. The percentage of target B cells after treatment was measured by flow cytometry. using an anti-CD19-AF700 antibody. Data were collected and analyzed with Kaluza software.
- FIG. 12 represents the comparative analysis of the bioactivity of pentameric and hexameric IgM after resistance induction: a) study of B lymphocyte depletion; b) study of cell death.
- CLL cells were suspended at 1 million per milliliter in RPMI culture medium, 10% FBS.
- the mAbs were incubated with the cells at a concentration of 2 pg/ml.
- the percentage (%) of B target [Fig.
- Fig. 12a] as well as the % of B cell death [Fig. 12a] 12b] were evaluated after 6 hours of incubation by flow cytometry using an anti-CD19 antibody, AF700, for the specific detection of B lymphocytes and annexin V coupled to FITC for the detection of dead cells (Excitation: 488 nm; Emission: 350 nm). Data were collected and analyzed using Kaluza software.
- Figure 13 illustrates the endothelial toxicity study of pentameric and hexameric IgM on: a) primary HUVEC cells in the absence or presence of PBMCs from CLL patients; b) the EA.hy926 endothelial cell line.
- cells were stimulated with 10 ng/ml of interferon gamma (IFN ⁇ ) for 24 hours to induce HLA-DR protein membrane expression.
- IFN ⁇ interferon gamma
- Endothelial toxicity was assessed on primary HUVEC cells (PromoCell) in 12-well plates ( 2 x 105 HUVEC/well/ml) [Fig. 13a].
- monoclonal antibodies mAbs
- HUVECs were co-cultured with CLL PBMCs (6 million/ml) at the time of mAb addition. After 6 hours of incubation, the PBMCs (non-adherent cells) were washed off, and then the HUVECs were detached by trypsin. Mortality was assessed by flow cytometry with annexin V/IP staining (apoptosis: annexin V+; necrosis: annexin V+/IP+).
- Endothelial toxicity on the EA.hy926 cell line was assessed in a 96-well plate (2.5 x 105 EA.hy926/ml) [Fig. 13b].
- Monoclonal antibodies (mAbs) were added at 5 pg/ml in the presence of 20% human serum.
- the anti-HLA-DR IgG L243 antibody was tested in comparison to hexameric and pentameric IgM. After 24 hours of treatment, cell viability was assessed using the MTS assay (Promega) after 1 hour of incubation. The cells' ability to reduce MTS to formazan is measurable at 490 nm.
- This absorbance represents the mitochondrial activity induced by treatment with the monoclonal antibody in question (hexameric IgM, pentameric IgM, or anti-HLA-DR L243 antibody).
- One-hour incubation with 10 mM H2O2 was used as a positive control, consistent with the MTS assay.
- the results represent the absorbance value of the test wells minus the absorbance obtained for the cell-free medium (OD 490: test - blank).
- Figure 4 illustrates the study of anti-B-lymphocyte cytotoxicity induced by the IgG/IgM combination in a non-Hodgkin lymphoma model: a) Cells from patients with B-cell non-Hodgkin lymphoma (B-NHL): marginal zone lymphoma (MZL) and mantle cell lymphoma (MCL); b) and c) The Raji cell line was used as a model for studying Burkitt lymphoma in 3D spheroid culture.
- B-NHL B-cell non-Hodgkin lymphoma
- MZL marginal zone lymphoma
- MCL mantle cell lymphoma
- the Raji cell line was used as a model for studying Burkitt lymphoma in 3D spheroid culture.
- Figure 14a assesses the toxicity of NHL PBMCs after 4 hours of treatment in a 96-well plate (1 million/ml) by flow cytometry using an anti-CD19-AF700 antibody with annexin V staining (apoptosis).
- the monoclonal antibodies (mAbs) were added at 2 pg/ml in the presence of 10% FBS. Data were collected and analyzed using Kaluza software. The results represent the percentage of the B tumor target and the percentage of cell death on these same cells.
- Fig. 14b The toxicity of monoclonal antibodies (mAbs) on the Raji cell line was evaluated in the 3D spheroid model in the absence and presence of effector T lymphocytes from a healthy donor.
- T cells were seeded at 1 x 104 cells per well of ULA round-bottom plates (Face 11 i tate) and cultured for 3 days, before or without the addition of effector T lymphocytes (T cells) at 3 x 104 cells per well and the parallel addition of mAbs at 2 pg/ml. Acquisition was performed using the IncucyteTM and the Spheroid analysis module. The histogram on the right represents the surface area of the spheroids after day 4 treatments in ⁇ m2 .
- Fig. 14c The images corresponding to the spheroids after 4 days of treatment were obtained with IncucyteTM; the white area in the spheroids corresponds to the surface area of live cells (MRD).
- the scale bar represents 1.3 mm.
- the original anti-HLA-DR monoclonal antibody was generated in mice using human cells expressing HLA-DR as the antigen.
- Complementary DNA encoding the VH and VL variable domains of this antibody was isolated from murine hybridoma (International Request WO201 0/145895) [23]. This cDNA enabled the production of this antibody in recombinant form under the IgG1 and IgM isotypes.
- An anti-HLA-DR IgM monoclonal antibody in its hexameric form (12 Fab domains instead of 2 with an lgG1) was produced using the baculovirus/insect cell expression system.
- the cDNAs encoding the variable VH and VL regions of the anti-HLADR antibody were cloned into two specific transfer vectors (pVT light chain and pVT heavy chain) already containing complementary DNAs encoding the constant kappa or mu regions, as described in Juliant et al. 2013 [24].
- Double recombinant viruses were generated after co-transfection of Sf9 cells (ATCC CRL1711) with the two loaded transfer vectors and viral DNA, according to the technology described in International Application WO2019/081858 [25].
- the recombinant viruses were cloned using the plaque lysis method. The genome of the recombinant viruses was checked by southern blot, and the sequences integrated into the viral DNA were verified by sequencing after PCR amplification. After 3 days of incubation at 28°C, the recombinant antibodies secreted during the infection of serum-free cultured Sf9 cells were purified from the culture supernatant on a protein A column. Antibody purity was verified by polyacrylamide gel electrophoresis and silver staining.
- An anti-HLA-DR IgM monoclonal antibody in its pentameric form (10 Fab domains instead of 2 with an lgG1) was produced using the baculovirus/insect cell expression system.
- the cDNAs encoding the VH and VL variable regions of the anti-HLADR antibody were cloned into 2 specific transfer vectors (pVT light chain and pVT heavy chain) already containing the complementary DNAs encoding the kappa or mu constant regions as described in Juliant et al. 2013 [24].
- a third transfer vector was generated by cloning the cDNA encoding the J chain with the following sequence: MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDI VERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQ SNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETALTPDACYPD (SEQ ID NO: 10).
- Triple recombinant viruses were generated after co-transfection of Sf9 cells (ATCC CRL1711) with the three loaded transfer vectors and viral DNA according to the technology described in International Application WO2019/081858 [25].
- the recombinant viruses were cloned by plaque lysis. The genome of the recombinant viruses was checked by southern blot, and the sequences integrated into the viral DNA were verified by sequencing after PCR amplification. After 3 days of incubation at 28°C, recombinant antibodies secreted during infection of Sf9 cells cultured in serum-free medium were purified from the culture supernatant on a protein A column. The purity of the antibodies was verified by polyacrylamide gel electrophoresis and silver staining.
- lymphoma cells were performed in vitro using primary tumor B lymphocytes and a tumor cell line.
- the primary cells were obtained from patients with B-cell non-Hodgkin lymphoma (B-NHL): two marginal zone lymphomas (MZL) and one mantle cell lymphoma (MCL) (with their informed consent).
- B-NHL B-cell non-Hodgkin lymphoma
- MZL marginal zone lymphomas
- MCL mantle cell lymphoma
- the Raji cell line was used as a model for studying Burkitt lymphoma in the absence or presence of T lymphocytes from a healthy donor.
- the determination of the epitope recognized by the anti-HLADR antibody was carried out by the company Mabsilico (https://www.mabsilico.com) using a bioinformatics approach.
- the work carried out to identify the epitope was performed using a heterodimer composed of the ⁇ chain and the ⁇ chain HLA-DRB1 (HLADRB UNIPROT P01911,DRB1_HUMAN), which is the most represented (over 80%), as a model. From 3D models of the target and the antibody, docking positions identified by bioinformatics are classified according to their raw probability of belonging to the epitope, from dark gray for the highest probability to light gray for the lowest (but still significant) probability.
- CLL cells were suspended at 2 million per milliliter in RPMI culture medium without fetal bovine serum (FBS) on 16 mm diameter glass coverslips placed in 12-well culture plates containing anti-HLA-DR IgG and IgM monoclonal antibodies coupled to FITC at 2 pg/ml. After 4–6 hours of incubation, the well contents were rinsed with phosphate buffer (1x PBS), and the cells were fixed with 4% paraformaldehyde (PFA) for 15 minutes at room temperature. After two washes with 1x PBS, the preparations were covered with DAPI-containing mounting medium for nuclear staining. The slides were examined with the Axio Imager 2 (Zeiss). Images were acquired with a 63x objective and analyzed using ImageJ software.
- FBS fetal bovine serum
- CLL or NHL cells are suspended at 1 million per milliliter in RPMI culture medium, 10% FBS.
- Anti-HLA-DR antibodies IgG and IgM isotypes and anti-CD20 RTX and OBZ are incubated with the cells at a concentration of 2 pg/ml.
- B lymphocyte viability was compared following 3 regimens of mAb administration allowing for chronobiological analysis of the treatments:
- CLL PBMCs were pre-incubated for 16 hours, with or without CpG ODN (CpG oligodeoxynucleotides) (1.5 pg/ml) and CD40 ligand (CD40L) (1 pg/ml), to provide a microenvironment conducive to the survival of clonal B cells, mimicking the tumor microenvironment in vivo.
- CpG ODN CpG oligodeoxynucleotides
- CD40L CD40 ligand
- the cytotoxicity index combining 3 parameters representative of cytotoxicity, is calculated according to formula (II):
- Cytotoxicity Index (CI) (% MTT - % MTC) + (% BC - % BT) + (% NCC- % NCT) with % MTT and MTC, the % total mortality in the test and control tubes (without antibodies); % BC and BT, the % LB in the control and test tubes; % NCC and NCT, the % of cells of normal size/structure in the test and control tubes.
- CI Cytotoxicity Index
- CLL-PDX NGS mice were intravenously (IV) injected with fresh CLL PBMCs ( 3–107 cells/mouse).
- IV intravenously
- the mice were randomly divided into four groups (5 mice per group), and immunotherapy was administered with an IV dose of each monoclonal antibody (mAb).
- mAb monoclonal antibody
- Two experiments were conducted combining the anti-CD20 IgG1 and anti-HLA-DR IgM mAbs, first with rituximab (RTX) and then with obozoolitin (OBZ).
- RTX rituximab
- OBZ obozoolitin
- CLL-PDX NGS mice received IV 0.9% NaCl (group 1), 7.5 mg/kg of RTX or 7.5 mg/kg of OBZ (group 2), 7.5 mg/kg of anti-HLA-DR IgM (group 3), and IV RTX (7.5 mg/kg) or OBZ (7.5 mg/kg) followed by anti-HLA-DR IgM (7.5 mg/kg) ⁇ 2 hours after IgG 1 (group 4).
- CLL-PDX NGS mice were sacrificed on day 5 after the single-dose treatment at day 0.00.
- CLL tumor B cells The presence of CLL tumor B cells was assessed by RT-qPCR in the liver, spleen, lungs and bone marrow, using primers specific for human Alu sequences.
- the detection of primary human B-cell tumors in mouse spleen, bone marrow, lung, and liver was based on the quantitative detection of human Alu sequences in mouse organ DNA extracts using a protocol developed by Funakoshi et al., 2017 [35].
- DNA extraction 100 microliters of homogenized organ in PBS were used.
- the QIAGEN BioSprint 15 DNA Blood & Tissue kit (Ref: 940017) was used according to the manufacturer's instructions.
- primers specific for human Alu sequences were used to amplify human Alu sequences present in genomic DNA extracted from the samples.
- Mouse-specific ⁇ -actin primers were used as housekeeping genes (forward: 5'-AAGGCCAACCGTGAAAAGAT-3' (SEQ ID NO: 8); reverse: 5'-GTGGTACGACCAGGGATAC-3' (SEQ ID NO: 8). 9) [36].
- Real-time RT-qPCR to amplify and detect huAlu sequences was performed on 40 ng of genomic DNA with 0.1 pM of each primer and 5 ⁇ l of SYBR green Master Mix (Thermofisher) in a final volume of 10 ⁇ l.
- a QuantStudio 6 Flex Real Time System (Applied Biosystems) was used to monitor acquisitions under the following conditions: 50°C for 2 min and 95°C for 10 min followed by 50 cycles at 95°C for 30 sec, 60°C for 1 min, a melting curve step at 95°C for 15 sec, 60°C for 1 min and 95°C for 15 sec.
- a quantitative measure of amplifiable mouse DNA was obtained by amplifying the mouse p-actin genomic DNA sequence with m-actin primers (forward and reverse), using the same PCR conditions.
- the cycle threshold (Ct) of each sample was recorded as a quantitative measure of the amount of PCR product in the sample.
- Each assay included a negative control, a positive control, a control without a DNA template, and duplicate experimental samples. Data processing and statistical analysis were performed using GraphPad Prism.
- the evaluation of the anti-B lymphocyte cytotoxicity of mAbs in the Raji 3D lymphoma cell model was performed in spheroid culture, a model commonly used to represent in vivo tissue environments and for screening therapeutic molecules.
- Spheroids were created by culturing 1 x 104 Raji cells in RPMI culture medium in ULA non-adherent plates (Facellitate) at 37°C with 5 % CO2 for 72 hours.
- Antibodies, with or without T lymphocytes from a healthy donor (30,000 cells) were then were added at 2 pg/ml.
- the antibodies were added to RPMI medium containing CytotoxGreen at a final concentration of 5 pM for monitoring cell death in IncuCyteTM with the X4 objective.
- the HLA-DR molecule is composed of two subunits, alpha and beta. Based on the highest-ranked docking positions, target residues were noted according to their probability of belonging to the epitope. Residues expected to belong to the epitope are indicated on the sequence and on the target structure (Fig. 1).
- the target is renumbered as a single chain. Furthermore, not all amino acids in the target chains are visible in the 3D structure. The residues predicted to belong to the epitope and the validation peptides are indicated on the target sequence.
- the anti-HLA-DR monoclonal antibody preferentially recognizes an epitope of the HLA-DR alpha chain, but also certain amino acids of the beta chain.
- the anti-HLADR antibody under an IgM isotype exhibits very different properties compared to IgGI of the same specificity, in particular the oligomerization of the target not observed by the anti-HLA-DR IgG 1 agonist.
- the IgG1 anti-HLA-DR isotype induces only a random and disorganized distribution of the HLA-DR epitope within the membrane of CLL B cells.
- the IgM anti-HLA-DR isotype rapidly induces ( ⁇ 3 hours) the grouping of HLA-DR molecules into epitope-membrane clusters specifically in areas of intercellular contact.
- the anti-HLA-DR monoclonal antibody (mAb) was used in the hexameric IgM isotype, a substantial and significant reduction in the viability of tumor B cells was observed. Efficacy was assessed 6 hours (H6) after exposure to a single dose of mAb.
- the anti-HLA-DR IgM isotype mAb potentiates the antitumor activity on CLL B cells of the anti-CD20 lgG1 isotype mAb.
- Efficacy was assessed at 6 hours (H6) after exposure to a single dose of AcMs.
- the combination of anti-HLA-DR IgG and anti-CD20 IgG did not increase cellular cytotoxicity, with approximately 20% cell death (data not shown).
- the combination of anti-CD20 IgG1 and anti-HLA-DR IgM creates an amplifying antitumor activity against the B lymphocyte clone, an activity that is synergistic and not additive.
- the convergence of the respective bioactivities of these two monoclonal antibodies (mAbs) relies on the amplification of the NADPH oxidase pathway via the B lymphocyte membrane protein NOX2, whose synergistic activation by IgG1 and IgM generates reactive oxygen species (ROS). ROS lead to the induction of neoplastic clonal B lymphocyte death, a B cell death independent of caspase activation.
- ROS reactive oxygen species
- B lymphocyte mortality due to ATP-induced cell necrosis constitute the property of the IgG1 anti-CD20 and IgM anti-HLA synergy.
- DR generate B lymphocyte death by induced and regulated necrosis, preceded by edema of the mitochondria and the peri-nuclear membrane.
- IgM anti-HLA-DR monoclonal antibody potentiating the anti-tumor activity of an IgG1 or IgM anti-CD20 monoclonal antibody (derived from RTX). Impact of the tumor microenvironment and autologous serum.
- SA reproduces the tumor microenvironment (soluble immunosuppressive factors and survival factors) with greater fidelity, compared to SVF.
- the bio-activity of the mAbs is evaluated at 6 hours (H6) after exposure to a single dose of antibody.
- AcM RTX anti-CD20 average loss of -2.5% for IgG 1 and average loss of -6.2% for IgM anti-CD20.
- IgM anti-HLA-DR a decrease of approximately -2.7%.
- RTX IgG + anti-HLA-DR IgM a decrease of approximately -9.5%.
- RTX anti-CD20 mAb In FBS, compared to H6 controls, 2 pg/ml of RTX anti-CD20 mAb induces a low cytotoxicity index against CLL tumor B cells, representing an increase of approximately 5.4% for RTX lgG1 and 13.8% for RTX IgM.
- the addition of anti-HLA-DR IgM to anti-CD20 mAbs significantly increases B cell death compared to IgGI and anti-CD20 IgM. alone: average gain of +32.8% for RTX IgG + IgM anti-HLA-DR; average gain of +17.6% for RTX IgM + IgM anti-HLA-DR.
- the anti-B lymphocyte cytotoxicity index with the anti-CD20 RTX is approximately 3.1% for IgGI and 7.6% for the anti-CD20 IgM isotype.
- the combination of anti-CD20 monoclonal antibodies (mAbs) with anti-HLA-DR IgM potentiates their effect: an average gain of +25.6% for RTX IgG + IgM anti-HLA-DR; an average gain of +32.5% for RTX IgM + IgM anti-HLA-DR.
- the combination of RTX IgM with the anti-HLA-DR IgM mAb increases the efficacy of the synergy: an average gain of 8.6%.
- B cells are pretreated for 16 hours with the combination of CpG ODN (CpG oligodeoxynucleotides) and CD40 ligand (CD40L) to provide an environment conducive to cell survival by inducing resistance in clonal B cells.
- CpG ODN CpG oligodeoxynucleotides
- CD40L CD40 ligand
- CpG/CD40L with anti-CD20 1.93%; with IgM: 6.3%); with CpG/CD40L and anti-CD20 used alone: an average decrease of -0.6%, in CpG/CD40L condition with treatment by an anti-HLA-DR IgM in combination with an anti-CD20: an increase of approximately 15.9% is observed.
