WO2024256467A1 - Anti-npc vhh antibodies and methods for their stabilization - Google Patents

Anti-npc vhh antibodies and methods for their stabilization Download PDF

Info

Publication number
WO2024256467A1
WO2024256467A1 PCT/EP2024/066244 EP2024066244W WO2024256467A1 WO 2024256467 A1 WO2024256467 A1 WO 2024256467A1 EP 2024066244 W EP2024066244 W EP 2024066244W WO 2024256467 A1 WO2024256467 A1 WO 2024256467A1
Authority
WO
WIPO (PCT)
Prior art keywords
vhh
vhh antibody
antibody
sequence
npc
Prior art date
Legal status (The legal status is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the status listed.)
Ceased
Application number
PCT/EP2024/066244
Other languages
French (fr)
Inventor
Kathrin GREGOR
Mireia SOLÀ COLOM
Trevor HUYTON
Dirk GÖRLICH
Current Assignee (The listed assignees may be inaccurate. Google has not performed a legal analysis and makes no representation or warranty as to the accuracy of the list.)
Max Planck Gesellschaft zur Foerderung der Wissenschaften eV
Original Assignee
Max Planck Gesellschaft zur Foerderung der Wissenschaften eV
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by Max Planck Gesellschaft zur Foerderung der Wissenschaften eV filed Critical Max Planck Gesellschaft zur Foerderung der Wissenschaften eV
Priority to EP24731389.3A priority Critical patent/EP4727968A1/en
Priority to IL325224A priority patent/IL325224A/en
Publication of WO2024256467A1 publication Critical patent/WO2024256467A1/en
Anticipated expiration legal-status Critical
Ceased legal-status Critical Current

Links

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IG], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/20Immunoglobulins specific features characterized by taxonomic origin
    • C07K2317/22Immunoglobulins specific features characterized by taxonomic origin from camelids, e.g. camel, llama or dromedary
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K2317/00Immunoglobulins specific features
    • C07K2317/50Immunoglobulins specific features characterized by immunoglobulin fragments
    • C07K2317/56Immunoglobulins specific features characterized by immunoglobulin fragments variable (Fv) region, i.e. VH and/or VL
    • C07K2317/569Single domain, e.g. dAb, sdAb, VHH, VNAR or nanobody®

