WO2024167317A1 - Novel crispr/cas12a composition and use thereof for detecting target nucleic acid - Google Patents
Novel crispr/cas12a composition and use thereof for detecting target nucleic acid Download PDFInfo
- Publication number
- WO2024167317A1 WO2024167317A1 PCT/KR2024/001849 KR2024001849W WO2024167317A1 WO 2024167317 A1 WO2024167317 A1 WO 2024167317A1 KR 2024001849 W KR2024001849 W KR 2024001849W WO 2024167317 A1 WO2024167317 A1 WO 2024167317A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- nucleic acid
- sequence
- rna
- cas12a
- Prior art date
Links
- 150000007523 nucleic acids Chemical class 0.000 title claims abstract description 479
- 102000039446 nucleic acids Human genes 0.000 title claims abstract description 397
- 108020004707 nucleic acids Proteins 0.000 title claims abstract description 397
- 239000000203 mixture Substances 0.000 title claims description 86
- 108091033409 CRISPR Proteins 0.000 title abstract description 214
- 101150059443 cas12a gene Proteins 0.000 title 1
- 108700004991 Cas12a Proteins 0.000 claims abstract description 562
- 108020005004 Guide RNA Proteins 0.000 claims abstract description 298
- 238000003776 cleavage reaction Methods 0.000 claims abstract description 128
- 230000007017 scission Effects 0.000 claims abstract description 128
- 108091028043 Nucleic acid sequence Proteins 0.000 claims description 193
- 239000000523 sample Substances 0.000 claims description 148
- 238000001514 detection method Methods 0.000 claims description 78
- 238000000034 method Methods 0.000 claims description 74
- 102000004389 Ribonucleoproteins Human genes 0.000 claims description 51
- 108010081734 Ribonucleoproteins Proteins 0.000 claims description 51
- 108020004414 DNA Proteins 0.000 claims description 40
- 238000002156 mixing Methods 0.000 claims description 32
- 230000008569 process Effects 0.000 claims description 30
- 102000053602 DNA Human genes 0.000 claims description 27
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 claims description 14
- 108020004682 Single-Stranded DNA Proteins 0.000 claims description 13
- 230000003213 activating effect Effects 0.000 claims description 11
- 125000003275 alpha amino acid group Chemical group 0.000 claims 59
- 238000010354 CRISPR gene editing Methods 0.000 abstract description 207
- 230000000694 effects Effects 0.000 abstract description 43
- 238000004458 analytical method Methods 0.000 abstract description 7
- 150000001413 amino acids Chemical group 0.000 description 144
- 239000003795 chemical substances by application Substances 0.000 description 33
- 108090000623 proteins and genes Proteins 0.000 description 23
- 239000013604 expression vector Substances 0.000 description 18
- ZMMJGEGLRURXTF-UHFFFAOYSA-N ethidium bromide Chemical compound [Br-].C12=CC(N)=CC=C2C2=CC=C(N)C=C2[N+](CC)=C1C1=CC=CC=C1 ZMMJGEGLRURXTF-UHFFFAOYSA-N 0.000 description 14
- 229960005542 ethidium bromide Drugs 0.000 description 14
- 238000002474 experimental method Methods 0.000 description 14
- 238000010186 staining Methods 0.000 description 14
- 239000007795 chemical reaction product Substances 0.000 description 12
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 11
- 238000000338 in vitro Methods 0.000 description 10
- 239000013598 vector Substances 0.000 description 10
- 238000010453 CRISPR/Cas method Methods 0.000 description 8
- 241000588724 Escherichia coli Species 0.000 description 8
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 8
- 102000004169 proteins and genes Human genes 0.000 description 8
- 230000010076 replication Effects 0.000 description 8
- 210000004027 cell Anatomy 0.000 description 7
- TWRXJAOTZQYOKJ-UHFFFAOYSA-L Magnesium chloride Chemical compound [Mg+2].[Cl-].[Cl-] TWRXJAOTZQYOKJ-UHFFFAOYSA-L 0.000 description 6