- the bioactivity of the IgM monoclonal antibody remains unchanged and induces the same B-cell mortality threshold, even under tumor-resistant conditions, unlike type I and II anti-CD20 antibodies. This highlights the fact that IgM is relatively insensitive to the tumor microenvironment, which, conversely, induces resistance to IgG treatment.
- B lymphocyte viability was compared according to the following three regimens of monoclonal antibody (mAb) administration: - Synchronous IgG1 and IgM treatment
- the anti-HLA-DR IgM isotype combined with OBZ induced in vivo non-measurable residual disease of CLL. This result demonstrates the efficacy of reducing MRD in a B-cell lymphoid malignancy by combining type I or type II anti-CD20 IgGI with a low dose of the anti-HLA-DR IgM monoclonal antibody.
- the lgG1 RTX isotype combined with the anti-HLA-DR IgM isotype reduces MRD levels in the spleen by 17-fold in vivo.
- the lgG1 OBZ isotype combined with the IgM isotype anti-HLA-DR reduces, in vivo, the level of MRD in the spleen by 2 times (Fig. 7A bc and 7B bc).
- the purpose of this test is to verify whether the association of a therapeutic monoclonal antibody of the anti-CD20 IgG isotype (type I and II) with a therapeutic monoclonal antibody of the anti-HLA-DR IgM isotype (in isodose) is the rule: that of the ability of an IgM to amplify the bio-activity of an IgG.
- PBMCs from patients with CLL were treated with anti-CD20 and anti-HLA-DR of IgG or IgM isotype for 6h (H6) and analyzed by flow cytometry (detection of annexin V+ labeling, indicating progressive cell death).
- a- The ability to deplete the tumor B lymphocyte (B) population at T6 (evaluation of tumor lysis). This is identified in Fig. 8A by the symbol: %B.
- b- The ability to induce B lymphocyte cell death in cells retaining a normal size/structure (referred to as "remaining B cells") also at H6. Cell death is detected by annexin V+ membrane staining. It is identified in Fig. 8B by the symbol: % cell death.
- T lymphocyte (TL) toxicity that could have been induced by the antibodies alone or in combination was also analyzed. This toxicity was examined by The calculation of the proportion of T cells before and after antibody treatment. No T lymphocyte toxicity has ever been observed, either with IgG and IgM alone or in combination (data not shown).
- Figure 8A shows that B cell depletion (% B cell) is maximal for the "anti-CD20 IgG + anti-HLA-DR IgM” combinations compared to the same combinations with inverted isotypes.
- the "double IgM” combinations are also effective, with the "RX IgM + HLA-DR IgM” combination resulting in a B cell reduction of 19.7% and the "OBZ IgM + HLA-DR IgM” combination resulting in a B cell reduction of 29.4%.
- Figure 8B shows that cell death in the remaining B cells is highest with OBZ IgG + HLA-DR IgM, as supported by the invention.
- the anti-CD20 IgG + anti-HLA-DR IgM combinations exhibit higher cytotoxicity (53.61% and 75.56%) than the same combinations with the reversed combined isotypes.
- the latter (anti-CD20 IgM + anti-HLA-DR IgG) nevertheless induce significant mortality of 37.09% and 49.96% in the remaining B cells.
- the dual IgM combinations are also effective with RX IgM + HLA-DR IgM: +34.3% and OBZ IgM + HLA-DR IgM: +44.6%.
- Figure 8C illustrates the importance of epitopes for antibody bioactivity using a control isotype (non-relevant isotype, either IgG or IgM) without specific target recognition.
- Control IgG and IgM (iso-IgG and iso-IgM) showed no effect on CLL B cells.
- the combination of RX IgG and iso-IgM also showed no synergistic effect.
- OBZ IgG and iso-IgM the same B cell depletion and cell death values were observed as with the use of OBZ IgG alone. Therefore, there was no effect of a non-relevant isotype on the activity of type I or II anti-CD20 IgG (negative control).
- a pentameric IgM was produced ( Figure 9).
- a comparative analysis of the bioactivity of pentameric and hexameric anti-HLA-DR IgM was performed on primary B-cell tumor cells from patients with B-cell chronic lymphocytic leukemia (CLL). After 48 hours of real-time mortality monitoring using the "Incucyte" technique, the data were normalized to the control and presented as a percentage of cell viability (histogram, Fig. 10A). Cumulative data for 7 CLL patients showed no significant difference between the two IgMs. In 3 CLL patients, the pentameric IgM demonstrated superiority (Fig. 10B). The respective efficacy of pentameric and hexameric IgMs appears to be patient-dependent.
- the effect of induced resistance on IgM bioactivity was tested in 4 to 9 experiments depending on the conditions at H6.
- the culture medium was supplemented with CpG-ODN (CpG oligodeoxynucleotide) in the absence or presence of CD40 ligand (CD40L).
- CpG-ODN CpG oligodeoxynucleotide
- CD40L CD40 ligand
- cytotoxicity of anti-HLA-DR IgM antibodies was evaluated on HUVEC endothelial cells and on the EA.hy926 cell line after 24-hour stimulation with interferon-gamma to induce HLA-DR protein expression (a pro-inflammatory condition). Endothelial mortality is predictive of the occurrence of vasculitis in vivo. Cytotoxicity on HUVEC cells was evaluated both directly and in the presence of PBMCs from CLL patients and their respective serum to mimic physiological conditions, as well as potential indirect cytotoxicity. The results showed no toxicity of anti-HLA-DR IgM towards endothelial cells [Fig.
- the toxicity of the interferon-gamma-induced HLA-DR protein cell line EA.hy926 was evaluated in human serum after 24 hours of treatment with anti-HLA-DR IgM antibodies.
- the anti-HLA-DR IgG antibody L243 was used as a commercial control, and I H2O2 as a positive control for cell death. The results showed no toxicity from our pentameric and hexameric anti-HLA-DR IgM antibodies, with functional mitochondrial metabolism identical to the control condition [Fig. 13b].
- B-NHL B-cell non-Hodgkin lymphomas
- MZL marginal zone lymphoma
- MCL mantle cell lymphoma
- B-cell non-Hodgkin lymphomas B-HLH (LZM and LM)
- B-HLH B-cell non-Hodgkin lymphomas
- These two lymphomas exhibit similar sensitivity to IgG/IgM treatments.
- the evaluation of IgG/IgM combinations in the Raji spheroid model after 4 days of treatment was performed in the absence or presence of T lymphocytes from a healthy donor to assess the effect mediated by cell-mediated ...
- Chronic lymphocytic leukaemia ESMO Clinical Practice Guidelines for diagnosis, treatment and follow-up. Eichhorst B, Robak T, Montserrat E, Ghia P, Niemann CU, Kater AP, Gregor M, Cymbalista F, Buske C, Hillmen P, Hallek M, Mey U; ESMO Guidelines Committee. Ann Oncol. 2021 Jan;32(1):23-33. 2020 Oct 19. 17.
- Blinatumomab a CD19/CD3 bispecific T cell engage (BiTE) with unique antitumor efficacy. Goebeler ME, Bargou R. Leuk Lymphoma. 2016 May;57(5):1021-32. 2016 Apr 6.
- Epcoritamab a Novel, Subcutaneous CD3xCD20 Bispecific T-Cell-Engaging Antibody, in Relapsed or Refractory Large B-Cell Lymphoma: Dose Expansion in a Phase l/ll Trial. Catherine Thieblemont et al. J Clin Oncol 2023 Apr 20; 41 (12): 2238-2247.
- the humanized anti-HLA-DR moAb, IMMU-114 depletes APCs and reduces alloreactive T cells: implications for preventing GVHD. Chen X, Chang CH, Stein R, Goldenberg DM. Bone Marrow Transplant. 2012 Jul;47(7):967-80. 2011 Oct 24.
- Anti-class ll-DR humanized monoclonal antibody, IMMU-114 blocks allogeneic immune response. Park KH, Sawada T, Murakami T, Ishii Y, Yasuo M, Fuchinoue S, Goldenberg DM, Kubota K.Am J Surg. 2012 Oct;204(4):527-34. 2012 Jun 1
- Anti-human leukocyte antigen-DR humanized monoclonal antibody, IMMU-114, suppresses human to bovine cellular responses. Park KH, Sawada T, Murakami T, Ishii Y, Yasuo M, Urakawa M, Aoyagi Y, Fuchinoue S, Kubota K.J Surg Res. 2012 Nov;178(1):472-7. 2012 Apr 2.
- a bispecific antibody-IFNalpha2b immunocytokine targeting CD20 and HLA-DR is highly toxic to human lymphoma and multiple myeloma cells.
- IMMU-140 a Novel SN-38 Antibody-Drug Conjugate Targeting HLA-DR, Mediates Dual Cytotoxic Effects in Hematologic Cancers and Malignant Melanoma. Cardillo TM, Govindan SV, Zalath MB, Rossi DL, Wang Y, Chang CH, Goldenberg DM. Mol Cancer Ther. 2018 Jan;17(1):150-160. Nov 13. 35. Funakoshi, K. et al. Highly sensitive and specific Alu-based quantification of human cells among rodent cells. Sci. Rep. 7, 13202 (2017).
Landscapes
- Health & Medical Sciences (AREA)
- Immunology (AREA)
- Chemical & Material Sciences (AREA)
- Organic Chemistry (AREA)
- General Health & Medical Sciences (AREA)
- Biophysics (AREA)
- Biochemistry (AREA)
- Genetics & Genomics (AREA)
- Medicinal Chemistry (AREA)
- Molecular Biology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Life Sciences & Earth Sciences (AREA)
- Medicines Containing Antibodies Or Antigens For Use As Internal Diagnostic Agents (AREA)
- Peptides Or Proteins (AREA)
Abstract
La présente invention concerne un nouvel anticorps monoclonal d'isotype IgM anti-HLA-DR et son utilisation seul ou en complément d'anticorps d'isotype IgG1 ou d'IgM anti-CD20, dans le traitement des hémopathies lymphoïdes de phénotype B, et en particulier du lymphome non-hodgkinien B, de la leucémie lymphoïde chronique (LLC) et des hémopathies lymphoïdes malignes à cellules B en général.
Description
Domaine technique de l’invention
La présente invention concerne un nouvel anticorps monoclonal d’isotype IgM anti-HLA-DR et son utilisation seul ou en complément d’anticorps d’isotype IgG 1 ou d’IgM anti-CD20, dans le traitement des hémopathies lymphoïdes malignes de phénotype B, telle la leucémie lymphoïde chronique (LLC) et les lymphomes non hodgkiniens B.
La présente invention trouve une application en santé humaine, par exemple en immuno-hématologie, hémato-oncologie et oncologie, et hémopathies lymphoïdes malignes à cellules B.
Dans la description ci-dessous, les références entre crochets ([ ]) renvoient à la liste de références à la fin du texte.
Etat de la technique
Au cours des dernières décennies, l’immunothérapie est devenue l’une des avancées les plus remarquables dans le domaine du traitement du cancer en particulier des hémopathies malignes lymphoïdes, essentiellement de phénotype B. Contrairement aux approches traditionnelles telles que la chimiothérapie et la radiothérapie, qui visent principalement à éliminer directement les cellules tumorales, l’immunothérapie exploite le pouvoir du système immunitaire pour combattre la maladie.
Les succès remarquables de l’immunothérapie dans le traitement de certains types de cancer ont suscité un vif intérêt et ont ouvert de nouvelles perspectives dans le domaine de la recherche et du développement de médicaments.
Pour l’immunothérapie anti-tumorale, les anticorps monoclonaux (AcM) humanisés ou humains lgG1 divalents représentent la majorité (80 %) des
anticorps approuvés pour différentes indications oncologiques et hématologiques.
Un exemple d’immunothérapie actuelle est celle qui vise la protéine CD20, ou cluster de différenciation 20, qui est une glycoprotéine transmembranaire exprimée principalement à la surface des lymphocytes B matures. Son rôle principal est d’agir comme un régulateur crucial de la prolifération et de la différenciation des lymphocytes B, ainsi que dans leur activation et leur fonction immunitaire. La protéine CD20 agit comme un canal calcique, elle présente en effet des similitudes structurelles avec certains canaux ioniques (CD20 : protéine tétraspan spécifique des cellules B). La protéine membranaire CD20 régule un canal d'entrée du calcium qui agit en synergie avec le récepteur B à l’antigène (« B-cell receptor » ou BCR).
Elle est devenue une cible thérapeutique importante dans le traitement de diverses maladies, en particulier des troubles lymphoprolifératifs de phénotype B tels que les lymphomes non hodgkiniens B et la leucémie lymphoïde chronique. Ainsi, le traitement des hémopathies malignes lymphoïdes B implique l'utilisation d'anticorps monoclonaux anti-CD20 qui permettent une élimination des lymphocytes B pathologiques et clonaux, tout en préservant les fonctions des autres cellules immunitaires, en particulier les lymphocytes T et lymphocytes NK. Par exemple, le rituximab (RTX) (AcM anti-CD20 de type I) a démontré une activité clinique significative contre la majorité des néoplasies à cellules B tels que le lymphome diffus à grandes cellules (DLBCL), le lymphome folliculaire (FL), le lymphome à cellules du manteau (MCL). Le RTX peut être utilisé seul dans les lymphomes non hodgkiniens indolents à cellules B tels que le FL en immunothérapie ou associé à la chimiothérapie dans les lymphomes non hodgkiniens agressifs à cellules B sous la forme d'une immunochimiothérapie.
Dans la leucémie lymphoïde chronique (maladie clonale des lymphocytes B CD20+ CD19+ CD5+ CD23+), l'AcM anti-CD20 de référence est l'Obinutuzumab (OBZ) (AcM anti-CD20 de type II), utilisé, selon les recommandations cliniques actuelles (recommandations du FILO-LYSA 2025), en association avec un inhibiteur de l’oncogène du lymphome 2 à cellules B, Bcl-2 (le Vénétoclax).
Aujourd'hui, les approches "sans chimio" (« chemo-free ») tendent à devenir la règle en pratique clinique et dans les protocoles de recherche clinique, mais aussi la préférence des malades, par rapport à l’immunochimiothérapie. Lorsqu’un AcM anti-CD20 est utilisé en monothérapie, par exemple le RTX, une maladie résiduelle mesurable persiste après le traitement (incidence de 67%) [1-3]. La poursuite de l'approche thérapeutique « sans chimio » nécessite le renforcement de la bioactivité des AcM anti-CD20 ou de tout autres AcM anti-lymphocytaire B, (anti-CD19, anti-CD38 (le daratumumab et isatuximab), anti-CD47...), sans entrainer de toxicité. Au-delà de leur utilisation en tant qu'agent thérapeutique unique ou en tant qu’anticorps de référence dans les recommandations cliniques, l'étape actuelle consiste à envisager leur association avec une thérapie ciblant une protéine tumorale lymphocytaire B tel le Vénétoclax (thérapie ciblée) ou encore potentiellement dans le futur, avec un modulateur de chromatine ou un autre agent (alisertib, inhibiteur de TGF-P, FOXO1 ou farnésyltransférase) [4-10]. Malgré des avantages très prometteurs, l’immunothérapie présente des défis, notamment la variation de la réponse des patients, l’identification de biomarqueur(s) prédictif(s) de la réponse clinique à un agent immunothérapeutique et/ou à une thérapie ciblée et l’émergence possible de résistance biologique (par exemple, régulation négative de l’épitope). L’atteinte d’un statut de maladie résiduelle non-mesurable (« measurable residual disease » ou « minimal residual disease » ou MRD) constitue un enjeu majeur pour sécuriser l’évolution clinique favorable du malade, évolution favorable sur la survie sans maladie ou « progression-free survival ou PFS, et la survie globale ou « overall survival » ou OS. Le statut de la MRD prédit bien la PFS et la qualité de la rémission de la maladie maligne hématologique. En cas d’obtention d’une rémission complète hématologique, mais associée à une positivité de la MRD > 10'4 (soit MRD intermédiaire : 10'4-10'2 ; ou MRD élevée : > 10’2), un renforcement du traitement est actuellement considéré comme bénéfique. De même, la surveillance évolutive de la MRD est conseillée quand une MRD basse ou indétectable < 10'4 est obtenue, ce qui doit faire considérer le traitement si la MRD redevient détectable, en amont de la rechute clinique.
Les mécanismes de résistance aux AcM d’isotype lgG1 peuvent exister naturellement (résistance primaire) ou apparaître après traitement (résistance acquise dans les cellules tumorales résiduelles). Le niveau d'expression de marqueurs de surface tels que la densité du CD20, l’expression élevée des protéines CD55 et CD59 induit une résistance au RTX. La résistance au RTX implique également l'hyper-expression des molécules Bcl-2 ou Bcl-xL, en tant que facteurs anti-apoptotiques.
Dans la LLC, l’OBZ est le traitement anticorps de référence utilisé, conformément aux recommandations cliniques du FILO-LYSA 2025, dans le cadre du traitement de 1 ere ligne (en 1 ere rechute, le RTX est préconisé), OBZ (ou RTX en 1 er rechute) prescrit en association avec le Vénétoclax qui est une thérapie ciblée anti-Bcl2 : traitement limité dans le temps à 1-2 ans, maladie résiduelle non-mesurable (MRD) atteignable (MDR négative : 62% pour la combinaison RTX + Vénétoclax dans l’essai clinique MURANO; 76% pour la combinaison OBZ + Vénétoclax dans l’étude CLL14. Cette combinaison d’immunothérapie et de thérapie ciblée est très onéreuse. L’utilisation d’un iBTK (traitement continu à vie, persistance d’une maladie résiduelle détectable dans 90% des cas pour l’ibrutinib en monothérapie), est également une thérapie très onéreuse car l’utilisation d’un iBTK constitue un traitement considéré actuellement de durée continue [1 -3]. Un iBTK peut également être combiné avec le Vénétoclax, mais le risque de complications cardiologiques est réel : hypertension artérielle, fibrillation atriale. En effet, cette combinaison est associée à une compétition sur le cytochrome P450, le CYP3A4, ceci pour le catabolisme hépatique des deux molécules et susceptible d’augmenter ou de modifier le niveau de leurs concentrations plasmatiques. La combinaison iBTK + Vénétoclax augmente considérablement le cout de cette thérapie ciblée combinée. Le traitement par un iBTK en monothérapie est efficace mais conduit à une maladie résiduelle mesurable le plus souvent détectable, nécessitant un traitement à long terme et induisant un coût médico-économique significatif. La combinaison d’un iBTK (Ibrutinib) et du RTX conduit à une MRD négative à 12 mois dans 8,3 % des cas. La combinaison d’un iBTK (Ibrutinib) et de l’OBZ conduit à une MRD négative dans 30% des cas (étude ILLUMINATE). La combinaison d’un iBTK (Ibrutinib) et du Vénétoclax
conduit à une MRD négative dans 75 % des cas à 12 cycles de traitement (étude CAPTIVATE).