Definitions

  • the present invention relates to VHH antibodies that specifically bind to components of nuclear pore complexes of human cells and other species. Further, the present invention relates to the labelling of VHH antibodies through maleimide chemistry and ectopic cysteine residues. Further, the present invention relates to a method for forming a stabilizing, structural disulfide bond in VHH antibodies that were initially reduced and labelled through ectopic cysteines.
  • VHH antibodies are isolated antigen-binding domains of camelid heavy-chain-only antibodies (Hamers-Casterman et al., 1993; Muyldermans, 2013). They are straightforward to obtain by immunizing a camelid, such as an alpaca, with an antigen of choice, preparing an immune library, and performing phage display using the antigen again as a panning bait. Such workflow avoids the combinatorial complications typical of traditional antibodies whose paratopes are made of two different polypeptide chains.
  • VHH antibodies have found many practical applications, as crystallization chaperones, as imaging agents in immunofluorescence applications (Rothbauer et al., 2008; Pleiner ef al., 2015, 2018), or for virus-neutralization in anti-viral therapy (Guttler et al., 2021 ; Koenig et al., 2021 ).
  • VHHs are easily produced in bacteria, such as Escherichia coli, or in yeast, such as Pichia pastoris. They contain a highly conserved structural disulfide bond that is buried in their hydrophobic core and stabilizes them against denaturation (Muyldermans, 2013; Pleiner et al., 2015). This disulfide bond forms between two conserved cysteines, but only when the VHH is produced under the oxidizing conditions that prevail in a secretory compartment, such as the periplasm of E. co// or the endoplasmic reticulum of eukaryotes.
  • VHHs can recognize their antigens even when they are produced under reducing conditions in the cytoplasm, i.e. , when their structural disulfide bond has not formed and the corresponding cysteines remained in their -SH form (Pleiner et al., 2015).
  • Fluorescent VHH imaging reagents are of particular interest because their actual production does not require animals and they are fully defined by sequence. Compared to traditional stainings with primary and secondary antibodies, they allow for simplified staining workflows (with just a single incubation of the specimen) and a smaller offset (linkage error) between label and epitopes. The latter is highly relevant for super-resolution microscopy, where the linkage error becomes limiting for resolution.
  • NPCs Nuclear pore complexes
  • VHHs recognizing Xenopus (i.e., frog) NPCs. While this was straightforward because Xenopus nucleoporins are very immunogenic in camelids, their use was limited because only a few labs work with frog cells, but many more with human/ mammalian cell lines.
  • VHH antibodies showing improved binding to mammalian and other animal NPCs and indeed to cross-react from frogs to humans.
  • a first aspect of the present invention relates to an VHH antibody against a mammalian nuclear pore complex (NPC).
  • the VHH antibody is directed against a component of a mammalian NPC including Nup358, Nup133, Nup155, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer.
  • VHH antibodies comprise two structural cysteine residues capable of forming an intramolecular disulfide bond.
  • the VHH antibody comprises at least one additional solvent-accessible ectopic cysteine residue.
  • a solvent-accessible ectopic cysteine residue may be introduced in any portion of the VHH antibody that does not interfere with target-recognition, for example, in its N- and/or C-terminal region and/or in the folded part of the VHH antibody avoiding the paratope regions.
  • the VHH antibody comprises a heterologous amino acid sequence including a solvent-accessible ectopic cysteine residue at its N-terminus and/or at its C-terminus.
  • the VHH antibody carries at least one labelling agent, e.g., a fluorescent labelling agent (fluorophore) or biotin.
  • a fluorescent labelling agent fluorophore
  • biotin e.g., biotin
  • the VHH antibody carries a labelling agent attached to a solvent-accessible ectopic SH group on the VHH antibody, particularly an SH group on the N and/or C-terminus of the VHH antibody.
  • the VHH antibody is a stable, e.g., a thermostabilized VHH antibody.
  • the VHH antibody is labelled at an ectopic cysteine (e.g., through maleimide chemistry) and it comprises two structural cysteines that are quantitatively oxidized to an intramolecular disulfide bond.
  • a further aspect of the present invention relates to a set of at least two VHH antibodies each recognizing a different component of an animal NPC, particularly a vertebrate, e.g., mammalian NPC selected from the group comprising Nup358, Nup155, Nup133, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer.
  • a vertebrate e.g., mammalian NPC selected from the group comprising Nup358, Nup155, Nup133, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer.
  • a further aspect of the present invention relates to the use of the VHH antibody or the set of the VHH antibodies for imaging applications including fluorescence spectroscopy or fluorescence microscopy.
  • VHH antibodies The binding characteristics of specific VHH antibodies are shown in Table 1 : All antibodies except Nb116 are directed against components of the NPC. Nb116 is directed against the Fc portion of rabbit IgG and may serve as a secondary detection reagent.
  • VHH antibodies are shown in Table 2.
  • VHH antibodies of the present invention are antibodies recognizing Nup 133 P-propeller such as KG1 D08 (SEQ ID NO: 1 ) and KG1 C05 (SEQ ID NO: 5), variants thereof, competing antibodies and antibodies binding the same epitope as described herein.
  • VHH antibodies of the present invention are KG1 D08 (SEQ ID NO: 1 ), KG1 C05 (SEQ ID NO: 5), Re3E01 (SEQ ID NO: 21 ), xhNup358 Nb2t (SEQ ID NO: 25), xhNup93 Nb3t (SEQ ID NO: 29), xhNup35 Nb1t (SEQ ID NO: 33), Bm53C05 (SEQ ID NO: 37), KG26C08 (SEQ ID NO: 49), Nb116 (SEQ ID NO: 53), variants thereof, competing antibodies and antibodies binding the same epitope as described herein.
  • VHH antibodies without ectopic cysteines
  • CDR sequences of a given antibody molecule There are several methods known in the art for determining the CDR sequences of a given antibody molecule, but there is no standard unequivocal method. Determination of CDR sequences from antibody heavy chain variable regions can be made according to any method known in the art, including, but not limited to, the methods known as KABAT, Chothia, and IMGT.
  • a selected set of CDRs may include sequences identified by more than one method, namely, some CDR sequences may be determined using KABAT and some using IMGT, for example.
  • the CDR sequences of the VHH variable regions are determined using the KABAT methods.
  • CDRs may also be defined through a multiple alignment (with many other VHH antibodies), to identify the hot-spots of variability and relate them to a standard VHH antibody structure. It is also possible to define CDRs by analyzing the structure of the VHH antibody and deciding what is a loop and what is the antibody’s scaffold. In some cases, CDR-adjacent residues are also variable, and are therefore included in the CDR definition.
  • VHH antibody comprising two structural cysteines and optionally at least one solvent-accessible ectopic cysteine in a host cell under reducing or at least partially reducing conditions
  • thermostabilized VHH antibody wherein the two structural cysteines are quantitatively oxidized to a disulfide bond.
  • the VHH antibody comprises two structural cysteines and at least one solvent-accessible ectopic cysteine.
  • the method comprises step (iii).
  • the oxidation in step (iv) may be carried out in the presence of an oxidation agent, e.g., a disulfide compound such as glutathione disulfide (GSSG) and optionally in the presence of a protein disulfide isomerase (PDI).
  • an oxidation agent e.g., a disulfide compound such as glutathione disulfide (GSSG) and optionally in the presence of a protein disulfide isomerase (PDI).
  • GSSG glutathione disulfide
  • PDI protein disulfide isomerase
  • the oxidation comprises a treatment at an elevated temperature thereby leading to a transient at least partial thermal unfolding of the VHH antibody.
  • the VHH antibody is subjected to a treatment at a temperature which is at least as high as the onset of melting of the VHH antibody with reduced structural cysteines.
  • VHH antibody which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a).
  • VHH antibody of embodiment 1 comprising
  • VHH antibody which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a).
  • the VHH antibody of embodiment 1 or 2 comprising
  • VHH sequence which has an identity of at least 70%, at least 80%, at least 90%, at least 95% or at least 98% to a VHH sequence of (a),
  • VHH antibody which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a).
  • the VHH antibody of any one of embodiments 1 -3 comprising at least one solvent-accessible ectopic cysteine residue in its N-and/or C-terminal region, particularly at its N- and/or C-terminus and/or in its folded part avoiding the paratope regions.
  • the VHH antibody of any one of embodiments 1 -4 comprising a heterologous amino acid sequence including a solvent-accessible ectopic cysteine residue at its N-terminus and/or at its C-terminus.
  • the VHH antibody of any one of embodiments 1 -5 which carries a labelling agent, particularly a fluorescent group, biotin, a DNA oligonucleotide group, an enzyme, an electron spin resonance (EPR) probe, or a group for immobilization to a chromatographic support.
  • a labelling agent particularly a fluorescent group, biotin, a DNA oligonucleotide group, an enzyme, an electron spin resonance (EPR) probe, or a group for immobilization to a chromatographic support.
  • the VHH antibody of any one of embodiments 1 -6 which carries a labelling agent attached to a solvent-accessible ectopic SH group on the VHH antibody.
  • the VHH antibody of any one of embodiments 1 -8 which is a thermostabilized VHH antibody.
  • the VHH antibody of any one of embodiments 1 -9 which comprises two structural cysteines that are quantitatively oxidized and form an intramolecular disulfide bond.
  • the VHH antibody of any one of embodiments 1 -10 which has a crossreactivity with a homologous NPC component from Xenopus laevis.
  • NPC mammalian nuclear pore complex
  • the set of embodiment 12 which comprises a VHH antibody recognizing Nup133 [3-propeller.
  • the set of embodiment 12 or 13 wherein at least one VHH antibody comprises at least one solvent-accessible ectopic cysteine residue, particularly in its N-and/or C-terminal region and/or in its folded part avoiding the paratope regions.
  • the set of any one of embodiments 12-14 comprising at least one VHH antibody comprising:
  • VHH antibody which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a).
  • the set of any one of embodiments 12-15 comprising at least one VHH antibody comprising:
  • VHH antibody which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a).
  • the set of any one of embodiments 12-16 comprising at least one VHH antibody comprising:
  • VHH sequence which has an identity of at least 70%, at least 80%, at least 90%, at least 95% or at least 98% to a VHH sequence of (a),
  • a VHH antibody which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a).
  • the set of any one of embodiments 12-17 comprising at least one VHH antibody comprising 2, 3, 4, 5, 6 or 7 different VHH antibodies, particularly 2, 3, 4, 5, 6 or 7 different VHH antibodies as defined in any one of embodiments 13-15.
  • the set of any one of embodiments 12-18 wherein at least one VHH antibody carries a labelling agent, particularly a fluorescent group, biotin, a DNA oligonucleotide group, an enzyme, an electron spin resonance (EPR) probe, or a group for immobilization to a chromatographic support.
  • a labelling agent particularly a fluorescent group, biotin, a DNA oligonucleotide group, an enzyme, an electron spin resonance (EPR) probe, or a group for immobilization to a chromatographic support.
  • VHH antibodies carry different labelling agents, particularly different spectrally separatable fluorescent groups.
  • the set of any one of embodiments 12-22 wherein at least one VHH antibody comprises two structural cysteines that are quantitatively oxidized and form an intramolecular disulfide bond.
  • Use of the VHH antibody of any one of embodiments 1 -11 or the set of any one of embodiments 12-23 for imaging applications particularly for fluorescence spectroscopy or microscopy.
  • a method of producing a VHH antibody comprising the steps:
  • step (i) expressing a VHH antibody comprising two structural cysteines and at least one solvent-accessible ectopic cysteine in a host cell under reducing or at least partially reducing conditions, (ii) purifying the VHH antibody obtained in step (i) from the host cell or the culture medium under conditions wherein the at least one solvent- accessible ectopic cysteine is preserved in the reduced SH state;
  • step (iv) subjecting the VHH antibody obtained in step (ii) or (iii) to an oxidation that converts the two structural cysteines to a disulfide bond, and
  • thermostabilized VHH antibody wherein the two structural cysteines are quantitatively oxidized to a disulfide bond.
  • the VHH antibody comprises at least one solvent-accessible ectopic cysteine.
  • the VHH antibody comprises an solvent-accessible ectopic cysteine residue in its N-and/or C-terminal region and/or in its folded part, avoiding the paratope regions.
  • step (i) comprise expression of the VHH antibody in the cytoplasm of a prokaryotic host cell such as E.coli or a eukaryotic host cell such as a yeast, protozoan, plant, or animal cell, optionally followed by a reduction treatment.
  • a prokaryotic host cell such as E.coli
  • a eukaryotic host cell such as a yeast, protozoan, plant, or animal cell
  • step (ii) comprises a treatment with a reducing agent such as a thiol, e.g., DTT (dithiothreitol) or a phosphine, e.g., TCEP (tris(carboxyethyl)phosphine), followed by a removal of the reducing agent.
  • a reducing agent such as a thiol, e.g., DTT (dithiothreitol) or a phosphine, e.g., TCEP (tris(carboxyethyl)phosphine
  • the labelling agent is a thiol-reactive compound, e.g., an maleimide-, iodoacetamidebromoacetamide- or acrylamide-activated compound.
  • the labelling agent is a fluorophore, biotin, a DNA oligonucleotide, an enzyme, an electron spin resonance (EPR) probe, or a compound for immobilization to a chromatographic support.
  • step (iv) comprises a treatment of the VHH antibody with an oxidant.
  • oxidant is a disulfide compound particularly oxidized glutathione (GSSG).
  • GSSG oxidized glutathione
  • step (iv) is carried out in the presence of a protein disulfide isomerase (PDI), particularly in the presence of DsbA and/or DsbC from E. coli.
  • PDI protein disulfide isomerase
  • step (iv) comprises a transient thermal unfolding of the VHH antibody.
  • the method of embodiment 38 wherein the transient thermal unfolding comprises incubating the VHH antibody at a temperature which is in the range between the onset of melting of the reduced form of the VHH antibody (with reduced structural cysteines) and the nominal melting temperature (Tm) of the reduced form of the VHH antibody.
  • a VHH antibody recognizing an Fc region of a rabbit IgG comprising:
  • VHH antibody which competes with the VHH antibody of (a) for the binding to its target antigen
  • VHH antibody which binds the same or an overlapping epitope of its target antigen as a VHH antibody of (a).
  • the VHH antibody of embodiment 40 comprising
  • VHH antibody which competes with the VHH antibody of (a) for the binding to its target antigen
  • VHH antibody which binds the same or an overlapping epitope of its target antigen as a VHH antibody of (a).
  • the VHH antibody of embodiment 40 or 41 comprising
  • VHH antibody which competes with the VHH antibody of (a) for the binding to its target antigen
  • VHH antibody which binds the same or an overlapping epitope of its target antigen as a VHH antibody of (a). 43.
  • VHH antibody of any one of embodiments 40-42 as a secondary detection reagent, particularly for the imaging of an NPC, more particularly for a use as defined in embodiment 24.
  • the inventors prepared mixes of human and Xenopus NPC antigens (Nup133, Nup358, Nup155, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer), immunized alpacas, selected VHHs by phage display, produced them by recombinant expression in the E.coli cytoplasm, and labeled them through ectopic cysteines with fluorescent dyes.
  • the VHH sequences of the antibodies are shown at the end of the description. Table 2 discloses their specificity-determining CDRs.
  • nuclei had been assembled from Xenopus sperm chromatin and Xenopus egg extract; here, three VHHs (labelled with different fluorophores) were each combined, demonstrating their utility in multi-color colocalizations.
  • Alexa488-labelled anti-Nup133 with AbberiorStar635- labelled anti-Nup358, and Alexa568-labelled anti-Nup35 to generate a three-color three-dimensional pattern by staining NPCs of HeLa cells.
  • patterns can be reproduced by standardized cell-staining protocols, they can also be used for benchmarking super-resolution fluorescence microscopes.
  • it is relevant that such patterns are generated with biologically relevant samples, which can reveal typical challenges, such as offsets between color channels due to mismatches in diffractive index within the specimen.
  • Nup358 organizes the cytoplasmic ring with 5 copies per asymmetric unit.
  • Nup133 is part of the Y-complex and forms the scaffolds of the cytoplasmic and nuclear rings.
  • Nup35 and Nup155 are two different components of the inner ring.
  • the Nup214 Nup88 Nup62 heterotrimer is located near the cytoplasmic ring.
  • Elys is part of those Y-complexes that form the outermost nuclear ring and occurs in only one copy per asymmetric unit.
  • Elys and Nup358 mark the most distant components of the (rigid) NPC scaffold (along the cytoplasmic-nuclear axis).
  • VHH antibodies their target binding can be defined with (near) atomic resolution.
  • the inventors crystallized a complex of xhNup358-Nb2t with the N-terminal domain (NTD) of Xenopus Nup358 as well as a complex of the human Nup133 [3-propeller with VHH KG1 D08 and KG1 C05. They collected x-ray diffraction data at a synchrotron source and solved the structures by molecular replacement.
  • the epitope is highly conserved between frogs and human, with only two conservative exchanges: R58K (arginine against lysine) and L87V (leucine against valine). The other 13 epitope residues are identical ( Figure 3C). This explains why this VHH cross-reacts so well between Xenopus and human RanBP2, despite the fact that the N-terminal domains share only 71 % sequence identity.
  • the Nup133 [3-propeller structures shows that the two VHH bind to distinct and nonoverlapping epitopes (Figure 4A), which is consistent with biolayer interferometry measurements indicating that the two VHH do not compete for a common binding site.
  • KG1 C05 docks with its CDR3 loop into the central cavity of the propeller.
  • KG1 D08 the so far brightest staining VHH against the Y-complex, binds to the side of the propeller.
  • Cryo-electron tomography maps of the nuclear pore complexes are meanwhile sufficiently well resolved to visualize individual protein domains (Mosalaganti et al., 2022).
  • the here disclosed crystal structures of the Nup-VHH complexes can be docked in to such cryo-EM maps to locate VHH-attached fluorophores. This in turns allows to interpret obtained fluorescence microscopic patterns with molecular precision.
  • E. coli Shuffle strain commercially available from NEB whose cytoplasm is less reducing for disulfide bonds (because of a genetic deletion of the GOR gene, which encodes the glutathione reductase or more correctly a glutathione disulfide reductase).
  • GOR gene which encodes the glutathione reductase or more correctly a glutathione disulfide reductase.
  • Such strain also expresses the PDI DsbC in the cytoplasm (Bessette et al., 1999), which in wildtype cells forms disulfide bonds in the periplasm.
  • the inventors developed, therefore, an alternative technology. They conceived a workflow that includes (i) expression of a VHH with ectopic cysteines for later labeling, under reducing (or semi-reducing) conditions for expression, (ii) VHH purification including a final reduction step to ensure an -SH state of the ectopic cysteines, (iii) modification of the ectopic (and fully exposed) cysteines with a label, e.g., a maleimide-activated label (fluorophore, biotin, DNA-oligonucleotide) while keeping the structural cysteines unmodified, (iv) a post-treatment that converts the two structural cysteines (which are buried in the hydrophobic core of the VHH) to a disulfide bond, and (v) obtaining the VHH antibody in a stable oxidized form.
  • a label e.g., a maleimide-activated label (fluorophore, biotin, DNA-oligon
  • a PDI should catalyze the disulfide bond formation; however, initial experiments showed only low efficiency and rather variable results with different VHHs.
  • the inventors reasoned that the problem might relate to the fact that the two structural cysteines are buried in the hydrophobic interior of the VHH and are thus not easily accessible for modification or enzymatic action. This burial helps to confine the fluorophore-labelling to only the engineered, ectopic cysteines. However, in the next step of the above-sketched workflow, the burial prevents the two structural cysteines also from being oxidized to a stabilizing disulfide bond. Indeed, PDIs act in vivo probably already during the translocation of the still fully unfolded VHH polypeptide through the plasma membrane (of E.
  • VHH (such as the here described anti-Nup VHHs) produced under reducing conditions is, however, a correctly folded entity, because it can bind its target perfectly well (see Pleiner et al., 2015 and below, Figure 13). Indeed, this poses the question if and how a chaperone/ folding enzyme can recognize such a reduced VHH as a folding substrate.
  • the inventors used oxidized glutathione (GSSG) as an oxidant and the three (periplasmic) PDIs from E. coli, namely DsbA, DsbC, and DsbG, as catalytic enzymes.
  • GSSG oxidized glutathione
  • PDIs from E. coli
  • DsbA, DsbC, and DsbG oxidized glutathione
  • DsbA, DsbC, and DsbG catalytic enzymes.
  • a given VHH was incubated with various combinations of GSSG and the above-mentioned enzymes. Disulfide bond formation was then assessed by non- reducing SDS PAGE, where the (more compact) disulfide-bridged form runs faster than the reduced form (see Figures 6, 7, 8, 10C, 11 , 12, 16).
  • Re9B09 an anti-SARS-CoV-2 VHH antibody (SEQ ID NO: 60) (Guttler et al., 2021 ), was a first example for a post-production disulfide-bonding (Figure 7). Incubations were performed at 37°C because this corresponds to the body temperature of alpacas (from which the VHH originated) and because this is the optimal growth temperature of E. coli and should therefore be an ideal temperature for the action of the Dsb enzymes that are of E. coli origin.
  • Re24H12 another anti-SARS-CoV-2 VHH antibody (SEQ ID NO: 61 ) showed no disulfide bond formation when tested under the same conditions (37°C), even when all three Dsb enzyme had been added. Surprisingly, however, a quantitative disulfide bond formation was observed when the treatment temperature was raised to 65°C and kept for 5 minutes (Figure 8A).
  • the optimal treatment temperature was here determined by pipetting a master mix (35 pM VHH, 2 mM GSSG, and 1.5 pM each DsbA, DsbC, and DsbG), aliquoting this to PCR tubes, incubating the 12 parallel samples in a gradient-thermocycler with end-temperatures reaching a range between 30°C and 70°C, and analyzing disulfide-bonding in each of the samples by nonreducing SDS-PAGE.
  • 65°C is a rather non-physiological temperature, lethal for either E. coli or mammalian cells, but the effective treatment at this temperature is explainable by the assumption that thermal unfolding of the VHH is the first and essential step in the reaction. Such unfolding would transiently make one of the two buried thiol groups accessible and thus allow its oxidation, through a covalent (S-S) intermediate with either a Dsb or a glutathione molecule, followed by the displacement of the enzyme/ glutathione by the thiol group of the second VHH cysteine.
  • S-S covalent
  • Thermal unfolding can be measured by differential scanning fluorimetry or DSF for short (also called thermofluor), using, e.g., SYBR orange as an indicator.
  • DSF differential scanning fluorimetry
  • SYBR orange an indicator for SYBR orange
  • Tm nominal melting temperature
  • 58°C as defined by the inflection point of the melting curve
  • the onset of unfolding is seen at ⁇ 50°C, which in turn is close to the optimal disulfide bonding temperature of 48°C in the 16 h incubation.
  • Nb116 SEQ ID NO: 53
  • a secondary VHH directed against the anti-rabbit IgG Fc fragment (Table 1 ).
  • NEB Shuffle this VHH can reach up to 50% disulfide-bonding.
  • a post-production treatment at 60°C allows for a quantitative conversion into a hyperthermostable, disulfide-bridged form.
  • the treatment strategy disclosed here allows for an excellent stabilization of fluorophore-labeled VHHs that initially had a reduced structural disulfide bond.
  • the VHH antibodies may be used for imaging applications, e.g., confocal laser scanning microscopy or stimulated emission depletion (STED) microscopy. They were found to be cross-reactive with NPCs from the frog Xenopus laevis. For staining, two or more, e.g., three VHHs labelled with different labelling agents such as fluorophores may be combined, demonstrating their utility in multi-color co-localizations.
  • imaging applications e.g., confocal laser scanning microscopy or stimulated emission depletion (STED) microscopy. They were found to be cross-reactive with NPCs from the frog Xenopus laevis.
  • two or more, e.g., three VHHs labelled with different labelling agents such as fluorophores may be combined, demonstrating their utility in multi-color co-localizations.
  • VHH antibodies are combined into sets comprising a plurality of VHH antibodies.
  • the present invention relates to a VHH antibody, which is a monovalent heavy chain- only antibody comprising a CDR1 domain, a CDR2 domain and a CDR3 domain linked by framework regions including, but not being limited to, whole VHH antibodies, e.g. native VHH antibodies comprising framework regions derived from camelids, and modified VHH antibodies comprising modified framework regions, VHH antibody fragments and VHH antibody fusion proteins, e.g. a fusion protein with an immunoglobulin or non-immunoglobulin peptide or polypeptide, as long as it shows the properties according to the invention.
  • VHH antibody which is a monovalent heavy chain- only antibody comprising a CDR1 domain, a CDR2 domain and a CDR3 domain linked by framework regions including, but not being limited to, whole VHH antibodies, e.g. native VHH antibodies comprising framework regions derived from camelids, and modified VHH antibodies comprising modified framework regions, VHH antibody fragments and VHH antibody fusion proteins, e.
  • a VHH antibody according to the present invention is characterized by (i) a CDR3 sequence, (ii) a combination of a CDR1 sequence, a CDR2 sequence, and a CDR3 sequence, (iii) by a complete VHH sequence, or (iv) by competition with a specific reference antibody.