- 101710163270 Nuclease Proteins 0.000 description 6
- 230000003321 amplification Effects 0.000 description 6
- 239000000872 buffer Substances 0.000 description 6
- 238000003199 nucleic acid amplification method Methods 0.000 description 6
- 230000000295 complement effect Effects 0.000 description 5
- 238000010362 genome editing Methods 0.000 description 5
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 4
- 244000005700 microbiome Species 0.000 description 4
- 239000002773 nucleotide Substances 0.000 description 4
- 125000003729 nucleotide group Chemical group 0.000 description 4
- 235000018102 proteins Nutrition 0.000 description 4
- 239000011780 sodium chloride Substances 0.000 description 4
- 238000013518 transcription Methods 0.000 description 4
- 230000035897 transcription Effects 0.000 description 4
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 4
- 241000282836 Camelus dromedarius Species 0.000 description 3
- 241000701022 Cytomegalovirus Species 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 3
- 101000631760 Homo sapiens Sodium channel protein type 1 subunit alpha Proteins 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- AYFVYJQAPQTCCC-GBXIJSLDSA-N L-threonine Chemical compound C[C@@H](O)[C@H](N)C(O)=O AYFVYJQAPQTCCC-GBXIJSLDSA-N 0.000 description 3
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 3
- 241000700584 Simplexvirus Species 0.000 description 3
- 239000011543 agarose gel Substances 0.000 description 3
- 235000001014 amino acid Nutrition 0.000 description 3
- 229940024606 amino acid Drugs 0.000 description 3
- 210000004899 c-terminal region Anatomy 0.000 description 3
- 238000012790 confirmation Methods 0.000 description 3
- 238000005520 cutting process Methods 0.000 description 3
- 238000005516 engineering process Methods 0.000 description 3
- 239000012634 fragment Substances 0.000 description 3
- 101150094164 lysY gene Proteins 0.000 description 3
- 229910001629 magnesium chloride Inorganic materials 0.000 description 3
- 238000004519 manufacturing process Methods 0.000 description 3
- 239000000463 material Substances 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 238000012986 modification Methods 0.000 description 3
- 230000004048 modification Effects 0.000 description 3
- 239000002777 nucleoside Substances 0.000 description 3
- 108090000765 processed proteins & peptides Proteins 0.000 description 3
- 238000000746 purification Methods 0.000 description 3
- 210000002784 stomach Anatomy 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- PIEPQKCYPFFYMG-UHFFFAOYSA-N tris acetate Chemical compound CC(O)=O.OCC(N)(CO)CO PIEPQKCYPFFYMG-UHFFFAOYSA-N 0.000 description 3
- 239000013603 viral vector Substances 0.000 description 3
- QKNYBSVHEMOAJP-UHFFFAOYSA-N 2-amino-2-(hydroxymethyl)propane-1,3-diol;hydron;chloride Chemical compound Cl.OCC(N)(CO)CO QKNYBSVHEMOAJP-UHFFFAOYSA-N 0.000 description 2
- 108091093088 Amplicon Proteins 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 2
- 238000010443 CRISPR/Cpf1 gene editing Methods 0.000 description 2
- 108010053770 Deoxyribonucleases Proteins 0.000 description 2
- 102000016911 Deoxyribonucleases Human genes 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- WHUUTDBJXJRKMK-UHFFFAOYSA-N Glutamic acid Natural products OC(=O)C(N)CCC(O)=O WHUUTDBJXJRKMK-UHFFFAOYSA-N 0.000 description 2
- NYHBQMYGNKIUIF-UUOKFMHZSA-N Guanosine Chemical compound C1=NC=2C(=O)NC(N)=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O NYHBQMYGNKIUIF-UUOKFMHZSA-N 0.000 description 2
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 description 2
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 2
- 239000006137 Luria-Bertani broth Substances 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 108010077850 Nuclear Localization Signals Proteins 0.000 description 2