L’enjeu actuel de la recherche en immunothérapie est de définir la meilleure combinaison d’immunothérapie et/ou de thérapie(s) ciblée(s), sans adjonction de chimiothérapie et sans apport de toxicité additionnelle. De plus, dans le cadre de l’utilisation des AcMs thérapeutiques, la question est posée du meilleur isotype (IgG, IgA, IgM) de l’anticorps monoclonal à utiliser au lit du malade. A ce jour, les lgG1 , à structure divalente, représentent la majorité (80%) des anticorps approuvés et autorisés pour les différentes indications hématologiques et oncologiques.
Les AcM d’isotype IgM ont fait leur entrée sur la scène thérapeutique. En raison de leur format naturel qui peut être soit pentamérique soit hexamérique, leur bioactivité et leur puissance anti-tumorale peuvent être considérées comme potentiellement supérieures à celles des IgG, en raison d'une cytotoxicité dépendante du complément (CDC) supérieure et de leur multivalence, puisqu’elles présentent l'avantage d'avoir de nombreux sites de liaison pour leur cible (10 ou 12 sites, respectivement). Cette multivalence des IgM est capable d'induire une forte multimérisation des cibles épitopiques à la surface cellulaire, des capacités d'agglutination cellulaire et moléculaire, et d'induire ainsi des voies de transduction du signal intra-cellulaire (telle la voie ERK1/2) et/ou des réponses cytokiniques (interféron-gamma, TNF-alpha, IL-12...) conduisant à une réduction importante de la viabilité cellulaire des cellules tumorales et à la mort de celles- ci.
L’isotype IgM a ainsi été introduit dans la génération d’anticorps monospécifiques et bispécifiques contre les tumeurs malignes solides et hématologiques (IgM- 8444, agoniste de réticulation du récepteur DR5) et contre les lymphomes non hodgkiniens réfractaires et résistants et la LLC (anti-CD20 x CD3 IgM} (IgM BioSciences}. Le PAT-SM6 a également été évalué dans le cadre d'un essai de phase 1 dans le myélome multiple récidivant ou réfractaire [11-15].
Il existe des pathologies lymphocytaires B résistantes aux anticorps monoclonaux anti-CD20 (RTX ou OBZ) ou présentant un besoin médical non satisfait, telles que :
• la LLC à délétion du gène P53 et doublement réfractaire (LLC 2R) (risque génétique élevé et risque élevé de transformation de Richter) ou malades ne tolérant pas les traitements de référence et/ou ayant présenté des effets indésirables majeurs, et patients âgés ne pouvant pas les tolérer et /ou à risques de complications avec ces traitements (cardiaques, infectieuses...), encore dénommés malades « unfit ».
• Les lymphomes non hodgkiniens à double ou triple hit (DHL/THL) et à double expression (DEL), ces deux pathologies entraînant une amplification de l’expression de l’oncogène c-Myc (un facteur de prolifération avec Ki-67 > 70 %), ainsi que les patients âgés atteints d’un lymphome diffus à grandes cellules B récidivant, réfractaire ou résistant.
Cas particuliers des patients réfractaires :
Dans la LLC, l’allogreffe de moelle osseuse peut être considérée :
- chez des malades réfractaires aux thérapies immunologiques et/ou aux thérapies ciblées et /ou à l’immunochimiothérapie et/ou aux malades présentant une mutation TP53 ou del(17p). ou
- chez des malades porteurs de LLC évoluant en un syndrome de Richter après une réponse isotopique après traitement immunochimiothérapeutique du syndrome de Richter.
Dans ces deux cas, les anticorps bispécifiques (BsAbs) et les CART-cells (cellules T à récepteur antigènique chimérique) peuvent constituer une alternative à l’allogreffe de moelle osseuse. Le caractère curateur de ces approches est incertain à moyen et à long-terme. Ces approches immunologiques peuvent être considérées chez des malades présentant des comorbidités interdisant l’allogreffe de moelle osseuse. Néanmoins, Ils ne sont pas dénués de toxicité : syndrome de relargage cytokinique (SRC), encéphalopathie reliée à l’utilisation des CAR-T cells [16].
Les BsAbs sont des anticorps possédant deux sites de liaison dirigés contre deux antigènes différents ou deux épitopes différents d’un même antigène. Avec le traitement par l’epcoritamab (IgG 1 bispécifique anti-CD3xanti-CD20), le SRC est observé chez 90% des malades (40% de grade 1 et 50% de grade 2). Un premier
BsAb à base de scFv anti-CD3/anti-CD19 (BiTE, blinatumomab) a eu son autorisation de mise sur le marché (AMM) mais cette molécule possède une demi-vie très courte (doit être utilisée en perfusion continue) et peut présenter des effets secondaires notables. Des événements neurologiques, y compris des tremblements, des convulsions et des modifications de l'état mental, peuvent être observés chez 52% des patients, principalement de grade 1 ou 2, avec 11 % de grade 3 et 4 (2 %) de grade 4 [17-19]. Les doses inférieures à 60 pg/m2/jour ont entraîné des taux de réponse médiocres et une dose de 90 pg/m2/jour a été limitée par la neurotoxicité [17-19]. Dans la LLC, l’efficacité du blinatumomab a été analysée dans une phase II en combinaison avec le nivolumab (Ac anti-PD- 1 ) et l’ibrutinib (iBTK) et a montré des résultats décevants (taux de réponse de 22% à deux mois du traitement).
Dans la LLC et le syndrome de Richter, un autre AcM BsAb est en phase Ib/ll dans l’essai EPCORE-CLL : il s’agit de l’ebcoritamab (Tepkinly*), un Ac bivalent CD20/CD3 BiTe [20]. Son indication clinique future s’oriente vers une synergie ebcoritamab-vénétoclax. L’AcM BsAb, le glofitamab, un Ac bivalent CD20/CD3 BiTe (Columvi*), pourrait également trouver une place future dans le traitement de la LLC réfractaire [21-22],
Les cellules CAR-T représentent un autre domaine d'investigation prometteur dans les thérapies cellulaires adoptives, combinant les forces des cellules T et des anticorps pour stimuler l'activité anti-tumorale des cellules T. Les cellules CAR-T CD19 ont été largement utilisées dans les hémopathies lymphoïdes malignes B et il y a peu de recul de son utilisation dans la LLC. Dans la LLC, leur efficacité est incertaine et controversée en raison du phénotype épuisé ou “exhausted” des lymphocytes T et de la perte possible du CD19 via un phénomène de « shaving », créant une résistance à la thérapie CAR-T cells.
Nous avons évalué une combinaison immunologique d’un anticorps lgG1 anti- CD5 en combinaison avec une lgG1 anti-HLA-DR. La protéine HLA-DR est un récepteur de surface cellulaire du CMH de classe II codé par le complexe d’antigènes leucocytaires humains sur la région 6p21 .31 du chromosome 6. Sa fonction principale est de présenter des antigènes peptidiques, potentiellement d'origine étrangère, au système immunitaire dans le but d’induire des réponses
des lymphocytes T CD4+ (lymphocytes T auxiliaires ou helper) qui conduisent potentiellement à la production d'anticorps contre le même antigène peptidique. L’anticorps IgG 1 anti-HLA-DR a été testé vis-à-vis de tumeurs malignes à cellules B (Demande internationale WO2010145895) [23]. Des expérimentations ont été réalisées in vivo, avec l’injection de cellules JOK-1 (lignée cellulaire), exprimant la protéine CD5 humaine (cellules transfectées de façon stable). Les résultats obtenus ont été très prometteurs dans la mesure où les souris traitées avec la combinaison d’anticorps monoclonaux anti-CD5 + anti-HLA-DR n’ont pas développé de maladie, contrairement aux souris traitées avec d’autres combinaisons : anti-HLA-DR x anti-CD71 ou anti-CD20, mAb RTX seul.
Description de l’invention
Les anticorps anti-CD20 sont très efficaces mais une maladie résiduelle minimale (MRD) est encore détectable et mesurable. Les Inventeurs ont donc cherché à améliorer les immunothérapies basées sur la molécule CD20 en évitant la formation des mécanismes de résistance de la maladie contre ce type d’agent (e.g. résistance à l’utilisation d’anticorps d’isotype lgG1 anti-CD20 tels que le RTX et l’OBZ) tout en réduisant les risques de récidive de la maladie, dont le risque peut être évalué selon une mesure de la maladie résiduelle minimale en RT-qPCR (ASO-PCR, ou immunophénotypage du clone tumoral en cytométrie en flux, ou plus récemment, séquençage de nouvelle génération, c’est-à-dire en étude NGS) des cellules du sang et/ou issues de la moelle osseuse.
Pour ce faire, les Inventeurs ont cherché un partenaire immunothérapeutique afin de renforcer la bio-activité anti-CD20 et induire une maladie résiduelle non- mesurable et mettre en place un traitement non-toxique et de durée limitée. L’objectif principal est d’augmenter l’efficacité d’AcMs IgG 1 anti-CD20, de type I (e.g. RTX) pour les tumeurs malignes lymphoïdes à cellules B non-LLC et de type Il (e.g. OBZ, anticorps de référence) pour la LLC à cellules B et/ou d’AcMs IgM anti-CD20 ; et de lever la résistance aux anticorps anti-CD20.
Les applications médicales sont :
- Hémopathies lymphoïdes à cellules B en général, mais en particulier pathologies résistantes aux anticorps monoclonaux anti-CD20 (RTX ou OBZ) ou présentant un besoin médical non satisfait, telles que :
• LLC avec délétion du gène P53 et double-réfractaire (LLC 2R) (risque génétique élevé et risque élevé de transformation de Richter) ou les malades ne tolérant pas les traitements de référence et/ou ayant présenté des effets indésirables majeurs, et les patients âgés ne pouvant pas les tolérer et /ou à risques de complications avec ces traitements (cardiaques, infectieuses...), encore dénommés malades « unfit ».
• Lymphomes non hodgkiniens à double ou triple hit (DHL/THL) et à double expression (DEL), ces deux pathologies entraînant une amplification de l’expression de l’oncogène c-Myc (un facteur de prolifération avec Ki-67 > 70 %), ainsi que les patients âgés atteints d’un lymphome diffus à grandes cellules B récidivant, réfractaire ou résistant. Les Inventeurs ont mis en évidence de manière tout à fait inattendue que l’utilisation d’un anticorps monoclonal dïsotype IgM anti-HLA-DR (chaine lourde VHantiHLADR-Cmu, SEQ ID NO : 1 ; chaine légère VLantiHLADR-Ck, SEQ ID NO : 2 ; VHanti-HLADR, SEQ ID NO : 3 ; VLanti-HLADR, SEQ ID NO : 4) en combinaison avec un anticorps monoclonal dïsotype lgG1 anti-CD20 de type I (le rituximab, RTX) ou II, (l’Obinutuzumab, OBZ), ou avec un anticorps monoclonal dïsotype IgM anti-CD20, permet d’améliorer l’efficacité d’AcM anti-CD20. L’IgM anti-HLA-DR, même à faible dose ou isodose par rapport à une IgG anti-HLA-DR, associé aux anti-CD20, est capable de compléter la réponse anti-tumorale anti-cellule B des anti-CD20 et obtenir une maladie résiduelle non-mesurable in vivo. L’IgM anti-HLA-DR n’a présenté aucune toxicité in vitro, sur les cellules HUVEC HLA-DR+, contrairement à d’autres anticorps dïsotype lgG1 anti-HLA-DR tels que l’anticorps IMMU-114 (L243). Aucune toxicité n’a été observée durant les expérimentations réalisées in vivo dans le modèle murin CLL-PDX NGS ou l’embryon de poulet.
Les Inventeurs proposent donc un nouveau traitement de la LLC et des hémopathies lymphoïdes malignes B (lymphomes non hodgkiniens B) et en particulier dans des situations cliniques d’hémopathies malignes lymphoïdes B
présentant un besoin médical non satisfait (cf. ci-dessus), sur la base d’une combinaison de deux anticorps, anti-CD20 (e.g. OBZ ou RTX) et IgM anti-HLA- DR, qui conduit à une maladie résiduelle qui n’est plus mesurable contrairement au traitement de référence avec l’ IgG 1 anti-CD20 (OBZ ou RTX) et une meilleure gestion des hémopathies lymphoïdes B et des patients, en particulier lorsque la maladie progresse et que le patient devient résistant à l’ IgG 1 OBZ/RTX.
La présente invention a donc pour objet un anticorps monoclonal dïsotype IgM anti-HLA-DR, sous forme pentamérique ou hexamérique. Par exemple, l’AcM dïsotype IgM anti-HLA-DR reconnaît le même épitope ou fragment d’épitope que l’anticorps monoclonal murin dïsotype lgG1 IMMU357 (Beckman Coulter), mais avec une meilleure affinité pour la molécule HLA-DR. Lïsotype IgG 1 IMMU357 est un AcM utilisé en diagnostic.
Selon un mode particulier de la présente invention, l’anticorps monoclonal dïsotype IgM anti-HLA-DR est sous forme pentamérique ou hexamérique, de préférence pentamérique, et présente une plus grande efficacité que lïsotype lgG1 anti-HLA-DR.
Selon un mode particulier de la présente invention, l’anticorps monoclonal dïsotype IgM anti-HLA-DR selon la présente invention a pour fonction de potentialiser l’activité d’anticorps monoclonaux dïsotype lgG1 anti-CD20 et/ou dïsotype IgM anti-CD20.
La présente invention a encore pour objet une composition pharmaceutique comprenant l’anticorps monoclonal dïsotype IgM anti-HLA-DR selon la présente invention, au moins un anticorps monoclonal dïsotype lgG1 anti-CD20 et/ou au moins un anticorps monoclonal dïsotype IgM anti-CD20, et un excipient pharmaceutiquement acceptable.
Selon un mode particulier de la présente invention, ledit au moins un anticorps monoclonal dïsotype lgG1 anti-CD20 est un anti-CD20 de type I.
Selon un mode particulier de la présente invention, ledit au moins un anticorps monoclonal dïsotype lgG1 anti-CD20 est un anti-CD20 de type II.
La présente invention a encore pour objet un anticorps monoclonal dïsotype IgM anti-HLA-DR selon la présente invention ou une composition pharmaceutique selon la présente invention, pour une utilisation comme médicament.
La présente invention a encore pour objet un anticorps monoclonal d’isotype IgM anti-HLA-DR selon la présente invention ou une composition pharmaceutique selon la présente invention, pour une utilisation dans le traitement d’un lymphome, par exemple d’une hémopathie maligne lymphoïde B, d’un lymphome non hodgkinien (de phénotype B) ou d’une leucémie lymphoïde chronique de la lignée B (LLC) et également dans des situations cliniques d’hémopathies malignes lymphoïdes B présentant un besoin médical non satisfait (cf. ci-dessus).
BREVE DESCRIPTION DES FIGURES
[Figure 1] représente la carte épitopique de l’anticorps monoclonal dïsotype IgM anti-HLA-DR. Les résidus prédits comme appartenant à l'épitope sont indiqués sur la séquence et sur la structure de la cible, les sous unités alpha (HLA-DRA) et bêta (HLA-DRB) de la molécule HLA-DR (SEQ ID NO : 5). Ils sont répartis en quatre catégories en fonction de leur probabilité brute d'appartenir à l'épitope, en dégradé de gris du plus clair au plus foncé en fonction de la probabilité faible à élevée. Les régions d’interactions faibles (0, gris clair) à fortes (3, gris foncé) sont représentées par des traits sous les séquences d’acides aminés.
[Figure 2] représente la comparaison de la spécificité de reconnaissance antigénique de l’anticorps monoclonal dïsotype IgM anti-HLA-DR avec 4 anticorps commerciaux anti-HLA-DR dïsotype IgG utilisés pour le diagnostic. Les histogrammes représentent l’overlay des MFI obtenues par analyse cytométrique pour des cellules B de la lignée Daudi (HLA-DR positives) marquées avec les anticorps commerciaux dïsotype IgG 1 anti-HLA-DR (LN3 et L243 de Biolegend ; et IM1638U et IMMU-357 de Beckman) couplés au FITC. Pour chaque clone testé, les cellules sont incubées au préalable ou non, avec les AcMs anti-HLA- DR aux formats Fab’2, IgG et IgM. La ligne verticale en pointillé représente la médiane de fluorescence du clone commercial seul.
[Figure 3] représente la répartition membranaire comparée de l’épitope HLA-DR, en fonction de lïsotype de l’anticorps monoclonal agoniste anti-HLA-DR, isotype IgM ou IgG. Les cellules de LLC sont incubées avec les AcMs anti-HLA-DR IgG 1 et IgM conjugués au FITC à 2 pg/ml pendant 4 heures sur des lamelles de verre dans un milieu RPMI sans sérum. Après fixation les cellules sont recouvertes
d’un milieu de montage contenant du DAPI (marquage nucléaire) et analysées en microscopie à fluorescence. La figure montre des images représentatives obtenues avec les AcMs IgG ou IgM anti-HLA-DR, les noyaux (DAPI) et la fusion des deux fluorescences (MERGE). Barre d’échelle 10 pm.
[Figure 4A] représente la mortalité cellulaire B comparée des lymphocytes B clonaux primaires et issus de malades, mortalité B observée après 6 heures (H6) de traitement par les isotypes IgG et IgM anti-HLA-DR. Les cellules de LLC ont été incubées pendant 6 heures avec les AcMs anti-HLA-DR isotype IgG et IgM à une concentration isodose de 2 pg/ml. La cytotoxicité sur les cellules B a ensuite été analysée par cytométrie en flux en utilisant un anticorps anti-CD19-AF700 pour la détection spécifique des lymphocytes B et l’annexine V couplée au FITC pour la détection des cellules mortes. La mortalité normalisée des cellules B est représentée pour chaque condition. Les barres représentent la moyenne ± SEM. La signification statistique des différences entre les groupes a été déterminée à l'aide du test t non apparié (*p < 0,05).
[Figure 4B] représente la mortalité cellulaire B comparée des lymphocytes B clonaux primaires et issus de malades, mortalité B observée après 6 heures (H6) de traitement par les anti-CD20 lgG1 seuls ou en association avec l’isotype IgM anti-HLA-DR. Les cellules de LLC ont été incubées pendant 6 heures avec les AcMs anti-CD20 lgG1 , l’IgM anti-HLA-DR ou l’association des deux, tous à une concentration isodose de 2 pg/ml. La cytotoxicité sur les cellules B a ensuite été analysée par cytométrie en flux avec marquage des cellules mortes en utilisant un anticorps anti-CD19-AF700 pour la détection spécifique des lymphocytes B et l’annexine V couplée au FITC pour la détection des cellules mortes. La mortalité normalisée des cellules B est représentée pour chaque condition. Les barres représentent la moyenne ± SEM. La signification statistique des différences entre les groupes a été déterminée à l'aide du test t non apparié (ns = non significatif, *p < 0,05, **p < 0,01 , ***p < 0,001 , ****p < 0,0001 ).