  • Specific CDR and VHH sequences are provided in the Tables, Figures and the Sequence Listing. According to the present invention, sequences related to the above sequences are encompassed. These related sequences are defined by having a minimum identity to a specifically indicated amino acid sequence, e.g., a CDR or VHH sequence. This identity is indicated over the whole length of the respective reference sequence and may be determined by using well-known algorithms such as BLAST.
  • a related CDR3 sequence has an identity of at least 80% or at least 90% or at least 95% to a specifically indicated CDR3 sequence, e.g., a substitution of 1 , 2, or 3 amino acids.
  • a related combination of a CDR1 sequence, a CDR2 sequence, and a CDR3 sequence has an identity of at least 80% or at least 90% or at least 95% to a specifically indicated combination of a CDR1 sequence, a CDR2 sequence, and a CDR3 sequence, e.g., a substitution of 1 , 2, 3, 4, 5 or 6 amino acids by different amino acids.
  • a related VHH sequence has an identity of least 70%, at least 80%, at least 90%, at least 95% or at least 98% to a VHH sequence, e.g., a substitution of 1 , 2, 3, 4, 5 or up to 20 amino acids.
  • the invention relates to a VHH antibody recognizing Nup358 which competes with the VHH antibody xhNup358-Nb2t (SEQ. ID NO: 25) for the binding to Nup358 and/or which binds to the epitope of Xenopus Nup358 and/or human Nup358 indicated in Fig. 3C (by bold letters).
  • the invention relates to a VHH antibody recognizing Nup133 which competes with the VHH antibody KG1 C05 (SEQ. ID NO: 1 ) for the binding to Nup133 and/or which binds to the epitope of human Nup133 indicated in Fig. 4C (by bold letters).
  • the invention relates to a VHH antibody recognizing Nup133 which competes with the VHH antibody KG1 D08 (SEQ. ID NO: 5) for the binding to Nup133 and/or which binds to the epitope of human Nup133 indicated in Fig. 4C (by bold letters).
  • the present invention relates to a nucleic acid molecule, e.g., a DNA molecule, encoding a VHH as indicated above, or a vector, comprising said nucleic acid molecule as indicated above in operative linkage with an expression control sequence, particularly with a heterologous expression control sequence. Furthermore, the invention relates to a cell comprising a nucleic acid molecule or a vector as described above.
  • Vectors for the recombinant production of VHH antibodies are well-known in the art.
  • the vector is an extrachromosomal vector.
  • the vector is a vector for genomic integration.
  • the cell may be a known host cell for producing antibodies or antibody fragments, e.g., a prokaryotic cell such as an E. coli or a Bacillus sp. cell, a yeast cell, particularly a Pichia yeast cell, an insect cell, or a mammalian cell, e.g., a CHO cell, or a plant cell.
  • a prokaryotic cell such as an E. coli or a Bacillus sp. cell
  • a yeast cell particularly a Pichia yeast cell, an insect cell, or a mammalian cell, e.g., a CHO cell, or a plant cell.
  • the cell comprises the nucleic acid or the vector extrachromosomally.
  • the cell comprises the nucleic acid or the vector integrated into the genome, e.g., as a genomically integrated expression cassette.
  • a particular aim of the invention has been to generate stable VHH antibodies useful for imaging mammalian NPCs.
  • the inventors prepared VHH antibodies specifically directed against a component of a mammalian nuclear pore complex (NPC) selected from the group comprising Nup133, Nup358, Nup155, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer.
  • the VHH antibodies are specifically directed against a component of a human nuclear pore complex (NPC) selected from the group comprising human Nup133, human Nup358, human Nup155, human Nup93, human Nup35, human Elys, and the human Nup214 Nup88 Nup62 heterotrimer.
  • the VHH antibody recognizes Nup133 [3-propeller, particularly human Nup133 [3-propeller.
  • the component of the human NPC is selected from human Nup133 (UniProt #ID: Q8WUM0), human Nup358 (UniProt #ID: P49792), human Nup155 (UniProt #ID 075694), human Nup93 (UniProt #ID: Q8N1 F7), human Nup35, (UniProt #ID:Q8NFH5), human Elys (UniProt #ID Q8WYP5), and the human Nup214 (UniProt #ID: P35658) Nup88 (UniProt #ID: Q99567) Nup62(UniProt #ID: P37198) heterotrimer.
  • the component of the human NPC is Nup133 [3-propeller.
  • VHH antibodies are disclosed herein.
  • a further aim of the invention has been to generate stable VHH antibodies against the Fc region of an antibody, e.g., a rabbit IgG antibody useful as secondary detection reagent in imaging applications.
  • an antibody e.g., a rabbit IgG antibody useful as secondary detection reagent in imaging applications.
  • VHH antibodies A specific embodiment of such VHH antibodies is disclosed herein.
  • the antibodies were produced recombinantly and modified with labelling agents, e.g., fluorophores, which were attached to solvent-accessible ectopic cysteines introduced into the antibody sequence.
  • labelling agents e.g., fluorophores
  • the term “solvent-accessible” means the cysteine is accessible to the surrounding medium and thus to the attachment of a labelling agent when the VHH antibody is in a folded state.
  • the VHH antibody comprises 1 , 2 , 3, or 4 to solvent-accessible ectopic cysteines.
  • a solvent-accessible ectopic cysteine residue may be located in the N-and/or C-terminal region and/or in the folded part of the VHH antibody, avoiding the paratope regions.
  • the VHH antibody comprises at least one heterologous cysteine-containing amino acid sequence at the N-terminus and/or at the C-terminus of the VHH sequence.
  • the heterologous cysteine-containing amino acid sequence typically has a length of up to about 20 amino acids, e.g., about 1 to about 20 amino acids, or about 4 to about 10 amino acids.
  • the heterologous amino acid sequence comprises one cysteine.
  • a cysteine present in the heterologous amino acid sequence is an ectopic cysteine, particularly a solvent-accessible ectopic cysteine.
  • the heterologous cysteine-containing amino acid sequence is flexible and/or comprises hydrophilic amino acids, e.g., amino acids selected from Gly, Ser, Thr, Gin, Asn, Glu, and Asp, particularly from Gly, Ser, Thr and Glu.
  • the VHH antibody comprises a heterologous cysteine- containing amino acid sequence at the N-terminus and a heterologous cysteine- containing amino acid sequence at the C-terminus of the VHH sequence.
  • the VHH antibody further comprises at least one heterologous tag-containing amino acid sequence, e.g., for purification.
  • the tag-containing amino acid sequence is a poly-His sequence comprising up to about 20 histidine residues or even more, e.g., a His-SUMO or a His-NEDD8 tag.
  • the tag-containing amino acid sequence is cleavable, e.g., by a protease under conditions where the residual VHH antibody remains intact.
  • the heterologous amino acid sequence comprises a heterologous tag-containing amino acid sequence, particularly a cleavable tagcontaining amino acid sequence and at least one heterologous cysteine-containing amino acid sequence.
  • the VHH antibody carries a labelling agent.
  • the labelling agent may be any compound to be known in the art for labelling, e.g., detecting and/or immobilizing a polypeptide.
  • labelling agents are fluorophores, biotin, DNA oligonucleotides, enzymes, electron spin resonance (EPR) probes, or groups for immobilization to a chromatographic support.
  • the labelling agent is preferably attached to a solvent-accessible ectopic SH group on the VHH antibody.
  • the labelling agent may be attached to the VHH antibody at as a thiol-reactive compound, e.g., an maleimide-, iodoacetamide- bromoacetamide- or acrylamide- activated compound to a solvent-accessible ectopic SH group on the VHH antibody.
  • a thiol-reactive compound e.g., an maleimide-, iodoacetamide- bromoacetamide- or acrylamide- activated compound to a solvent-accessible ectopic SH group on the VHH antibody.
  • VHH antibody has to survive long-term storage and continued use under various conditions: at 4°C, freeze-thaw cycles, changes in temperature without a loss of activity or aggregation.
  • thermostability which can be measured, e.g., by thermal shift assays or specifically by differential scanning fluorimetry.
  • the invention relates to a VHH antibody, which is stable, particularly thermostable.
  • the VHH antibody has a melting point (melting temperature) of at least about 65°C, of at least about 80°C, of at least 90°C or of at least about 95°C, and/or an aggregation temperature of at least about 50°C, of at least about 60°C, of at least 70°C or of at least about 80°C when measured under nonreducing conditions. Melting and aggregation temperatures are determined as described herein.
  • the invention relates to a stable VHH antibody that is thermostabilized which comprises two structural cysteines that are quantitatively oxidized and form an intramolecular disulfide bond.
  • the term “quantitatively” means that the oxidized form with an intramolecular disulfide bond is present in a VHH antibody preparation in an amount of at least about 85%, at least 90% or at least about 95% as measured by non-reducing gel electrophoresis, as shown in the figures.
  • the present invention relates to a set comprising at least 2, 3, 4 or more of the above VHH antibodies.
  • the individual VHH antibodies are present in suitable molar ratios.
  • the molar ratios are in the range of about 2:1 to about 1 :2, particularly about 1.5:1 to about 1 :1.5, even more particularly about 1 :1.
  • the VHH antibody set may comprise a single composition wherein the VHH antibodies in said set consist of a predetermined number of different species of VHH antibodies as described above.
  • the VHH antibody set may comprise a plurality of compositions each comprising a different species of VHH antibody as described above.
  • the set of the present invention may be free from other VHH antibodies.
  • the set of VHH antibodies comprises at least 2, e.g., 2, 3, 4, or
  • VHH antibodies each recognizing a different component of a mammalian, e.g., human nuclear pore complex (NPC) selected from the group comprising Nup133, Nup358, Nup155, Nup93, Nup35, Elys and the Nup214 Nup88 Nup62 heterotrimer.
  • NPC human nuclear pore complex
  • the set of VHH antibodies comprises at least 2, e.g., 2, 3, 4, 5,
  • VHH antibodies selected from:
  • the set comprises a VHH antibody recognizing Nup133 [3- propeller, e.g., KG1 D08 (SEQ. ID NO: 1 ) or KG1 C05 (SEQ. ID NO: 5) or a variant thereof.
  • the set comprises VHH antibodies selected from:
  • VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing Nup358, a VHH antibody recognizing Nup93, a VHH antibody recognizing Nup35; and a VHH antibody recognizing the Nup214 Nup88 Nup62 heterotrimer;
  • VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing the Nup214 Nup88 Nup62 heterotrimer, a VHH antibody recognizing Nup155 and a VHH antibody recognizing Elys;
  • VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing Nup358, and a VHH antibody recognizing Nup35;
  • VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing Nup358, a VHH antibody recognizing Nup35, a VHH antibody recognizing Nup155 and a VHH antibody recognizing Elys;
  • VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing Nup358, and a VHH antibody recognizing Nup93;
  • VHH antibody recognizing Nup133 a VHH antibody recognizing Nup358, a VHH antibody recognizing Nup93, a VHH antibody recognizing Nup155 and a VHH antibody recognizing Elys.
  • VHH antibodies in a set may be conjugated to different labelling agents, e.g., compatible fluorophores of different spectral properties such as excitation and/or emission properties. These sets may be used to generate 2D and 3D multicolor nanoscopic patterns that can be used for benchmarking super-resolution fluorescence microscopes. Alternatively, individual VHHs can also be combined when carrying the same or spectrally similar labelling agents, e.g., fluorophores, in order to obtain an additive, stronger signal.
  • labelling agents e.g., compatible fluorophores of different spectral properties such as excitation and/or emission properties.
  • the VHH antibody is recombinantly produced in a bacterium, e.g., E. coli or Bacillus.
  • expression in a bacterium may involve cytoplasmic and/or periplasmic expression and purification of the VHH antibody from the host cell, or secretory expression and purification of the VHH antibody from the culture medium.
  • the nucleic acid sequence encoding the VHH antibody is fused to at least one sequence directing the expression to the periplasm and/or into the culture medium.
  • the present invention relates to a novel method for producing a stable VHH antibody.
  • This method is not only applicable to the anti-NPC VHH antibodies as described herein but for any type of VHH antibody comprising two structural cysteines capable of forming an intramolecular disulfide bond.
  • this method is also applicable to anti-SARS-CoV2 VHH antibodies, e.g., VHH antibodies Re9B09 (SEQ ID NO: 60) and Re24H12 (SEQ ID NO: 61 ) and anti-rabbit Fc VHH antibody Nb116 (SEQ ID NO: 53) as shown in the Figures and Examples.
  • This method is specifically applicable to a VHH antibody comprising two structural cysteines and further at least one solvent-accessible ectopic cysteine as described herein.
  • the structural disulfide bond of a VHH is important for its stability and that this disulfide bond can be introduced in a workflow that includes (i) expression of a VHH antibody optionally with a solvent-accessible ectopic cysteine for later labeling, under reducing conditions, e.g., cytoplasmic expression in a normal E. coli, or semi-reducing conditions, e.g., cytoplasmic expression in E.
  • VHH purification including a final reduction step to ensure an -SH state of the ectopic cysteines, (iii) modification of the ectopic (and fully exposed) cysteines with a labelling agent, e.g., a thiol-reactive labelling agent, while keeping the structural cysteines unmodified, (iv) a post-treatment in the presence of an oxidant that converts the two structural cysteines (which are buried in the hydrophobic core of the VHH) to a disulfide bond, and (v) obtaining the resulting thermostabilized VHH antibody.
  • a labelling agent e.g., a thiol-reactive labelling agent
  • a further aspect of the invention is a novel method of producing a stable VHH antibody comprising the steps:
  • step (ii) purifying the VHH antibody obtained in step (i) from the host cell or the culture medium under conditions wherein the at least one solvent- accessible ectopic cysteine is in the reduced SH state;
  • step (iv) subjecting the VHH antibody obtained in step (ii) or (iii) to an oxidation that converts the two structural cysteines to a disulfide bond, and
  • thermostabilized and optionally labelled VHH antibody wherein the two structural cysteines are quantitatively oxidized to a disulfide bond.
  • the VHH antibody comprises a solvent-accessible ectoptic cysteine as herein described above, e.g., in its N-and/or C-terminal region and/or in its folded part, avoiding the paratope regions.
  • the VHH antibody further comprises at least one heterologous tag-containing amino acid sequence as herein described above.
  • the antibody expression in the host cell according to step (i) is carried out under reducing or at least partially reducing conditions. These conditions may comprise expression of the VHH antibody in the cytoplasm of a prokaryotic host cell such as E.coli or a eukaryotic host cell such as a yeast, protozoan, or animal cell optionally followed by a reduction.
  • a prokaryotic host cell such as E.coli
  • a eukaryotic host cell such as a yeast, protozoan, or animal cell optionally followed by a reduction.
  • the labelling agent is a fluorophore, biotin, a DNA oligoucleotide or another labelling agent as herein desscribed above.
  • the labelling agent is a thiol-reactive compound as herein described above, e.g., a maleimide-activated compound.
  • Step (iv) comprises a treatment of the VHH antibody with an oxidant.
  • a disulfide compound such as oxidized glutathione (GSSG), cystine, dithioglycolic acid or 2,2 'dithiopyridine may be used as an oxidant.
  • step (iv) is carried out in the presence of a PDI such as DsbA from E. coli (SEQ ID NO: 57), DsbC from E. coli (SEQ ID NO: 58), or DsbG from E. coli (SEQ ID NO: 59).
  • a PDI such as DsbA from E. coli (SEQ ID NO: 57), DsbC from E. coli (SEQ ID NO: 58), or DsbG from E. coli (SEQ ID NO: 59).
  • the oxidation is preferably carried out under conditions wherein an at least partial thermal unfolding of the VHH antibody takes place.
  • the VHH antibody still comprises reduced structural cysteines.
  • the VHH antibody is subjected to an incubation at a temperature and for a time period wherein a transient (reversible) thermal unfolding of the VHH antibody is promoted.
  • the incubation temperature is preferably in the range between the nominal melting temperature (Tm) of the reduced form of the VHH antibody (with reduced structural cysteines) and the onset of melting of the reduced form of the VHH antibody (which is typically 10°C-15°C below Tm).
  • Tm nominal melting temperature
  • An incubation temperature above the onset of melting of the reduced form is advisable only in a slow warmup-regime.
  • An upper temperature threshold is the onset of melting of the disulfide-bonded form (which is typically 10-15°C below the nominal Tm of the disulfide-bonded form).
  • the melting temperatures of individual VHH antibodies may vary considerably.
  • the optimal incubation temperature of an individual VHH antibody may be determined as described in the Figures and Examples, particularly by the methods disclosed in Figures 8, 11 , 12, and 16.
  • the incubation during the oxidation step may involve a slow warm-up regime, e.g., involving a temperature increase of about 1 °C per min or less over a temperature range of at least 10°C, preferably of about 15°C.
  • the incubation time of the oxidation step can vary to great extent, e.g., between about 5 min and about 24 h, preferably between 1 h and 16 h.
  • the incubation time needed for completing reaction correlates inversely with the incubation temperature.
  • the treatment considerably increases the melting temperature of a VHH antibody, e.g. by a ATm of at least 10°C, by at least 20°C, by at least 30°C or by at least 40°C, reaching stabilities with a Tm of 60°C to even hyperthermostability with a Tm of >95°C.
  • Table 3 lists selected anti-NPC VHH antibodies that were initially produced under reducing conditions and then stabilized by a post-production treatment with oxidized glutathione (GSSG) and Dsb enzymes as disclosed here. Note that the treatment increased the melting temperatures (Tm) by at least 14°C (xhNup35-Nb1t) or to more than 45°C (KG26C08).
  • FIG. 1 Anti-nuclear pore complex (NPC) VHH antibodies and their application in confocal laser scanning microscopy.
  • VHH antibodies were generated by immunizing alpacas with human as well as Xenopus antigens, constructing immune libraries from blood samples, and phage display using folded nucleoporin (Nup) domains as baits.
  • NPC Anti-nuclear pore complex
  • Antigens included the N-terminal a-helical domain of Nup358 (the N-terminal a-helical domain comprising residues 1 -145), the RRM domain of Nup35, the a-solenoid of Nup93, the [3-propel ler of Nup133, full length Nup155, the [3-propeller of Elys, and the heterotrimeric coiled-coil of the Nup214 Nup88 Nup62 complex (or Nup214 complex for short).
  • VHH antibodies were expressed in E. coli NEB Shuffle with two ectopic cysteines each (placed on N- and C-termini). These ectopic cysteines were kept reduced during purification and were modified with the fluorophore maleimides of Alexa647, Alexa488, and Alexa568.
  • FIG. 2 Application of anti-NPC VHHs in super-resolution microscopy. Immunofluorescence was performed as described in Figure 1 with the following modifications: AbberiorStar 635 maleimide was used for labeling, cells were mounted in SlowFade Gold (Thermo Fisher Scientific) imaging medium to protect the dyes from photobleaching, images were acquired with a STEDycon microscope (Abberior Instruments) using the 640 nm laser and deconvoluted using the Huygens Professional software (version 19.10) with a saturation factor of 80 and an immunity factor of 1. Images reveal the typical ring-like NPC structure originating from their 8- fold rotational symmetry. Scale bar, 500 nm.
  • Figure 3 Crystal structure of xhNup358-Nb2t bound to the Xenopus Nup358 NTD.
  • the complex was produced by recombinant expression and purification, it was crystallized and subjected to structural analysis by x-ray crystallography.
  • FIG. 5 Sensitivity of cytoplasmically expressed VHH KG1 D08 to repeated freeze-thaw cycles. Immunofluorescence of HeLa cells was performed similarly to Figure 1 , but with a few modifications. Cells were first semi-permeabilized with 30 pg/ml digitonin in ‘transport buffer’ (20 mM HEPES/ KOH pH 7.5, 3.5 mM MgAc, 110 mM KAc, 0.5 mM EGTA, 250 mM sucrose) for 5 minutes at room temperature. They were then incubated with 40 nM anti-Nup133 VHH KG1 D08 expressed in NEB Shuffle and labeled with AbberiorStar 635.
  • transport buffer (20 mM HEPES/ KOH pH 7.5, 3.5 mM MgAc, 110 mM KAc, 0.5 mM EGTA, 250 mM sucrose
  • the VHH was frozen once (as a 20pM stock in PBS plus 20% glycerol) in liquid nitrogen and thawed at room temperature immediately before the experiment.
  • the VHH was frozen and thawed six more times after a 4-fold dilution in transport buffer. Note that the repeated freezing and thawing caused a severe loss of staining activity. This loss is probably due to the irreversible denaturation of KG1 D08 molecules that were not stabilized by the structural disulfide bond. The low residual activity is probably due to a small ( ⁇ 10-20%) fraction of disulfide-bonded VHH formed during expression in NEB Shuffle (see below, figure 8C).
  • FIG. 6 Disulfide bonding state of VHHs dependent on the mode of expression in Escherichia coli.
  • VHH antibody Re24H12 (directed against the receptor binding domain of SARS-CoV-2) was expressed in three ways: in the reducing cytosol of NEB Express, the partially oxidizing cytosol of NEB Shuffle, and under the oxidizing conditions of the periplasm.
  • the disulfide bonding of these preparations was then elucidated by SDS polyacrylamide electrophoresis (SDS PAGE) under non-reducing conditions (keeping any formed disulfide bonds intact), each in comparison to a sample prior reduced by dithiothreitol (DTT). Gel-staining was performed with Coomassie Brilliant Blue G250.
  • FIG. 7 Enzymatic post-production disulfide bond formation.
  • the anti-SARS- CoV-2 VHH antibody Re9B09 was produced cytoplasmically in NEB Express as described in Figure 4. It was thus initially fully reduced.
  • a 35 pM VHH stock in Dsb buffer 50 mM Tris/ HCI pH 8.0, 150 mM NaCI was then incubated for 30 minutes at 37°C with the indicated additives, namely 2 mM oxidized glutathione (GSSG) as an oxidant, and 1.5 pM of the E. coli thiol: disulfide exchange proteins DsbA, DsbC, or DsbG (concentrations refer to the enzyme monomers).
  • Figure 8 Treatment temperature and treatment time as key parameters for optimal post-production disulfide bond formation.
  • Fully reduced Re24H12 was produced by cytoplasmic expression in NEB express as described above.
  • a mixture of 35 pM VHH, 2 mM GSSG, and 1.5 pM each of DsbA, DsbC, and DsbG was prepared in Dsb buffer and placed in 20 pl aliquots into a gradient thermocycler. Within 45 minutes, the samples were linearly heated to either 30°C, 32°C, 35°C, 39°C, 43°C, 48°C, 52°C, 57°C, 61 °C, 65°C, 68°C, or 70°C.
  • the end temperature was then kept for either 5 minutes, for one hour, or overnight (16 hours), before returning to 20°C. Samples were subsequently analyzed by non-reducing SDS PAGE for disulfide bonding. For the short treatment (5 minutes hold time), an end temperature of 65°C was required to convert VHH Re24H12 quantitatively to the disulfide-bonded form. For the medium-length treatment, 61 °C was sufficient. This temperature optimum dropped to 48°C for a 16 hours-treatment.
  • FIG 11 Optimal treatment temperatures for enzymatic post-production disulfide bonding of VHH KG1 D08.
  • Optimal conditions for introducing the structural disulfide bond in the initially fully reduced KG1 D08 were elucidated as described for Re24H12 in Figure 6, again in the presence of 2 mM GSSG, and 1.5 pM each DsbA, DsbC, and DsbG.
  • the optimal temperature for the overnight treatment (35°) approximates the onset of melting of the fully reduced VHH
  • the optimal endpoint temperature (43-52°) in the fast-treatment (5-60 minutes) approximates the nominal melting point of 46°C.
  • the overnight treatment at lower temperature appears superior since less aggregates are formed.
  • Figure 12 Non-enzymatic disulfide bridging in KG1 D08. Left: experiment was performed as in Figure 9 (holding the endpoint temperature for 5 minutes) but without the Dsb enzymes. Note that the disulfide bond formation in this particular VHH was as efficient as in the presence of the enzymes. Right: same experiment but using cystine (oxidized cysteine) instead of GSSG as an oxidant. This had essentially the same effect but resulted in more aggregates.
  • cystine oxidized cysteine
  • Figure 13 Affinities of reduced and post-production disulfide-bridged KG1 D08 for its Nup133 [3-propeller target.
  • KG1 D08 was expressed with two additional cysteines at its N- and C-terminus in the cytoplasm of NEB Express. After purification, these two exposed cysteines were modified with Biotin-PEG11 -maleimide (Iris Biotech). Half of the preparation was treated with 2 mM GSSG, 1.5 pM each DsbA, DsbC, and DsbG for 5 minutes at 52°C with 45 minutes heat up time, resulting in quantitative disulfide bonding.
  • the biotinylated VHHs were then immobilized for biolayer interferometry to High precision streptavidin sensors of an Octet Red96 machine (to a binding signal of 1 nm), using PBS+ 1 % BSA as an assay buffer. Loaded sensors were then dipped for 800 seconds into 40 nM solutions of the human or the Xenopus Nup133 [3-propeller to measure association, and subsequently dipped into buffer only to measure dissociation. Dissociation constants were computed using the Octet software.
  • Figure 14 Disulfide bond formation in fluorophore-labelled KG1 D08.
  • KG1 D08 was produced in fully reduced form with two additional cysteines as described above and labelled AbberiorStar 635 maleimide to a density of labelling of 2.
  • the labelled VHH was then treated with 2 mM GSSG, 1.5 pM each DsbA, DsbC, and DsbG for 5 minutes at 52°C with 45 minutes heat up time, resulting in quantitative disulfide bonding. Analysis was by reducing/ non-reducing SDS PAGE followed by fluorescence detection and by Coomassie staining.
  • Re24H12 was expressed with a cleavable N-terminal DsbA secretion signal and a C-terminal spacer-Hisi2 tag. It was purified by Ni 2+ chelate chromatography from the periplasmic fraction (obtained by an osmotic shock). The C-terminal tag was not removed, resulting in a slower migrating species.
  • VHH sequences of VHH antibodies described herein (without ectopic cysteines), PDI enzymes and human (h) or frog (x) NPC antigens described herein are listed.
  • AWHPGDNPCQIYYTLVTVKDEGYNISDEITVEVTQFNPVFQARGMQLCQLWPNFS SQACYLYTQEMIFACSTGTGRSTLPQEKIPFEAQGDNIVGAGSCEGWPVFFIRKSG MLTVVARETAS