- 102000002488 Nucleoplasmin Human genes 0.000 description 2
- 238000012408 PCR amplification Methods 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 108020005091 Replication Origin Proteins 0.000 description 2
- 241000714474 Rous sarcoma virus Species 0.000 description 2
- VMHLLURERBWHNL-UHFFFAOYSA-M Sodium acetate Chemical compound [Na+].CC([O-])=O VMHLLURERBWHNL-UHFFFAOYSA-M 0.000 description 2
- 108091027544 Subgenomic mRNA Proteins 0.000 description 2
- AYFVYJQAPQTCCC-UHFFFAOYSA-N Threonine Natural products CC(O)C(N)C(O)=O AYFVYJQAPQTCCC-UHFFFAOYSA-N 0.000 description 2
- 239000004473 Threonine Substances 0.000 description 2
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 2
- ISAKRJDGNUQOIC-UHFFFAOYSA-N Uracil Chemical compound O=C1C=CNC(=O)N1 ISAKRJDGNUQOIC-UHFFFAOYSA-N 0.000 description 2
- DRTQHJPVMGBUCF-XVFCMESISA-N Uridine Chemical compound O[C@@H]1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-XVFCMESISA-N 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- 241000700605 Viruses Species 0.000 description 2
- 230000004913 activation Effects 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- AVKUERGKIZMTKX-NJBDSQKTSA-N ampicillin Chemical compound C1([C@@H](N)C(=O)N[C@H]2[C@H]3SC([C@@H](N3C2=O)C(O)=O)(C)C)=CC=CC=C1 AVKUERGKIZMTKX-NJBDSQKTSA-N 0.000 description 2
- 229960000723 ampicillin Drugs 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 235000009582 asparagine Nutrition 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- 210000001124 body fluid Anatomy 0.000 description 2
- OPTASPLRGRRNAP-UHFFFAOYSA-N cytosine Chemical compound NC=1C=CNC(=O)N=1 OPTASPLRGRRNAP-UHFFFAOYSA-N 0.000 description 2
- SESMVOSHGGZZQF-KRUJRXCESA-N dT8 Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)COP(O)(=O)O[C@@H]2[C@H](O[C@H](C2)N2C(NC(=O)C(C)=C2)=O)CO)[C@@H](O)C1 SESMVOSHGGZZQF-KRUJRXCESA-N 0.000 description 2
- 239000003814 drug Substances 0.000 description 2
- 239000012636 effector Substances 0.000 description 2
- UYTPUPDQBNUYGX-UHFFFAOYSA-N guanine Chemical compound O=C1NC(N)=NC2=C1N=CN2 UYTPUPDQBNUYGX-UHFFFAOYSA-N 0.000 description 2
- 108060005597 nucleoplasmin Proteins 0.000 description 2
- 125000003835 nucleoside group Chemical group 0.000 description 2
- 239000013612 plasmid Substances 0.000 description 2
- 238000002360 preparation method Methods 0.000 description 2
- 238000012163 sequencing technique Methods 0.000 description 2
- 235000017281 sodium acetate Nutrition 0.000 description 2
- 239000001632 sodium acetate Substances 0.000 description 2
- 238000002415 sodium dodecyl sulfate polyacrylamide gel electrophoresis Methods 0.000 description 2
- 125000006850 spacer group Chemical group 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000008685 targeting Effects 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 241000701161 unidentified adenovirus Species 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 102000040650 (ribonucleotides)n+m Human genes 0.000 description 1
- UHDGCWIWMRVCDJ-UHFFFAOYSA-N 1-beta-D-Xylofuranosyl-NH-Cytosine Natural products O=C1N=C(N)C=CN1C1C(O)C(O)C(CO)O1 UHDGCWIWMRVCDJ-UHFFFAOYSA-N 0.000 description 1
- 229930024421 Adenine Natural products 0.000 description 1
- GFFGJBXGBJISGV-UHFFFAOYSA-N Adenine Chemical compound NC1=NC=NC2=C1N=CN2 GFFGJBXGBJISGV-UHFFFAOYSA-N 0.000 description 1
- 206010061692 Benign muscle neoplasm Diseases 0.000 description 1
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 101100421200 Caenorhabditis elegans sep-1 gene Proteins 0.000 description 1
- 241000282832 Camelidae Species 0.000 description 1
- 102100031437 Cell cycle checkpoint protein RAD1 Human genes 0.000 description 1