[Figure 5A] représente l’impact du microenvironnement tumoral sur la bioactivité des anticorps monoclonaux de type IgG 1 ou IgM anti-CD20 et IgM anti-HLA-DR. Le sérum autologue (SA) reflète l’activité immunosuppressive du microenvironnement tumoral (MET). Le SA contient des molécules à activité
immunosuppressives (molécules HLA-DR solubles inductrices de tolérance immunologique, TGF-béta, CD48 soluble...) et des facteurs de survie dérivés des cellules nurse-like. La viabilité cellulaire lymphocytaire B après traitement par les AcMs anti-CD20 rituximab (RTX) d’isotype lgG1 et IgM anti-CD20 seuls ou en association de l’IgGI et IgM RTX avec l’isotype IgM anti-HLA-DR en sérum de veau foetal (SVF) et en SA des malades a été déterminée après incubation des cellules de LLC pendant 6 heures avec les AcMs anti-CD20 RTX lgG1 et IgM, l’IgM anti-HLA-DR ou l’association des deux, tous à une concentration isodose de 2 pg/ml. La cytotoxicité sur les cellules B a ensuite été analysée par cytométrie en flux (CF) en utilisant un anticorps anti-CD19-AF700 pour la détection spécifique des lymphocytes B et l’annexine V couplée au FITC pour la détection des cellules mortes. La mortalité normalisée des cellules B est représentée pour chaque condition. Les barres représentent la moyenne ± SEM.
[Figure 5B] représente l’impact du microenvironnement tumoral sur la bioactivité des anticorps monoclonaux de type IgG 1 ou IgM anti-CD20. Les PBMCs de LLC ont été pré-incubés pendant 16 heures, sans ou avec CpG ODN (1.5 pg/ml) et CD40 ligand (CD40L) (1 pg/ml), afin d’induire un microenvironnement favorable à la survie des cellules clonales B, à l’image de l’effet de survie du microenvironnement tumoral in vivo. A l’issue, les cellules ont été traitées par les AcMs pendant 5 heures, à la dose de 2 pg/ml. La mortalité cellulaire B a été évaluée par le marquage en annexine V.
[Figure 6A] représente l’étude de l’impact de la chronobiologie du traitement par les IgG 1 anti-CD20 et IgM anti-HLA-DR sur l’activité synergique de l’association IgG plus IgM. La mortalité cellulaire induite par les AcMs anti-CD20 RTX et OBZ d’isotype lgG1 en association avec l’IgM anti-HLA-DR a été déterminée après incubation des cellules de CLL pendant 6 heures avec les AcMs à 2 pg/ml en déposant les IgG 30 minutes avant l’IgM ou inversement. La cytotoxicité comparative sur les cellules B tumorales a ensuite été analysée par cytométrie en flux en utilisant un anticorps anti-CD19-AF700 pour la détection spécifique des lymphocytes B et l’annexine V couplée au FITC pour la détection des cellules mortes. L’indice de cytotoxicité (%) est représenté pour chaque condition.
[Figure 6B] représente les effets de la chronobiologie lgG1 anti-CD20 et anti- HLA-DR IgM sur l’agrégation homotypique cellulaire B-B. La modification des cellules en culture induite par les AcMs anti-CD20 RTX et OBZ d’isotype IgG 1 en association avec l’IgM anti-HLA-DR a été observée après 1 jour et 3 jours d’incubation des PBMC de LLC avec les AcMs à 2 pg/ml en déposant l’IgG 30 minutes avant l’IgM ou inversement.
[Figure 7A] représente l’impact du traitement in vivo par le rituximab (RTX) sur la maladie résiduelle minimale (« mesurable residual disease » ou MRD), en comparaison avec son association avec l’IgM anti-HLA-DR. La détection des cellules tumorales humaines (PBMC de LLC) dans le modèle de xénogreffe de souris a été évaluée chez la souris CLL-PDX NGS (n= 5 par groupe). Groupe 1 : contrôle (NaCI 0,9 %). Groupe 2 : Rituximab RTX. Groupe 3 : IgM anti-HLA-DR, Groupe 4 : Rituximab RTX/lgM anti-HLA-DR. Les animaux ont été sacrifiés 5 jours après le traitement par les AcMs (J5). La présence de cellules clonales B de LLC dans la rate a été réalisée par RT-qPCR en temps réel avec des amorces spécifiques pour les séquences Alu humaines (hAlu) normalisées sur l'expression de la [3-Actine de souris (m[3actine) sur des extraits d'ADN total (a). En utilisant une courbe étalon réalisée avec un nombre de cellules connu, la maladie résiduelle minimale (MRD) (b) et un ratio de cellules détectées normalisées sur le contrôle a été calculé (c). Les données sont exprimées en moyenne ± SD, un point représentant une souris. La signification statistique des différences entre les groupes a été déterminée par un test ANOVA à sens unique (ns = non significatif, *p < 0,05, **p < 0,01 , ***p < 0,001 , ****p < 0,0001 ).
[Figure 7B] représente l’impact du traitement in vivo par l’anticorps obinutuzumab (OBZ) sur la MRD, en comparaison avec son association avec l’IgM anti-HLA- DR. La détection des cellules tumorales humaines (PBMC de LLC) dans le modèle de xénogreffe de souris a été évaluée chez la souris CLL-PDX NGS (n= 5 par groupe). Groupe 1 : contrôle (NaCI 0,9 %). Groupe 2 : Obinutuzumab OBZ. Groupe 3 : IgM anti-HLA-DR. Groupe 4 : Obinutuzumab OBZ/lgM anti-HLA-DR. Les animaux ont été sacrifiés 5 jours après le traitement par les AcMs (J5). La présence de cellules clonales B de LLC dans la rate a été réalisée par RT-qPCR en temps réel avec des amorces spécifiques pour les séquences Alu humaines
(hAlu) normalisées sur l'expression de la P-Actine de souris (m actine) sur des extraits d'ADN total (a). En utilisant une courbe étalon réalisée avec un nombre de cellules connues la MRD (b) et un ratio de cellules détectées normalisées sur le contrôle a été calculé (c). Les données sont exprimées en moyenne ± SD, un point représentant une souris. La signification statistique des différences entre les groupes a été déterminée par un test ANOVA à sens unique (ns = non significatif, *p < 0,05, **p < 0,01 , ***p < 0,001 , ****p < 0,0001 ).
[Figure 8A] représente la viabilité cellulaire B post-traitement (à H6) par les anticorps monoclonaux thérapeutiques anti-CD20, IgG et IgM anti-HLA-DR, utilisés seuls ou en combinaisons. La viabilité est identifiée par la déplétion des lymphocytes B (% LB) pour des combinaisons anti-CD20 IgG de type I ou II (anticorps RX et OBZ) et anti-HLA-DR IgM, les mêmes combinaisons avec des isotypes inversés, et des combinaisons « double IgM » ; au regard des anticorps utilisés seuls ou d’un contrôle négatif sans anticorps.
[Figure 8B] représente la mortalité cellulaire des LB « restants » (identifiés par une taille/structure restant normale), pour des combinaisons anti-CD20 IgG de type I ou II (anticorps RX et OBZ) et anti-HLA-DR IgM, les mêmes combinaisons avec des isotypes inversés, et des combinaisons « double IgM », au regard des anticorps utilisés seuls ou d’un contrôle négatif sans anticorps.
[Figure 8C] représente l’importance des épitopes dans la bio-activité des anticorps anti-CD20 IgG sur les LB tumoraux primaires de patients atteints de LLC.
L’évaluation du rôle des isotypes IgG et IgM dans les combinaisons d'anticorps anti-CD20 et anti-HLA-DR a été réalisée sur PBMC de LLC. Les cellules de LLC ont été mises en suspension à 1 million par millilitre dans le milieu de culture RPMI, 10% de SVF. Les anticorps d’isotype IgG et IgM anti-HLA-DR et anti-CD20 RTX et OBZ ont été incubés avec les cellules à une concentration de 2 pg/ml.
L’administration des AcMs a été réalisée en alternant les combinaisons anti- CD20 (RX ou OBZ) et anti-HLA-DR selon la description ci-dessous : - Traitement IgG + IgM - Traitement IgM + IgG - Traitement IgM + IgM
Des isotypes contrôles IgG et IgM ont également été évalués.
Le pourcentage (%) de cible B [Fig. 8A], la mortalité cellulaire B [Fig. 8B] ainsi que l’effet des isotypes contrôles [Fig. 8C] ont été évalués après 6 heures (H6) d’incubation en cytométrie en flux en utilisant un anticorps anti-CD19-AF700 pour la détection spécifique des lymphocytes B et l’annexine V couplée au FITC pour la détection des cellules mortes (Excitation: 488 nm; Émission: 350 nm). Les données ont été collectées et analysées avec le logiciel Kaluza.
[Figure 9] représente la structure de l’ IgM hexamérique et pentamérique.
[Figure 10] représente la réponse anti-tumorale comparée de l’IgM hexamérique et pentamérique par la technique Incucyte après 48h, pour 7 patients atteints de LLC. L’analyse cinétique de la cytotoxicité et du stress oxydatif a été réalisée à l’aide du système d’imagerie en temps réel Incucyte® Live-Cell Analysis System (Essen BioScience, Ann Arbor, Ml, USA), à 37 °C avec 5 % de CO2. Les cellules mononucléées du sang périphérique (PBMC) ont été ensemencées en plaques de culture 96 puits (300000 cellules/puits dans 200 pL de milieu complet RPMI). Pour l’analyse de la viabilité cellulaire, le milieu a été supplémenté avec 5 pM du réactif Incucyte® Cytotox Green, qui pénètre spécifiquement les cellules mortes. Le stress oxydatif intracellulaire a été quantifié à l’aide de la sonde CelIROX™ Deep Red (5 pM). Le taux de mortalité a été calculé en croisant les signaux de cytotoxicité et de stress oxydatif, normalisés par la surface cellulaire détectée. Les anticorps ont été testés en duplicat sur les PBMC. Les acquisitions ont été réalisées pendant 48 à 72 heures, toutes les heures à l’aide d’un objectif *20. Quatre images ont été collectées par puits à chaque point temporel. L’imagerie en contraste de phase a permis de suivre la dynamique morphologique des populations cellulaires au cours du traitement.
[Figure 11] représente l’analyse comparative de courbes dose-réponse sur la déplétion lymphocytaire B de 3 patients atteints de LLC (LLC1 , LLC2, LLC3). La cytotoxicité des IgM hexamérique et pentamérique a été évaluée en effet dose (de 1 à 5 - 10 pg/ml) sur PBMC de 3 LLC. Les cellules de LLC ont été mises en suspension à 1 million par millilitre dans le milieu de culture RPMI, 10% de SVF. Les AcMs ont été déposés en doses croissantes et incubées 6 heures. Le pourcentage (%) de cible B après traitement a été mesuré en cytométrie en flux
en utilisant un anticorps anti-CD19-AF700. Les données ont été collectées et analysées avec le logiciel Kaluza.
[Figure 12] représente l’analyse comparative de la bio-activité des IgM pentamérique et hexamérique après induction de la résistance : a) étude de la déplétion lymphocytaire B ; b) étude de la mortalité cellulaire. La bioactivité des anticorps anti-HLA-DR hexamérique et pentamérique a été évaluée selon deux conditions de culture en environnement de résistance, oligodésoxynucléotides CpG (0.25 pM) sans ou avec du CD40L (1 pg/ml) (n=2 à 8 LLC selon les conditions). Les cellules de LLC ont été mises en suspension à 1 million par millilitre dans le milieu de culture RPMI, 10% de SVF. Les AcMs ont été incubés avec les cellules à une concentration de 2 pg/ml. Le pourcentage (%) de cible B [Fig. 12a] ainsi que le % de mortalité cellulaire B [Fig. 12b] ont été évalués après 6 heures d’incubation en cytométrie en flux en utilisant un anticorps anti-CD19- AF700 pour la détection spécifique des lymphocytes B et l’annexine V couplée au FITC pour la détection des cellules mortes (Excitation: 488 nm; Émission: 350 nm). Les données ont été collectées et analysées avec le logiciel Kaluza.
[Figure 13] représente l’étude de la toxicité endothéliale des IgM pentamérique et hexamérique sur : a) les cellules primaires HUVEC en absence ou présence de PBMCs de patients atteints de LLC ; b) la lignée endothéliale EA.hy926. Dans les deux expériences, les cellules ont été stimulées avec 10 ng/ml d’interféron gamma (IFNy) pendant 24 heures afin d’induire l’expression membranaire de la protéine HLA-DR. La toxicité endothéliale a été évaluée sur les cellules primaires HUVEC (PromoCell) en plaque 12 puits (2.105 HUVEC/puits/ml) [Fig. 13a], Pour l’évaluation de la toxicité directe, les AcMs ont été ajoutés à 5 pg/ml. Pour l’évaluation de la toxicité indirecte, les HUVEC ont été co-cultivées avec des PBMC de LLC (6 millions / ml) au moment de l’ajout des AcMs. Après 6 heures d’incubation, les PBMC (cellules non adhérentes) ont été éliminées par lavage puis les HUVEC sont décollées par action de la trypsine. La mortalité a été évaluée en cytométrie en flux avec le marquage annexine V /IP (apoptose : annexine V+ ; nécrose : annexine V+ /IP+). La toxicité endothéliale sur la lignée EA.hy926, dérivée de cellules endothéliales de la veine ombilicale humaine transformées, a été évaluée en plaque 96 puits (2.5.105 EA.hy926 / ml) [Fig. 13b].
Les AcMs ont été ajoutés à 5 pg/ml en présence de sérum humain à 20%. L’anticorps anti-HLA-DR IgG L243 (Biolegend) a été testé en comparaison des IgM hexamérique et pentamérique. Après 24 heures de traitement, la viabilité cellulaire a été évaluée avec le test MTS (Promega) après 1 h d’incubation. La capacité des cellules à réduire le MTS en formazan est mesurable à 490 nm. Cette absorbance représente l’activité mitochondriale induite par le traitement par l’anticorps monoclonal considéré (IgM hexamérique, IgM pentamérique, anticorps anti-HLA-DR L243). L’incubation 1 heure avec de l’H2O2 à 10 mM a été utilisée comme contrôle positif, compatible avec le test MTS. Les résultats représentent la valeur d’absorbance des puits tests moins l’absorbance obtenue pour le milieu sans cellules (DO 490 : test - blanc).
[Figurel 4] représente l’étude de la cytotoxicité anti-lymphocytaire B induite par la combinaison IgG/lgM dans le modèle lymphome non-hodgkinien: a) Cellules de patients atteints de lymphomes non hodgkiniens B (LNH-B) : lymphomes de la zone marginale (LZM) et lymphome du manteau (LM) ; b) et c) La lignée cellulaire Raji a été utilisée comme modèle d’étude du lymphome de Burkitt en culture 3D sphéroïde. [Fig. 14a] La toxicité sur PBMCs de LNH a été évaluée après 4 heures de traitement en plaque 96 puits (1 millions / ml) en cytométrie en flux en utilisant un anticorps anti-CD19-AF700 avec le marquage annexine V (apoptose). Les AcMs ont été ajoutés à 2 pg/ml en présence de SVF 10%. Les données ont été collectées et analysées avec le logiciel Kaluza. Les résultats représentent le % de la cible tumorale B et le % de mortalité sur ces mêmes cellules. [Fig. 14b] La toxicité des AcMs sur la lignée Raji a été évaluée dans le modèle 3D sphéroïde en absence et présence d’effecteurs lymphocytaires T d’un donneur sain. Les cellules ont été ensemencées à 1 .104 cellules par puits de plaques fond rond ULA (Face 11 i tate) et cultivées 3 jours, avant ou non, ajout des effecteurs T (LT) à 3.104 cellules par puits et ajouts en parallèle des AcMs à 2 pg/ml. L’acquisition a été effectuée en utilisant l’Incucyte™ et le module d’analyse Sphéroïde. L’histogramme de droite représente la surface des sphéroïdes après traitements J4 en pm2. Les résultats de l’histogramme de gauche représentent la surface de cellules vivantes après traitement à J4 (= MRD en pm2), soit la surface totale du sphéroïde « masque brightfield » moins la surface de mort cellulaire « masque
CytotoxGreen ». [Fig. 14c] Les images correspondantes aux sphéroïdes après 4 jours de traitement ont été obtenues avec l’Incucyte™, la surface blanche dans les sphéroïdes correspond à la surface de cellules vivantes (MRD). La barre d’échelle représente 1 ,3 mm.
EXEMPLES
EXEMPLE 1 : MATERIEL ET METHODES
- Production de l’IgM anti-HLADR recombinante [24-25].
L’anticorps monoclonal anti-HLA-DR d’origine a été généré chez la souris en utilisant comme antigène des cellules humaines exprimant le HLADR. Les ADN complémentaires (ADNc) codant les domaines variables VH et VL de cet anticorps ont été isolés à partir de l’hybridome murin (Demande internationale WO201 0/145895) [23]. Ces ADNc ont permis la production de cet anticorps sous une forme recombinante sous les isotypes IgG 1 et IgM.
Un AcM dïsotype IgM anti-HLA-DR sous sa forme hexamérique (12 domaines Fab au lieu de 2 avec une lgG1 ) a été produit grâce au système d’expression baculovirus/cellules d’insectes. Pour cela, les ADNc codant les régions variables VH et VL de l’anticorps anti-HLADR ont été clonés dans 2 vecteurs de transfert spécifiques (pVT chaîne légère et pVT chaîne lourde) comprenant déjà les ADN complémentaires codant les régions constantes kappa ou mu comme décrit dans Juliant et al. 2013 [24], Des virus double recombinants ont été générés après co- transfection des cellules Sf9 (ATCC CRL1711 ) avec les 2 vecteurs de transfert chargés et de l’ADN viral selon la technologie décrite dans la Demande internationale WO2019/081858 [25]. Les virus recombinants ont été clonés par la méthode des plages de lyse. Le génome des virus recombinants a été contrôlé par southern blot et les séquences intégrées dans l’ADN viral ont été vérifiées par séquençage après amplification PCR. Après 3 jours d’incubation à 28°C, les anticorps recombinants sécrétés au cours de l’infection de cellules Sf9 cultivées en milieu sans sérum ont été purifiés à partir du surnageant de culture sur une
colonne de protéine A. La pureté des anticorps a été vérifiée par électrophorèse en gel de polyacrylamide et coloration argentique.