Landscapes

  • Chemical & Material Sciences (AREA)
  • Organic Chemistry (AREA)
  • Health & Medical Sciences (AREA)
  • General Health & Medical Sciences (AREA)
  • Biochemistry (AREA)
  • Biophysics (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Genetics & Genomics (AREA)
  • Medicinal Chemistry (AREA)
  • Molecular Biology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Immunology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention relates to VHH antibodies that specifically bind to components of nuclear pore complexes of human cells and other species. Further, the present invention relates to the labelling of VHH antibodies through maleimide chemistry and ectopic cysteine residues. Further, the present invention relates to a method for forming a stabilizing, structural disulfide bond in initially reduced VHH antibodies.

Description

Anti-NPC VHH antibodies and methods fortheir stabilization
Field of the Invention
The present invention relates to VHH antibodies that specifically bind to components of nuclear pore complexes of human cells and other species. Further, the present invention relates to the labelling of VHH antibodies through maleimide chemistry and ectopic cysteine residues. Further, the present invention relates to a method for forming a stabilizing, structural disulfide bond in VHH antibodies that were initially reduced and labelled through ectopic cysteines.
Background of the invention
VHH antibodies (VHHs, also called nanobodies) are isolated antigen-binding domains of camelid heavy-chain-only antibodies (Hamers-Casterman et al., 1993; Muyldermans, 2013). They are straightforward to obtain by immunizing a camelid, such as an alpaca, with an antigen of choice, preparing an immune library, and performing phage display using the antigen again as a panning bait. Such workflow avoids the combinatorial complications typical of traditional antibodies whose paratopes are made of two different polypeptide chains.
VHH antibodies have found many practical applications, as crystallization chaperones, as imaging agents in immunofluorescence applications (Rothbauer et al., 2008; Pleiner ef al., 2015, 2018), or for virus-neutralization in anti-viral therapy (Guttler et al., 2021 ; Koenig et al., 2021 ).
VHHs are easily produced in bacteria, such as Escherichia coli, or in yeast, such as Pichia pastoris. They contain a highly conserved structural disulfide bond that is buried in their hydrophobic core and stabilizes them against denaturation (Muyldermans, 2013; Pleiner et al., 2015). This disulfide bond forms between two conserved cysteines, but only when the VHH is produced under the oxidizing conditions that prevail in a secretory compartment, such as the periplasm of E. co// or the endoplasmic reticulum of eukaryotes. Its formation is catalyzed by protein disulfide isomerases or PDIs for short (Goldberger et al., 1963; Roth and Mesirow, 1984; Edman et al., 1985; Lambert and Freedman, 1985; Bulleid and Freedman, 1988; Bardwell et al., 1991 ; Tu and Weissman, 2004; Hatahet and Ruddock, 2009).
Formation of the structural disulfide bond has, however, little direct effect on the VHH structure and its paratope. In fact, VHHs can recognize their antigens even when they are produced under reducing conditions in the cytoplasm, i.e. , when their structural disulfide bond has not formed and the corresponding cysteines remained in their -SH form (Pleiner et al., 2015).
The laboratory of the inventors exploited reducing expression previously to produce directly fluorophore-labeled, VHH-based imaging reagents (Pleiner etal., 2015, 2018). For labeling, they coupled fluorophore-maleimides to engineered cysteines that were introduced, for example, at the N- and/or C-terminus of the respective VHH. The thereby occurring thiol Michael addition results in a stable thioether linkage between VHH and fluorophore(s), and it allows labeling without modifying the paratope. This requires, however, the acceptor cysteines to be reduced. This can be ensured by cytoplasmic production under reducing conditions. Indeed, such a workflow has yielded VHH imaging reagents of excellent performance (Pleiner et al., 2015, 2018).
Fluorescent VHH imaging reagents are of particular interest because their actual production does not require animals and they are fully defined by sequence. Compared to traditional stainings with primary and secondary antibodies, they allow for simplified staining workflows (with just a single incubation of the specimen) and a smaller offset (linkage error) between label and epitopes. The latter is highly relevant for super-resolution microscopy, where the linkage error becomes limiting for resolution.
Nuclear pore complexes (NPCs) are a perfect and indeed preferred object for superresolution microscopy (Ldschberger et al., 2012; Szymborska et al., 2013; Pleiner et al., 2015; Gdttfert etal., 2017; Weber et al., 2023). They are embedded into the nuclear envelope, conduct nucleocytoplasmic transport, have an outer diameter of 120 nm, and are of 8-fold rotational symmetry. When stained for immunofluorescence, NPCs yield diagnostic images, provided the resolution is sufficient to reveal such details. The laboratory of the inventors has previously reported VHHs recognizing Xenopus (i.e., frog) NPCs. While this was straightforward because Xenopus nucleoporins are very immunogenic in camelids, their use was limited because only a few labs work with frog cells, but many more with human/ mammalian cell lines.
It was an object of the present invention to provide VHH antibodies showing improved binding to mammalian and other animal NPCs and indeed to cross-react from frogs to humans.
Summary of the Invention
A first aspect of the present invention relates to an VHH antibody against a mammalian nuclear pore complex (NPC). In some embodiments, the VHH antibody is directed against a component of a mammalian NPC including Nup358, Nup133, Nup155, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer.
VHH antibodies comprise two structural cysteine residues capable of forming an intramolecular disulfide bond. In some embodiments, the VHH antibody comprises at least one additional solvent-accessible ectopic cysteine residue. A solvent-accessible ectopic cysteine residue may be introduced in any portion of the VHH antibody that does not interfere with target-recognition, for example, in its N- and/or C-terminal region and/or in the folded part of the VHH antibody avoiding the paratope regions. In particuar embodiments, the VHH antibody comprises a heterologous amino acid sequence including a solvent-accessible ectopic cysteine residue at its N-terminus and/or at its C-terminus.
In some embodiments, the VHH antibody carries at least one labelling agent, e.g., a fluorescent labelling agent (fluorophore) or biotin.
In some embodiments, the VHH antibody carries a labelling agent attached to a solvent-accessible ectopic SH group on the VHH antibody, particularly an SH group on the N and/or C-terminus of the VHH antibody.
In some embodiments, the VHH antibody is a stable, e.g., a thermostabilized VHH antibody. In particular embodiments, the VHH antibody is labelled at an ectopic cysteine (e.g., through maleimide chemistry) and it comprises two structural cysteines that are quantitatively oxidized to an intramolecular disulfide bond.
A further aspect of the present invention relates to a set of at least two VHH antibodies each recognizing a different component of an animal NPC, particularly a vertebrate, e.g., mammalian NPC selected from the group comprising Nup358, Nup155, Nup133, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer.
A further aspect of the present invention relates to the use of the VHH antibody or the set of the VHH antibodies for imaging applications including fluorescence spectroscopy or fluorescence microscopy.
The binding characteristics of specific VHH antibodies are shown in Table 1 : All antibodies except Nb116 are directed against components of the NPC. Nb116 is directed against the Fc portion of rabbit IgG and may serve as a secondary detection reagent.
Table 1
Figure imgf000005_0001
Table 1: VHH antibodies for imaging nuclear pores and their specificity
The specificity-determining CDRs (complementarity-determining regions) of these
VHH antibodies are shown in Table 2.
Table 2
Figure imgf000006_0001
Table 2: Specific VHHs and their CDR regions.
Preferred VHH antibodies of the present invention are antibodies recognizing Nup 133 P-propeller such as KG1 D08 (SEQ ID NO: 1 ) and KG1 C05 (SEQ ID NO: 5), variants thereof, competing antibodies and antibodies binding the same epitope as described herein.
Especially preferred VHH antibodies of the present invention are KG1 D08 (SEQ ID NO: 1 ), KG1 C05 (SEQ ID NO: 5), Re3E01 (SEQ ID NO: 21 ), xhNup358 Nb2t (SEQ ID NO: 25), xhNup93 Nb3t (SEQ ID NO: 29), xhNup35 Nb1t (SEQ ID NO: 33), Bm53C05 (SEQ ID NO: 37), KG26C08 (SEQ ID NO: 49), Nb116 (SEQ ID NO: 53), variants thereof, competing antibodies and antibodies binding the same epitope as described herein.
A list of complete sequences of VHH antibodies (without ectopic cysteines) is shown at the end of the specification.
There are several methods known in the art for determining the CDR sequences of a given antibody molecule, but there is no standard unequivocal method. Determination of CDR sequences from antibody heavy chain variable regions can be made according to any method known in the art, including, but not limited to, the methods known as KABAT, Chothia, and IMGT. A selected set of CDRs may include sequences identified by more than one method, namely, some CDR sequences may be determined using KABAT and some using IMGT, for example. According to some embodiments of the present invention, the CDR sequences of the VHH variable regions are determined using the KABAT methods. CDRs may also be defined through a multiple alignment (with many other VHH antibodies), to identify the hot-spots of variability and relate them to a standard VHH antibody structure. It is also possible to define CDRs by analyzing the structure of the VHH antibody and deciding what is a loop and what is the antibody’s scaffold. In some cases, CDR-adjacent residues are also variable, and are therefore included in the CDR definition.
A further aspect of the present invention relates to a method of producing a stabilized and optionally labelled VHH antibody comprising the steps:
(i) expressing a VHH antibody comprising two structural cysteines and optionally at least one solvent-accessible ectopic cysteine in a host cell under reducing or at least partially reducing conditions,
(ii) purifying the VHH antibody from the host cell or the culture medium under conditions wherein the at least one solvent-accessible ectopic cysteine, if present, is preserved in the reduced SH state;
(iii) optionally attaching a labelling agent to the at least one solvent- accessible ectopic cysteine under conditions wherein the structural cysteines are kept unmodified,
(iv) subjecting the VHH antibody to an oxidation that converts the two structural cysteines to a disulfide bond, and
(v) obtaining a thermostabilized VHH antibody wherein the two structural cysteines are quantitatively oxidized to a disulfide bond.
In particular embodiments, the VHH antibody comprises two structural cysteines and at least one solvent-accessible ectopic cysteine. In some of those embodiments, the method comprises step (iii). The oxidation in step (iv) may be carried out in the presence of an oxidation agent, e.g., a disulfide compound such as glutathione disulfide (GSSG) and optionally in the presence of a protein disulfide isomerase (PDI).
In some embodiments, the oxidation comprises a treatment at an elevated temperature thereby leading to a transient at least partial thermal unfolding of the VHH antibody. In particular embodiments, the VHH antibody is subjected to a treatment at a temperature which is at least as high as the onset of melting of the VHH antibody with reduced structural cysteines.
Embodiments of the invention
In the following, specific embodiments of the invention are disclosed as follows:
1. A VHH antibody recognizing a component of a mammalian nuclear pore complex (NPC) selected from the group comprising Nup358, Nup133, Nup155, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer comprising:
(a) a CDR3 sequence as shown in SEQ. ID NO: 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48 or 52, and
(b) a CDR3 sequence, which has an identity of at least 80%, at least 90% or at least 95% to a CDR3 sequence of (a);
(c) a VHH antibody, which competes with a VHH antibody of (a) for the binding to the respective component of the NPC; or
(d) a VHH antibody, which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a).
2. The VHH antibody of embodiment 1 comprising
(a) a combination of CDR1 , CDR2 and CDR3 sequences as shown in SEQ. ID NO: 2-4, 6-8, 10-12, 14-16, 18-20, 22-24, 26-28, 30-32, 34-36, 38-40, 42- 44, 46-48 or 50-52;
(b) a combination of CDR1 , CDR2 and CDR3 sequences which has an identity of at least 80%, at least 90% or at least 95% to a combination of CDR1 , CDR2 and CDR3 sequences of (a); (c) a VHH antibody, which competes with a VHH antibody of (a) for the binding to the respective component of the NPC; or
(d) a VHH antibody, which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a). The VHH antibody of embodiment 1 or 2 comprising
(a) a VHH sequence as shown in SEQ. ID NO: 1 , 5, 9, 13, 17, 21 , 25, 29, 33, 37, 41 , 45 or 49 and optionally at least one additional solvent-accessible ectopic cysteine residue;
(b) a VHH sequence which has an identity of at least 70%, at least 80%, at least 90%, at least 95% or at least 98% to a VHH sequence of (a),
(c) a VHH antibody, which competes with a VHH antibody of (a) for the binding to the respective component of the NPC, or
(d) a VHH antibody, which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a). The VHH antibody of any one of embodiments 1 -3 comprising at least one solvent-accessible ectopic cysteine residue in its N-and/or C-terminal region, particularly at its N- and/or C-terminus and/or in its folded part avoiding the paratope regions. The VHH antibody of any one of embodiments 1 -4 comprising a heterologous amino acid sequence including a solvent-accessible ectopic cysteine residue at its N-terminus and/or at its C-terminus. The VHH antibody of any one of embodiments 1 -5 which carries a labelling agent, particularly a fluorescent group, biotin, a DNA oligonucleotide group, an enzyme, an electron spin resonance (EPR) probe, or a group for immobilization to a chromatographic support. The VHH antibody of any one of embodiments 1 -6 which carries a labelling agent attached to a solvent-accessible ectopic SH group on the VHH antibody. The VHH antibody of embodiment 7 wherein the labelling agent is attached as a thiol-reactive compound, e.g., an maleimide-, iodoacetamide-, bromoacetamide- or acrylamide-activated compound to a solvent- accessible ectopic SH group on the VHH antibody. The VHH antibody of any one of embodiments 1 -8 which is a thermostabilized VHH antibody. The VHH antibody of any one of embodiments 1 -9 which comprises two structural cysteines that are quantitatively oxidized and form an intramolecular disulfide bond. The VHH antibody of any one of embodiments 1 -10 which has a crossreactivity with a homologous NPC component from Xenopus laevis. A set of at least 2 VHH antibodies recognizing each a different component of a mammalian nuclear pore complex (NPC) selected from the group comprising Nup358, Nup133, Nup155, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer. The set of embodiment 12 which comprises a VHH antibody recognizing Nup133 [3-propeller. The set of embodiment 12 or 13 wherein at least one VHH antibody comprises at least one solvent-accessible ectopic cysteine residue, particularly in its N-and/or C-terminal region and/or in its folded part avoiding the paratope regions. The set of any one of embodiments 12-14 comprising at least one VHH antibody comprising:
(a) a CDR3 sequence as shown in SEQ. ID NO: 4, 8, 12, 16, 20, 24, 28, 32, 36, 40, 44, 48 or 52; (b) a CDR3 sequence, which has an identity of at least 80%, at least 90% or at least 95% to a CDR3 sequence of (a);
(c) a VHH antibody, which competes with a VHH antibody of (a) for the binding to the respective component of the NPC; or
(d) a VHH antibody, which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a). The set of any one of embodiments 12-15 comprising at least one VHH antibody comprising:
(a) a combination of CDR1 , CDR2 and CDR3 sequences as shown in SEQ. ID NO: 2-4, 6-8, 10-12, 14-16, 18-20, 22-24, 26-28, 30-32, 34-36, 38-40, 42- 44, 46-48 or 50-52;
(b) a combination of CDR1 , CDR2 and CDR3 sequences which has an identity of at least 80%, at least 90% or at least 95% to a combination of CDR1 , CDR2 and CDR3 sequences of (a);
(c) a VHH antibody, which competes with a VHH antibody of (a) for the binding to the respective component of the NPC; or
(d) a VHH antibody, which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a). The set of any one of embodiments 12-16 comprising at least one VHH antibody comprising:
(a) a VHH sequence as shown in SEQ. ID NO: 1 , 5, 9, 13, 17, 21 , 25, 29, 33, 37, 41 , 45 or 49; and optionally at least one additional solvent- accessible ectopic cysteine residue;
(b) a VHH sequence which has an identity of at least 70%, at least 80%, at least 90%, at least 95% or at least 98% to a VHH sequence of (a),
(c) a VHH antibody, which competes with a VHH antibody of (a) for the binding to the respective component of the NPC; or
(d) a VHH antibody, which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a). The set of any one of embodiments 12-17 comprising at least one VHH antibody comprising 2, 3, 4, 5, 6 or 7 different VHH antibodies, particularly 2, 3, 4, 5, 6 or 7 different VHH antibodies as defined in any one of embodiments 13-15. The set of any one of embodiments 12-18 wherein at least one VHH antibody carries a labelling agent, particularly a fluorescent group, biotin, a DNA oligonucleotide group, an enzyme, an electron spin resonance (EPR) probe, or a group for immobilization to a chromatographic support. The set of embodiment 19 wherein at least 2 VHH antibodies, e.g., 2, 3, 4, 5, 6 or 7 VHH antibodies carry different labelling agents, particularly different spectrally separatable fluorescent groups. The set of any one of embodiments 12-20 wherein at least one VHH antibody carries a labelling agent attached to a solvent-accesible ectopic SH group on the VHH antibody. The set of any one of embodiments 12-21 wherein at least one VHH antibody is a thermostable VHH antibody. The set of any one of embodiments 12-22 wherein at least one VHH antibody comprises two structural cysteines that are quantitatively oxidized and form an intramolecular disulfide bond. Use of the VHH antibody of any one of embodiments 1 -11 or the set of any one of embodiments 12-23 for imaging applications particularly for fluorescence spectroscopy or microscopy. A method of producing a VHH antibody comprising the steps:
(i) expressing a VHH antibody comprising two structural cysteines and at least one solvent-accessible ectopic cysteine in a host cell under reducing or at least partially reducing conditions, (ii) purifying the VHH antibody obtained in step (i) from the host cell or the culture medium under conditions wherein the at least one solvent- accessible ectopic cysteine is preserved in the reduced SH state;
(iii) optionally attaching a labelling agent to the at least one solvent- accessible ectopic cysteine under conditions while keeping the two structural cysteines unmodified,
(iv) subjecting the VHH antibody obtained in step (ii) or (iii) to an oxidation that converts the two structural cysteines to a disulfide bond, and
(v) obtaining a thermostabilized VHH antibody wherein the two structural cysteines are quantitatively oxidized to a disulfide bond. The method of embodiment 25 wherein the VHH antibody comprises at least one solvent-accessible ectopic cysteine. The method of embodiment 25 or 26 wherein the VHH antibody comprises an solvent-accessible ectopic cysteine residue in its N-and/or C-terminal region and/or in its folded part, avoiding the paratope regions. The method of any one of embodiments 25 -27 wherein the VHH antibody comprises at least one heterologous solvent-accessible ectopic cysteine- containing amino acid sequence at its N- and/or C-terminus, particularly having a length of up to about 20 amino acids. The method of any one of embodiments 25 -28 wherein the VHH antibody further comprises at least one heterologous tag-containing heterologous amino acid sequence at its N- and/or C-terminus, particularly a cleavable tag-containing amino acid sequence. The method of any one of embodiments 25 -29 wherein the reducing or at least partially reducing conditions in step (i) comprise expression of the VHH antibody in the cytoplasm of a prokaryotic host cell such as E.coli or a eukaryotic host cell such as a yeast, protozoan, plant, or animal cell, optionally followed by a reduction treatment. The method of any one of embodiments 25-30 wherein step (ii) comprises a treatment with a reducing agent such as a thiol, e.g., DTT (dithiothreitol) or a phosphine, e.g., TCEP (tris(carboxyethyl)phosphine), followed by a removal of the reducing agent. The method of any one of embodiments 25-30 wherein step (ii) comprises a chromatographic purification in the presence of a reducing agent. The method of any one of embodiments 25-32 wherein the labelling agent is a thiol-reactive compound, e.g., an maleimide-, iodoacetamidebromoacetamide- or acrylamide-activated compound. The method of any one of embodiments 25-33 wherein the labelling agent is a fluorophore, biotin, a DNA oligonucleotide, an enzyme, an electron spin resonance (EPR) probe, or a compound for immobilization to a chromatographic support. The method of any one of embodiments 25-34 wherein step (iv) comprises a treatment of the VHH antibody with an oxidant. The method of embodiment 35 wherein the oxidant is a disulfide compound particularly oxidized glutathione (GSSG). The method of any one of embodiments 25-36 wherein the oxidation in step (iv) is carried out in the presence of a protein disulfide isomerase (PDI), particularly in the presence of DsbA and/or DsbC from E. coli. The method of any one of embodiments 25-37 wherein step (iv) comprises a transient thermal unfolding of the VHH antibody. The method of embodiment 38 wherein the transient thermal unfolding comprises incubating the VHH antibody at a temperature which is in the range between the onset of melting of the reduced form of the VHH antibody (with reduced structural cysteines) and the nominal melting temperature (Tm) of the reduced form of the VHH antibody. A VHH antibody recognizing an Fc region of a rabbit IgG comprising:
(a) a CDR3 sequence as shown in SEQ. ID NO: 56;
(b) a CDR3 sequence, which has an identity of at least 80%, at least 90% or at least 95% to the CDR3 sequence of (a);
(c) a VHH antibody, which competes with the VHH antibody of (a) for the binding to its target antigen, or
(d) a VHH antibody, which binds the same or an overlapping epitope of its target antigen as a VHH antibody of (a). The VHH antibody of embodiment 40 comprising
(a) a combination of CDR1 , CDR2 and CDR3 sequences as shown in SEQ. ID NO: 54-56;
(b) a combination of CDR1 , CDR2 and CDR3 sequences which has an identity of at least 80%, at least 90% or at least 95% to the combination of CDR1 , CDR2 and CDR3 sequences of (a);
(c) a VHH antibody, which competes with the VHH antibody of (a) for the binding to its target antigen, or
(d) a VHH antibody, which binds the same or an overlapping epitope of its target antigen as a VHH antibody of (a). The VHH antibody of embodiment 40 or 41 comprising
(a) a VHH sequence as shown in SEQ. ID NO: 53; and optionally an additional cysteine residue at its N- and/or C-terminus;
(b) a sequence which has an identity of at least 70%, at least 80%, at least 90%, at least 95% or at least 99% to a VHH sequence of (a),
(c) a VHH antibody, which competes with the VHH antibody of (a) for the binding to its target antigen, or
(d) a VHH antibody, which binds the same or an overlapping epitope of its target antigen as a VHH antibody of (a). 43. Use of the VHH antibody of any one of embodiments 40-42 as a secondary detection reagent, particularly for the imaging of an NPC, more particularly for a use as defined in embodiment 24.
Detailed description of the invention
The inventors prepared mixes of human and Xenopus NPC antigens (Nup133, Nup358, Nup155, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer), immunized alpacas, selected VHHs by phage display, produced them by recombinant expression in the E.coli cytoplasm, and labeled them through ectopic cysteines with fluorescent dyes. The VHH sequences of the antibodies are shown at the end of the description. Table 2 discloses their specificity-determining CDRs.
As detailed in Table 1 and Figure 1 , several of the VHH antibodies actually performed very well in immunofluorescence applications and specifically recognize not only human NPCs, but also cross-react from frogs to humans. Images obtained by confocal laser scanning microscopy on human HeLa cells with the focal plane across the equators of the cell nuclei are shown in Figure 1A and 1 B. The bright staining of the nuclear rim is indeed indicative of a specific detection of NPCs. Figure 1 B and C show also specific NPC stains of Xenopus nuclei, demonstrating the cross-reaction over a long evolutionary distance. In Figure 1 B, cultured frog fibroblasts (Xenopus xtc cells) were analyzed. In Figure 1 C, nuclei had been assembled from Xenopus sperm chromatin and Xenopus egg extract; here, three VHHs (labelled with different fluorophores) were each combined, demonstrating their utility in multi-color colocalizations.