- 108091035707 Consensus sequence Proteins 0.000 description 1
- MIKUYHXYGGJMLM-GIMIYPNGSA-N Crotonoside Natural products C1=NC2=C(N)NC(=O)N=C2N1[C@H]1O[C@@H](CO)[C@H](O)[C@@H]1O MIKUYHXYGGJMLM-GIMIYPNGSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-PSQAKQOGSA-N Cytidine Natural products O=C1N=C(N)C=CN1[C@@H]1[C@@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-PSQAKQOGSA-N 0.000 description 1
- NYHBQMYGNKIUIF-UHFFFAOYSA-N D-guanosine Natural products C1=2NC(N)=NC(=O)C=2N=CN1C1OC(CO)C(O)C1O NYHBQMYGNKIUIF-UHFFFAOYSA-N 0.000 description 1
- 108091092584 GDNA Proteins 0.000 description 1
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 101001130384 Homo sapiens Cell cycle checkpoint protein RAD1 Proteins 0.000 description 1
- 101000938351 Homo sapiens Ephrin type-A receptor 3 Proteins 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 1
- 241000904817 Lachnospiraceae bacterium Species 0.000 description 1
- 101710128836 Large T antigen Proteins 0.000 description 1
- 241000713666 Lentivirus Species 0.000 description 1
- 241000713333 Mouse mammary tumor virus Species 0.000 description 1
- 101100078999 Mus musculus Mx1 gene Proteins 0.000 description 1
- 101710135898 Myc proto-oncogene protein Proteins 0.000 description 1
- 102100038895 Myc proto-oncogene protein Human genes 0.000 description 1
- 201000004458 Myoma Diseases 0.000 description 1
- 108091061960 Naked DNA Proteins 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 102000012338 Poly(ADP-ribose) Polymerases Human genes 0.000 description 1
- 108010061844 Poly(ADP-ribose) Polymerases Proteins 0.000 description 1
- 229920000776 Poly(Adenosine diphosphate-ribose) polymerase Polymers 0.000 description 1
- 238000012300 Sequence Analysis Methods 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- PZBFGYYEXUXCOF-UHFFFAOYSA-N TCEP Chemical compound OC(=O)CCP(CCC(O)=O)CCC(O)=O PZBFGYYEXUXCOF-UHFFFAOYSA-N 0.000 description 1
- MECLEFZMPPOEAC-VOAKCMCISA-N Thr-Leu-Lys Chemical compound C[C@H]([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)O)N)O MECLEFZMPPOEAC-VOAKCMCISA-N 0.000 description 1
- 108091028113 Trans-activating crRNA Proteins 0.000 description 1
- 101710150448 Transcriptional regulator Myc Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 241000700618 Vaccinia virus Species 0.000 description 1
- 229960000643 adenine Drugs 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 102000009899 alpha Karyopherins Human genes 0.000 description 1
- 108010077099 alpha Karyopherins Proteins 0.000 description 1
- 239000000427 antigen Substances 0.000 description 1
- 102000036639 antigens Human genes 0.000 description 1
- 108091007433 antigens Proteins 0.000 description 1
- 235000003704 aspartic acid Nutrition 0.000 description 1
- 239000002585 base Substances 0.000 description 1
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 1
- DRTQHJPVMGBUCF-PSQAKQOGSA-N beta-L-uridine Natural products O[C@H]1[C@@H](O)[C@H](CO)O[C@@H]1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-PSQAKQOGSA-N 0.000 description 1
- OQFSQFPPLPISGP-UHFFFAOYSA-N beta-carboxyaspartic acid Natural products OC(=O)C(N)C(C(O)=O)C(O)=O OQFSQFPPLPISGP-UHFFFAOYSA-N 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 230000015572 biosynthetic process Effects 0.000 description 1
- 239000008280 blood Substances 0.000 description 1
- 210000004369 blood Anatomy 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-ZAKLUEHWSA-N cytidine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O1 UHDGCWIWMRVCDJ-ZAKLUEHWSA-N 0.000 description 1
- 229940104302 cytosine Drugs 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 201000010099 disease Diseases 0.000 description 1
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 210000003527 eukaryotic cell Anatomy 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000003862 glucocorticoid Substances 0.000 description 1