Un AcM d’isotype IgM anti-HLA-DR sous sa forme pentamérique (10 domaines Fab au lieu de 2 avec une lgG1 ) a été produit grâce au système d’expression baculovirus / cellules d’insectes. Pour cela, les ADNc codant les régions variables VH et VL de l’anticorps anti-HLADR ont été clonés dans 2 vecteurs de transfert spécifiques (pVT chaîne légère et pVT chaîne lourde) comprenant déjà les ADN complémentaires codant les régions constantes kappa ou mu comme décrit dans Juliant et al. 2013 [24]. Un 3ème vecteur de transfert a été généré en clonant l’ADNc codant pour la chaîne J de séquence suivante : MKNHLLFWGVLAVFIKAVHVKAQEDERIVLVDNKCKCARITSRIIRSSEDPNEDI VERNIRIIVPLNNRENISDPTSPLRTRFVYHLSDLCKKCDPTEVELDNQIVTATQ SNICDEDSATETCYTYDRNKCYTAVVPLVYGGETKMVETALTPDACYPD (SEQ ID NO : 10). Des virus triple recombinants ont été générés après co-transfection des cellules Sf9 (ATCC CRL1711 ) avec les 3 vecteurs de transfert chargés et de l’ADN viral selon la technologie décrite dans la Demande internationale WO2019/081858 [25]. Les virus recombinants ont été clonés par la méthode des plages de lyse. Le génome des virus recombinants a été contrôlé par southern blot et les séquences intégrées dans l’ADN viral ont été vérifiées par séquençage après amplification PCR. Après 3 jours d’incubation à 28°C, les anticorps recombinants sécrétés au cours de l’infection de cellules Sf9 cultivées en milieu sans sérum ont été purifiés à partir du surnageant de culture sur une colonne de protéine A. La pureté des anticorps a été vérifiée par électrophorèse en gel de polyacrylamide et coloration argentique.
- Les cellules de LLC
Toutes les expérimentations ont été réalisées avec des cellules primaires tumorales de malades (avec leur consentement éclairé), in vitro et chez la souris in vivo, et non avec des lignées de cellules tumorales établies (lignées de cellules tumorales B). Le tableau clinique de chaque patient atteint de LLC est connu avec précision, la connaissance des paramètres phénotypiques, cytogénétiques
et moléculaires permet des études de corrélation entre le traitement d'intérêt et la réponse à celui-ci.
- Les cellules de lymphomes B
Les expérimentations sur cellules de lymphomes ont été réalisées in vitro avec des cellules primaires tumorales lymphocytaires B et une lignée de cellule tumorale. Les cellules primaires proviennent de patients atteints de lymphomes non hodgkiniens B (LNH-B) : deux lymphomes de la zone marginale (LZM) et un lymphome du manteau (LM) (avec leur consentement éclairé). La lignée cellulaire Raji a été utilisée comme modèle d’étude du lymphome de Burkitt en absence ou présence de lymphocytes T d’un donneur sain.
- Identification des résidus participant à l’épitope reconnu par l’anticorps monoclonal d’isotype IgM anti-HLA-DR utilisé.
La détermination de l’épitope reconnu par l’anticorps anti-HLADR a été effectuée par la société Mabsilico (https://www.mabsilico.com) par une approche bioinformatique.
S’il n’existe qu’une seule chaine a (HLADRA UNIPROT P01903.DRA_HUMAN), il y a de nombreux variants de la chaine p. Les travaux effectués pour l’identification de l’épitope ont été réalisés en utilisant comme modèle un hétérodimère composé de la chaine a et de la chaine P HLA-DRB1 (HLADRB UNIPROT P01911 ,DRB1_HUMAN) qui est la plus représentée (plus de 80%). À partir de modèles 3D de la cible et de l’anticorps, des positions d'amarrage identifiées par bio-informatique sont classées en fonction de leur probabilité brute d'appartenir à l'épitope, de gris foncé pour la probabilité la plus élevée, au gris le plus clair pour la probabilité la plus faible (mais toujours significative).
- Comparaison de la spécificité et l’individualité de reconnaissance antigénique de l’anticorps monoclonal d’isotype IgM anti-HLA-DR utilisé avec 4 anticorps commerciaux.
Quatre anticorps commerciaux d’isotype IgG anti-HLA-DR (LN3 et L243 de Biolegend ; et IM1638U et IMMU-357 de Beckman) couplés au FITC
(isothiocyanate de fluorescéine) ont été incubés à une dose saturante avec des cellules de la lignée B Daudi (400.000 Daudi par test, en PBS1X 4°C) préalablement incubées 15 minutes à 4°C avec une forte dose (4 pg) de l’IgM anti HLA-DR, l’IgG anti-HLA-DR, un Fab’2 anti-HLA-DR (dérivé de l’IgM ou de l’IgG), ou rien. Après incubation avec les anticorps commerciaux 15 minutes, les cellules sont lavées et analysées en cytométrie en flux (Navios, Beckman; Laser FL1 pour la détection du FITC).
Les résultats montrent que les trois formats d’anticorps gênent la fixation des anticorps commerciaux selon la signification décroissante suivante : IMMU- 357»IM1638U>LN3>L243 (Fig. 2). Par conséquent, l’IgM anti-HLA-DR a un épitope identique ou chevauchant avec l’IMMU-357.
Il est à noter que l’anticorps L243 (IMMU114) a été utilisé pour des essais cliniques [27-34],
- Immunofluorescence sur lame.
Les cellules de LLC sont mises en suspension à 2 millions par millilitre dans le milieu de culture RPMI sans SVF (sérum de veau foetal) sur des lamelles de verre (16 mm de diamètre) placées dans des puits de plaque de culture 12 puits avec les AcMs anti-HLA-DR IgG et IgM couplés au FITC à 2 pg/ml. Après 4 à 6 heures d’incubation, le contenu des puits est rincé avec du tampon phosphate (PBS 1x) et les cellules sont fixées avec 4% de paraformaldéhyde (PFA) pendant 15 minutes à température ambiante. Après deux lavages avec du PBS 1x, les préparations sont recouvertes de milieu de montage contenant du DAPI pour la coloration nucléaire. Les lames ont été examinées avec l’Axio Imager 2 (Zeiss). Les images ont été collectées avec un objectif *63 et analysées à l'aide du logiciel ImageJ.
- Bioactivité : effet des AcMs sur la viabilité des lymphocytes B tumoraux et détermination de l’activité cytotoxique des anticorps.
Les cellules de LLC ou LNH sont mises en suspension à 1 million par millilitre dans le milieu de culture RPMI, 10% de SVF. Les anticorps anti-HLA-DR
d’isotype IgG et IgM et les anti-CD20 RTX et OBZ sont incubés avec les cellules à une concentration de 2 pg/ml.
Selon les expériences, la viabilité lymphocytaire B a été comparée en suivant 3 schémas d’administration des AcMs permettant l’analyse chronobiologique des traitements :
- Traitement IgG 1 et IgM synchrone
- Traitement par l’IgG 1 30 minutes puis IgM
- Traitement par l’IgM 30 minutes puis lgG1 .
Dans le but d’évaluer l’impact du microenvironnement, dans certaines expériences les PBMCs de LLC ont été pré-incubées pendant 16 heures, sans ou avec CpG ODN (CpG oligodeoxynucleotides) (1.5 pg/ml) et CD40 ligand (CD40L) (1 pg/ml), afin de fournir un microenvironnement favorable à la survie des cellules clonales B, à l’image du microenvironnement tumoral in vivo. A l’issue, les cellules ont été traitées par les AcMs pendant 6 heures, à la dose de 2 pg/ml. La mortalité cellulaire B a été évaluée par le marquage en annexine V. L’analyse de la mort cellulaire est effectuée après 6 heures d’incubation (à H6), en cytométrie en flux en utilisant un anticorps anti-CD19-AF700 pour la détection spécifique des lymphocytes B et l’annexine V couplée au FITC pour la détection des cellules mortes (Excitation: 488 nm; Émission: 350 nm). Les données sont collectées et analysées avec le logiciel Kaluza. La mort cellulaire normalisée est calculée en utilisant cette formule (I): (I) % de mort cellulaire normalisée =100 - ((%T*100) / %C) avec “% T”, le % de cellules vivantes dans le tube test et le “%C”, le % de viabilité dans la condition contrôle.
L’index de cytotoxicité associant 3 paramètres représentatifs de la cytotoxicité est calculé selon la formule (II):
(II) Index de cytotoxicité (IC) = (% MTT - % MTC) + (% BC - % BT) + (%NCC- %NCT) avec % MTT et MTC, les % de mortalité totale dans le tube test et contrôle (sans anticorps); les % BC et BT, le % de LB dans les tubes contrôle et le test ; les % NCC et NCT, le % de cellules de taille/structure normale dans les tubes test et contrôle.
- Détection de la MRD en chronobiologie in vivo : le modèle murin CLL-PDX NGS.
Le jour 0, des souris CLL-PDX NGS ont été injectées par voie intraveineuse (IV) avec des PBMC fraîches de LLC (3><107 cellules/souris). Le premier jour, les souris ont été réparties au hasard en quatre groupes (5 souris par groupe) et l'immunothérapie a été réalisée avec une dose en IV de chaque AcM. Deux expériences ont été menées en associant les AcMs anti-CD20 IgG 1 et l’IgM anti- HLA-DR, d'abord avec le RTX et ensuite avec l’OBZ. Les souris CLL-PDX NGS ont reçu par voie IV du NaCI 0,9 % (groupe 1 ), 7,5 mg/kg de RTX ou 7,5 mg/kg d'OBZ (groupe 2), 7,5 mg/kg IgM anti-HLA-DR (groupe 3) et du RTX (7,5 mg/kg) ou OBZ (7,5 mg/kg) suivi IgM anti-HLA-DR (7,5 mg/kg) I.V < 2 heures après l’ IgG 1 (groupe 4). Les souris CLL-PDX NGS ont été sacrifiées le cinquième jour après le traitement réalisé en dose unique à JO.
La présence de cellules B tumorales de la LLC a été évaluée par RT-qPCR dans le foie, la rate, les poumons et la moelle osseuse, en utilisant des amorces spécifiques pour les séquences Alu humaines.
- Détection quantitative des cellules humaines par q-PCR.
La détection de cellules humaines tumorales B primaires dans la rate, la moelle osseuse, les poumons et le foie de souris était basée sur la détection quantitative de séquences Alu humaines dans des extraits d'ADN d'organes de souris à l'aide d'un protocole mis au point par Funakoshi et al, 2017 [35]. Pour l’extraction d’ADN cent microlitres d'organe homogénéisé dans du PBS ont été utilisés. Le kit BioSprint 15 DNA Blood & Tissue de QIAGEN (Ref : 940017) a été utilisé conformément aux instructions du fabricant. Pour détecter les cellules humaines dans les tissus de souris, des amorces spécifiques des séquences Alu humaines (forward : 5'- GGTGAAACCCCGTCTACT-3' (SEQ ID NO : 6); reverse : 5'- GGTTCAAGCGATTCTCGC-3' (SEQ ID NO : 7)) ont été utilisées pour amplifier les séquences Alu humaines présentes dans l'ADN génomique extrait des échantillons. Des amorces -actine spécifiques de la souris (mp-actine) ont été utilisées comme gène de ménage (forward : 5'-AAGGCCAACCGTGAAAAGAT- 3' (SEQ ID NO : 8); reverse : 5'-GTGGTACGACCAGGGATAC-3' (SEQ ID NO :
9) [36]. La RT-qPCR en temps réel pour amplifier et détecter les séquences huAlu a été réalisée sur 40 ng d'ADN génomique avec 0,1 pM de chaque amorce et 5pl de Master mix SYBR green (Thermofisher) dans un volume final de 10 pl. Un système QuantStudio 6 Flex Real Time System (Applied Biosystems) a été utilisé pour le suivi des acquisitions dans les conditions suivantes : 50°C pendant 2 min et 95°C pendant 10 min suivi de 50 cycles à 95°C pendant 30 sec, 60°C pendant 1 min, une étape de courbe de fusion à 95°C pendant 15 sec, 60°C pendant 1 min et 95°C pendant 15 sec. Une mesure quantitative de l'ADN de souris amplifiable a été obtenue par amplification de la séquence d'ADN génomique de la p-actine de souris avec des amorces de m -actine (forward et revers), en utilisant les mêmes conditions de PCR. Le cycle seuil (Ct) de chaque échantillon a été enregistré comme mesure quantitative de la quantité de produit PCR dans l'échantillon. Lorsque cela est indiqué, le signal Alu a été normalisé par rapport à la quantité relative de mp-actine et exprimé sous la forme ACt = (Ctmp-actine- Ctalu). Les modifications du signal Alu par rapport à la quantité totale d'ADN génomique (c'est-à-dire les modifications de la quantité d'ADN humain dans le tissu de la souris) ont été exprimées comme AACt = ACtcontrôle - ACtraitement. Les changements relatifs dans la détection ont ensuite été calculés comme 2- AACt. Chaque essai comprenait un contrôle négatif, un contrôle positif, un contrôle sans modèle d'ADN et les échantillons expérimentaux en double. Le traitement des données et l'analyse statistique ont été effectués à l'aide de GraphPad Prism.
- Cytotoxicité des AcMs dans le modèle sphéroïde de lymphome : lignée Raji.
L’évaluation de la cytotoxicité anti-lymphocytaire B des AcMs dans le modèle 3D de cellules lymphomateuses Raji a été réalisée en culture sphéroïde, modèle couramment utilisé pour représenter les environnements tissulaires in vivo et le screening de molécules thérapeutiques. Les sphéroïdes ont été réalisés en cultivant 1.104 cellules Raji dans le milieu de culture RPMI en plaque non adhérente ULA (Facellitate) à 37 °C avec 5 % de CO2 pendant 72 heures. Les anticorps, avec ou sans lymphocytes T d’un donneur sain (30 000 cellules), ont
ensuite été ajoutés à 2 pg/ml. Les anticorps ont été ajoutés dans du milieu RPMI contenant du CytotoxGreen à une concentration finale de 5 pM pour le suivi de la mortalité cellulaire en Incucyte™ avec l’objectif X4. L’analyse des images a été réalisée à l’aide du logiciel IncuCyte®, les valeurs de surface des sphéroïdes (masque brightfield, acquisitions en champ clair) et la surface de cellules mortes, CytotoxGreen positives, ont été utilisées pour calculer la surface de cellules vivantes après traitement en pm2 (= MRD).
EXEMPLE 2 : RESULTATS
- Identification des résidus participant à l’épitope reconnu par l’anticorps monoclonal d’isotype IgM anti-HLA-DR utilisé.
La molécule HLA-DR est composée de deux sous-unités alpha et bêta. À partir des positions d'amarrage les mieux classées, les résidus de la cible ont été notés selon leur probabilité d'appartenir à l'épitope. Les résidus censés appartenir à l'épitope sont indiqués sur la séquence et sur la structure de la cible (Fig. 1 ).
Ils sont divisés en 4 catégories en fonction de leur probabilité brute d'appartenir à l'épitope, de gris foncé pour la probabilité la plus élevée, au gris le plus clair pour la probabilité la plus faible (mais toujours significative). Pour des raisons techniques, la cible est renumérotée comme une seule chaîne. De plus, les acides aminés des chaînes de la cible ne sont pas tous visibles dans la structure 3D. Les résidus prédits comme appartenant à l'épitope et les peptides de validation sont indiqués sur la séquence de la cible.
A partir de ces résidus, quatre régions d’interaction principales ont été définies sur la cible. Les régions d'interaction sont indiquées sur la structure de la cible. Il est intéressant de noter que l’AcM anti-HLA-DR reconnaît préférentiellement un épitope de la chaîne alpha du HLA-DR, mais aussi certains acides aminés de la chaîne bêta.
- Effet de clustérisation membranaire (oligomérisation) de l’épitope HLA- DR induit par l’AcM anti-HLA-DR d’isotype IgM et effets biologiques liés au clustering épitopique.
L’anticorps anti-HLADR sous un isotype IgM présente des propriétés très différentes comparé à l’IgGI de même spécificité, en particulier à l’oligomérisation de la cible non observée par l’agoniste IgG 1 anti-HLA-DR.
Observable : la bio-distribution membranaire de l’épitope HLA-DR après traitement avec les AcM anti-HLA-DR d’isotype IgG ou IgM a été analysée en immunofluorescence. Elle met en exergue la capacité et la spécificité inductive d’oligomérisation de l’épitope induite par l’isotype agoniste de l’ IgM anti-HLA-DR (Fig. 3).
Les résultats montrent que l'isotype I gG 1 anti-HLA-DR n’induit qu’une distribution aléatoire et non organisée de l’épitope HLA-DR au sein de la membrane des cellules B de LLC. En revanche, l’isotype IgM anti-HLA-DR induit rapidement (< 3 heures) le regroupement en clustering épitopique membranaire des molécules HLA-DR spécifiquement dans les zones de contacts intercellulaires.
Cette oligomérisation conduit au recrutement de HLA-DR au sein de radeaux lipidiques et à l'induction de nombreuses autres nouvelles activités biologiques liées à ce clustering épitopique :
- Interaction avec le cytosquelette, réorganisation de la F-actine et du cytosquelette ;
- Forte colocalisation de la cortactine et de la F-actine dans les structures membranaires de podosomes impliquées dans la forte adhésion homotypique lymphocytaire B-B ;
- Forte agrégation homotypique (HA) et clustering lymphocytaire de cellules B bien visibles en microscopie optique et en imagerie en temps réel avec l’Incucyte™.
- Interaction avec de nouvelles voies de transduction du signal inductrices de mort cellulaire lymphocytaire B (activation de la NOX2, production de radicaux libres de l’oxygène et création d’un stress oxydatif cellulaire B léthal, phosphorylation des protéines JNK1/2, ERK1-2 et Bcl-2, activation de la Bécline 1 , production importante intrinsèque B d’interféron-gamma);
- Tous ces événements biologiques conduisant à la mort de la cellule cible tumorale lymphocytaire B.
Nous avons montré la corrélation qui existait entre agrégation homotypique et mortalité cellulaire lymphocytaire B ainsi que la corrélation entre le pourcentage de l’HA et la viabilité cellulaire réduite (induction de clusters de taille importante avec 100% de mortalité cellulaire B au sein de ces clusters).
- Bioactivité comparative de l’AcM d’isotype IgM anti-HLA-DR versus IgG anti-HLADR.
Observable : le traitement par l'isotype IgM anti-HLA-DR induit une plus grande efficacité anti-tumorale comparé à l’isotype IgG 1 anti-HLA-DR (Fig. 4A).
Lorsque l’AcM anti-HLA-DR a été utilisé sous l'isotype IgM hexamérique, une réduction importante et significative de la viabilité des cellules B tumorales a été observée. L'efficacité a été évaluée à 6 heures (H6) après une exposition à une dose unique d’AcM. L'isotype lgG1 anti-HLA-DR est moins efficace que l’IgM pour induire la mort des cellules B de la LLC : l'anticorps lgG1 anti-HLA-DR a induit à H6 la mort de 14,7± 2,8 % des cellules B de la LLC (n = 24) et on observe une augmentation significative jusqu'à 26,6 ± 3 % avec l'anticorps IgM anti-HLA- DR (*p < 0,05 ; n = 36).