To obtain images at higher resolution, the inventors turned to STED (stimulated emission depletion) microscopy (Sahl et al., 2017). As documented for the anti- Nup358 and anti-Nup133 VHHs, this now allowed to resolve rings in individual NPCs (Figure 2), consistent with their 8-fold rotational symmetry. Individual Nups occur within NPCs at different positions and copy numbers (Hampoelz et al., 2019). The here- disclosed anti-Nup VHHs can thus be combined into sets, where individual VHHs are conjugated to compatible fluorophores of different spectral (excitation and/or emission) properties and used to generate 2D and 3D multicolor nanoscopic patterns. For example, one can combine Alexa488-labelled anti-Nup133 with AbberiorStar635- labelled anti-Nup358, and Alexa568-labelled anti-Nup35 to generate a three-color three-dimensional pattern by staining NPCs of HeLa cells. As such patterns can be reproduced by standardized cell-staining protocols, they can also be used for benchmarking super-resolution fluorescence microscopes. Here, it is relevant that such patterns are generated with biologically relevant samples, which can reveal typical challenges, such as offsets between color channels due to mismatches in diffractive index within the specimen.
The targeted proteins and protein domains of the VHH were chosen such that various patterns can be generated with them. All of them should follow the 8-fold rotational symmetry. Nup358 organizes the cytoplasmic ring with 5 copies per asymmetric unit. Nup133 is part of the Y-complex and forms the scaffolds of the cytoplasmic and nuclear rings. Nup35 and Nup155 are two different components of the inner ring. The Nup214 Nup88 Nup62 heterotrimer is located near the cytoplasmic ring. Elys is part of those Y-complexes that form the outermost nuclear ring and occurs in only one copy per asymmetric unit. Elys and Nup358 mark the most distant components of the (rigid) NPC scaffold (along the cytoplasmic-nuclear axis).
Having recombinant VHH antibodies, their target binding can be defined with (near) atomic resolution. For this, the inventors crystallized a complex of xhNup358-Nb2t with the N-terminal domain (NTD) of Xenopus Nup358 as well as a complex of the human Nup133 [3-propeller with VHH KG1 D08 and KG1 C05. They collected x-ray diffraction data at a synchrotron source and solved the structures by molecular replacement. The structure of the xhNup358-Nb2t - xNup358 NTD complex was refined to a resolution of 2.3A and an Rfree of 24.7%, the Nup133 [3-propeller complex to a resolution of 2.36A and an Rfree of 24.4%. Figures 3 and 4 show graphical representations of these structures (panels A). They also provide precise definitions of the paratopes on the VHH antibodies (panels B) and the recognized epitopes on the Nup targets (panels C). xhNup358-Nb2t recognizes the a-helical N-terminal domain of Nup358. The epitope is highly conserved between frogs and human, with only two conservative exchanges: R58K (arginine against lysine) and L87V (leucine against valine). The other 13 epitope residues are identical (Figure 3C). This explains why this VHH cross-reacts so well between Xenopus and human RanBP2, despite the fact that the N-terminal domains share only 71 % sequence identity.
The Nup133 [3-propeller structures shows that the two VHH bind to distinct and nonoverlapping epitopes (Figure 4A), which is consistent with biolayer interferometry measurements indicating that the two VHH do not compete for a common binding site. KG1 C05 docks with its CDR3 loop into the central cavity of the propeller. KG1 D08, the so far brightest staining VHH against the Y-complex, binds to the side of the propeller.
Cryo-electron tomography maps of the nuclear pore complexes are meanwhile sufficiently well resolved to visualize individual protein domains (Mosalaganti et al., 2022). The here disclosed crystal structures of the Nup-VHH complexes can be docked in to such cryo-EM maps to locate VHH-attached fluorophores. This in turns allows to interpret obtained fluorescence microscopic patterns with molecular precision.
While the VHH listed in Tables 1 and 2 performed well in immunofluorescence, the inventors noted that several of the VHHs started to denature and precipitate during repeated freeze-thaw cycles, during storage, or during prolonged incubations at room temperature or at 37°C. Figure 5 documents such problem for the anti-Nup133 VHH KG1 D08 (SEQ ID NO: 1 ) labelled with AbberiorStar 635, which loses most of its staining-activity after 7 freeze-thaw cycles. This happens even in a buffer containing 250 mM sucrose or 20% glycerol, which normally provides already some protection against such damage.
They reasoned that this reduced stability might be due to the structural disulfide bond not being formed during expression in the (reducing) E. coli cytosol, and that the problem can be solved by oxidizing the two structural cysteines to cystine. One way of achieving this is to use the E. coli Shuffle strain (commercially available from NEB) whose cytoplasm is less reducing for disulfide bonds (because of a genetic deletion of the GOR gene, which encodes the glutathione reductase or more correctly a glutathione disulfide reductase). Such strain also expresses the PDI DsbC in the cytoplasm (Bessette et al., 1999), which in wildtype cells forms disulfide bonds in the periplasm. However, the disulfide bond formation of VHHs expressed in Shuffle remains notoriously incomplete (see Figure 6 for VHH Re24H12 and below Figure 10C for VHH KG1 D08). Furthermore, the Shuffle strain suffers from sensitivity already to atmospheric levels of oxygen and has a severely problematic growth phenotype or even completely fails to grow, for example, when inoculated at too low cell densities.
The inventors developed, therefore, an alternative technology. They conceived a workflow that includes (i) expression of a VHH with ectopic cysteines for later labeling, under reducing (or semi-reducing) conditions for expression, (ii) VHH purification including a final reduction step to ensure an -SH state of the ectopic cysteines, (iii) modification of the ectopic (and fully exposed) cysteines with a label, e.g., a maleimide-activated label (fluorophore, biotin, DNA-oligonucleotide) while keeping the structural cysteines unmodified, (iv) a post-treatment that converts the two structural cysteines (which are buried in the hydrophobic core of the VHH) to a disulfide bond, and (v) obtaining the VHH antibody in a stable oxidized form.
A PDI should catalyze the disulfide bond formation; however, initial experiments showed only low efficiency and rather variable results with different VHHs. The inventors reasoned that the problem might relate to the fact that the two structural cysteines are buried in the hydrophobic interior of the VHH and are thus not easily accessible for modification or enzymatic action. This burial helps to confine the fluorophore-labelling to only the engineered, ectopic cysteines. However, in the next step of the above-sketched workflow, the burial prevents the two structural cysteines also from being oxidized to a stabilizing disulfide bond. Indeed, PDIs act in vivo probably already during the translocation of the still fully unfolded VHH polypeptide through the plasma membrane (of E. coli) or the ER membrane of a eukaryote and thus before the VHH adopts its fold. Likewise, the textbook example for measuring PDI activity utilized denatured folding substrates, such as RNase A with scrambled (i.e. incorrectly formed) disulfide bonds (Goldberger et al., 1963) (Tu and Weissman, 2004). A VHH (such as the here described anti-Nup VHHs) produced under reducing conditions is, however, a correctly folded entity, because it can bind its target perfectly well (see Pleiner et al., 2015 and below, Figure 13). Indeed, this poses the question if and how a chaperone/ folding enzyme can recognize such a reduced VHH as a folding substrate.
The inventors used oxidized glutathione (GSSG) as an oxidant and the three (periplasmic) PDIs from E. coli, namely DsbA, DsbC, and DsbG, as catalytic enzymes. In each case, a given VHH was incubated with various combinations of GSSG and the above-mentioned enzymes. Disulfide bond formation was then assessed by non- reducing SDS PAGE, where the (more compact) disulfide-bridged form runs faster than the reduced form (see Figures 6, 7, 8, 10C, 11 , 12, 16).
Re9B09, an anti-SARS-CoV-2 VHH antibody (SEQ ID NO: 60) (Guttler et al., 2021 ), was a first example for a post-production disulfide-bonding (Figure 7). Incubations were performed at 37°C because this corresponds to the body temperature of alpacas (from which the VHH originated) and because this is the optimal growth temperature of E. coli and should therefore be an ideal temperature for the action of the Dsb enzymes that are of E. coli origin. Incubation with GSSG alone (2 mM) resulted already in some (10-20%) intramolecular disulfide bond formation, however, higher molecular weight bands were also prominent, pointing to intermolecular S-S bridges and thus undesired aggregates (Figure 7). Consistent with this, the mixture turned visibly cloudy indicating aggregation. The presence of DsbA or DsbC (1 .5 pM) increased the yield of VHH with an intramolecular disulfide bond to ~60-70% but still, aggregates and precipitating reduced VHH were still prominent. The solution to the problem was to adapt the temperature regime of the incubation to the properties of this VHH. Specifically, this included a slow warmup phase (over 45 minutes) from 20°C to 37°C. Under these conditions, either DsbA or DsbC (1.5 pM) suppressed aggregation completely and conferred a complete intramolecular disulfide bonding (Figure 7).
Re24H12, another anti-SARS-CoV-2 VHH antibody (SEQ ID NO: 61 ) showed no disulfide bond formation when tested under the same conditions (37°C), even when all three Dsb enzyme had been added. Surprisingly, however, a quantitative disulfide bond formation was observed when the treatment temperature was raised to 65°C and kept for 5 minutes (Figure 8A). The optimal treatment temperature was here determined by pipetting a master mix (35 pM VHH, 2 mM GSSG, and 1.5 pM each DsbA, DsbC, and DsbG), aliquoting this to PCR tubes, incubating the 12 parallel samples in a gradient-thermocycler with end-temperatures reaching a range between 30°C and 70°C, and analyzing disulfide-bonding in each of the samples by nonreducing SDS-PAGE.
65°C is a rather non-physiological temperature, lethal for either E. coli or mammalian cells, but the effective treatment at this temperature is explainable by the assumption that thermal unfolding of the VHH is the first and essential step in the reaction. Such unfolding would transiently make one of the two buried thiol groups accessible and thus allow its oxidation, through a covalent (S-S) intermediate with either a Dsb or a glutathione molecule, followed by the displacement of the enzyme/ glutathione by the thiol group of the second VHH cysteine.
If unfolding were indeed the rate-limiting step, then one would predict that slower unfolding at lower temperature can be compensated by longer incubation times. Indeed, the optimal temperature dropped to 60°C and 48°C when the treatment was extended to 60 minutes or 16 hours, respectively (Figure 8B-C).
Thermal unfolding can be measured by differential scanning fluorimetry or DSF for short (also called thermofluor), using, e.g., SYBR orange as an indicator. Such analysis revealed that fully disulfide-bonded Re24H12 is hyperthermostable, resisting 95°C (Figure 9). Its reduced form had a nominal melting temperature (Tm) of 58°C (as defined by the inflection point of the melting curve). This corresponds approximately to a half-maximal unfolding and is close to the optimal disulfide-bonding temperature in the short incubation setup. The onset of unfolding is seen at ~50°C, which in turn is close to the optimal disulfide bonding temperature of 48°C in the 16 h incubation.
Interestingly, the reduced VHH Re9B09 has a rather low Tm of 35°C, explaining why an endpoint temperature 37°C was already sufficient for a quantitative post-production disulfide bond formation in this particular VHH. The low Tm also explains why the slow warmup regime was here so beneficial. It avoids an initially high rate of thermal unfolding, thus a high concentration of aggregation-prone intermediates and thus aggregation in the multi-molecular aggregation reaction.
The inventors analyzed KG1 D08 in the same way, which is a VHH with particularly good NPC-staining properties (Figures 1 and 2). Its reduced form has a melting temperature (Tm) of 46°C (Figure 10A and C) and showed quantitative disulfide bond formation when incubated for 5 minutes at a final temperature of 52°C, reached during a 45 minute warmup phase (Figure 11 ). Pre-trials had also here established that such slow warming and thus an initially slow melting makes the reaction more robust, probably because a low concentration of melted intermediates makes them less likely to aggregate with each other. The Dsb enzymes/ glutathione can trap the unfolding intermediates as soon as they appear, catalyze disulfide bond formation, which is then irreversible under these conditions, because the disulfide-bonded form has a >20°C higher melting temperature and cannot participate in the back-reaction. Consistent with this interpretation, the inventors found that too high incubation temperatures favored the formation of higher order aggregates (Figure 11 ). An upper threshold is here the onset of melting of the disulfide-bonded form (which is 10-15°C below the nominal Tm). An incubation temperature near or above the nominal Tm of the reduced form is advisable only in the slow warmup-regime.
Extending the incubations at the final temperatures, from 5 to 60 minutes or to 16 hours, lowered the optimal temperature for disulfide bonding in KG1 D08 from 53°C to 43°C and 35°C, respectively. These lower temperatures coincide, again, with the onset of melting of the reduced KG1 D08 (see Figure 10C).
Quite unexpectedly, the disulfide bond formation in KG1 D08 did not require an addition of any PDI (Figure 12). The presence of GSSG as an oxidant was sufficient, and even the temperature optimum (52°C) of the reaction did not change when the enzymes were omitted. GSSG was, however, superior to cystine as an oxidant, leading to less aggregates and a more complete formation of the intramolecular disulfide bond (Figure 12). This can be explained by a higher hydrophilicity of a covalent intermediate with glutathione as compared to a cysteinylated species and thus a lower probability of aggregation. In any case, either treatment (with or without enzyme) allows for complete disulfide bonding and is thus far superior to the alternative of VHH expression in E. coli Shuffle, which yielded only 10-20% disulfide-bonded KG1 D08 (Figure 10C).
The treatment of a VHH at elevated temperatures might appear harsh. Nevertheless, it does not compromise function. KG1 D08 with post-production disulfide-bonding bound its target equally well as the initially reduced form, with a KD of ~2 nM to the human Nup133 [3-propeller and with a low picomolar KD to the Xenopus antigen (Figure 13).
The inventors developed KG1 D08 for imaging applications, expressed it under reducing conditions with ectopic cysteines, which in turn were modified with fluorophore-maleimides. This procedure left the structural cysteines non-modified but reduced. The conjugate performed very well in imaging (Figure 1 and 2) but was instable and sensitive to freeze-thaw cycles (Figure 5). A post-production, postlabelling disulfide bonding in the labelled VHH (Figure 14) solved this problem completely and yielded an imaging reagent that performed very well in immunofluorescence even after numerous freeze-thaw cycles (Figure 15).
A final example is Nb116 (SEQ ID NO: 53) - a secondary VHH directed against the anti-rabbit IgG Fc fragment (Table 1 ). In labelled form, it allows, for example, to use primary rabbit anti-Nup antibodies for imaging NPCs. When expressed in NEB Shuffle, this VHH can reach up to 50% disulfide-bonding. A post-production treatment at 60°C allows for a quantitative conversion into a hyperthermostable, disulfide-bridged form. Thus, the treatment strategy disclosed here allows for an excellent stabilization of fluorophore-labeled VHHs that initially had a reduced structural disulfide bond. It is a generally applicable procedure, requiring only GSSG (or a similar oxidant), a matching of the incubation temperature to the melting temperature of the VHH, and in some cases the help of PDI enzymes, such as DsbA or DsbC from Escherichia coli that are remarkably resistant against thermal denaturation.
The VHH antibodies may be used for imaging applications, e.g., confocal laser scanning microscopy or stimulated emission depletion (STED) microscopy. They were found to be cross-reactive with NPCs from the frog Xenopus laevis. For staining, two or more, e.g., three VHHs labelled with different labelling agents such as fluorophores may be combined, demonstrating their utility in multi-color co-localizations.
In some embodiments, VHH antibodies are combined into sets comprising a plurality of VHH antibodies.
Further, the inventors noted that the stability, e.g., the thermostability of VHH antibodies may be improved by providing VHH antibodies that are quantitatively oxidized and form an intramolecular structural disulfide bond between the two structural cysteines in the VHH sequence.
VHH antibodies
The present invention relates to a VHH antibody, which is a monovalent heavy chain- only antibody comprising a CDR1 domain, a CDR2 domain and a CDR3 domain linked by framework regions including, but not being limited to, whole VHH antibodies, e.g. native VHH antibodies comprising framework regions derived from camelids, and modified VHH antibodies comprising modified framework regions, VHH antibody fragments and VHH antibody fusion proteins, e.g. a fusion protein with an immunoglobulin or non-immunoglobulin peptide or polypeptide, as long as it shows the properties according to the invention.
The present invention is also directed to a covalent or non-covalent conjugate of a VHH antibody molecule to a non-proteinaceous structure, for example, a labelling agent, a capture group such a solid phase-binding group, or an effector group such as a toxin. For example, the heterologous moiety may be from a fluorescence group, biotin, an enzyme such as a peroxidase, phosphatase, or luciferase, a hapten, an affinity tag, or a nucleic acid such as an oligonucleotide.
The VHH antibody of the present invention is particularly a monoclonal VHH antibody characterized by a specific amino acid sequence. The VHH antibody may be produced in a prokaryotic host cell, a yeast cell or a mammalian cell. In certain embodiments, the VHH antibody is non-glycosylated. In certain embodiments, the VHH antibody is glycosylated, wherein a carbohydrate structure may be derived from a glycosylation site introduced into the VHH sequence and/or from a fusion partner.
A VHH antibody according to the present invention is characterized by (i) a CDR3 sequence, (ii) a combination of a CDR1 sequence, a CDR2 sequence, and a CDR3 sequence, (iii) by a complete VHH sequence, or (iv) by competition with a specific reference antibody. Specific CDR and VHH sequences are provided in the Tables, Figures and the Sequence Listing. According to the present invention, sequences related to the above sequences are encompassed. These related sequences are defined by having a minimum identity to a specifically indicated amino acid sequence, e.g., a CDR or VHH sequence. This identity is indicated over the whole length of the respective reference sequence and may be determined by using well-known algorithms such as BLAST.
In particular embodiments, a related CDR3 sequence has an identity of at least 80% or at least 90% or at least 95% to a specifically indicated CDR3 sequence, e.g., a substitution of 1 , 2, or 3 amino acids.
In particular embodiments, a related combination of a CDR1 sequence, a CDR2 sequence, and a CDR3 sequence has an identity of at least 80% or at least 90% or at least 95% to a specifically indicated combination of a CDR1 sequence, a CDR2 sequence, and a CDR3 sequence, e.g., a substitution of 1 , 2, 3, 4, 5 or 6 amino acids by different amino acids. In particular embodiments, a related VHH sequence has an identity of least 70%, at least 80%, at least 90%, at least 95% or at least 98% to a VHH sequence, e.g., a substitution of 1 , 2, 3, 4, 5 or up to 20 amino acids.
In certain embodiments, the invention relates to VHH antibodies which compete with a VHH reference antibody for the binding to the respective target antigen, e.g., a component of the NPC.
In certain embodiments, the invention relates to VHH antibodies which bind the same or an overlapping epitope of the respective target antigen, e.g., the respective component of the NPC as a VHH reference antibody.
In particular embodiments, the invention relates to a VHH antibody recognizing Nup358 which competes with the VHH antibody xhNup358-Nb2t (SEQ. ID NO: 25) for the binding to Nup358 and/or which binds to the epitope of Xenopus Nup358 and/or human Nup358 indicated in Fig. 3C (by bold letters).
In further particular embodiments, the invention relates to a VHH antibody recognizing Nup133 which competes with the VHH antibody KG1 C05 (SEQ. ID NO: 1 ) for the binding to Nup133 and/or which binds to the epitope of human Nup133 indicated in Fig. 4C (by bold letters).
In further particular embodiments, the invention relates to a VHH antibody recognizing Nup133 which competes with the VHH antibody KG1 D08 (SEQ. ID NO: 5) for the binding to Nup133 and/or which binds to the epitope of human Nup133 indicated in Fig. 4C (by bold letters).
Further, the present invention relates to a nucleic acid molecule, e.g., a DNA molecule, encoding a VHH as indicated above, or a vector, comprising said nucleic acid molecule as indicated above in operative linkage with an expression control sequence, particularly with a heterologous expression control sequence. Furthermore, the invention relates to a cell comprising a nucleic acid molecule or a vector as described above. Vectors for the recombinant production of VHH antibodies are well-known in the art. In certain embodiments, the vector is an extrachromosomal vector. In other embodiments, the vector is a vector for genomic integration. The cell may be a known host cell for producing antibodies or antibody fragments, e.g., a prokaryotic cell such as an E. coli or a Bacillus sp. cell, a yeast cell, particularly a Pichia yeast cell, an insect cell, or a mammalian cell, e.g., a CHO cell, or a plant cell. In certain embodiments, the cell comprises the nucleic acid or the vector extrachromosomally. In other embodiments, the cell comprises the nucleic acid or the vector integrated into the genome, e.g., as a genomically integrated expression cassette.
A particular aim of the invention has been to generate stable VHH antibodies useful for imaging mammalian NPCs. The inventors prepared VHH antibodies specifically directed against a component of a mammalian nuclear pore complex (NPC) selected from the group comprising Nup133, Nup358, Nup155, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer. In particular embodiments, the VHH antibodies are specifically directed against a component of a human nuclear pore complex (NPC) selected from the group comprising human Nup133, human Nup358, human Nup155, human Nup93, human Nup35, human Elys, and the human Nup214 Nup88 Nup62 heterotrimer. In even more particular embodiments, the VHH antibody recognizes Nup133 [3-propeller, particularly human Nup133 [3-propeller.
In some embodiments, the component of the human NPC is selected from human Nup133 (UniProt #ID: Q8WUM0), human Nup358 (UniProt #ID: P49792), human Nup155 (UniProt #ID 075694), human Nup93 (UniProt #ID: Q8N1 F7), human Nup35, (UniProt #ID:Q8NFH5), human Elys (UniProt #ID Q8WYP5), and the human Nup214 (UniProt #ID: P35658) Nup88 (UniProt #ID: Q99567) Nup62(UniProt #ID: P37198) heterotrimer. In particular embodiments, the component of the human NPC is Nup133 [3-propeller.
Specific embodiments of such VHH antibodies are disclosed herein.
A further aim of the invention has been to generate stable VHH antibodies against the Fc region of an antibody, e.g., a rabbit IgG antibody useful as secondary detection reagent in imaging applications.
A specific embodiment of such VHH antibodies is disclosed herein.
The antibodies were produced recombinantly and modified with labelling agents, e.g., fluorophores, which were attached to solvent-accessible ectopic cysteines introduced into the antibody sequence. The term „ectopic“ means that the cysteine has been added to the sequence and was not present in the original VHH sequence. The term “solvent-accessible” means the cysteine is accessible to the surrounding medium and thus to the attachment of a labelling agent when the VHH antibody is in a folded state. In some embodiments, the VHH antibody comprises 1 , 2 , 3, or 4 to solvent-accessible ectopic cysteines. A solvent-accessible ectopic cysteine residue may be located in the N-and/or C-terminal region and/or in the folded part of the VHH antibody, avoiding the paratope regions.
In particular embodiments, the VHH antibody comprises at least one heterologous cysteine-containing amino acid sequence at the N-terminus and/or at the C-terminus of the VHH sequence. The heterologous cysteine-containing amino acid sequence typically has a length of up to about 20 amino acids, e.g., about 1 to about 20 amino acids, or about 4 to about 10 amino acids.