- 235000013922 glutamic acid Nutrition 0.000 description 1
- 239000004220 glutamic acid Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229940029575 guanosine Drugs 0.000 description 1
- 208000006454 hepatitis Diseases 0.000 description 1
- 231100000283 hepatitis Toxicity 0.000 description 1
- 244000038280 herbivores Species 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- 102000057382 human EPHA3 Human genes 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 108700032552 influenza virus INS1 Proteins 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 239000007788 liquid Substances 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 108020004999 messenger RNA Proteins 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- 230000000813 microbial effect Effects 0.000 description 1
- 230000025308 nuclear transport Effects 0.000 description 1
- 150000003833 nucleoside derivatives Chemical class 0.000 description 1
- 230000030648 nucleus localization Effects 0.000 description 1
- 230000009438 off-target cleavage Effects 0.000 description 1
- 239000008188 pellet Substances 0.000 description 1
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 229920002401 polyacrylamide Polymers 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 239000000047 product Substances 0.000 description 1
- 238000001742 protein purification Methods 0.000 description 1
- 239000011541 reaction mixture Substances 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 210000004767 rumen Anatomy 0.000 description 1
- 230000028327 secretion Effects 0.000 description 1
- 239000007787 solid Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 108020003113 steroid hormone receptors Proteins 0.000 description 1
- 102000005969 steroid hormone receptors Human genes 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 210000004243 sweat Anatomy 0.000 description 1
- 238000003786 synthesis reaction Methods 0.000 description 1
- 229940104230 thymidine Drugs 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- 230000032258 transport Effects 0.000 description 1
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 1
- 241001430294 unidentified retrovirus Species 0.000 description 1
- 229940035893 uracil Drugs 0.000 description 1
- DRTQHJPVMGBUCF-UHFFFAOYSA-N uracil arabinoside Natural products OC1C(O)C(CO)OC1N1C(=O)NC(=O)C=C1 DRTQHJPVMGBUCF-UHFFFAOYSA-N 0.000 description 1
- 229940045145 uridine Drugs 0.000 description 1
- 210000002700 urine Anatomy 0.000 description 1
- 238000012795 verification Methods 0.000 description 1
Images
Landscapes
- Measuring Or Testing Involving Enzymes Or Micro-Organisms (AREA)
Abstract
The present specification addresses the technical problem of providing a novel CRISPR/Cas12a system that can be used for detecting a target nucleic acid, wherein the previously unused CRISPR/Cas12a system having the Cas12a protein and guide RNA was discovered from a known DB through metagenome analysis and manufactured, and the auxiliary cleavage activity of the CRISPR/Cas12a system was verified. In order to solve the technical problem, the components of the CRISPR/Cas12a system, which was confirmed to be capable of recognizing a target nucleic acid and have auxiliary cleavage activity, are disclosed in detail in the present specification.
Description
본 명세서에서 개시되는 기술은 CRISPR/Cas 시스템, 특히 부수적 절단 기능(collateral cleavage function)을 가지는 CRISPR/Cas12a 시스템 및 이를 이용한 표적 핵산 검출 방법에 대한 기술이다.The technology disclosed in this specification is a technology for a CRISPR/Cas system, particularly a CRISPR/Cas12a system having a collateral cleavage function, and a method for detecting a target nucleic acid using the same.