- Combinaisons anticorps anti-CD20 de type I et de type II plus AcM anti- HLA-DR : l’AcM d’isotype IgM anti-HLA-DR potentialise l’activité antitumorale sur les cellules B de la LLC des AcM d’isotype lgG1 anti-CD20.
Observable : le traitement par une faible dose (< 2 pg/ml) d'IgM anti-HLA-DR est synergique avec les AcMs anti-CD20 (Fig. 4B) et amplifie la bioactivité d’un Ac monoclonal anti-CD20, que ce soit de type I ou de type II. Une telle amplification de l’activité de l’anticorps monoclonal anti-CD20 de type I et de type II par l’IgM anti-HLA-DR est observée jusqu’à des doses faibles de l’IgM à 0,5 pg/ml, témoignant d’une activité synergique à faibles doses de l’IgM in vitro et in vivo (dose de l’IgM < 2 pg/ml). Cette activité synergique observée de type « low dose IgM » permet d’envisager un bénéfice pharmacocinétique et pharmacodynamique in vivo.
L'efficacité a été évaluée à 6 heures (H6) après l'exposition à une dose unique d'AcMs.
Par rapport aux contrôles H6, 2 pg/ml d'AcMs anti-CD20 ont induit une moyenne de mort normalisée des cellules B de la LLC de 10 ± 1 ,2 % pour RTX (n = 36) à 28,6 ± 5,1 % pour OBZ (n = 17). L'association d’IgGI anti-HLA-DR et d'IgGI anti- CD20 n'augmente pas la cytotoxicité cellulaire avec environ 20 % de mort cellulaire (données non représentées). A l'inverse, le traitement associé par l'isotype IgM anti-HLA-DR augmente significativement la mort cellulaire détectée à H6, par rapport à l’IgG 1 anti-CD20 seul (39,14 ± 4,14 % pour RTX + IgM ; 50,06 ± 5,18 % pour OBZ + IgM).
La combinaison lgG1 anti-CD20 plus IgM anti-HLA-DR crée une activité antitumorale amplificatrice vis-à-vis du clone lymphocytaire B, activité synergique et non additive. La convergence des bioactivités respectives de ces deux AcMs repose sur l'amplification de la voie NADPH oxydase via la protéine membranaire lymphocytaire B, la NOX2, dont l’activation synergique par l’IgG 1 et l’ IgM génère des espèces réactives de l'oxygène (ROS). Les ROS conduisent à une induction de la mort des cellules lymphocytaires B clonales néoplasiques, mortalité B indépendante de l’activation des caspases. Il s’agit d’une mort cellulaire nécrotique régulée, caspase-indépendante, induite par les ROS responsables d’un stress oxydatif léthal, qui occasionne un stress du réticulum endoplasmique, qui est associé à un transfert calcique intra-mitochondrial que nous avons mesuré par la sonde Rhod-2. L’importance du transfert calcique intra-mitochondrial à partir du réticulum endoplasmique via la protéine IP3R, est corrélée au traitement par l’ IgM et son intensité est corrélée à la mort lymphocytaire B observée. Stress oxydatif et transfert calcique intra-mitochondrial entraînent une dysfonction mitochondriale lymphocytaire B et des dommages morphologiques mitochondriaux létaux.
Nous avons régulièrement observé des lésions mitochondriales létales en étude en microscopie électronique, à H6 du traitement, par la combinaison des AcMs lgG1 puis IgM : ballonnement oedémateux de l’ensemble des mitochondries, involution sévère des crêtes mitochondriales, rupture mitochondriale.
Ces altérations mitochondriales morphologiques et fonctionnelles sont majeures et léthales (mortalité lymphocytaire B par nécrose cellulaire induite par la carence en ATP), constituent la propriété de la synergie IgG 1 anti-CD20 et IgM anti-HLA-
DR, génèrent une mort lymphocytaire B par nécrose induite et régulée, précédée d’un oedème des mitochondries et de la membrane péri-nucléaire.
- Combinaisons anti-HLA-DR x anti-CD20 : AcM d’isotype IgM anti-HLA-DR potentialisant l’activité anti-tumorale d’un AcM d’isotype lgG1 ou IgM anti- CD20 (dérivé du RTX). Impact du microenvironnement tumoral et du sérum autologue.
Le SA reproduit avec une plus grande fidélité le microenvironnement tumoral (facteurs solubles d’immunodépression et facteurs de survie), en comparaison avec le SVF.
Observable : l’utilisation de sérum autologue (SA) de malades atteints de LLC diminue l’efficacité des AcMs seuls ou en combinaison lgG1 plus IgM anti-HLA- DR, par comparaison avec l’utilisation du SVF 10% (sérum de référence in vitro). De façon importante, l’utilisation d’une IgM anti-CD20 avec l’ IgM anti-HLA-DR, non seulement, rend la combinaison insensible à l’effet inhibiteur du SA mais majore sa bio-activité dans cette condition de résistance immune.
La bio-activité des AcMs est évaluée à 6 heures (H6) après l'exposition à une dose unique d'anticorps.
En SA, par rapport à utilisation du SVF 10%, les niveaux de perte d’activité sont les suivantes :
AcM RTX anti-CD20 : perte moyenne de - 2.5 % pour l’IgG 1 et perte moyenne de - 6.2 % pour l’ IgM anti-CD20.
IgM anti-HLA-DR : une diminution d’environ - 2.7 %.
Pour l’association RTX IgG + anti-HLA-DR IgM : une diminution d’environ - 9.5 %.
Une faible dose (< 2 pg/ml) d'IgM anti-HLA-DR induit une efficacité synergique avec les AcMs anti-CD20 lgG1 de type I et de type II, aussi bien en SVF 10 % qu’en sérum autologue de patient (n = 3) (Fig. 5A).
En SVF 10% par rapport aux contrôles H6, 2 pg/ml d'AcM RTX anti-CD20 induit un faible index de cytotoxicité vis-à-vis des cellules B tumorales de la LLC, soit une augmentation d’environ 5.4 % pour RTX lgG1 et 13.8 % pour le RTX IgM. En milieu SVF, l’ajout d'IgM anti-HLA-DR aux AcMs anti-CD20 augmente significativement la mort cellulaire B, par rapport à l’IgGI et l’IgM anti-CD20
seules : gain moyen de + 32.8 % pour RTX IgG + IgM anti-HLA-DR ; gain moyen de + 17.6 % pour RTX IgM + IgM anti-HLA-DR.
En SA, l’index de cytotoxicité anti-lymphocytaire B avec l’anti-CD20 RTX est d’environ 3.1 % pour l’IgGI et 7.6 % pour l’isotype IgM anti-CD20. De la même manière qu’en SVF 10%, en SA, l’association des AcMs anti-CD20 avec l’anti- HLA-DR IgM potentialise leur effet : gain moyen de + 25.6 % pour RTX IgG + IgM anti-HLA-DR ; gain moyen de + 32.5 % pour RTX IgM + IgM anti-HLA-DR. L’association RTX IgM avec l’AcM anti-HLA-DR IgM augmente l'efficacité de la synergie : gain moyen de 8.6 %.
Les cellules B sont pré-traitées pendant 16 heures par l’association CpG ODN (CpG oligodeoxynucleotides) et CD40 ligand (CD40L), pour fournir un environnement favorable à la survie cellulaire en induisant une résistance dans les cellules clonales B, puis celles-ci sont traitées par les anticorps monoclonaux lgG1 anti-CD20 et l’ IgM anti-HLA-DR, seuls ou en combinaison. La mortalité est ensuite évaluée en cytométrie et normalisée à la condition contrôle sans CpG /CD40L.
En comparant la mortalité cellulaire normalisée des LB sans pré-traitement par CpG ODN / CD40L, on observe une diminution de la mort cellulaire basale en présence de CpG ODN / CD40L (Fig. 5B). Le pré-traitement par CpG ODN et CD40L entraîne effectivement une meilleure survie des lymphocytes B tumoraux et une réduction importante de leur mortalité spontanée (contrôle positif expérimental). Une mortalité spontanée importante des lymphocytes B de LLC > 30% est observable après un cycle de congélation / décongélation cellulaire et permet bien de confirmer l’effet de résistance induite à la mort cellulaire B par le pré-traitement par CpG ODN et CD40L (voire contrôle positif des cellules non traitées dans la condition CpG/CD40L).
L’efficacité des AcMs avec ou sans pré-traitement est évaluée en parallèle. Les traitements AcMs anti-CD20 ne suffisent pas à lever la résistance induite par la condition de culture prétraitée. A l’inverse, l’AcM IgM anti-HLA-DR seule ou en association avec les anti-CD20 lgG1 permet l’induction significative d’une importante mort cellulaire en CpG/CD40L par comparaison à l’effet des IgG 1 anti- CD20, sans bénéfice de l’association avec une lgG1 (moyenne des conditions
sans CpG/CD40L avec les anti-CD20 : 1.93 % ; avec IgM : 6.3 %) ; avec CpG/CD40L et anti-CD20 utilisée seuls: une diminution moyenne de -0.6 %, en condition CpG/CD40L avec traitement par une IgM anti-HLA-DR en combinaison avec un anti-CD20 : on observe une augmentation d’environ 15.9 %).
La bio-activité de l’anticorps monoclonal de type IgM reste inchangée et induit le même seuil de mortalité B, y compris dans les conditions de résistance tumorale, à l’inverse des anticorps anti-CD20 de type I et II. Ceci met en évidence le fait que l’ IgM est peu sensible au microenvironnement tumoral qui induit à contrario, une résistance au traitement par les IgG.
- Chronobiologie du traitement in vitro et in vivo IgM anti-HLA-DR x lgG1 anti-CD20 (OBZ).
Chronobiologie in vitro
L’étude de la viabilité cellulaire lymphocytaire B a été analysée en chronobiologie afin d’optimiser la réponse anti-tumorale. Ainsi, la viabilité lymphocytaire B a été comparée selon les 3 schémas suivants d’administration des AcMs : - Traitement IgG 1 et IgM synchrone
- Traitement par l’Igl 30 minutes puis IgM
- Traitement par l’IgM 30 minutes puis lgG1
Observable : nous montrons que le traitement par lgG1 puis le traitement par l’IgM anti-HLA-DR (après 30 minutes d’exposition à l’IgGI ) induit une forte agrégation homotypique B-B et une mortalité cellulaire significativement supérieure, par rapport aux autres formes chronobiologiques, traitement IgG 1 et IgM synchrone et IgM puis lgG1 (Fig. 6A) (Fig. 6B).
L'efficacité a été évaluée à 6 heures (H6) en cytométrie après l'exposition à une dose unique d'AcMs.
Une faible dose (< 2 pg/ml jusqu’à 0,5 pg/ml) d'IgM anti-HLA-DR a conduit à une efficacité synergique avec les AcMs anti-CD20 lgG1 (RTX et OBZ) (SVF 10 %), avec la chronobiologie IgG avant IgM (RTX, n = 3 ; OBZ, n = 4) (Fig. 6A).
Pour la combinaison RTX + IgM anti-HLA-DR, on augmente de + 21.5% l’indice de cytotoxicité anti-lymphocytaire B, en déposant l’IgG avant l’IgM (indice de cytotoxicité à H6 pour IgG puis IgM = 47.5 % et IgM puis IgG = 26 %).
Pour la combinaison OBZ + IgM anti-HLA-DR, on augmente de + 11.2% l’indice de cytotoxicité anti-lymphocytaire B, en déposant IgG avant l’IgM (indice de cytotoxicité à H6 pour IgG puis IgM = 78 % et IgM puis IgG = 66.8 %).
Des évaluations en imagerie en temps réel avec captation des images à J1 et J3 (technique IncuCyte) montrent la nette différence entre les deux chronobiologies avec une nette augmentation de l’agrégation cellulaire homotypique B-B, avec la chronobiologie IgG 30 minutes avant IgM (Fig. 6B).
Evaluation de la MRD : Chronobiologie in vivo
L'objectif d'obtenir une maladie résiduelle non-mesurable est très important dans la prise en charge médicale des hémopathies malignes. En effet, les cellules tumorales qui survivent au traitement sont capables de nouvelles modifications génétiques, à l'origine de la récidive et de l'efficacité transitoire des AcMs dues au développement d'une résistance acquise.
Observable : Le traitement in vivo des souris CLL-PDX NGS, par la combinaison des AcMs RTX (ou AcMs OBZ) et IgM anti-HLA-DR, induit une forte réponse antitumorale vis-à-vis des lymphocytes B clonaux B de LLC. L’analyse de la MRD montre une réponse anti-tumorale induite par la combinaison IgG 1 RTX (ou OBZ) plus IgM significativement supérieure au traitement par le RTX (ou l’OBZ) utilisé en monothérapie.
En effet, en utilisant le modèle murin PDX-CLL NGS, nous montrons que la maladie résiduelle tumorale reste détectable après un traitement avec des AcMs d’isotype lgG1 anti-CD20 utilisés en monothérapie (RTX et OBZ), alors que l'association avec OBZ x IgM HLA-DR rend la maladie résiduelle indétectable et non-mesurable dans la rate (Fig. 7A et 7B).
L'isotype IgM anti-HLA-DR combiné à l'OBZ a induit in vivo une maladie résiduelle non-mesurable de la LLC. Ce résultat démontre l’efficacité de la réduction de la MRD d’une hémopathie lymphoïde B, en combinant l'IgGI anti- CD20 de type I ou de type II ceci avec une faible dose d'AcM dïsotype IgM anti- HLA-DR.
L'isotype lgG1 RTX combiné à lïsotype IgM anti-HLA-DR réduit, in vivo, de 17 fois le niveau de MRD dans la rate. L'isotype lgG1 OBZ combiné à lïsotype IgM
anti-HLA-DR réduit, in vivo, de 2 fois le niveau de MRD dans la rate (Fig. 7A b-c et 7B b-c).
La diminution de la MRD a été confirmée in vivo dans 2 modèles différents, en xénogreffe tumorale de l’embryon de poulet et en la xénogreffe de souris par des PBMC de malades atteints de LLC (modèle murin PDX-CLL NGS).
- Comparaison de l’effet biologique des combinaisons IgG/lgM sur des cellules de patients atteints de leucémie lymphoïde chronique (LLC).
Ce test a pour objet de vérifier si l’association d’un anticorps monoclonal thérapeutique d’isotype IgG anti-CD20 (de type I et II) avec un anticorps monoclonal thérapeutique d’isotype IgM anti-HLA-DR (en isodose) est la règle : celle de la capacité d’une IgM d’amplifier la bio-activité d’une IgG.
Les PBMCs de patients atteints de LLC ont été traitées avec les anti-CD20 et anti-HLA-DR d’isotype IgG ou IgM pendant 6h (H6) et analysées en cytométrie en flux (repérage d’un marquage annexine V+, témoignant d’une mortalité cellulaire évolutive).
Deux fenêtres de lecture sont utilisées.
Elles reflètent toutes deux la bio-activité des anticorps monoclonaux seuls ou en combinaisons IgG + IgM : a- La capacité de déplétion de la population tumorale lymphocytaire B (LB) à T6 (évaluation de la lyse tumorale). Elle est identifiée dans la Fig. 8A par le symbole : %LB. b- La capacité d’induire une mortalité cellulaire lymphocytaire B des cellules gardant une taille / structure normale (dits « B restants ») à H6 également. La mortalité cellulaire est repérée par un marquage membranaire annexine V+. Elle est identifiée dans la Fig. 8B par le symbole : % mort cellulaire. c- Au temps d’analyse H6, la mortalité acquise (a- lyse lymphocytaire B complète et déplétion LB) et la mortalité cellulaire évolutive (b- lymphocytes B dits « restants » « annexine V+ ») s’additionnent pour donner une mortalité cellulaire LB globale.
La toxicité lymphocytaire T (LT) qui aurait pu être induite par les anticorps seuls ou en combinaisons a également été analysée. Cette toxicité a été examinée par
le calcul de la proportion des LT avant et après le traitement par les anticorps. Aucune toxicité lymphocytaire T n’a jamais été observée, que ce soit avec les IgG et les IgM seules ou en combinaison (données non représentées).
La Fig. 8A montre que la déplétion des lymphocytes B (% LB) est maximale pour les associations « anti-CD20 IgG + IgM anti-HLA-DR » par comparaison avec les mêmes combinaisons avec les isotypes inversés. Les combinaisons « double IgM » sont également efficaces avec l’association « RX IgM + HLA-DR IgM » soit : - 19.7% de LB et « OBZ IgM + HLA-DR IgM » : - 29.4%.
La Fig. 8B montre que la mortalité cellulaire des LB « restants » est maximale avec « OBZ IgG + HLA-DR IgM », comme soutenu dans l’invention. Les associations « anti-CD20 IgG + anti-HLA-DR IgM » montent une cytotoxicité supérieure (53.61 % et 75,56%) que les mêmes combinaisons avec les isotypes combinés inversés. Ces derniers (anti-CD20 IgM + anti-HLA-DR IgG) permettent néanmoins d’induire une mortalité notable de 37.09% et 49.96% au sein des LB restants. Les combinaisons « double IgM » sont également efficaces avec « RX IgM + HLA-DR IgM » : + 34.3% et « OBZ IgM + HLA-DR IgM » : + 44.6%.
La Fig. 8C montre l’importance des épitopes pour la bio-activité des anticorps via l’utilisation d’isotype contrôle (isotype non pertinent, soit IgG soit IgM), sans reconnaissance de cible spécifique. Les IgG et IgM contrôles (iso IgG et iso IgM) ne présentent pas d’effet sur les LB de LLC. La combinaison « RX IgG + iso IgM » ne montre pas non plus d’effet synergique. Avec la combinaison « OBZ IgG + iso IgM », les mêmes valeurs de déplétion B et de mort cellulaire sont observés qu’avec l’utilisation de l’ IgG OBZ seule. Il n’y a donc aucun effet d’un isotype non pertinent sur l’activité des IgG anti-CD20 de type I ou II (contrôle négatif).
Ces résultats montrent l’importance des épitopes dans une association IgM/IgG. L’isotype contrôle IgM n’apporte aucun bénéficie aux anticorps anti-CD20 IgG.
- Comparaison de la bio-activité de l’IgM anti-HLA-DR pentamérique recombinante et de l’IgM anti-HLA-DR hexamérique.
Par co-expression du gène codant pour la chaine J et des gènes codant pour la chaine lourde et la chaine légère de l’IgM, une IgM pentamérique a été produite (Figure 9).