In some embodiments, the heterologous amino acid sequence comprises one cysteine. A cysteine present in the heterologous amino acid sequence is an ectopic cysteine, particularly a solvent-accessible ectopic cysteine. In some embodiments, the heterologous cysteine-containing amino acid sequence is flexible and/or comprises hydrophilic amino acids, e.g., amino acids selected from Gly, Ser, Thr, Gin, Asn, Glu, and Asp, particularly from Gly, Ser, Thr and Glu.
In particular embodiments, the VHH antibody comprises a heterologous cysteine- containing amino acid sequence at the N-terminus and a heterologous cysteine- containing amino acid sequence at the C-terminus of the VHH sequence.
In some embodiments, the VHH antibody further comprises at least one heterologous tag-containing amino acid sequence, e.g., for purification. In some embodiments, the tag-containing amino acid sequence is a poly-His sequence comprising up to about 20 histidine residues or even more, e.g., a His-SUMO or a His-NEDD8 tag. In some embodiments, the tag-containing amino acid sequence is cleavable, e.g., by a protease under conditions where the residual VHH antibody remains intact.
In some embodiments, the heterologous amino acid sequence comprises a heterologous tag-containing amino acid sequence, particularly a cleavable tagcontaining amino acid sequence and at least one heterologous cysteine-containing amino acid sequence.
In some embodiments, the VHH antibody carries a labelling agent. The labelling agent may be any compound to be known in the art for labelling, e.g., detecting and/or immobilizing a polypeptide. Examples of labelling agents are fluorophores, biotin, DNA oligonucleotides, enzymes, electron spin resonance (EPR) probes, or groups for immobilization to a chromatographic support. The labelling agent is preferably attached to a solvent-accessible ectopic SH group on the VHH antibody.
The labelling agent may be attached to the VHH antibody at as a thiol-reactive compound, e.g., an maleimide-, iodoacetamide- bromoacetamide- or acrylamide- activated compound to a solvent-accessible ectopic SH group on the VHH antibody.
Stability
For the intended applications, a VHH antibody has to survive long-term storage and continued use under various conditions: at 4°C, freeze-thaw cycles, changes in temperature without a loss of activity or aggregation.
A good predictor for stability is thermostability, which can be measured, e.g., by thermal shift assays or specifically by differential scanning fluorimetry.
In a particular embodiment, the invention relates to a VHH antibody, which is stable, particularly thermostable. Preferably, the VHH antibody has a melting point (melting temperature) of at least about 65°C, of at least about 80°C, of at least 90°C or of at least about 95°C, and/or an aggregation temperature of at least about 50°C, of at least about 60°C, of at least 70°C or of at least about 80°C when measured under nonreducing conditions. Melting and aggregation temperatures are determined as described herein.
In particular embodiments, the invention relates to a stable VHH antibody that is thermostabilized which comprises two structural cysteines that are quantitatively oxidized and form an intramolecular disulfide bond. The term “quantitatively” means that the oxidized form with an intramolecular disulfide bond is present in a VHH antibody preparation in an amount of at least about 85%, at least 90% or at least about 95% as measured by non-reducing gel electrophoresis, as shown in the figures.
Sets of VHH antibodies
In a further aspect, the present invention relates to a set comprising at least 2, 3, 4 or more of the above VHH antibodies. In such a set, the individual VHH antibodies are present in suitable molar ratios. Typically, the molar ratios are in the range of about 2:1 to about 1 :2, particularly about 1.5:1 to about 1 :1.5, even more particularly about 1 :1. In certain embodiments, the VHH antibody set may comprise a single composition wherein the VHH antibodies in said set consist of a predetermined number of different species of VHH antibodies as described above. The VHH antibody set may comprise a plurality of compositions each comprising a different species of VHH antibody as described above. The set of the present invention may be free from other VHH antibodies.
In some embodiments, the set of VHH antibodies comprises at least 2, e.g., 2, 3, 4, or
5 VHH antibodies each recognizing a different component of a mammalian, e.g., human nuclear pore complex (NPC) selected from the group comprising Nup133, Nup358, Nup155, Nup93, Nup35, Elys and the Nup214 Nup88 Nup62 heterotrimer.
In some embodiments, the set of VHH antibodies comprises at least 2, e.g., 2, 3, 4, 5,
6 or 7 VHH antibodies selected from:
- a VHH antibody recognizing Nup133;
- a VHH antibody recognizing Nup155
- a VHH antibody recognizing Nup358;
- a VHH antibody recognizing Nup93;
- a VHH antibody recognizing Nup35;
- a VHH antibody recognizing Elys and
- a VHH antibody recognizing the Nup214 Nup88 Nup62 heterotrimer.
In particular embodiments, the set comprises a VHH antibody recognizing Nup133 [3- propeller, e.g., KG1 D08 (SEQ. ID NO: 1 ) or KG1 C05 (SEQ. ID NO: 5) or a variant thereof.
In specific embodiments, the set comprises VHH antibodies selected from:
- a VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing Nup358, a VHH antibody recognizing Nup93, a VHH antibody recognizing Nup35; and a VHH antibody recognizing the Nup214 Nup88 Nup62 heterotrimer;
- a VHH antibody recognizing Nup133 [3-propeller Nup133, a VHH antibody recognizing Nup358, a VHH antibody recognizing Nup93, a VHH antibody recognizing Nup35; a VHH antibody recognizing the Nup214 Nup88 Nup62 heterotrimer; a VHH antibody recognizing Nup155 and a VHH antibody recognizing Elys; - a VHH antibody recognizing Nup133 [3-propeller, and a VHH antibody recognizing Nup93;
- VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing Nup93, a VHH antibody recognizing Nup155 and a VHH antibody recognizing Elys;
- a VHH antibody recognizing Nup358 and a VHH antibody recognizing Nup35;
- a VHH antibody recognizing Nup358 and a VHH antibody recognizing Nup35, a VHH antibody recognizing Nup155 and a VHH antibody recognizing Elys;
- a VHH antibody recognizing Nup133 [3-propeller, and a VHH antibody recognizing the Nup214 Nup88 Nup62 heterotrimer;
- a VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing the Nup214 Nup88 Nup62 heterotrimer, a VHH antibody recognizing Nup155 and a VHH antibody recognizing Elys;
- a VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing Nup358, and a VHH antibody recognizing Nup35;
- a VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing Nup358, a VHH antibody recognizing Nup35, a VHH antibody recognizing Nup155 and a VHH antibody recognizing Elys;
- a VHH antibody recognizing Nup133 [3-propeller, a VHH antibody recognizing Nup358, and a VHH antibody recognizing Nup93;
- a VHH antibody recognizing Nup133, a VHH antibody recognizing Nup358, a VHH antibody recognizing Nup93, a VHH antibody recognizing Nup155 and a VHH antibody recognizing Elys.
In some embodiments, VHH antibodies in a set may be conjugated to different labelling agents, e.g., compatible fluorophores of different spectral properties such as excitation and/or emission properties. These sets may be used to generate 2D and 3D multicolor nanoscopic patterns that can be used for benchmarking super-resolution fluorescence microscopes. Alternatively, individual VHHs can also be combined when carrying the same or spectrally similar labelling agents, e.g., fluorophores, in order to obtain an additive, stronger signal.
Production of VHH antibodies
VHH antibodies may be produced by methods well known in the art. A VHH antibody may be recombinantly produced in a suitable host cell, e.g., in a prokaryotic or eukaryotic host cell or host organism. For this purpose, a nucleic acid molecule encoding the VHH antibody is introduced into the host cell or host organism and expressed in the host cell or host organism. The VHH antibody may be obtained from the host cell or the culture medium according to known procedures.
In some embodiments, the VHH antibody may be produced in bacteria or yeast, e.g., Pichia pastoris, Saccharomyces cerevisiae, or Hansenula polymorpha, may be preferred.
In some embodiments, the VHH antibody is recombinantly produced in a bacterium, e.g., E. coli or Bacillus. For example, expression in a bacterium may involve cytoplasmic and/or periplasmic expression and purification of the VHH antibody from the host cell, or secretory expression and purification of the VHH antibody from the culture medium. In certain embodiments, the nucleic acid sequence encoding the VHH antibody is fused to at least one sequence directing the expression to the periplasm and/or into the culture medium.
In particular embodiments, the present invention relates to a novel method for producing a stable VHH antibody. This method is not only applicable to the anti-NPC VHH antibodies as described herein but for any type of VHH antibody comprising two structural cysteines capable of forming an intramolecular disulfide bond. For example, this method is also applicable to anti-SARS-CoV2 VHH antibodies, e.g., VHH antibodies Re9B09 (SEQ ID NO: 60) and Re24H12 (SEQ ID NO: 61 ) and anti-rabbit Fc VHH antibody Nb116 (SEQ ID NO: 53) as shown in the Figures and Examples. This method is specifically applicable to a VHH antibody comprising two structural cysteines and further at least one solvent-accessible ectopic cysteine as described herein.
The inventors found that the structural disulfide bond of a VHH is important for its stability and that this disulfide bond can be introduced in a workflow that includes (i) expression of a VHH antibody optionally with a solvent-accessible ectopic cysteine for later labeling, under reducing conditions, e.g., cytoplasmic expression in a normal E. coli, or semi-reducing conditions, e.g., cytoplasmic expression in E. coli NEB Shuffle, (ii) VHH purification including a final reduction step to ensure an -SH state of the ectopic cysteines, (iii) modification of the ectopic (and fully exposed) cysteines with a labelling agent, e.g., a thiol-reactive labelling agent, while keeping the structural cysteines unmodified, (iv) a post-treatment in the presence of an oxidant that converts the two structural cysteines (which are buried in the hydrophobic core of the VHH) to a disulfide bond, and (v) obtaining the resulting thermostabilized VHH antibody.
Thus, a further aspect of the invention is a novel method of producing a stable VHH antibody comprising the steps:
(i) expressing a VHH antibody comprising two structural cysteines and at least one solvent-accessible ectopic cysteine in a host cell under reducing or at least partially reducing conditions,
(ii) purifying the VHH antibody obtained in step (i) from the host cell or the culture medium under conditions wherein the at least one solvent- accessible ectopic cysteine is in the reduced SH state;
(iii) optionally attaching a labelling agent to the at least one solvent- accessible ectopic cysteine under conditions while keeping the two structural cysteines unmodified,
(iv) subjecting the VHH antibody obtained in step (ii) or (iii) to an oxidation that converts the two structural cysteines to a disulfide bond, and
(v) obtaining a thermostabilized and optionally labelled VHH antibody wherein the two structural cysteines are quantitatively oxidized to a disulfide bond.
In some embodiments, the VHH antibody comprises a solvent-accessible ectoptic cysteine as herein described above, e.g., in its N-and/or C-terminal region and/or in its folded part, avoiding the paratope regions.
In some embodiments, the VHH antibody comprises at least one heterologous solvent-accessible ectopic cysteine-containing amino acid sequence at its N- and/or C-terminus, particularly a heterologous solvent-accessible ectopic cysteine-containing amino acid sequence having a length of up to about 20 amino acids.
In some embodiments, the VHH antibody further comprises at least one heterologous tag-containing amino acid sequence as herein described above.
The antibody expression in the host cell according to step (i) is carried out under reducing or at least partially reducing conditions. These conditions may comprise expression of the VHH antibody in the cytoplasm of a prokaryotic host cell such as E.coli or a eukaryotic host cell such as a yeast, protozoan, or animal cell optionally followed by a reduction.
The antibody purification in step (ii) may comprise a treatment with a reducing agent such as a thiol, e.g., DTT (dithiothreitol) or a phosphine, e.g., TCEP (tris(carboxyethyl)phosphine), followed by a removal of the reducing agent prior to an optional subsequent incubation with the labelling agent. In some embodiments, step (ii) comprises a chromatographic purification in the presence of a reducing agent.
In some embodiments, the labelling agent is a fluorophore, biotin, a DNA oligoucleotide or another labelling agent as herein desscribed above.
In some embodiments, the labelling agent is a thiol-reactive compound as herein described above, e.g., a maleimide-activated compound.
Step (iv) comprises a treatment of the VHH antibody with an oxidant. In some embodiments, a disulfide compound such as oxidized glutathione (GSSG), cystine, dithioglycolic acid or 2,2 'dithiopyridine may be used as an oxidant.
In some embodiments, step (iv) is carried out in the presence of a PDI such as DsbA from E. coli (SEQ ID NO: 57), DsbC from E. coli (SEQ ID NO: 58), or DsbG from E. coli (SEQ ID NO: 59).
Further, the inventors found the oxidation is preferably carried out under conditions wherein an at least partial thermal unfolding of the VHH antibody takes place. In this stage, the VHH antibody still comprises reduced structural cysteines.
Thus, in some embodiments, the VHH antibody is subjected to an incubation at a temperature and for a time period wherein a transient (reversible) thermal unfolding of the VHH antibody is promoted. The incubation temperature is preferably in the range between the nominal melting temperature (Tm) of the reduced form of the VHH antibody (with reduced structural cysteines) and the onset of melting of the reduced form of the VHH antibody (which is typically 10°C-15°C below Tm). An incubation temperature above the onset of melting of the reduced form is advisable only in a slow warmup-regime. An upper temperature threshold is the onset of melting of the disulfide-bonded form (which is typically 10-15°C below the nominal Tm of the disulfide-bonded form). The melting temperatures of individual VHH antibodies may vary considerably. The optimal incubation temperature of an individual VHH antibody may be determined as described in the Figures and Examples, particularly by the methods disclosed in Figures 8, 11 , 12, and 16.
The incubation during the oxidation step may involve a slow warm-up regime, e.g., involving a temperature increase of about 1 °C per min or less over a temperature range of at least 10°C, preferably of about 15°C.
The incubation time of the oxidation step can vary to great extent, e.g., between about 5 min and about 24 h, preferably between 1 h and 16 h. Typically, the incubation time needed for completing reaction correlates inversely with the incubation temperature.
In certain embodiments, the treatment considerably increases the melting temperature of a VHH antibody, e.g. by a ATm of at least 10°C, by at least 20°C, by at least 30°C or by at least 40°C, reaching stabilities with a Tm of 60°C to even hyperthermostability with a Tm of >95°C.
Table 3 lists selected anti-NPC VHH antibodies that were initially produced under reducing conditions and then stabilized by a post-production treatment with oxidized glutathione (GSSG) and Dsb enzymes as disclosed here. Note that the treatment increased the melting temperatures (Tm) by at least 14°C (xhNup35-Nb1t) or to more than 45°C (KG26C08).
Table 3
Figure imgf000034_0001
Further, the invention shall be explained in more detail by the following Figures and Examples. Figures
Figure 1 : Anti-nuclear pore complex (NPC) VHH antibodies and their application in confocal laser scanning microscopy. VHH antibodies were generated by immunizing alpacas with human as well as Xenopus antigens, constructing immune libraries from blood samples, and phage display using folded nucleoporin (Nup) domains as baits. Antigens included the N-terminal a-helical domain of Nup358 (the N-terminal a-helical domain comprising residues 1 -145), the RRM domain of Nup35, the a-solenoid of Nup93, the [3-propel ler of Nup133, full length Nup155, the [3-propeller of Elys, and the heterotrimeric coiled-coil of the Nup214 Nup88 Nup62 complex (or Nup214 complex for short). VHH antibodies were expressed in E. coli NEB Shuffle with two ectopic cysteines each (placed on N- and C-termini). These ectopic cysteines were kept reduced during purification and were modified with the fluorophore maleimides of Alexa647, Alexa488, and Alexa568.
(A) For immunofluorescence, HeLa-K cells were grown on 10-well glass slides, fixed with 2.4% paraformaldehyde for 5 minutes at room temperature (RT), and permeabilized with 0.3% TritonXIOO in PBS. Cells were then blocked with 1 % (w/v) bovine serum albumin (BSA) for 30 mins and stained with 35 nM of the indicated Alexa 647-labeled tracking nanobodies for 30 mins at RT. Finally, the excess of tracking nanobodies was washed off and cells were imaged using a Leica SP8 confocal microscope (Leica, Germany) and excitation by the 638 nm laser line. The figure shows confocal sections through the equator of the cell nuclei. The pattern of a crisp nuclear rim is typical for a nuclear pore complex (NPC) stain. Scale bar, 10 pm.
(B) Either human HeLa or Xenopus xtc cells were grown, semi-permeabilized for four minutes with 50pg/ml digitonin in transport buffer (TB; 20 mM Hepes/ KOH pH 7.3, 80 mM potassium acetate, 250 mM sucrose, 5 mM magnesium acetate, 0.5 mM EGTA), fixed for four minutes with 2.4% paraformaldehyde, permeabilized with 0.15% TritonXI OO. Reactive formaldehyde species where then quenched for 30 minutes by reduction with 10 mM dimethylamine-borane complex (in TB), and non-specific binding sites were blocked by BSA, fish gelatine and ovalbumin (2% each in TB), before applying 30 nM labelled VHH in the blocking solution for 60 minutes in blocking solution. Samples were imaged directly by confocal laser scanning microscopy after a single wash step with TB. Scale bar, 10 pm. (C) Cell nuclei were assembled from Xenopus egg extract and sperm chromatin as an assembly template. They were then fixed with paraformaldehyde (PFA), spun onto coverslips and stained with the indicated mix of three different VHH antibodies labeled with Alexa488, Alexa568 and Alexa647-maleimide, respectively. Confocal scans were recorded sequentially. Scale bar, 5 pm (upper panels, equatorial scan) and 1 pm (lower panels, scan of nuclear surface).
Figure 2: Application of anti-NPC VHHs in super-resolution microscopy. Immunofluorescence was performed as described in Figure 1 with the following modifications: AbberiorStar 635 maleimide was used for labeling, cells were mounted in SlowFade Gold (Thermo Fisher Scientific) imaging medium to protect the dyes from photobleaching, images were acquired with a STEDycon microscope (Abberior Instruments) using the 640 nm laser and deconvoluted using the Huygens Professional software (version 19.10) with a saturation factor of 80 and an immunity factor of 1. Images reveal the typical ring-like NPC structure originating from their 8- fold rotational symmetry. Scale bar, 500 nm.
Figure 3: Crystal structure of xhNup358-Nb2t bound to the Xenopus Nup358 NTD. The complex was produced by recombinant expression and purification, it was crystallized and subjected to structural analysis by x-ray crystallography.
(A) Cartoon representation of the solved structure. The VHH is shown in green. Sidechains of the paratope are shown as sticks with atoms colored according to elements. The Nup358 N-terminal domain is depicted in gray, the epitope in orange. Sidechains of the epitope are shown as sticks.
(B) Sequence of xhNup358-Nb2t with paratope residues highlighted in bold.
(C) Sequence of the Xenopus and human Nup358 NTD with epitope residues highlighted in bold. The epitope residues of the Xenopus domain were determined by x-ray crystallography. Epitope residues of the human domain were derived from a homology model, based on the Xenopus structure. Figure 4: Crystal structure of human Nup133 [3-propeller bound to VHHs KG1C05 and KG1 D08. The complex was produced by recombinant expression, purified, crystallized and subjected to structural analysis by x-ray crystallography.
(A) Surface representation of the solved structure. The KG1 D08 is shown in green, KG1 C05 in orange, the [3-propeller in gray.
(B) Sequences of the VHH antibodies with paratope residues being highlighted in bold.
(C) Sequence of the human Nup133 [3-propeller shown with the KG1 C05 epitope (upper) or the KG1 D08 epitope (lower) highlighted in bold.
Figure 5: Sensitivity of cytoplasmically expressed VHH KG1 D08 to repeated freeze-thaw cycles. Immunofluorescence of HeLa cells was performed similarly to Figure 1 , but with a few modifications. Cells were first semi-permeabilized with 30 pg/ml digitonin in ‘transport buffer’ (20 mM HEPES/ KOH pH 7.5, 3.5 mM MgAc, 110 mM KAc, 0.5 mM EGTA, 250 mM sucrose) for 5 minutes at room temperature. They were then incubated with 40 nM anti-Nup133 VHH KG1 D08 expressed in NEB Shuffle and labeled with AbberiorStar 635. On the left, the VHH was frozen once (as a 20pM stock in PBS plus 20% glycerol) in liquid nitrogen and thawed at room temperature immediately before the experiment. On the right side, the VHH was frozen and thawed six more times after a 4-fold dilution in transport buffer. Note that the repeated freezing and thawing caused a severe loss of staining activity. This loss is probably due to the irreversible denaturation of KG1 D08 molecules that were not stabilized by the structural disulfide bond. The low residual activity is probably due to a small (~10-20%) fraction of disulfide-bonded VHH formed during expression in NEB Shuffle (see below, figure 8C).
Figure 6: Disulfide bonding state of VHHs dependent on the mode of expression in Escherichia coli. VHH antibody Re24H12 (directed against the receptor binding domain of SARS-CoV-2) was expressed in three ways: in the reducing cytosol of NEB Express, the partially oxidizing cytosol of NEB Shuffle, and under the oxidizing conditions of the periplasm. The disulfide bonding of these preparations was then elucidated by SDS polyacrylamide electrophoresis (SDS PAGE) under non-reducing conditions (keeping any formed disulfide bonds intact), each in comparison to a sample prior reduced by dithiothreitol (DTT). Gel-staining was performed with Coomassie Brilliant Blue G250. The disulfide bond-containing VHH (**, lower band) migrates faster than the corresponding reduced form (*, upper band). The analysis revealed that cytoplasmic production in NEB Express gave a VHH with fully reduced cysteines, while cytoplasmic expression in Shuffle resulted in ~30% bond formation. Only the periplasm ically expressed species was quantitively disulfide-bonded.
Figure 7: Enzymatic post-production disulfide bond formation. The anti-SARS- CoV-2 VHH antibody Re9B09 was produced cytoplasmically in NEB Express as described in Figure 4. It was thus initially fully reduced. Left: A 35 pM VHH stock in Dsb buffer (50 mM Tris/ HCI pH 8.0, 150 mM NaCI) was then incubated for 30 minutes at 37°C with the indicated additives, namely 2 mM oxidized glutathione (GSSG) as an oxidant, and 1.5 pM of the E. coli thiol: disulfide exchange proteins DsbA, DsbC, or DsbG (concentrations refer to the enzyme monomers). Samples were then analyzed by reducing and non-reducing SDS PAGE as described in Figure 4. The incubation with GSSG alone resulted in an incomplete formation of the structural disulfide bond as well in higher molecular weight aggregates. In the presence of DsbA or DsbC, disulfide bond formation was more complete, and less aggregates were observed. Right: incubations were as on the left side, but the incubations included a slow warmup over 45 minutes from 20°C to 37°C and a longer (60 minutes) incubation at 37°C. This regime allowed a quantitative disulfide bond formation in the presence of DsbA or DsbC without aggregation. DsbG had a partially positive effect on disulfide bond formation and suppression of aggregation.
Figure 8: Treatment temperature and treatment time as key parameters for optimal post-production disulfide bond formation. Fully reduced Re24H12 was produced by cytoplasmic expression in NEB express as described above. A mixture of 35 pM VHH, 2 mM GSSG, and 1.5 pM each of DsbA, DsbC, and DsbG was prepared in Dsb buffer and placed in 20 pl aliquots into a gradient thermocycler. Within 45 minutes, the samples were linearly heated to either 30°C, 32°C, 35°C, 39°C, 43°C, 48°C, 52°C, 57°C, 61 °C, 65°C, 68°C, or 70°C. The end temperature was then kept for either 5 minutes, for one hour, or overnight (16 hours), before returning to 20°C. Samples were subsequently analyzed by non-reducing SDS PAGE for disulfide bonding. For the short treatment (5 minutes hold time), an end temperature of 65°C was required to convert VHH Re24H12 quantitatively to the disulfide-bonded form. For the medium-length treatment, 61 °C was sufficient. This temperature optimum dropped to 48°C for a 16 hours-treatment.
Figure 9: Melting behavior of VHH Re24H12. The VHH was prepared as indicated and as described in Figure 4. To determine the melting temperatures of the VHH in these preparations, differential scanning fluorimetry (DSF, Thermofluor) was performed, using SYPRO orange (1x, Invitrogen) as a fluorescent unfolding indicator, 20pl sample volume, and a temperature increase of 1 °C every 45 seconds from 20°C to 95°C. Periplasmically expressed Re24H12 showed no melting at all, indicating hyperthermostability. The fully reduced form melted at 56°C (as defined by the inflection point of the melting curve). Note that this temperature is close to the optimal treatment temperature for disulfide bonding of this VHH in the fast-treatment protocol (5 or 60 minutes). The onset of melting occurred at ~48°C, which in turn coincides with the optimal treatment temperature in the overnight protocol.