CRISPR/Cas12a 시스템은 CRISPR/Cpf1 시스템으로도 불리며, Class 2 중 Type V의 A 서브타입에 속하는 CRISPR/Cas 시스템이다. 상기 CRISPR/Cas12a 시스템은 Broad Institute의 Feng Zhang 연구진에 의해 최초로 보고되었다. 상기 CRISPR/Cas12a 시스템은 CRISPR/Cas9 시스템 대비 더 간단한 가이드 RNA 구조를 가지고, Off-target 절단 비율이 적어 더 정교한 유전자 편집이 가능한 점 등의 장점이 있으며, 많은 연구자들이 그 활용 방안을 활발히 연구하고 있다. 본 명세서의 발명자들은 공지된 DB로부터 메타지놈(metagenome) 분석을 통해 기존에 사용된 바 없는 Cas12a 단백질 및 가이드 RNA를 가지는 CRISPR/Cas12a 시스템을 발견하였고, 이를 기초로 표적 핵산 검출에 사용할 수 있는 신규 CRISPR/Cas12a 시스템을 완성하였다.The CRISPR/Cas12a system, also called the CRISPR/Cpf1 system, is a CRISPR/Cas system belonging to the A subtype of Type V of Class 2. The CRISPR/Cas12a system was first reported by Feng Zhang's research team at the Broad Institute. The CRISPR/Cas12a system has a simpler guide RNA structure than the CRISPR/Cas9 system, has a lower off-target cleavage rate, and thus enables more precise gene editing, and many researchers are actively studying its utilization methods. The inventors of the present specification discovered a CRISPR/Cas12a system having a Cas12a protein and guide RNA that has not been used previously through metagenome analysis from a known DB, and completed a novel CRISPR/Cas12a system that can be used for target nucleic acid detection based on this.
본 명세서에서는 공지된 DB로부터 메타지놈(metagenome) 분석을 통해 기존에 사용된 바 없는 Cas12a 단백질 및 가이드 RNA를 가지는 CRISPR/Cas12a 시스템을 발굴하고, 이를 제조하고, 상기 CRISPR/Cas12a 시스템의 부수적 절단 활성 기능을 검증함으로써, 표적 핵산 검출에 사용할 수 있는 신규 CRISPR/Cas12a 시스템을 제공하는 것을 기술적 과제로 한다.The technical task of this specification is to discover a CRISPR/Cas12a system having a Cas12a protein and guide RNA that has not been used previously through metagenome analysis from a known DB, to manufacture the same, and to verify the secondary cleavage activity function of the CRISPR/Cas12a system, thereby providing a novel CRISPR/Cas12a system that can be used for target nucleic acid detection.
상기 기술적 과제를 해결하기 위해, 본 명세서에서는 실제로 표적 핵산을 인식할 수 있으며, 부수적 절단 활성이 있는 것이 확인된 CRISPR/Cas12a 시스템의 구성요소를 자세히 개시한다. 구체적으로, No entry found의 아미노산 서열을 가지는 Cas12a 단백질, 및 상기 Cas12a 단백질과 함께 동작할 수 있는 프로그램 가이드 RNA의 구성을 개시한다.To solve the above technical problems, the present specification discloses in detail components of a CRISPR/Cas12a system that can actually recognize a target nucleic acid and has a secondary cleavage activity. Specifically, the composition of a Cas12a protein having an amino acid sequence of No entry found and a program guide RNA capable of operating together with the Cas12a protein is disclosed.
본 명세서에서 특정한 신규 CRISPR/Cas12a 시스템은 표적 핵산이 존재할 때 부수적 절단 기능 (collateral-editing function)이 활성화되는 것이 특징이며, 해당 효과를 이용하면 표적 핵산의 존재여부를 검출할 수 있으며, 나아가 표적 핵산이 얼마나 포함되어 있는 지 측정할 수 있다.The novel CRISPR/Cas12a system described herein is characterized by the activation of a collateral-editing function when a target nucleic acid is present, and this effect can be utilized to detect the presence of the target nucleic acid and further to measure how much of the target nucleic acid is contained.
도 1은 실험예 1.3에 따라 제조된 Cas12a 단백질을 Ethidium Bromide 염색을 통해 검증한 결과를 나타낸다.Figure 1 shows the results of verifying the Cas12a protein manufactured according to Experimental Example 1.3 through ethidium bromide staining.
도 2는 실험예 1.4에 따라 제조된 Cas12a 단백질의 발현 결과를 SDS-PAGE를 사용하여 분석한 것을 나타낸다.Figure 2 shows the results of analyzing the expression of Cas12a protein manufactured according to Experimental Example 1.4 using SDS-PAGE.