L’analyse comparative de la bio-activité des IgM anti-HLA -DR pentamérique et hexamérique a été réalisée sur des cellules primaires tumorales lymphocytaires B de malades atteints de leucémie lymphoïde chronique (LLC) de la lignée B. Après 48h de suivi de la mortalité en temps réel avec la technique « Incucyte », les données ont été normalisées au contrôle et présentées en % de viabilité cellulaire (histogramme, Fig. 10A). Les données cumulées pour 7 patients atteints de LLC ne montrent pas de différence significative entre les deux IgM. Pour 3 patients atteints de LLC, une supériorité de l’IgM pentamérique a été mise en évidence (Fig. 10B). L’efficacité respective des IgM pentamérique et hexamérique semblent être malade-dépendant.
Sur les 3 patients atteints de LLC, les analyses dose-réponse ont montré une forte efficacité de déplétion B des deux IgM à très faibles doses (0.25-1 pg/ml) (Fig. 11 ). Une supériorité de l’IgM pentamérique à ces mêmes doses a été observée. L’effet est similaire entre les deux IgM pour des doses de 2 ou 4 pg/ml selon le patient. Pour les doses plus élevées (>4 pg/ml), une inhibition de l’effet des anticorps a été observée (effet dose de l’anticorps IgM favorisant la liaison du CH4 de son Fcp avec le FCMR lymphocytaire B responsable de l’induction d’un signal de survie cellulaire B). Les résultats montrent donc la capacité déplétive lymphocytaire B supérieure de l’IgM pentamérique ; son optimum étant atteint à une concentration de 4 pg/ml d’anticorps.
L’effet de la résistance induite sur la bio-activité des IgM a été testé à partir de 4 à 9 expériences selon les conditions à H6. Le milieu de culture a été supplémenté avec CpG-ODN (CpG oligodeoxynucleotide) en absence ou en présence de ligand CD40 (CD40L). Ces deux conditions de culture ont permis d’induire un environnement cellulaire connu pour réguler l’apoptose en induisant des signaux pro-survie (Granziero et al., 2001 ) [37], En condition de résistance, les IgM ont montré un bon effet sur la déplétion lymphocytaire B (Fig. 12a) ainsi que sur l’induction de la mort cellulaire sur les LB restants (Fig. 12b). La mort cellulaire étant un phénomène survenant en amont de la disparition de lymphocytes B tumoraux par lyse cellulaire (= déplétion B), la diminution du % de LB permet une interprétation cinétique de l’effet des anticorps. Les LB ayant survécu et conservé une taille/structure normale à ce temps de l’étude ont permis d’observer un effet
persistant des anticorps si un marquage annexine V+ était observé (cellules présentant un signe biologique de mortalité et destinées à la lyse cellulaire). Ces deux paramètres ont été analysés à H6.
- Etude de la toxicité endothéliale des IgM anti-HLA-DR pentamérique et hexamérique.
La cytotoxicité des anticorps IgM anti-HLA-DR a été évaluée sur cellules endothéliales HUVEC et sur la lignée EA.hy926 après stimulation 24 heures avec de l’interféron gamma pour induire l’expression de la protéine HLA-DR (condition pro-inflammatoire). Une mortalité endothéliale serait prédictive de la survenue de vascularites in vivo. La cytotoxicité sur les cellules HUVEC a été évaluée en effet direct ou en présence de cellules (PBMCs) de patients atteints de LLC et de leur sérum respectif pour mimer les conditions physiologiques ainsi qu’une potentielle cytotoxicité indirecte. Les résultats ne montrent aucune toxicité de l’IgM anti-HLA- DR vis-à-vis des cellules endothéliales [Fig. 13a], ni d’induction de stress oxydatif dans les cellules endothéliales (données non représentées), que ce soit en présence ou non de PBMCs de patients atteints de LLC. La toxicité sur la lignée EA.hy926, protéine HLA-DR induite par lïnterféron-gamma, a été évaluée en sérum humain après 24 heures de traitement avec les anticorps anti-HLA-DR IgM. L’anticorps anti-HLA-DR IgG L243 a été utilisé comme contrôle commercial et I H2O2 comme contrôle positif de mort cellulaire. Les résultats ne montrent pas de toxicité de nos anticorps IgM anti-HLA-DR, pentamérique et hexamérique, avec un métabolisme mitochondriale fonctionnel, identique à la condition contrôle [Fig. 13b]. L’IgG anti-HLA-DR, le L243, montre une augmentation significative de l’activité mitochondriale (**p= 0.003), non retrouvée avec les IgM anti-HLA-DR.
- Comparaison de l’effet biologique des combinaisons IgG/lgM sur des cellules de lymphomes. Afin d’évaluer la toxicité des AcMs dans un autre modèle d’évolution maligne B, la bioactivité a été testée sur des cellules de patients atteints de lymphomes non hodgkiniens B (LNH-B) : lymphomes de la zone marginale (LZM) et lymphome du manteau (LM) [Fig. 14a]. La lignée cellulaire Raji a été utilisée comme modèle d’étude du lymphome de Burkitt en
culture 3D sphéroïde [Fig. 14b] et [Fig. 14c]. Sur PBMCs de LNH-B (LZM et LM), la combinaison de I’IgGI anti-CD20 OBZ avec l’anti-HLA-DR IgM majore l’effet de l’OBZ sur la réduction du % de cible tumorale B ainsi que sur la mortalité lymphocytaire B des cellules restantes, ceci après un temps court d’exposition soit 4 heures de traitement. (LZM n=2 et LM n=1 ). Ces deux lymphomes présentent une sensibilité similaire aux traitements IgG/IgM. L’évaluation des combinaisons IgG/lgM dans le modèle sphéroïde Raji après 4 jours de traitement a été réalisée en absence ou présence de lymphocytes T d’un donneur sain pour évaluer l’effet médié par les effecteurs cellulaire (ADCC) et l’effet direct. L’acquisition a été réalisée avec le module sphéroïde de l’Incucyte™ en mesurant la surface des sphéroïdes ainsi que la surface de cellules morte (CytotoxGreen positives). Les résultats montrent une réduction globale de la taille des sphéroïdes après traitement, avec une réduction maximale observée dans la condition combinant OBZ/lgM hexamérique, en présence de lymphocytes T [Fig14. b] et [Fig 14. c]. Pour estimer plus précisément la viabilité cellulaire, la MRD (Maladie Résiduelle Détectable) a été déterminée comme étant la surface représentant les cellules vivantes au sein de chaque sphéroïde (pm2). Les analyses révèlent que le traitement avec OBZ seul entraîne déjà une réduction de la MRD, indiquant une perte de viabilité. Cette diminution est fortement accentuée par la combinaison synergique avec l’IgM hexamérique. La présence des LT renforce encore davantage cet effet, traduisant une implication de l’immunité cellulaire lymphocytaire T dans la bioactivité anti-lymphocytaire B observée. Les images [Fig 14. c] des sphéroïdes à J4 de traitement permettent à la fois d’observer la diminution de la taille des sphéroïdes ainsi que l’observation de la MRD, représentée par la surface de couleur blanche. Les valeurs correspondantes sont reportées en dessous des images avec une diminution de 3,7.106 pm2 dans le contrôle à 0.27.106 pm2 en présence de OBZ/lgM + LT. L’apport des LT permet de diminuer de 0,43.106 pm2 la MRD de l’OBZ /IgM. On observe également la présence d’un noyau central de cellules mortes, résultant d'une nécrose spontanée.
Liste des références
1. Measurable residual disease in chronic lymphocytic leukemia. Benintende G, Pozzo F, Innocenti I, Autore F, Fresa A, D'Arena G, Gattei V, Lurenti L. Front Oncol. 2023 Feb 14;13:1112616.
2. Measurable residual disease in chronic lymphocytic leukemia: expert review and consensus recommendations. Wierda WG, Rawstron A, Cymbalista F, Badoux X, Rossi D, Brown JR, Egle A, Abello V, Cervera Ceballos E, Herishanu Y, Mulligan SP, Niemann CU, Diong CP, Soysal T, Suzuki R, Tran HTT, Wu SJ, Owen C, Stilgenbauer S, Ghia P, Hillmen P. Leukemia. 2021 Nov;35(11 ):3059- 3072. Jun 24.
Pavlasova, G. & Mraz, M. The regulation and function of CD20: an ‘enigma’ of B- cell biology and targeted therapy. Haematologica 105, 1494-1506 (2020).
3. Chronic Lymphocytic Leukemia Therapy Guided by Measurable Residual Disease. Munir T, Cairns DA, Bloor A, Allsup D, Cwynarski K, Pettitt A, Paneesha S, Fox CP, Eyre TA, Forconi F, Elmusharaf N, Kennedy B, Gribben J, Pemberton N, Sheehy O, Preston G, Schuh A, Walewska R, Duley L, Howard D, Hockaday A, Jackson S, Greatorex N, Girvan S, Bell S, Brown JM, Webster N, Dalal S, de Tute R, Rawstron A, Patten PEM, Hillmen P; National Cancer Research Institute Chronic Lymphocytic Leukemia Subgroup. N Engl J Med. 2024 Jan 25;390(4):326-337.
4. Pierpont, T. M., Limper, C. B. & Richards, K. L. Past, Present, and Future of Rituximab-The World’s First Oncology Monoclonal Antibody Therapy. Front Oncol 8, 163 (2018).
5. Freeman, C. L. & Sehn, L. H. A tale of two antibodies: obinutuzumab versus rituximab. Br J Haematol 182, 29-45 (2018).
6. Goede, V., Klein, C. & Stilgenbauer, S. Obinutuzumab (GA101 ) for the treatment of chronic lymphocytic leukemia and other B-cell non-hodgkin’s lymphomas: a glycoengineered type II CD20 antibody. Oncol Res Treat 38, 185— 192 (2015).
7. Tobinai, K., Klein, C., Oya, N. & Fingerle-Rowson, G. A Review of Obinutuzumab (GA101 ), a Novel Type II Anti-CD20 Monoclonal Antibody, for the Treatment of Patients with B-Cell Malignancies. Adv Ther34, 324-356 (2017).
8. Al-Sawaf, O. et al. Obinutuzumab in chronic lymphocytic leukemia: design, development and place in therapy. Drug Des Devel Ther 11 , 295-304 (2017).
9. Rituximab and obinutuzumab differentially hijack the B cell receptor and NOTCH1 signaling pathways. Edelmann J, Dokal AD, Vilventhraraja E, Holzmann K, Britton D, Klymenko T, Dôhner H, Cragg M, Braun A, Outillas P, Gribben JG. iScience. 2021 Jan 22;24(2): 102089.
10. Combination therapy with the type II anti-CD20 antibody obinutuzumab. Klein C, Bacac M, Umana P, Fingerle-Rowson G. Expert Opin Investig Drugs. 2017 Oct;26(10):1145-1162.
11. Guettinger, Y. et al. A recombinant bispecific single-chain fragment variable specific for HLA class II and Fc alpha RI (CD89) recruits polymorphonuclear neutrophils for efficient lysis of malignant B lymphoid cells. J Immunol 184, 1210— 1217 (2010).
12. Kretschmer, A., Schwanbeck, R., Valerius, T. & Rosner, T. Antibody Isotypes for Tumor Immunotherapy. Transfus Med Hemother 44, 320-326 (2017).
13. Samsudin, F., Yeo, J. Y., Gan, S. K.-E. & Bond, P. J. Not all therapeutic antibody isotypes are equal: the case of IgM versus IgG in Pertuzumab and Trastuzumab. Chem. Sci. 11 , 2843-2854 (2020).
14. Pan, S., Manabe, N. & Yamaguchi, Y. 3D Structures of IgA, IgM, and Components. Int J Mol Sci 22, 12776 (2021 ).
15. Keyt, B. A., Baliga, R., Sinclair, A. M., Carroll, S. F. & Peterson, M. S. Structure, Function, and Therapeutic Use of IgM Antibodies. Antibodies (Basel) 9, E53 (2020).
16. Chronic lymphocytic leukaemia: ESMO Clinical Practice Guidelines for diagnosis, treatment and follow-up. Eichhorst B, Robak T, Montserrat E, Ghia P, Niemann CU, Kater AP, Gregor M, Cymbalista F, Buske C, Hillmen P, Hallek M, Mey U; ESMO Guidelines Committee. Ann Oncol. 2021 Jan;32(1 ):23-33. 2020 Oct 19.
17. Blinatumomab: a CD19/CD3 bispecific T cell engager (BiTE) with unique antitumor efficacy. Goebeler ME, Bargou R. Leuk Lymphoma. 2016 May;57(5):1021- 32. 2016 Apr 6.
18. Blinatumomab for minimal residual disease in adults with B-cell precursor acute lymphoblastic leukemia. Gôkbuget N, Dombret H, Bonifacio M, Reichle A, Graux C, Faul C, Diedrich H, Topp MS, Brüggemann M, Horst HA, Havelange V, Stieglmaier J, Wessels H, Haddad V, Benjamin JE, Zugmaier G, Nagorsen D, Bargou RC. Blood. 2018 Apr 5;131 (14):1522-1531 . 2018 Jan 22.
19. Blinatumomab for minimal residual disease in adults with B-cell precursor acute lymphoblastic leukemia. Gôkbuget N, Dombret H, Bonifacio M, Reichle A, Graux C, Faul C, Diedrich H, Topp MS, Brüggemann M, Horst HA, Havelange V, Stieglmaier J, Wessels H, Haddad V, Benjamin JE, Zugmaier G, Nagorsen D, Bargou RC. Blood. 2018 Apr 5;131 (14):1522-1531 . 2018 Jan 22.
20. Epcoritamab, a Novel, Subcutaneous CD3xCD20 Bispecific T-Cell-Engaging Antibody, in Relapsed or Refractory Large B-Cell Lymphoma: Dose Expansion in a Phase l/ll Trial. Catherine Thieblemont et al. J Clin Oncol 2023 Apr 20; 41 (12): 2238-2247.
21. Glofitamab: First Approval. Shirley M. Drugs. 2023 Jul;83(10):935-941 .
22. Glofitamab for Relapsed or Refractory Diffuse Large B-cell Lymphoma. Dickinson MJ, Carlo-Stella C, Morschhauser F, Bachy E, Corradini P, Iacoboni G, Khan C, Wrobel T, Offner F, Trnënÿ M, Wu SJ, Cartron G, Hertzberg M, Sureda A, Perez-Callejo D, Lundberg L, Relf J, Dixon M, Clark E, Humphrey K, Hutchings M.N Engl J Med. 2022 Dec 15;387(24):2220-2231 . 2022 Dec 11.
23. Demande internationale WO2010145895
24. Juliant, S., Lévêque,M., Cerutti, P., Ozil, A., Choblet, S., Violet, M-L, Slomianny, M-C, Harduin-Lepers, A., Cerutti M. Engineering the baculovirus genome to produce galactosylated antibodies in lepidopteran cells. Methods Mol Biol. 988, 59-77 (2013)
25. Demande internationale WO2019/081858
27. The humanized anti-HLA-DR moAb, IMMU-114, depletes APCs and reduces alloreactive T cells: implications for preventing GVHD. Chen X, Chang CH, Stein
R, Goldenberg DM. Bone Marrow Transplant. 2012 Jul;47(7):967-80. 2011 Oct 24.
28. Anti-class ll-DR humanized monoclonal antibody, IMMU-114, blocks allogeneic immune response. Park KH, Sawada T, Murakami T, Ishii Y, Yasuo M, Fuchinoue S, Goldenberg DM, Kubota K.Am J Surg. 2012 Oct;204(4):527-34. 2012 Jun 1
29. Therapy of B-cell malignancies by anti-HLA-DR humanized monoclonal antibody, IMMll-114, is mediated through hyperactivation of ERK and JNK MAP kinase signaling pathways. Stein R, Gupta P, Chen X, Cardillo TM, Furman RR, Chen S, Chang CH, Goldenberg DM. Blood. 2010 Jun 24;115(25):5180-90. 2010 Jan 25.
30. Anti-human leukocyte antigen-DR (MHC class II) humanized monoclonal antibody, IMMU-114, suppresses human to bovine cellular responses. Park KH, Sawada T, Murakami T, Ishii Y, Yasuo M, Urakawa M, Aoyagi Y, Fuchinoue S, Kubota K.J Surg Res. 2012 Nov;178(1 ):472-7. 2012 Apr 2.
31 . Characterization of a humanized lgG4 anti-HLA-DR monoclonal antibody that lacks effector cell functions but retains direct antilymphoma activity and increases the potency of rituximab. Stein R, Qu Z, Chen S, Solis D, Hansen HJ, Goldenberg DM. Blood. 2006 Oct 15;108(8):2736-44. 2006 Jun 15.
32. A bispecific antibody-IFNalpha2b immunocytokine targeting CD20 and HLA- DR is highly toxic to human lymphoma and multiple myeloma cells. Rossi EA, Rossi DL, Stein R, Goldenberg DM, Chang CH. Cancer Res. 2010 Oct 1 ;70(19):7600-9. 2010 Sep 28.
33. Evaluation of anti-human leukocyte antigen-DR monoclonal antibody therapy in spontaneous canine lymphoma. Stein R, Balkman C, Chen S, Rassnick K, McEntee M, Page R, Goldenberg DM.Leuk Lymphoma. 2011 Feb;52(2):273-84. 2010 Dec 6.
34. IMMU-140, a Novel SN-38 Antibody-Drug Conjugate Targeting HLA-DR, Mediates Dual Cytotoxic Effects in Hematologic Cancers and Malignant Melanoma. Cardillo TM, Govindan SV, Zalath MB, Rossi DL, Wang Y, Chang CH, Goldenberg DM. Mol Cancer Ther. 2018 Jan;17(1 ):150-160. Nov 13.
35. Funakoshi, K. et al. Highly sensitive and specific Alu-based quantification of human cells among rodent cells. Sci. Rep. 7, 13202 (2017).
36. Prigent, J. et al. Human Progenitor Cell Quantification After Xenotransplantation in Rat and Mouse Models by a Sensitive qPCR Assay. Cell Transplant. 24, 1639-1652 (2015).
37. Granziero, L. et al. Survivin is expressed on CD40 stimulation and interfaces proliferation and apoptosis in B-cell chronic lymphocytic leukemia. Blood. 97(9), 2777-2783 (2001 ).
Claims
REVENDICATIONS
1 ) Anticorps monoclonal d’isotype IgM anti-HLA-DR.
2) Anticorps monoclonal d’isotype IgM anti-HLA-DR selon la revendication 1 , où ledit anticorps est sous forme pentamérique ou hexamérique.
3) Anticorps monoclonal d’isotype IgM anti-HLA-DR selon la revendication 1 ou 2, où ledit anticorps potentialise l’activité d’anticorps monoclonaux d’isotype lgG1 anti-CD20 et/ou d’isotype IgM anti-CD20.
4) Composition pharmaceutique comprenant l’anticorps monoclonal d’isotype IgM anti-HLA-DR selon l’une quelconque des revendications 1 à 3, au moins un anticorps monoclonal d’isotype IgG 1 anti-CD20 et/ou au moins un anticorps monoclonal d’isotype IgM anti-CD20, et un excipient pharmaceutiquement acceptable.