Figure 10: Melting behavior of VHH KG1 D08. A) Melting analysis was as described in Figure 9. Plots of the fluorescence signals against temperature are shown. B) Same as A, but the first derivatives are being shown. The minima mark the respective melting temperatures (46°C for fully reduced KG1 D08 and 68°C for the fully disulfide-bonded form). C) Analysis of disulfide bonding by non-reducing SDS-PAGE. Cytoplasmic expression in NEB Express resulted in a fully reduced VHH, cytoplasmic expression in NEB Shuffle in ~10-20% disulfide bonding, and cytoplasmic expression in NEB Express followed by a treatment with GSSG resulted in a quantitative formation of the structural disulfide bridge.
Figure 11 : Optimal treatment temperatures for enzymatic post-production disulfide bonding of VHH KG1 D08. Optimal conditions for introducing the structural disulfide bond in the initially fully reduced KG1 D08 were elucidated as described for Re24H12 in Figure 6, again in the presence of 2 mM GSSG, and 1.5 pM each DsbA, DsbC, and DsbG. Note that the optimal temperature for the overnight treatment (35°) approximates the onset of melting of the fully reduced VHH, while the optimal endpoint temperature (43-52°) in the fast-treatment (5-60 minutes) approximates the nominal melting point of 46°C. The overnight treatment at lower temperature appears superior since less aggregates are formed.
Figure 12: Non-enzymatic disulfide bridging in KG1 D08. Left: experiment was performed as in Figure 9 (holding the endpoint temperature for 5 minutes) but without the Dsb enzymes. Note that the disulfide bond formation in this particular VHH was as efficient as in the presence of the enzymes. Right: same experiment but using cystine (oxidized cysteine) instead of GSSG as an oxidant. This had essentially the same effect but resulted in more aggregates.
Figure 13: Affinities of reduced and post-production disulfide-bridged KG1 D08 for its Nup133 [3-propeller target. KG1 D08 was expressed with two additional cysteines at its N- and C-terminus in the cytoplasm of NEB Express. After purification, these two exposed cysteines were modified with Biotin-PEG11 -maleimide (Iris Biotech). Half of the preparation was treated with 2 mM GSSG, 1.5 pM each DsbA, DsbC, and DsbG for 5 minutes at 52°C with 45 minutes heat up time, resulting in quantitative disulfide bonding.
The biotinylated VHHs were then immobilized for biolayer interferometry to High precision streptavidin sensors of an Octet Red96 machine (to a binding signal of 1 nm), using PBS+ 1 % BSA as an assay buffer. Loaded sensors were then dipped for 800 seconds into 40 nM solutions of the human or the Xenopus Nup133 [3-propeller to measure association, and subsequently dipped into buffer only to measure dissociation. Dissociation constants were computed using the Octet software. KG1 D08 bound the human propeller with a Kd of ~2 nM, and the Xenopus [3-propeller with a Kd probably better than 10 pM, and there was no obvious difference between the reduced and the disulfide-stabilized VHH.
Figure 14: Disulfide bond formation in fluorophore-labelled KG1 D08. KG1 D08 was produced in fully reduced form with two additional cysteines as described above and labelled AbberiorStar 635 maleimide to a density of labelling of 2. The labelled VHH was then treated with 2 mM GSSG, 1.5 pM each DsbA, DsbC, and DsbG for 5 minutes at 52°C with 45 minutes heat up time, resulting in quantitative disulfide bonding. Analysis was by reducing/ non-reducing SDS PAGE followed by fluorescence detection and by Coomassie staining.
Figure 15: Resistance of fluorophore-labelled KG1D08 towards freeze-thaw cycles following stabilization with its structural disulfide bond. Immunofluorescence was performed as in Figure 3, the only difference being that the AbberiorStar 635-labelled VHH was used after quantitative disulfide bonding as documented in Figure 12. Note that the stabilized VHH survived not only 7 but 13 freeze-thaw cycles without any loss in activity.
Figure 16: Quantitative introduction of a stabilizing disulfide bond into the anti- rabbit IgG VHH Nb116. The VHH was produced cytoplasm ically in NEB Shuffle, resulting in 50% disulfide bridge formation. This preparation was then tested for conditions allowing a quantitative disulfide bonding as described in Figures 6 and 9. 50 pM VHH was supplemented with 2 mM GSSG, and 1.5 pM each of DsbA, DsbC, and DsbG, and heated within 45 minutes from 20°C to either 25°C, 27°C, 30°C, 34°C, 38°C, 43°C, 47°C, 52°C, 56°C, 60°C, or 63°C and keeping the end temperature for 5 minutes. An end temperature of 60°C allowed quantitative disulfide bonding.
Examples
The details for the experiment shown in Figure 1 were as follows: Cytoplasmic expression was performed either in E.coli NEB Express (NEB #C3037l) or NEB Shuffle (NEB #C3028J) with IPTG induction, using a plasmid encoding a Hisu- NEDD8-VHH fusion (Pleiner et al., 2015). Cell lysates were prepared by sonication and ultracentrifugation, and the fusion was bound to a Ni2+ chelate matrix. After extensive washing, the VHH was eluted by cleaving the N-terminal Hisi4-NEDD8 tag with bdNEDPI protease (Frey and Gorlich, 2014a, 2014b). Alternatively, Re24H12 was expressed with a cleavable N-terminal DsbA secretion signal and a C-terminal spacer-Hisi2 tag. It was purified by Ni2+ chelate chromatography from the periplasmic fraction (obtained by an osmotic shock). The C-terminal tag was not removed, resulting in a slower migrating species.
The three VHH preparations were then analyzed by SDS PAGE after (denaturing) alkylation of free cysteines with 50 mM iodoacetamide (supplied as a 100 mM stock in 100% formamide). This treatment leaves any formed disulfide bond intact and protects such bond against re-arrangements during sample preparation or electrophoresis. DTT-reduced control samples were obtained by denaturing reduction with 20 mM DTT + 2% SDS for one minute at 95°C, followed by alkylation with 100 mM iodoacetamide (from a 500 mM stock in water) and the addition of 100 mM Tris base (from a 2 M stock) to neutralize the released hydrogen iodide. A disulfide-bonded species shows a characteristic size shift between the two conditions on the SDS-gel.
All other experiments are illustrated by the description of the invention, figures and the corresponding legends.
Sequences
In the following, the VHH sequences of VHH antibodies described herein (without ectopic cysteines), PDI enzymes and human (h) or frog (x) NPC antigens described herein are listed.
>KG1 D08 (SEQ ID NO: 1 )
QVQLVESGGGLVQAGGSLRLSCAASGRSFRGNIMAWFRQTPGKERLFVASITGSG YTSYENSVKGRFTISRDSARDTVDLQMTTLAPEDTAVYYCAGRFRGGHNRMPDAY EYWGQGTQVTVSS
>KG1 C05 (SEQ ID NO: 5)
QVQLVESGGGLVQAGGSLRLACATSGILLSKAVMDWYRQIPGKQRELVARTGIRDS ATYAD FVKG RFTVS R E N E N NTVYLQM N S LQ P E DAG LYVC KAAVTGVFG RLS E H WG QGTQVTVSS
>KG2E04 (SEQ ID NO: 9)
QVQLVESGGGLVQAGGSLRLSCAASGRGFSGYTWGWFRQVPGKDRTFVAAMSWI TGSTYYADSVKGRFTISGDNAKNTLLLQMDNLKPNDTAVYYCAARSKVSPDYDIWG QGTQVTVSS
>KG2B08 (SEQ ID NO: 13)
QVQLVESGGGLVQAGGSLRLSCAASGRGFSGYTWGWFRQVPGKERTFVAAMSWI TGSTYYADSVKGRFTISGDNAKNTLLLQMNNLKPGDTAVYYCAARSKVSYDYDIWG QGTQVTVSS
>KG2B12 (SEQ ID NO: 17)
QVQLVESGGGLVQAGGSLRLSCAASGRGFSGYTWGWFRQVPGKERTFVAAMSWI TGSTYYADSVKGRFTISGDNAKNTLLLQMNNLKPGDTAVYYCAARSKVSYDYDIWG QGTLVTVSS >Re3E01 (SEQ ID NO: 21 )
QVQLVESGGGLVQPGGSLRLSCAASGFTFTDYLMAWYRQAPGNQRQLVAYITSDG
STVYASSARGRFTISRDNAKNTVTLQMNSLLLDDTAVYYCSAKSGLKDYYGQGTQV TVSS
>xhNup358-Nb2t (SEQ ID NO: 25)
QVQLVESGGGLVQPGGSLRLSCAASGRPLSDYAMGWFRQAPGKEREFVAAISWK
GGETFYAGSVKGRFTISRDDAKNSLYLQMNNLKLEDTAEYSCAAVLGSPHYSGTHY YPAEYDYWGQGTQVTVSS
>xhNup93-Nb3t (SEQ ID NO: 29)
QVQLVESGGGWQTGDSLMLSCLFSGRPGRVFGHYLMGWFRQIPGKERDVVAAIS
FSGDPTYYADSVKGRATISRDNAKNTVYLQMNGLKSEDTAVYYCAADRLPYGDSW ASKDEYDYWGQGTQVTVSS
>xhNup35-Nb1t (SEQ ID NO: 33)
QVQLVESGGGLVQAGGSLRLSCVGTGNISSAYTMAWYRQAAGKEREVVAGILNGG STHYADSVKGRFTISRDNAKNTVYLQMNSLQPEDTGVYCCHWIESTRFVYDHYW GQGTRVTVSS
>Bm53C05 anti-Nup155 (SEQ ID NO: 37)
QVQLVESGGGSVQAGGSLILSCETSGRAISDYLMAWFRQAPGKEREFVAAISRNGS
GTRYRDSVKGRFTISRENAKNSVFLQMSDLKPEDTAVYYCAANRGSTYYFNYEYW GQGTQVTVSS
>KG26F06 anti-xhElys (SEQ ID NO: 41 ) QVQLVESGGGLVHTGDSLRLSCAASGLDLSRVGISWIRQPPGRGLEWVAKILADGT GAFYADFVKGRFTISKDSTKNTLYLQMDNLDAEDTAMYYCALGLVQDSQGLVLSSR ARGQGTQVTVSS
>KG26E04 anti-xhElys (SEQ ID NO: 45)
QVQLVESGGGLVQPGGSLRLSCAYSGLDLSRVGLSWIRQPPGRGLEWVSKILNNG SNAAYADSVKGRFTVSRDNAKNTVYLQMNDLQFEDTALYYCALGLVQDSQGWLS VRARGQGTQVTVSS
>KG26C08 anti-xhElys (SEQ ID NO: 49)
QVQLVESGGGLVQPGGSLRLSCAVSGVDLSRVGVSWIRQAPGRGLEWVSKILNNG TNTAYAASVKGRFTISRDNAKNTVYLQMNNLKSEDTAMYYCAQGLVQDSQGLVLSS RIRGQGTQVTVSS
>Nb116 (SEQ ID NO: 53)
QVQLVESGGGLVQPGGSLTLSCTVSRIINWTRMGWSRTAPGKQREFVANIDPSGTT NYADFVKGRFAISVNNDKRTVFLQMNGLKPEDTAVYRCFTIEPDRGTNWGQGTQV TVSS
>DsbA (SEQ ID NO: 57)
AQYEDGKQYTTLEKPVAGAPQVLEFFSFFCPHCYQFEEVLHISDNVKKKLPEGVKM TKYH VN FM GG D LG KD LTQAWAVAM ALGVE D KVTVP L FE GVQ KTQTI RSAS D I RDVF I NAG I KG E E YD AAWN S F WKS LVAQ Q E KAAAD VQ LRGVPAMFVNGKYQLNPQGMD TS N M D VF VQ Q YADTVKYLS E KK
>DsbC (SEQ ID NO: 58)
DDAAIQQTLAKMGIKSSDIQPAPVAGMKTVLTNSGVLYITDDGKHIIQGPMYDVSGTA PVNVTNKMLLKQLNALEKEMIVYKAPQEKHVITVFTDITCGYCHKLHEQMADYNALG ITVRYLAFPRQGLDSDAEKEMKAIWCAKDKNKAFDDVMAGKSVAPASCDVDIADHY
ALGVQLGVSGTPAWLSNGTLVPGYQPPKEMKEFLDEHQKMTSGK
>DsbG (SEQ ID NO: 59)
AEELPAPVKAIEKQGITIIKTFDAPGGMKGYLGKYQDMGVTIYLTPDGKHAISGYMYN
EKGENLSNTLIEKEIYAPAGREMWQRMEQSHWLLDGKKDAPVIVYVFADPFCPYCK
QFWQQARPVWDSGKVQLRTLLVGVIKPESPATAAAILASKDPAKTWQQYEASGGKL
KLNVPANVSTEQMKVLSDNEKLMDDLGANVTPAIYYMSKENTLQQAVGLPDQKTLN IIMGNK
>Re9B09 (SEQ ID NO: 60)
QVQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSRISSSD
GSTDYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCATVPGTYYSGNWYY TWH P E AVD YWG KGTQ VTVS S
>Re24H12 (SEQ ID NO: 61 )
QVQLVESGGGLVQPGGSLRLSCAASGFTLDYYAIGWFRQAPGKEREGVSYIRSSD
GTTYYADSVKGRFTISRDNAKNTVYLQMNSLKPEDTAVYYCAADEAYYSELGWESP WGWSYWGQGTQVTVSS
>hNup133J3-propeller (SEQ ID NO: 62)
SITESVNYDVKTFGSSLPVKVMEALTLAEVDDQLTINIDEGGWACLVCKEKLIIWKIAL
SPITKLSVCKELQLPPSDFHWSADLVALSYSSPSGEAHSTQAVAVMVATREGSIRYW
PSLAGEDTYTEAFVDSGGDKTYSFLTAVQGGSFILSSSGSQLIRLIPESSGKIHQHILP
QGQGMLSGIGRKVSSLFGILSPSSDLTLSSVLWDRERSSFYSLTSSNISKWELDDSS
EKHAYSWDINRALKENITDAIWGSESNYEAIKEGVNIRYLDLKQNCDGLVILAAAWHS
ADNPCLIYYSLITIEDNGCQMSDAVTVEVTQYNPPFQSEDLILCQLTVPNFSNQTAYL
YNESAVYVCSTGTGKFSLPQEKIVFNAQGDSVLGAGACGGVPIIFSRNSGLVSITSR ENVSGPG >xNup133J3-propeller (SEQ ID NO: 63)
PAASETVNYNVQLFGSSLPVKVMEALSNASADEPMAACIHEGGWAWLACNDRLIIW KISHSSSAKLMVCKELPLPLSDSEWSADLVDICAQTGDPAAAQSVALMAATPEGSS RYWPNILHEGTYIESYTEFGSSLCAFVTAVKGNSFILSSEKNQLVRLTPDASGKMNQ
RVLPQGQGMLSGIGRRVSTLFGILSPAVESTLCSVLWDKGDCFYTLTDSSINKWDLD DTSESQVLNWDMSRVLREYISDAIWGSESDYDDIKAGININYLSLNQNCDGLVILSA AWHPGDNPCQIYYTLVTVKDEGYNISDEITVEVTQFNPVFQARGMQLCQLWPNFS SQACYLYTQEMIFACSTGTGRSTLPQEKIPFEAQGDNIVGAGSCEGWPVFFIRKSG MLTVVARETAS
>hNup133_a-solenoid fragment (SEQ ID NO: 64)
ENVSILAEDLEGSLASSVAGPNSESMIFETTTKNETIAQEDKIKLLKAAFLQYCRKDL GHAQMWDELFSSHSDLDSDSELDRAVTQISVDLMDDYPASDPRWAESVPEEAPG
FSNTSLIILHQLEDKMKAHSFLMDFIHQVGLFGRLGSFPVRGTPMATRLLLCEHAEK LSAAIVLKNHHSRLSDLVNTAILIALNKREYEIPSNLTPADVFFREVSQVDTICECLLEH
EEQVLRDAPMDSIEWAEWINVNNILKDMLQAASHYRQNRNSLYRREESLEKEPEY VPWTATSGPGGIRTVIIRQHEIVLKVAYPQADSNLRNIVTEQLVALIDCFLDGYVSQLK
SVDKSSNRERYDNLEMEYLQKRSDLLSPLLSLGQYLWAASLAEKYCDFDILVQMCE QTDNQSRLQRYMTQFADQNFSDFLFRWYLEKGKRGKLLSQPISQHGQLANFLQAH EHLSWLHEINSQELEKAHATLLGLANMETRYFAKKKTLLGLSKLAALASDFSEDMLQ EKIEEMAEQERFLLHQETLPEQLLAEKQLNLSAMPVLTAPQLIGLYICEENRRANEYD FKKALDLLEYIDEEEDININDLKLEILCKALQRDNWSSSDGKDDPIEVSKDSIFVKILQ
KLLKDGIQLSEYLPEVKDLLQADQLGSLKSNPYFEFVLKANYEYYVQGQI
>xNup133_a-solenoid fragment (SEQ ID NO: 65)
TASVLPEHMEESLLSVSKSSSQAAVKDSTSRPDQIAHDDKTKLLKAAFLRCCRKDIL GAQSMVDSLFSDSDMGPDDELDQAVNQISVDLIDDYPASDPRWAESVPEEAAGFS
NTSLILLHQLEDKMKAHSFFVDFLHQVGLFSRLSTCQAKGMFVATRLLLCEHAEKLS AAIVLKNHHAKLPALVNSAIQLALDKRMCSIPQNLTAADVYFREVSQMDIIFECLVDKE EADLESTSMDSVEWANIVVNINTILKDMLHAACQYRQSKNSLYKNESGMQEPEYVP WTASSGIAGIRSWTRQHGVILKIYPQADSSLRTILIEQLAALLNYLLDDYVIQLKSVD KRTNQERYSVLEMEYAQKRSELLAPLLSLGQYAWASNLAEKYCDFDILVQICEMTD NQSRLQRYMTLFSDQNFSDFLFRWYLEKGKRGKLLSQPASQHGQLAVFLQAHEHL SWLHEVNSQEFEKAHRTLHTLANMETRYFCKKKTLLGLSKLAALASDFQEDILQEK VEEIAEQEHFLLHQETLPKQLLEEKQLDLNTMPVLSPIELIQLYICEENKRANENDFK KALDLLEYIGDDSEVDIEELKLEILCKAVKRDEWCATDGKDDPIEATKESIFVKVLQNL
LNKGIELKSYLPEAETLLQSDELSSLKTNSYFEFSLKANYEYYMKTQS
>xNup214(690-950) fragment (subunit of the Nup214-Nup88-Nup62 coiled coil heterotrimer) (SEQ ID NO: 66)
SVALENQAKVTKESDSILNGIREEIAHFQKELDDLKARTSRACFQVGSEEEKRQLRT ESDGLHSFFLEIKETTESLRGEFSAMKIKNLEGFASIEDVQQRNKLKQDPKYLQLLYK KPLDPKSETQMQEIRRLNQYVKNAVQDVNDVLDLEWDQYLEEKQKKKGIIIPERETL FNSLANHQEIINQQRPKLEQLVENLQKLRLYNQISQWNVPDSSTKSFDVELENMQK
TLSQTAIDTQTKPQAKLPAKISPVKQSQLRNFL
>xNup62(342-end) (subunit of the Nup214-Nup88-Nup62 coiled-coil heterotrimer) (SEQ ID NO: 67)
AAATG I STATAMTYAQ LE N L I N KWS LE LE DQ E KH F LQQATQVN AWD RTLM Q N GE R IT TLHREMEKVKLDQKRLDQELDFILSQQKELEDLLTPLEESVKEQSGTIYLQHADEER EKTYKLAENIDAQLKRMAQDLKEVIEHLNTSAGPGDASNPLQQICKILNAHMDSLQ WIDQNSALLQRKVEQVTKECESRRKEQERGFSIAFD
>xNup88(501 -end) (subunit of the Nup214-Nup88-Nup62 coiled-coil heterotrimer) (SEQ ID NO: 68)
STEILPHVLADVKGPFEEHIRGILRRNSANPLLLNSSSKDSSPPPEECLQLLSRATQV FREEYLLKQDLANEEIQRRVKLLIAQKEKQLEDLRYCREERKSLTETAERLAEKFEEA KEKQEDLINRLKRILRSFHTQLPVLSESERDMKKELQATNQQLQQLGNSINQVNRK MSYQEKQMEKGKSPRKSSLTLSDYQKKNIKTVLKEHGEHIQEMVKQINNIRNHVNF
>hNup214(687-951 ) (subunit of the Nup214-Nup88-Nup62 coiled-coil heterotrimer) (SEQ ID NO: 69) AVAEKQGHQWKDSDPVMAGIGEEIAHFQKELEELKARTSKACFQVGTSEEMKMLR
TESDDLHTFLLEIKETTESLHGDISSLKTTLLEGFAGVEEAREQNERNRDSGYLHLLY
KRPLDPKSEAQLQEIRRLHQYVKFAVQDVNDVLDLEWDQHLEQKKKQRHLLVPER
ETLFNTLANNREIINQQRKRLNHLVDSLQQLRLYKQTSLWSLSSAVPSQSSIHSFDS
DLESLCNALLKTTIESHTKSLPKVPAKLSPMKQAQLRNFL
>hNup62(318-end) (subunit of the Nup214-Nup88-Nup62 coiled-coil heterotrimer)
(SEQ ID NO: 70)
AAAGAAASSAMTYAQLESLINKWSLELEDQERHFLQQATQVNAWDRTLIENGEKIT
SLHREVEKVKLDQKRLDQELDFILSQQKELEDLLSPLEELVKEQSGTIYLQHADEER
EKTYKLAENIDAQLKRMAQDLKDIIEHLNTSGAPADTSDPLQQICKILNAHMDSLQWI
DQNSALLQRKVEEVTKVCEGRRKEQERSFRITFD
>hNup88(514-end) (subunit of the Nup214-Nup88-Nup62 coiled-coil heterotrimer)
(SEQ ID NO: 71 )
VAESPLRVLAETPDSFEKHIRSILQRSVANPAFLKASEKDIAPPPEECLQLLSRATQV
FREQYILKQDLAKEEIQRRVKLLCDQKKKQLEDLSYCREERKSLREMAERLADKYE
EAKEKQEDIMNRMKKLLHSFHSELPVLSDSERDMKKELQLIPDQLRHLGNAIKQVT
MKKDYQQQKMEKVLSLPKPTIILSAYQRKCIQSILKEEGEHIREMVKQINDIRNHVNF
>xNup358_N-terminal_a-helical domain (SEQ ID NO: 72)
MRRSKAELQRYIENAQNSASSPREKSMKGFLFARLYYEAKEYELAKRAVSSYISVQ
ERDPKAHRFLGQLFEIEGNVEKAVGCYKRSLELNPTQKDLVLRIAELICTLNIKDGRA
EYWVERASKLFPGSPEIYRLKEQLLSSQGE
>hNup358_N-terminal_a-helical domain(SEQ ID NO: 73)
MRRSKADVERYIASVQGSTPSPRQKSMKGFYFAKLYYEAKEYDLAKKYICTYINVQ
ERDPKAHRFLGLLYELEENTDKAVECYRRSVELNPTQKDLVLKIAELLCKNDVTDGR
AKYWLERAAKLFPGSPAIYKLKEQLLDCEGE >hNup93_a-solenoid (SEQ ID NO: 74)
SSDVGPPGRSSLDNIEMAYARQIYIYNEKIVNGHLQPNLVDLCASVAELDDKSISDM
WTMVKQMTDVLLTPATDALKNRSSVEVRMEFVRQALAYLEQSYKNYTLVTVFGNLH
QAQLGGVPGTYQLVRSFLNIKLPAPLPGLQDGEVEGHPVWALIYYCMRCGDLLAAS
QWNRAQHQLGEFKTWFQEYMNSKDRRLSPATENKLRLHYRRALRNNTDPYKRAV
YCIIGRCDVTDNQSEVADKTEDYLWLKLNQVCFDDDGTSSPQDRLTLSQFQKQLLE
DYGESHFTVNQQPFLYFQVLFLTAQFEAAVAFLFRMERLRCHAVHVALVLFELKLLLK
SSGQSAQLLSHEPGDPPCLRRLNFVRLLMLYTRKFESTDPREALQYFYFLRDEKDS
QGENMFLRCVSELVIESREFDMILGKLENDGSRKPGVIDKFTSDTKPIINKVASVAEN
KGLFEEAAKLYDLAKNADKVLELMNKLLSPWPQISAPQSNKERLKNMALSIAERYR
AQGISANKFVDSTFYLLLDLITFFDEYHSGHIDRAFDIIERLKLVPLNQESVEERVAAF RNFSDEIRHNLSEVLLATMNILFTQFKRLKGTSPSSSSRPQRVIEDRDSQLRSQART LITFAGM I PYRTSGDTNARLVQM EVLM N
>xNup93_a-solenoid (SEQ ID NO: 75)
SESGAPGRSSLDNVEMAYARQMYMYNEKVVSGHLQPSLVDLCTEAAERLDDKNVS
DLWVMVKQMTDVPLIPASDTLKSRCSGQMQMAFVRQALNYLEQSYKNYTLISVFAN
LQQAQLGGVPGTYNLVRSFLNIRLPTPIPGLQDGEIEGYPVWALIYYCMRCGDLMA
AQQWNRAQHQLGDFKNCFQEYIHNKDRRLSPTTENKLRLHYRRAVRASTDPYKR
AVYCIIGRCDVSDNHSEVADKTEDYLWLKLSQVCFEDEANSSPQDRLTLPQFQKQL
FEDYGESHFAVNQQPYLYFQVLFLTAQFEAAIAFLFRLERTRCHAVHVALALFELKLL
LKSTGQSAQLLSQEPGEPQGVRRLNFIRLLMLYTRKFEPTDPREALQYFYFLRNEK DNQGESMFLRCVSELVIESREFDMLLGKLEKDGSRKPGAIDKFTRDTKTIINKVASVA ENKGLFEEAAKLYDLAKNPDKVLELTNKLLSPWSQISAPQSNRERLKNMALAIAER
YKSQGVSAEKSINSTFYLLLDLITFFDEYHAGHIDLSFDVIERLKLVPLSQDSVEERVA AFRNFSDEIRHNLSEILLATMNILFTQYKRLKGSGPTTLGRPQRVQEDKDSVLRSQA RAL ITFAGM I P YRM SG DTN ARLVQM EVLM N
>hNup35_RRMdomain (SEQ ID NO: 76)
AAAFSMEPMGAEPMSLGSPTSPKPSAGAQFLPGFLLGDIPTPVTPQPRPSLGVME
MRSPLFSGGSPPQPWPTHKDKSGAPPVRSIYDDIASPGLGSTPLNARKTANFSVL HTPLSGVMPSSPASSVFSPATIGQKRKNTLSPAQMDPFYTQGDALTSDDQLDDTWV TVYGFPQASASYILLQFAQYGNIIKHVMSNNGNWMHIQYQSKLQARKALSKDGRIF
GESIMIGVKPCIDKSVMEAYEKVTTPSVSSVFTPPVKCIGTPTQSAGTPRAASMRPL AATYKTPAS ADYQVVTD KPAP RKD E S I VS KAM EYM FG W
>xNup35_RRMdomain (SEQ ID NO: 77)
AAFAVEPQGPALGSEPMMLGSPTSPKPGVNAQFLPGFLMGDLPAPVTPQPRSISG
PSVGVMEMRSPLLAGGSPPQPWPAHKDKSGAPPVRSIYDDISSPGLGSTPLTSRR
QPNISVMQSPLVGVTSTPGTGQSMFSPASIGQPRKTTLSPAQLDPFYTQGDSLTSE
DHLDDSWVTVFGFPQASASYILLQFAQYGNILKHVMSNTGNWMHIRYQSKLQARK
ALSKDGRIFGESIMIGVKPCIDKSVMESSDRCALSSPSLAFTPPIKTLGTPTQPGSTP R I STM R P LATAYKASTS D YQ VI S D RQTP KKD E S LVS KAM EYM FG W
>hNup155_antigen ([3-propeller + a-solenoid) (SEQ ID NO: 78)
DPSSLLGAAMPASTSAAALQEALENAGRLIDRQLQEDRMYPDLSELLMVSAPNNPT
VSGMSDMDYPLQGPGLLSVPNLPEISSIRRVPLPPELVEQFGHMQCNCMMGVFPPI
SRAWLTIDSDIFMWNYEDGGDLAYFDGLSETILAVGLVKPKAGIFQPHVRHLLVLATP
VDIVILGLSYANLQTGSGVLNDSLSGGMQLLPDPLYSLPTDNTYLLTITSTDNGRIFLA
GKDGCLYEVAYQAEAGWFSQRCRKINHSKSSLSFLVPSLLQFTFSEDDPILQIAIDNS
RNILYTRSEKGVIQVYDLGQDGQGMSRVASVSQNAIVSAAGNIARTIDRSVFKPIVQI
AVIENSESLDCQLLAVTHAGVRLYFSTCPFRQPLARPNTLTLVHVRLPPGFSASSTV
EKPSKVHRALYSKGILLMAASENEDNDILWCVNHDTFPFQKPMMETQMTAGVDGH
SWALSAIDELKVDKIITPLNKDHIPITDSPVWQQHMLPPKKFVLLSAQGSLMFHKLR
PVDQLRHLLVSNVGGDGEEIERFFKLHQEDQACATCLILACSTAACDREVSAWATR
AFFRYGGEAQMRFPTTLPPPSNVGPILGSPVYSSSPVPSGSPYPNPSFLGTPSHGI
QPPAMSTPVCALGNPATQATNMSCVTGPEIVYSGKHNGICIYFSRIMGNIWDASLVV
ERIFKSGNREITAIESSVPCQLLESVLQELKGLQEFLDRNSQFAGGPLGNPNTTAKV
QQRLIGFMRPENGNPQQMQQELQRKFHEAQLSEKISLQAIQQLVRKSYQALALWK
LLCEHQFTIIVAELQKELQEQLKITTFKDLVIRDKELTGALIASLINCYIRDNAAVDGISL
HLQDICPLLYSTDDAICSKANELLQRSRQVQNKTEKERMLRESLKEYQKISNQVDLS
NVCAQYRQVRFYEGVVELSLTAAEKKDPQGLGLHFYKHGEPEEDIVGLQAFQERL
NSYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGHHFEQML
KLSQRSKDELFSIALYNWLIQVDLADKLLQVASPFLEPHLVRMAKVDQNRVRYMDLL WRYYEKNRSFSNAARVLSRLADMHSTEISLQQRLEYIARAILSAKSSTAISSIAADGE
FLHELEEKMEVARIQLQIQETLQRQYSHHSSVQDAVSQLDSELMDITKLYGEFADPF
KLAECKLAIIHCAGYSDPILVQTLWQDIIEKELSDSVTLSSSDRMHALSLKIVLLGKIYA
GTPRFFPLDFIVQFLEQQVCTLNWDVGFVIQTMNEIGVPLPRLLEVYDQLFKSRDPF
WNRMKKPLHLLDCIHVLLIRYVENPSQVLNCERRRFTNLCLDAVCGYLVELQSMSS SVAVQAITGNFKSLQAKLERLH xNup155_antigen ([3-propeller + a-solenoid) (SEQ ID NO: 79)
PSATPGAPAASAAMQEALEGAGRIIDRLLQEDRAYPDLSELLNVPVHTCPTISGVSE
MDYPLQSPGLLTIPSLPEISAIRRVPLPPELIEQFGHMQCNCMMGVFPEISRAWLTID
SDIFMWNYEDGGDLAYYDGLSETILSVGLVKPKTGIFQPHIRFLLVLSTPVDIVILGLS
FANLQPGNLNDSISGGMQLLPDPLYSLPTDNTYLLSITSTDNGRIFLSGKDGCLYEV
EYQAEAGWFSQRCRKINHSKSSLSFLVPSVLQFAFSEDDPIVQIAIDNSRNILYTRSE
KGVIQVYDLGVDGHGMSRVASVSQNSLVSAAGNIARTIDRNVFKPIIHISVIEMSESV
NCHLLAVTHTGVRFYFSTVPFKQPTARPCMLALVHVRLPPGFSASSNVEKPSKVHK
ALYNNGVLLMAASENEDNDMLWCINRDSFPFQKPMMETQVTTQVDGHSWALSAV
DEQKADKIVTPLNKDLIPLTDSPVIIQQHMIPPKRFVLLSAQGSHIFYKLRPVDQLRHL
LVSNSGGDGEEIERFFKLHQENQACATCLILACSSAASDREVSSWAARAFFRYGGE
AQLRVQSALHAPSNVGPIFGSPLPVASPIPVGSPMPNPSFLGTPTQGACPPNVSTP
AYGVATPAPQPPAVPGMMGTEIVFSGKHNGICIYFCRIIGNIWDGSVAVENTFQSGN
REVTAIDSSVTPQHLESVLKELKGLLEFLDRYSQFTAGSLGNPGFGTPANRQQRLVS
LGRPDIGSSQQAQQELQRKYHTEAQLAEQFSLQGIHQLVRKMCQALALWKLLCEH
QFSLWSDLQKELQEQLKITTFKDLVIRDKELTGALTASLISCYIRDNASVDGISYRLQ
EVCPLLYSTDDAVCSKANELLQRSRHVPNKQEKERMLRESLKEYQKISQQVDLPNV
CAQYRQVRFYEGWELCLSAAEKKDPQGLGLHFHKNGEPEEDMAGLQAFQERLN
SYKCITDTLQELVNQSKAAPQSPSVPKKPGPPVLSSDPNMLSNEEAGIHFEQMLKL
AQRSADELFNIALFNWLIQADLTDKLLELNSPFLEPHLVRMAKLDQNKVRYMDLLWR
YYEKNRNFSNAARWAKLADMHSPEISLKQRLEYISRAILSAKSSTTMSTLAADGEF
LHELEEKLEVARIQLQIQETLTRQYSHHSTVGDAVSQLDSQLMDITKMFGQYADPFR
LSECKLAIIHCAGHSDPILVQTLWQDIIDKELSDSMGNSSVDRMQSLHLKITSLGKIYA
STPRYFPLEFLVKYLEQQVCNFSWDAGFVTYTMQEINVPVPKLLEVYDHLFKARDP
WWSRMKKPLHLLESIYILLSGYVQEPSKVPSYERRRFTTLCLDAISCYLVELQSMDP
APALLNTVSNFKSLQAKLERLS >hElysJ3-propeller(SEQ ID NO: 80)
GMRDLRAQVTSGLLPFPEVTLQALGEDEITLESVLRGKFAAGKNGLACLACGPQLE
WNSITGERLSAYRFSGVNEQPPWLAVKEFSWQKRTGLLIGLEETEGSVLCLYDLG
ISKWKAVVLPGRVTAIEPIINHGGASASTQHLHPSLRWLFGVAAWTDVGQILLVDLC
LDDLSCNQNEVEASDLEVLTGIPAEVPHIRESVMRQGRHLCFQLVSPTGTAVSTLSY
ISRTNQLAVGFSDGYLALWNMKSMKREYYIQLESGQVPVYAVTFQEPENDPRNCCY
LWAVQSTQDSEGDVLSLHLLQLAFGNRKCLASGQILYEGLEYCEERYTLDLTGGMF
PLRGQTSNTKLLGCQSIEKFRSHGDREEGVNEALSPDTSVSVFTWQVNIYGQGKP
SVYLGLFDINRWYHAQMPDSLRSGEYLHNCSYFALWSLESVVSRTSPHGILDILVHE
RSLNRGVPPSYPPPEQFFNPSTYNFDATCLLNSGWHLTCTG
>xElys_[3-propeller(SEQ ID NO: 81 )
MQNLEAQVTGSLVAFPDVTQKALKEDEINLDSVLRGKFSTGRTSLAWLACGPQLEIT
NSVTGERISAYHFSGLTERPPVWAVKEFTWQKKTGLLVGLVEAEGSVLCLYDIGISK
WKAWLPGSVTAVEPIINHGGASASTQHLHQSLRWFFGVTAVVTDVGHVLLIDLCL
DEVSSNQDELDASDLEVMSVIPTKIPKLREAATRERRHLCLQLAAPTGTTVSCLSYIS
RTNQLAVGYSDGYFSLWNMKTLRRDYHVQIEGGRVPVCAVAFQEPENDPRNCCYL
WAVQSSESGGDVSLHLLQLAFSDRKCLASGQIMYELLEYCEERYSLDLSGSTLSLR
GQSNNTKLLGCQTIEKFRVHGEREDGVHEVTSPDTSVSVFSWQVNTYGQGKPSV
YLGVFDINRWYQAQMPDSLRSGQFLRNCSYFAFWSLEAWNITTQDIIFDILVHERSL
SRGIPPSYPPPEQFYYPSTYNFDATCLLNSGLIHFACTGP
References
Bardwell JC, McGovern K, Beckwith J (1991 ) Identification of a protein required for disulfide bond formation in vivo. Cell, 67: 581-589
Bessette PH, Aslund F, Beckwith J, Georgiou G (1999) Efficient folding of proteins with multiple disulfide bonds in the Escherichia coli cytoplasm. Proceedings of the National Academy of Sciences, 96: 13703-13708
Bulleid NJ, Freedman RB (1988) Defective co-translational formation of disulphide bonds in protein disulphide-isomerase-deficient microsomes. Nature, 335: 649-651
Edman JC, Ellis L, Blacher RW, Roth RA, Rutter WJ (1985) Sequence of protein disulphide isomerase and implications of its relationship to thioredoxin. Nature, 317: 267-270
Frey S, Gdrlich D (2014a) A new set of highly efficient, tag-cleaving proteases for purifying recombinant proteins. J ChromatogrA, 1337: 95-105
Frey S, Gdrlich D (2014b) Purification of protein complexes of defined subunit stoichiometry using a set of orthogonal, tag-cleaving proteases. J ChromatogrA, 1337: 106-115
Goldberger RF, Epstein CJ, Anfinsen CB (1963) Acceleration of Reactivation of Reduced Bovine Pancreatic Ribonuclease by a Microsomal System from Rat Liver. Journal of Biological Chemistry, 238: 628-635
Gdttfert F, Pleiner T, Heine J, Westphal V, Gdrlich D, Sahl SJ, Hell SW (2017) Strong signal increase in STED fluorescence microscopy by imaging regions of subdiffraction extent. Proc Natl Acad Sci U S A, 114: 2125-2130
Guttler T, Aksu M, Dickmanns A, Stegmann KM, Gregor K, Rees R, Taxer W, Rymarenko O, Schunemann J, Dienemann C, Gunkel P, Mussil B, Krull J, Teichmann U, Grol3> U, Cordes VC, Dobbelstein M, Gdrlich D (2021 ) Neutralization of SARS-CoV- 2 by highly potent, hyperthermostable, and mutation-tolerant nanobodies. EMBO J, e107985 Hamers-Casterman C, Atarhouch T, Muyldermans S, Robinson G, Hamers C, Songa EB, Bendahman N, Hamers R (1993) Naturally occurring antibodies devoid of light chains. Nature, 363: 446-448
Hampoelz B, Andres-Pons A, Kastritis P, Beck M (2019) Structure and assembly of the nuclear pore complex. Annual review of biophysics, 48: 515-536
Hatahet F, Ruddock LW (2009) Protein disulfide isomerase: a critical evaluation of its function in disulfide bond formation. Antioxid Redox Signal, 11 : 2807-2850
Koenig PA, Das H, Liu H, Kummerer BM, Gohr FN, Jenster LM, Schiffelers LDJ, Tesfamariam YM, Uchirna M, Wuerth JD, Gatterdam K, Ruetalo N, Christensen MH, Fandrey Cl, Normann S, Tddtmann JMP, Pritzl S, Hanke L, Boos J, Yuan M, Zhu X, Schmid-Burgk JL, Kato H, Schindler M, Wilson IA, Geyer M, Ludwig KU, Hallberg BM, Wu NC, Schmidt Fl (2021 ) Structure-guided multivalent nanobodies block SARS-CoV- 2 infection and suppress mutational escape. Science, 371 : eabe6230
Lambert N, Freedman RB (1985) The latency of rat liver microsomal protein disulphide-isomerase. Biochem J, 228: 635-645
Ldschberger A, van de Linde S, Dabauvalle MC, Rieger B, Heilemann M, Krohne G, Sauer M (2012) Super-resolution imaging visualizes the eightfold symmetry of gp210 proteins around the nuclear pore complex and resolves the central channel with nanometer resolution. J Cell Sci, 125: 570-575
Mosalaganti S, Obarska-Kosinska A, Siggel M, Taniguchi R, Turonova B, Zimmerli CE, Buczak K, Schmidt FH, Margiotta E, Mackmull MT, Hagen WJH, Hummer G, Kosinski J, Beck M (2022) Al-based structure prediction empowers integrative structural analysis of human nuclear pores. Science, 376: eabm9506
Muyldermans S (2013) Nanobodies: natural single-domain antibodies. Annu Rev Biochem, 82: 775-797
Pleiner T, Bates M, Gdrlich D (2018) A toolbox of anti-mouse and anti-rabbit IgG secondary nanobodies. J Cell Biol, 217: 1143-1154
Pleiner T, Bates M, Trakhanov S, Lee CT, Schliep JE, Chug H, Bdhning M, Stark H, Urlaub H, Gdrlich D (2015) Nanobodies: site-specific labeling for super-resolution imaging, rapid epitope-mapping and native protein complex isolation. Elife, 4: e11349 Roth RA, Mesirow ML (1984) Production and characterization of a monoclonal antibody to rat liver thiol: protein-disulfide oxidoreductase/glutathione-insulin transhydrogenase. Biochim Biophys Acta, 788: 189-192
Rothbauer U, Zolghadr K, Muyldermans S, Schepers A, Cardoso MC, Leonhardt H (2008) A versatile nanotrap for biochemical and functional studies with fluorescent fusion proteins. Mol Cell Proteomics, 7: 282-289
Sahl SJ, Hell SW, Jakobs S (2017) Fluorescence nanoscopy in cell biology. Nat Rev Mol Cell Biol, 18: 685-701
Szymborska A, de Marco A, Daigle N, Cordes VC, Briggs JA, Ellenberg J (2013) Nuclear pore scaffold structure analyzed by super-resolution microscopy and particle averaging. Science, 341 : 655-658
Tu BP, Weissman JS (2004) Oxidative protein folding in eukaryotes: mechanisms and consequences. J Cell Biol, 164: 341-346
Weber M, von der Emde H, Leutenegger M, Gunkel P, Sambandan S, Khan TA, Keller- Findeisen J, Cordes VC, Hell SW (2023) MINSTED nanoscopy enters the Angstrom localization range. Nat Biotechnol, 41 : 569-576