도 3은 가이드 RNA의 발현 결과를 Ethidium Bromide 염색을 통해 확인한 결과를 나타낸다.Figure 3 shows the results of confirming the expression of guide RNA through ethidium bromide staining.
도 4는 실험예 2의 [표 2]에 나타낸 신규 CRISPR/Cas12a 시스템의 in vitro 표적-특이적 핵산 절단 활성 실험 결과를 나타낸 것으로, 반응 생성물을 Ethidium Bromide 염색으로 가시화한 것이다. 배양조건은 다음과 같다: pH 7.9, 25℃Figure 4 shows the results of an in vitro target-specific nucleic acid cleavage activity experiment of the novel CRISPR/Cas12a system shown in [Table 2] of Experimental Example 2, with the reaction products visualized by Ethidium Bromide staining. The culture conditions are as follows: pH 7.9, 25℃.
도 5는 실험예 2의 [표 2]에 나타낸 신규 CRISPR/Cas12a 시스템의 in vitro 표적-특이적 핵산 절단 활성 실험 결과를 나타낸 것으로, 반응 생성물을 Ethidium Bromide 염색으로 가시화한 것이다. 배양조건은 다음과 같다: pH 7.9, 37℃Figure 5 shows the results of an in vitro target-specific nucleic acid cleavage activity experiment of the novel CRISPR/Cas12a system shown in [Table 2] of Experimental Example 2, with the reaction products visualized by Ethidium Bromide staining. The culture conditions are as follows: pH 7.9, 37℃.
도 6은 실험예 2의 [표 2]에 나타낸 신규 CRISPR/Cas12a 시스템의 in vitro 표적-특이적 핵산 절단 활성 실험 결과를 나타낸 것으로, 반응 생성물을 Ethidium Bromide 염색으로 가시화한 것이다. 배양조건은 다음과 같다: pH 7.9, 60℃Figure 6 shows the results of an in vitro target-specific nucleic acid cleavage activity experiment of the novel CRISPR/Cas12a system shown in Table 2 of Experimental Example 2, visualizing the reaction products with Ethidium Bromide staining. The culture conditions are as follows: pH 7.9, 60℃.
도 7은 실험예 2의 [표 2]에 나타낸 신규 CRISPR/Cas12a 시스템의 in vitro 표적-특이적 핵산 절단 활성 실험 결과를 나타낸 것으로, 반응 생성물을 Ethidium Bromide 염색으로 가시화한 것이다. 배양조건은 다음과 같다: pH 6.5, 25℃Figure 7 shows the results of an in vitro target-specific nucleic acid cleavage activity experiment of the novel CRISPR/Cas12a system shown in Table 2 of Experimental Example 2, visualizing the reaction products with Ethidium Bromide staining. The culture conditions are as follows: pH 6.5, 25℃.
도 8은 실험예 2의 [표 2]에 나타낸 신규 CRISPR/Cas12a 시스템의 in vitro 표적-특이적 핵산 절단 활성 실험 결과를 나타낸 것으로, 반응 생성물을 Ethidium Bromide 염색으로 가시화한 것이다. 배양조건은 다음과 같다: pH 6.5, 37℃Figure 8 shows the results of an in vitro target-specific nucleic acid cleavage activity experiment of the novel CRISPR/Cas12a system shown in [Table 2] of Experimental Example 2, with the reaction products visualized by Ethidium Bromide staining. The culture conditions are as follows: pH 6.5, 37℃.
도 9는 실험예 2의 [표 2]에 나타낸 신규 CRISPR/Cas12a 시스템의 in vitro 표적-특이적 핵산 절단 활성 실험 결과를 나타낸 것으로, 반응 생성물을 Ethidium Bromide 염색으로 가시화한 것이다. 배양조건은 다음과 같다: pH 6.5, 60℃Figure 9 shows the results of an in vitro target-specific nucleic acid cleavage activity experiment of the novel CRISPR/Cas12a system shown in [Table 2] of Experimental Example 2, with the reaction products visualized by Ethidium Bromide staining. The culture conditions are as follows: pH 6.5, 60℃.