5) Composition pharmaceutique selon la revendication 4, où ledit au moins un anticorps monoclonal d’isotype IgG 1 est un anti-CD20 de type I.
6) Composition pharmaceutique selon la revendication 4, où ledit au moins un anticorps monoclonal d’isotype IgG 1 est un anti-CD20 de type II.
7) Anticorps monoclonal d’isotype IgM anti-HLA-DR selon l’une quelconque des revendications 1 à 3 ou composition pharmaceutique selon l’une quelconque des revendications 4 à 6, pour une utilisation comme médicament.
8) Anticorps monoclonal d’isotype IgM anti-HLA-DR selon l’une quelconque des revendications 1 à 3 ou composition pharmaceutique selon l’une quelconque des revendications 4 à 6, pour une utilisation dans le traitement d’un lymphome.
9) Anticorps monoclonal d’isotype IgM anti-HLA-DR selon l’une quelconque des revendications 1 à 3 ou composition pharmaceutique selon l’une quelconque des revendications 4 à 6, pour une utilisation selon la revendication 8, où le lymphome est choisi parmi les hémopathies lymphoïdes malignes B, le lymphome non-hodgkinien de phénotype B, la leucémie lymphoïde chronique (LLC).
Applications Claiming Priority (2)
| Application Number | Priority Date | Filing Date | Title |
|---|---|---|---|
| FR2406049A FR3163070A1 (fr) | 2024-06-07 | 2024-06-07 | NOUVEL ANTICORPS MONOCLONAL D’ISOTYPE IgM ANTI-HLA-DR POTENTIALISANT L’ACTIVITE D’ANTICORPS D’ISOTYPE IgG1 OU IgM ANTI-CD20 |
| FRFR2406049 | 2024-06-07 |
Publications (1)
| Publication Number | Publication Date |
|---|---|
| WO2025253079A1 true WO2025253079A1 (fr) | 2025-12-11 |
Family
ID=92926241
Family Applications (1)
| Application Number | Title | Priority Date | Filing Date |
|---|---|---|---|
| PCT/FR2025/050510 Pending WO2025253079A1 (fr) | 2024-06-07 | 2025-06-06 | Anticorps monoclonal d'isotype igm anti-hla-dr potentialisant l'activite d'anticorps d'isotype igg1 ou igm anti-cd20 |
Country Status (2)
| Country | Link |
|---|---|
| FR (1) | FR3163070A1 (fr) |
| WO (1) | WO2025253079A1 (fr) |
Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100196266A1 (en) * | 2005-03-03 | 2010-08-05 | Immunomedics, Inc. | Humanized Anti-HLA-DR Antibodies |
| WO2010145895A1 (fr) | 2009-05-14 | 2010-12-23 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Compositions contenant des anticorps pour traiter des maladies associées à cd5+ hla-dr+ b ou aux lymphocytes t |
| WO2019081858A1 (fr) | 2017-10-25 | 2019-05-02 | Centre National De La Recherche Scientifique (Cnrs) | Système d'expression baculovirus |
-
2024
- 2024-06-07 FR FR2406049A patent/FR3163070A1/fr active Pending
-
2025
- 2025-06-06 WO PCT/FR2025/050510 patent/WO2025253079A1/fr active Pending
Patent Citations (3)
| Publication number | Priority date | Publication date | Assignee | Title |
|---|---|---|---|---|
| US20100196266A1 (en) * | 2005-03-03 | 2010-08-05 | Immunomedics, Inc. | Humanized Anti-HLA-DR Antibodies |
| WO2010145895A1 (fr) | 2009-05-14 | 2010-12-23 | Institut National De La Sante Et De La Recherche Medicale (Inserm) | Compositions contenant des anticorps pour traiter des maladies associées à cd5+ hla-dr+ b ou aux lymphocytes t |
| WO2019081858A1 (fr) | 2017-10-25 | 2019-05-02 | Centre National De La Recherche Scientifique (Cnrs) | Système d'expression baculovirus |
Non-Patent Citations (44)
| Title |
|---|
| "UNIPROT", Database accession no. P01911 |
| AL-SAWAF, O. ET AL.: "Obinutuzumab in chronic lymphocytic leukemia: design, development and place in therapy", DRUG DES DEVEL THER, vol. 11, 2017, pages 295 - 304 |
| BENINTENDE GPOZZO FINNOCENTI IAUTORE FFRESA AD'ARENA GGATTEI VLURENTI L, FRONT ONCOL, vol. 13, 14 February 2023 (2023-02-14), pages 1112616 |
| CARDILLO TMGOVINDAN SVZALATH MBROSSI DLWANG YCHANG CHGOLDENBERG DM, MOL CANCER THER, vol. 17, no. 1, January 2018 (2018-01-01), pages 150 - 160 |
| CATHERINE THIEBLEMONT ET AL., J CLIN ONCOL, vol. 41, no. 12, 20 April 2023 (2023-04-20), pages 2238 - 2247 |
| CHEN X, CHANG CH, STEIN R, GOLDENBERG DM., BONE MARROW TRANSPLANT., vol. 47, no. 7, 24 October 2011 (2011-10-24), pages 967 - 80 |
| DICKINSON MJCARLO-STELLA CMORSCHHAUSER FBACHY ECORRADINI PLACOBONI GKHAN CWRÔBEL TOFFNER FTRNENY M, N ENGL J MED, vol. 387, no. 24, 11 December 2022 (2022-12-11), pages 2220 - 2231 |
| EDELMANN JDOKAL ADVILVENTHRARAJA EHOLZMANN KBRITTON DKLYMENKO TDÔHNER HCRAGG MBRAUN ACUTILLAS P, ISCIENCE, vol. 24, no. 2, 22 January 2021 (2021-01-22), pages 102089 |
| EICHHORST BROBAK TMONTSERRAT EGHIA PNIEMANN CUKATER APGREGOR MCYMBALISTA FBUSKE CHILLMEN P: "ESMO Guidelines Committee", ANN ONCOL, vol. 32, no. 1, 19 October 2020 (2020-10-19), pages 23 - 33 |
| FIRST APPROVAL, SHIRLEY M.DRUGS, vol. 83, no. 10, July 2023 (2023-07-01), pages 935 - 941 |
| FREEMAN, C. L.SEHN, L. H.: "A tale of two antibodies: obinutuzumab versus rituximab", BR J HAEMATOI, vol. 182, 2018, pages 29 - 45, XP071110328, DOI: 10.1111/bjh.15232 |
| FUNAKOSHI ET AL.: "Pour l'extraction d'ADN cent microlitres d'organe homogénéisé dans du PBS ont été utilisés", LE KIT BIOSPRINT 15 DNA BLOOD & TISSUE DE QIAGEN, 2017 |
| FUNAKOSHI, K. ET AL.: "Highly sensitive and specific Alu-based quantification of human cells among rodent cells", SCI. REP, vol. 7, 2017, pages 13202, XP055510120, DOI: 10.1038/s41598-017-13402-3 |
| GOEBELER MEBARGOU R, LEUK LYMPHOMA, vol. 57, no. 5, 6 April 2016 (2016-04-06), pages 1021 - 32 |
| GOEDE, V.KLEIN, C.STILGENBAUER, S.: "Obinutuzumab (GA101) for the treatment of chronic lymphocytic leukemia and other B-cell non-hodgkin's lymphomas: a glycoengineered type Il CD20 antibody", ONCOLRES TREAT, vol. 38, 2015, pages 185 - 192, XP055939561, DOI: 10.1159/000381524 |
| GÔKBUGET NDOMBRET HBONIFACIO MREICHLE AGRAUX CFAUL CDIEDRICH HTOPP MSBRÜGGEMANN MHORST HA, BLOOD, vol. 131, no. 14, 22 January 2018 (2018-01-22), pages 1522 - 1531 |
| GRANZIERO, L. ET AL.: "Survivin is expressed on CD40 stimulation and interfaces proliferation and apoptosis in B-cell chronic lymphocytic leukemia", BLOOD, vol. 97, no. 9, 2001, pages 2777 - 2783 |
| GUETTINGER, Y. ET AL.: "A recombinant bispecific single-chain fragment variable specific for HLA class Il and Fc alpha RI (CD89) recruits polymorphonuclear neutrophils for efficient lysis of malignant B lymphoid cells", J IMMUNOL, vol. 184, 2010, pages 1210 - 1217, XP055205593, DOI: 10.4049/jimmunol.0902033 |
| IVANOV ANDREI ET AL: "Monoclonal antibodies directed to CD20 and HLA-DR can elicit homotypic adhesion followed by lysosome-mediated cell death in human lymphoma and leukemia cells", JOURNAL OF CLINICAL INVESTIGATION, vol. 119, no. 8, 1 January 2009 (2009-01-01), pages 2143 - 2159, XP093216548, ISSN: 0021-9738, DOI: 10.1172/JCI37884 * |
| JULIANT, S.LÉVÊQUE,M.CERUTTI, P.OZIL, ACHOBLET, S.VIOLET, M-LSLOMIANNY, M-CHARDUIN-LEPERS, A.CERUTTI M.: "Engineering the baculovirus genome to produce galactosylated antibodies in lepidopteran cells", METHODS MOL BIOL, vol. 988, 2013, pages 59 - 77 |
| KALLOLIMATH SOMANATH ET AL: "Glyco engineered pentameric SARS-CoV-2 IgMs show superior activities compared to IgG1 orthologues", vol. 14, 8 June 2023 (2023-06-08), Lausanne, CH, XP093244043, ISSN: 1664-3224, Retrieved from the Internet <URL:https://pmc.ncbi.nlm.nih.gov/articles/PMC10285447/pdf/fimmu-14-1147960.pdf> DOI: 10.3389/fimmu.2023.1147960 * |
| KANAYAMA NAOKI KIMI ET AL: "Generation of IgM and IgGl monoclonal antibodies with identical variable regions: comparison of avidity", MEMOIRS OF THE FACULTY OF ENGINEERING, OKAYAMA UNIVERSITY, 1 March 2004 (2004-03-01), pages 91 - 96, XP093244060, Retrieved from the Internet <URL:https://ousar.lib.okayama-u.ac.jp/files/public/4/46955/20160528075837302815/mfe_38_1-2_091_096.pdf> DOI: 10.18926/46955 * |
| KEYT, B. A.BALIGA, R.SINCLAIR, A. M.CARROLL, S. F.PETERSON, M. S.: "Structure, Function, and Therapeutic Use of IgM Antibodies", ANTIBODIES, vol. 9, 2020, pages 53 |
| KLEIN CBACAC MUMANA PFINGERLE-ROWSON G, EXPERT OPIN INVESTIG DRUGS, vol. 26, no. 10, October 2017 (2017-10-01), pages 1145 - 1162 |
| KRETSCHMER, A.SCHWANBECK, R.VALERIUS, T.RÔSNER, T.: "Antibody Isotypes for Tumor Immunotherapy", TRANSFUS MED HEMOTHER, vol. 44, 2017, pages 320 - 326, XP055894976, DOI: 10.1159/000479240 |
| LAW ERIC CHUN ET AL: "IgM Antibodies Can Access Cryptic Antigens Denied to IgG: Hypothesis on Novel Binding Mechanism", vol. 10, 2 August 2019 (2019-08-02), Lausanne, CH, XP093244052, ISSN: 1664-3224, Retrieved from the Internet <URL:https://www.frontiersin.org/journals/immunology/articles/10.3389/fimmu.2019.01820/full> DOI: 10.3389/fimmu.2019.01820 * |
| LEI ZHAO ET AL: "Combating non-Hodgkin lymphoma by targeting both CD20 and HLA-DR through CD20-243 CrossMab", MABS, LANDES BIOSCIENCE, US, 26 March 2014 (2014-03-26), pages 739 - 747, XP009181694, ISSN: 1942-0862, DOI: 10.4161/MABS.28613 * |
| MUNIR TCAIRNS DABLOOR AALLSUP DCWYNARSKI KPETTITT APANEESHA SFOX CPEYRE TAFORCONI F: "National Cancer Research Institute Chronic Lymphocytic Leukemia Subgroup", N ENGL J MED, vol. 390, no. 4, 25 January 2024 (2024-01-25), pages 326 - 337 |
| PAN, S.MANABE, N.YAMAGUCHI, Y.: "3D Structures of IgA, IgM, and Components", INT J MOL SCI, vol. 22, 2021, pages 12776 |
| PARK KHSAWADA TMURAKAMI TISHII YYASUO MFUCHINOUE SGOLDENBERG DMKUBOTA K, AM J SURG, vol. 204, no. 4, 1 June 2012 (2012-06-01), pages 527 - 34 |
| PARK KHSAWADA TMURAKAMI TISHII YYASUO MURAKAWA MAOYAGI YFUCHINOUE SKUBOTA K, J SURG RES, vol. 178, no. 1, 2 April 2012 (2012-04-02), pages 472 - 7 |
| PAVLASOVA, G.MRAZ, M.: "The regulation and function of CD20: an 'enigma' of B-cell biology and targeted therapy", HAEMATOLOGICA, vol. 105, 2020, pages 1494 - 1506 |
| PIERPONT, T. M.LIMPER, C. B.RICHARDS, K. L. PAST: "Present, and Future of Rituximab-The World's First Oncology Monoclonal Antibody Therapy", FRONT ONCOL8, vol. 163, 2018 |
| PRIGENT, J ET AL.: "Human Progenitor Cell Quantification After Xenotransplantation in Rat and Mouse Models by a Sensitive qPCR Assay", CELL TRANSPLANT, vol. 24, 2015, pages 1639 - 1652 |
| ROSSI EAROSSI DLSTEIN RGOLDENBERG DMCHANG CH, CANCER RES., vol. 70, no. 19, 28 September 2010 (2010-09-28), pages 7600 - 9 |
| SAMSUDIN FIRDAUS ET AL: "Not all therapeutic antibody isotypes are equal: the case of IgM versus IgG in Pertuzumab and Trastuzumab", vol. 11, no. 10, 1 January 2020 (2020-01-01), United Kingdom, pages 2843 - 2854, XP093244041, ISSN: 2041-6520, Retrieved from the Internet <URL:https://pmc.ncbi.nlm.nih.gov/articles/PMC7069520/pdf/SC-011-C9SC04722K.pdf> DOI: 10.1039/C9SC04722K * |
| SAMSUDIN, F.YEO, J. Y.GAN, S. K.-E.BOND, P. J.: "Not all therapeutic antibody isotypes are equal: the case of IgM versus IgG in Pertuzumab and Trastuzumab", CHEM. SCI., vol. 11, 2020, pages 2843 - 2854, XP093244041, DOI: 10.1039/C9SC04722K |
| STEIN RBALKMAN CCHEN SRASSNICK KMCENTEE MPAGE RGOLDENBERG DM, LEUK LYMPHOMA, vol. 52, no. 2, 6 October 2010 (2010-10-06), pages 273 - 84 |
| STEIN RGUPTA PCHEN XCARDILLO TMFURMAN RRCHEN SCHANG CHGOLDENBERG DM, BLOOD, vol. 115, no. 25, 25 January 2010 (2010-01-25), pages 5180 - 90 |
| STEIN RHONA ET AL: "Characterization of a humanized IgG4 anti-HLA-DR monoclonal antibody that lacks effector cell functions but retains direct antilymphoma activity and increases the potency of rituximab", BLOOD, AMERICAN SOCIETY OF HEMATOLOGY, US, vol. 108, no. 8, 15 October 2006 (2006-10-15), pages 2736 - 2744, XP086510570, ISSN: 0006-4971, [retrieved on 20201104], DOI: 10.1182/BLOOD-2006-04-017921 * |
| STEIN RQU ZCHEN SSOLIS DHANSEN HJGOLDENBERG DM, BLOOD, vol. 108, no. 8, 15 June 2006 (2006-06-15), pages 2736 - 44 |
| TOBIN EVAN ET AL: "Combination immunotherapy with anti-CD20 and anti-HLA-DR monoclonal antibodies induces synergistic anti-lymphoma effects in human lymphoma cell lines", LEUKEMIA & LYMPHOMA, TAYLOR & FRANCIS, vol. 48, no. 5, 1 January 2007 (2007-01-01), pages 944 - 956, XP008093367, ISSN: 1042-8194, DOI: 10.1080/10428190701272272 * |
| TOBINAI, K.KLEIN, C.OYA, N.FINGERLE-ROWSON, G. A: "Review of Obinutuzumab (GA101), a Novel Type Il Anti-CD20 Monoclonal Antibody, for the Treatment of Patients with B-Cell Malignancies", ADV THER, vol. 34, 2017, pages 324 - 356, XP055538736, DOI: 10.1007/s12325-016-0451-1 |
| WIERDA WGRAWSTRON ACYMBALISTA FBADOUX XROSSI DBROWN JREGLE AABELLO VCERVERA CEBALLOS EHERISHANU Y, LEUKEMIA, vol. 35, no. 11, November 2021 (2021-11-01), pages 3059 - 3072 |
Also Published As
| Publication number | Publication date |
|---|---|
| FR3163070A1 (fr) | 2025-12-12 |
Similar Documents
| Publication | Publication Date | Title |
|---|---|---|
| US11717539B2 (en) | Combination immune therapy and cytokine control therapy for cancer treatment | |
| US11963980B2 (en) | Activated CD26-high immune cells and CD26-negative immune cells and uses thereof | |
| US20250090560A1 (en) | T cell receptors for immunotherapy | |
| US11684657B2 (en) | HLA-restricted VGLL1 peptides and use thereof in promoting an immune response in a subject | |
| CN112292140B (zh) | 靶向cd37和cd19的嵌合抗原受体 | |
| JP2022522775A (ja) | Lilrb4結合抗体およびその使用方法 | |
| TW202345901A (zh) | 用於治療結腸直腸癌之組合療法 | |
| US20250170240A1 (en) | Modified invariant natural killer t cells expressing a chimeric antigen receptor and uses thereof | |
| US10821134B2 (en) | BK virus specific T cells | |
| US20240122986A1 (en) | Cd38-nad+ regulated metabolic axis in anti-tumor immunotherapy | |
| EP4031655A2 (fr) | Association d'une cancérothérapie et d'une thérapie de contrôle des cytokines pour le traitement du cancer | |
| WO2025253079A1 (fr) | Anticorps monoclonal d'isotype igm anti-hla-dr potentialisant l'activite d'anticorps d'isotype igg1 ou igm anti-cd20 | |
| US20250009823A1 (en) | Oncolytic virus regimens for the treatment of cancer | |
| KR20230074195A (ko) | 조혈 세포 이식 후에 혈액학적 신생물 재발의 치료 또는 예방에 사용하기 위한 mdm2 억제제 | |
| WO2011116353A2 (fr) | Procédé de régulation de la survie et de la mémoire des lymphocytes t1 auxiliaires |
Legal Events
| Date | Code | Title | Description |
|---|---|---|---|
| 121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 25732463 Country of ref document: EP Kind code of ref document: A1 |