Claims

Claims
1 . A set of at least 2 VHH antibodies recognizing each recognizing a different component of a mammalian nuclear pore complex (NPC) selected from the group comprising Nup358, Nup133, Nup155, Nup93, Nup35, Elys, and the Nup214 Nup88 Nup62 heterotrimer.
2. The set of claim 1 which comprises a VHH antibody recognizing Nup133 [3- propeller.
3. The set of claim 1 or 2 wherein at least one VHH antibody comprises at least one solvent-accessible ectopic cysteine residue.
4. The set of claim 1 or 2 comprising at least one VHH antibody comprising:
(i) (a) a CDR3 sequence as shown in SEQ. ID NO: 4, 8, 24, 28, 32, 36, 40, or 52, and
(b) a CDR3 sequence, which has an identity of at least 80%, at least 90% or at least 95% to a CDR3 sequence of (a);
(c) a VHH antibody, which competes with a VHH antibody of (a) for the binding to the respective component of the NPC, or
(d) a VHH antibody, which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a), or
(ii) (a) a combination of CDR1 , CDR2 and CDR3 sequences as shown in SEQ. ID NO: 2-4, 6-8, 22-24, 26-28, 30-32, 34-36, 38-40, or 50-52;
(b) a combination of CDR1 , CDR2 and CDR3 sequences which has an identity of at least 80%, at least 90% or at least 95% to a combination of CDR1 , CDR2 and CDR3 sequences of (a);
(c) a VHH antibody, which competes with a VHH antibody of (a) for the binding to the respective component of the NPC, or
(d) a VHH antibody, which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a).
5. The set of any one of claims 1 -4 comprising at least one VHH antibody comprising:
(a) a VHH sequence as shown in SEQ. ID NO: 1 , 5, 21 , 25, 29, 33, 37, or 49 and optionally at least one additional solvent-accessible ectopic cysteine residue;
(b) a VHH sequence which has an identity of at least 70%, at least 80%, at least 90%, at least 95% or at least 98% to a VHH sequence of (a),
(c) a VHH antibody, which competes with a VHH antibody of (a) for the binding to the respective component of the NPC, or
(d) a VHH antibody, which binds the same or an overlapping epitope of the respective component of the NPC as a VHH antibody of (a).
6. The set of any one of claims 1 -5 wherein at least one VHH antibody carries a labelling agent, wherein the labelling agent is particularly attached to a solvent-accessible ectopic SH group on the VHH antibody.
7. The set of claim 6 wherein at least 2 VHH antibodies carry different labelling agents, particularly different spectrally separatable fluorophores.
8. The set of any one of claims 1 -7 wherein at least one VHH antibody is a thermostabilized VHH antibody which comprises two structural cysteines that are quantitatively oxidized and form an intramolecular disulfide bond.
9. Use of the set of any one of claims 1 -8 for imaging applications particularly for fluorescence spectroscopy or microscopy.
10. The use of claim 9 wherein the set further comprises a secondary detection antibody.
11 . The use of claim 10, wherein the secondary detection antibody is a VHH antibody comprising
(a) a VHH sequence as shown in SEQ. ID NO: 53; and optionally an additional cysteine residue at its N- and/or C-terminus;
(b) a VHH sequence which has an identity of at least 70%, at least 80%, at least 90%, at least 95% or at least 99% to a VHH sequence of (a),
(c) a VHH antibody, which competes with the VHH antibody of (a) for the binding to its target antigen, or
(d) a VHH antibody, which binds the same or an overlapping epitope of its target antigen as a VHH antibody of (a).
12. A method of producing a stable VHH antibody comprising the steps:
(i) expressing a VHH antibody comprising two structural cysteines and at least one solvent-accessible ectopic cysteine in a host cell under reducing or at least partially reducing conditions,
(ii) purifying the VHH antibody obtained in step (i) from the host cell or the culture medium under conditions wherein the at least one solvent- accessible ectopic cysteine is in the reduced SH state;
(iii) optionally attaching a labelling agent to the at least one solvent- accessible ectopic cysteine under conditions while keeping the two structural cysteines unmodified,
(iv) subjecting the VHH antibody obtained in step (ii) or (iii) to an oxidation that converts the two structural cysteines to a disulfide bond, and
(v) obtaining a thermostabilized VHH antibody wherein the two structural cysteines are quantitatively oxidized to a disulfide bond.
13. The method of claim 12 wherein step (iv) comprises a treatment of the VHH antibody with an oxidant which is a disulfide compound particularly oxidized glutathione (GSSG) optionally in the presence of a protein disulfide isomerase (PDI), particularly in the presence of DsbA and/or DsbC from E. coli.
14. The method of claim 12 or 13 wherein step (iv) comprises a transient thermal unfolding of the VHH antibody.
15. The method of claim 14 wherein the thermal unfolding comprises incubating the VHH antibody at a temperature which is in the range between the onset of melting of the reduced form of the VHH antibody and the nominal melting temperature (Tm) of the reduced form of the VHH antibody.
PCT/EP2024/066244 2023-06-13 2024-06-12 Anti-npc vhh antibodies and methods for their stabilization Ceased WO2024256467A1 (en)

Priority Applications (2)

Application Number Priority Date Filing Date Title
EP24731389.3A EP4727968A1 (en) 2023-06-13 2024-06-12 Anti-npc vhh antibodies and methods for their stabilization
IL325224A IL325224A (en) 2023-06-13 2024-06-12 Anti-npc vhh antibodies and methods for their stabilization

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
EP23178906.6 2023-06-13
EP23178906.6A EP4477666A1 (en) 2023-06-13 2023-06-13 Anti-npc vhh antibodies and methods for their stabilization

Publications (1)

Publication Number Publication Date
WO2024256467A1 true WO2024256467A1 (en) 2024-12-19

Family

ID=86764761

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/EP2024/066244 Ceased WO2024256467A1 (en) 2023-06-13 2024-06-12 Anti-npc vhh antibodies and methods for their stabilization

Country Status (3)

Country Link
EP (2) EP4477666A1 (en)
IL (1) IL325224A (en)
WO (1) WO2024256467A1 (en)

Family Cites Families (1)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
EP4183801A1 (en) * 2021-11-22 2023-05-24 Max-Planck-Gesellschaft zur Förderung der Wissenschaften e.V. Vhh antibodies against sars-cov-2 variants

Non-Patent Citations (32)

* Cited by examiner, † Cited by third party
Title
"The Protein Protocols Handbook", 1 January 1996, HUMANA PRESS, Totowa, NJ, ISBN: 978-1-60-327259-9, article GLENN E. MORRIS: "Epitope Mapping of Protein Antigens by Competition ELISA", pages: 595 - 600, XP055007939, DOI: 10.1007/978-1-60327-259-9_96 *
BARDWELL JCMCGOVERN KBECKWITH J: "Identification of a protein required for disulfide bond formation in vivo", CELL, vol. 67, 1991, pages 581 - 589, XP023908673, DOI: 10.1016/0092-8674(91)90532-4
BESSETTE PHASLUND FBECKWITH JGEORGIOU G: "Efficient folding of proteins with multiple disulfide bonds in the Escherichia coli cytoplasm", PROCEEDINGS OF THE NATIONAL ACADEMY OF SCIENCES, vol. 96, 1999, pages 13703 - 13708, XP002233564, DOI: 10.1073/pnas.96.24.13703
BULLEID NJFREEDMAN RB: "Defective co-translational formation of disulphide bonds in protein disulphide-isomerase-deficient microsomes", NATURE, vol. 335, 1988, pages 649 - 651, XP002465213, DOI: 10.1038/335649a0
COLOM MIREIA SOLÀ: "Nucleoporin-binding nanobodies that either track or trap nuclear pore complex assembly", DISSERTATION, 1 July 2020 (2020-07-01), pages 1 - 156, XP093096549, Retrieved from the Internet <URL:https://ediss.uni-goettingen.de/handle/21.11130/00-1735-0000-0008-57CA-3> [retrieved on 20231031], DOI: 10.53846/goediss-8508 *
DAN ZABETAKIS ET AL: "Evaluation of Disulfide Bond Position to Enhance the Thermal Stability of a Highly Stable Single Domain Antibody", PLOS ONE, vol. 9, no. 12, 19 December 2014 (2014-12-19), pages e115405, XP055520397, DOI: 10.1371/journal.pone.0115405 *
EDMAN JCELLIS LBLACHER RWROTH RARUTTER WJ: "Sequence of protein disulphide isomerase and implications of its relationship to thioredoxin", NATURE, vol. 317, 1985, pages 267 - 270, XP055854456, DOI: 10.1038/317267a0
FREY SGÖRLICH D: "A new set of highly efficient, tag-cleaving proteases for purifying recombinant proteins", J CHROMATOGR A, vol. 1337, pages 95 - 105, XP028634158, DOI: 10.1016/j.chroma.2014.02.029
FREY SGÖRLICH D: "Purification of protein complexes of defined subunit stoichiometry using a set of orthogonal, tag-cleaving proteases", J CHROMATOGR A, vol. 1337, pages 106 - 115, XP028634159, DOI: 10.1016/j.chroma.2014.02.030
GOLDBERGER RF, EPSTEIN CJ, ANFINSEN CB: "Acceleration of Reactivation of Reduced Bovine Pancreatic Ribonuclease by a Microsomal System from Rat Liver.", JOURNAL OF BIOLOGICAL CHEMISTRY, vol. 238, 1963, pages 628 - 635
GÖTTFERT FPLEINER THEINE JWESTPHAL VGÖRLICH DSAHL SJHELL SW: "Strong signal increase in STED fluorescence microscopy by imaging regions of subdiffraction extent", PROC NATL ACAD SCI U S A, vol. 114, 2017, pages 2125 - 2130, XP055433907, DOI: 10.1073/pnas.1621495114
GUTTLER TAKSU MDICKMANNS ASTEGMANN KMGREGOR KREES RTAXER WRYMARENKO OSCHINEMANN JDIENEMANN C: "Neutralization of SARS-CoV-2 by highly potent, hyperthermostable, and mutation-tolerant nanobodies", EMBO J, 2021, pages e107985
HAMERS-CASTERMAN CATARHOUCH TMUYLDERMANS SROBINSON GHAMERS CSONGA EBBENDAHMAN NHAMERS R: "Naturally occurring antibodies devoid of light chains", NATURE, vol. 363, 1993, pages 446 - 448, XP002535892, DOI: 10.1038/363446a0
HAMERS-CASTERMAN ET AL., MUYLDERMANS, 1993
HAMPOELZ BANDRES-PONS AKASTRITIS PBECK M: "Structure and assembly of the nuclear pore complex", ANNUAL REVIEW OF BIOPHYSICS, vol. 48, 2019, pages 515 - 536
HATAHET FRUDDOCK LW: "Protein disulfide isomerase: a critical evaluation of its function in disulfide bond formation", ANTIOXID REDOX SIGNAL, vol. 11, 2009, pages 2807 - 2850
KOENIG PADAS HLIU HKÜMMERER BMGOHR FNJENSTER LMSCHIFFELERS LDJTESFAMARIAM YMUCHIMA MWUERTH JD: "Structure-guided multivalent nanobodies block SARS-CoV-2 infection and suppress mutational escape", SCIENCE, vol. 371, 2021, pages eabe6230, XP055794977, DOI: 10.1126/science.abe6230
LAMBERT NFREEDMAN RB: "The latency of rat liver microsomal protein disulphide-isomerase", BIOCHEM J, vol. 228, 1985, pages 635 - 645
LÖSCHBERGER AVAN DE LINDE SDABAUVALLE MCRIEGER BHEILEMANN MKROHNE GSAUER M: "Super-resolution imaging visualizes the eightfold symmetry of gp210 proteins around the nuclear pore complex and resolves the central channel with nanometer resolution", J CELL SCI, vol. 125, 2012, pages 570 - 575
MOSALAGANTI SOBARSKA-KOSINSKA ASIGGEL MTANIGUCHI RTURONOVA BZIMMERLI CEBUCZAK KSCHMIDT FHMARGIOTTA EMACKMULL MT: "Al-based structure prediction empowers integrative structural analysis of human nuclear pores", SCIENCE, vol. 376, 2022, pages eabm9506
MUYLDERMANS S: "Nanobodies: natural single-domain antibodies", ANNU REV BIOCHEM, vol. 82, 2013, pages 775 - 797, XP055083831, DOI: 10.1146/annurev-biochem-063011-092449
PEREZ DE LA LASTRA ET AL: "Epitope mapping of 10 monoclonal antibodies against the pig analogue of human membrane cofactor protein (MCP)", CANCER RESEARCH, vol. 96, no. 4, 1 April 1999 (1999-04-01), GB, pages 663 - 670, XP055572134, ISSN: 0019-2805, DOI: 10.1046/j.1365-2567.1999.00732.x *
PLEINER TBATES MGÖRLICH D: "A toolbox of anti-mouse and anti-rabbit IgG secondary nanobodies", J CELL BIOL, vol. 217, 2018, pages 1143 - 1154, XP055466375, DOI: 10.1083/jcb.201709115
PLEINER TBATES MTRAKHANOV SLEE CTSCHLIEP JECHUG HBÖHNING MSTARK HURLAUB HGÖRLICH D: "Nanobodies: site-specific labeling for super-resolution imaging, rapid epitope-mapping and native protein complex isolation", ELIFE, vol. 4, 2015, pages e11349, XP009504731, DOI: 10.7554/eLife.11349
PLEINER TINO ET AL: "Nanobodies: site-specific labeling for super-resolution imaging, rapid epitope-mapping and native protein complex isolation", ELIFE, ELIFE SCIENCES PUBLICATIONS LTD, GB, vol. 4, 3 December 2015 (2015-12-03), pages e11349 - 1, XP009504731, ISSN: 2050-084X, DOI: 10.7554/ELIFE.11349 *
ROTH RAMESIROW ML: "Production and characterization of a monoclonal antibody to rat liver thiol: protein-disulfide oxidoreductase/glutathione-insulin transhydrogenase", BIOCHIM BIOPHYS ACTA, vol. 788, 1984, pages 189 - 192, XP023476845, DOI: 10.1016/0167-4838(84)90261-9
ROTHBAUER U, ZOLGHADR K, MUYLDERMANS S, SCHEPERS A, CARDOSO MC, LEONHARDT H: "A versatile nanotrap for biochemical and functional studies with fluorescent fusion proteins", MOL CELL PROTEOMICS, vol. 7, 2008, pages 282 - 289, XP055493624, DOI: 10.1074/mcp.M700342-MCP200
SAHL SJHELL SWJAKOBS S: "Fluorescence nanoscopy in cell biology", NAT REV MOL CELL BIOL, vol. 18, 2017, pages 685 - 701
SZYMBORSKA ADE MARCO ADAIGLE NCORDES VCBRIGGS JAELLENBERG J: "Nuclear pore scaffold structure analyzed by super-resolution microscopy and particle averaging", SCIENCE, vol. 341, 2013, pages 655 - 658, XP055075295, DOI: 10.1126/science.1240672
TINO PLEINER ET AL: "A toolbox of anti-mouse and anti-rabbit IgG secondary nanobodies", THE JOURNAL OF CELL BIOLOGY, vol. 217, no. 3, 20 December 2017 (2017-12-20), US, pages 1143 - 1154, XP055466375, ISSN: 0021-9525, DOI: 10.1083/jcb.201709115 *
TU BPWEISSMAN JS: "Oxidative protein folding in eukaryotes: mechanisms and consequences", J CELL BIOL, vol. 164, 2004, pages 341 - 346
WEBER MVON DER EMDE HLEUTENEGGER MGUNKEL PSAMBANDAN SKHAN TAKELLER-FINDEISEN JCORDES VCHELL SW: "MINSTED nanoscopy enters the Angstrom localization range", NAT BIOTECHNOL, vol. 41, 2023, pages 569 - 576, XP093049002, DOI: 10.1038/s41587-022-01519-4

Also Published As

Publication number Publication date
EP4727968A1 (en) 2026-04-22
IL325224A (en) 2026-02-01
EP4477666A1 (en) 2024-12-18

Similar Documents

Publication Publication Date Title
JP3415171B2 (en) Recombinant antibodies specific for growth factor receptors
JP5877893B2 (en) Amino acid sequences of fusion polypeptides and uses thereof
US7838629B2 (en) Ubiquitin or gamma-crystalline conjugates for use in therapy, diagnosis and chromatography
AU2004274368B2 (en) Methods, kits, and compositions for the development and use of monoclonal antibodies specific to antigens of low immunogenicity
JP2019502684A (en) Immunoglobulin conjugated with C-terminal lysine
EP2663642B1 (en) Treponema pallidum triplet antigen
JP2022525777A (en) Antigen binding protein
CN113150137B (en) A kind of preparation method and application of NDM-1 monoclonal antibody
US20120276099A1 (en) Monospecific polypeptide reagents
CN116368156A (en) Modular and generalized biosensor platform based on a de novo designed protein switch
JP2022526492A (en) Antigen-binding fragments bound to multiple FC isotypes and subclasses
KR102014826B1 (en) Novel peptide for enhancing expression efficiency and fusion protein including the same
EP4477666A1 (en) Anti-npc vhh antibodies and methods for their stabilization
KR20210094895A (en) Novel Peptide Tag, Antibodies Binding to the Same and Uses thereof
CN119019545B (en) Monoclonal antibody against human papillomavirus type 18 E protein
Markiv et al. Expression of recombinant multi-coloured fluorescent antibodies in gor-/trxB-E. coli cytoplasm
JP6419796B2 (en) Antibodies that specifically bind to HER3
US10414818B2 (en) Thermus thermophilus SlyD FKBP domain specific antibodies
CN114430747A (en) anti-CSF-1R antibodies
WO2025017153A1 (en) Dsfv as an igg fragment format and methods of production and labelling thereof
JP2002262883A (en) Method for producing monoclonal antibody
Lim Development of Molecular Tools and High Throughput Screens in Protein Engineering

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 24731389

Country of ref document: EP

Kind code of ref document: A1

WWE Wipo information: entry into national phase

Ref document number: 325224

Country of ref document: IL

WWE Wipo information: entry into national phase

Ref document number: 2024731389

Country of ref document: EP

NENP Non-entry into the national phase

Ref country code: DE

ENP Entry into the national phase

Ref document number: 2024731389

Country of ref document: EP

Effective date: 20260113

ENP Entry into the national phase

Ref document number: 2024731389

Country of ref document: EP

Effective date: 20260113

ENP Entry into the national phase

Ref document number: 2024731389

Country of ref document: EP

Effective date: 20260113

WWP Wipo information: published in national office

Ref document number: 325224

Country of ref document: IL

ENP Entry into the national phase

Ref document number: 2024731389

Country of ref document: EP

Effective date: 20260113

WWP Wipo information: published in national office

Ref document number: 2024731389

Country of ref document: EP