도 10은 실험예 2의 [표 2]에 나타낸 신규 CRISPR/Cas12a 시스템의 in vitro 표적-특이적 핵산 절단 활성 실험 결과를 나타낸 것으로, 반응 생성물을 Ethidium Bromide 염색으로 가시화한 것이다. 배양조건은 다음과 같다: pH 4.5, 25℃Figure 10 shows the results of an in vitro target-specific nucleic acid cleavage activity experiment of the novel CRISPR/Cas12a system shown in Table 2 of Experimental Example 2, visualizing the reaction products with Ethidium Bromide staining. The culture conditions are as follows: pH 4.5, 25℃.
도 11은 실험예 2의 [표 2]에 나타낸 신규 CRISPR/Cas12a 시스템의 in vitro 표적-특이적 핵산 절단 활성 실험 결과를 나타낸 것으로, 반응 생성물을 Ethidium Bromide 염색으로 가시화한 것이다. 배양조건은 다음과 같다: pH 4.5, 37℃Figure 11 shows the results of an in vitro target-specific nucleic acid cleavage activity experiment of the novel CRISPR/Cas12a system shown in [Table 2] of Experimental Example 2, and the reaction products were visualized by Ethidium Bromide staining. The culture conditions were as follows: pH 4.5, 37℃.
도 12는 실험예 2의 [표 2]에 나타낸 신규 CRISPR/Cas12a 시스템의 in vitro 표적-특이적 핵산 절단 활성 실험 결과를 나타낸 것으로, 반응 생성물을 Ethidium Bromide 염색으로 가시화한 것이다. 배양조건은 다음과 같다: pH 4.5, 60℃Figure 12 shows the results of an in vitro target-specific nucleic acid cleavage activity experiment of the novel CRISPR/Cas12a system shown in [Table 2] of Experimental Example 2, with the reaction products visualized by Ethidium Bromide staining. The culture conditions are as follows: pH 4.5, 60℃.
도 13은 실험예 3에 따라, [표 2]의 NGS-01의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 13 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-01 of [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 14는 실험예 3에 따라, [표 2]의 NGS-02의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 14 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-02 of [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 15는 실험예 3에 따라, [표 2]의 NGS-03의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 15 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-03 of [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 16은 실험예 3에 따라, [표 2]의 NGS-04의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 16 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-04 of [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 17은 실험예 3에 따라, [표 2]의 NGS-05의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 17 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-05 of [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 18은 실험예 3에 따라, [표 2]의 NGS-06의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 18 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-06 of [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 19은 실험예 3에 따라, [표 2]의 NGS-07의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 19 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-07 in [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 20은 실험예 3에 따라, [표 2]의 NGS-08의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 20 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-08 of [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 21은 실험예 3에 따라, [표 2]의 NGS-09의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 21 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-09 in [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 22은 실험예 3에 따라, [표 2]의 NGS-10의 CRISPR/Cas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 22 shows the results of confirming the collateral cleavage function of the CRISPR/Cas12a system of NGS-10 of [Table 2] according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 23은 실험예 3에 따라, 대조군인 CRISPR/LbaCas12a 시스템의 부가적 절단 기능(collateral cleavage function)을 확인한 결과를 나타낸다. 여기서, 가로축은 형광 측정한 시점, 세로축은 정규화한 형광 신호 세기를 나타낸다.Figure 23 shows the results of confirming the collateral cleavage function of the CRISPR/LbaCas12a system as a control group according to Experimental Example 3. Here, the horizontal axis represents the time point at which fluorescence was measured, and the vertical axis represents the normalized fluorescence signal intensity.
도 24는 실험예 2에 따라 제조된 프로그램 가능한 가이드 RNA의 발현 결과를 확인한 결과를 나타낸다.Figure 24 shows the results of confirming the expression results of the programmable guide RNA manufactured according to Experimental Example 2.
이하, 발명의 실시를 위한 최선의 형태를 예시적으로 개시한다. 이는 본 명세서에서 개시되는 발명의 일부 구현예를 포함하지만, 모든 구현예를 포함하고 있지는 않다. 본 단락에 서술된 실시예는 예시에 불과하며, 본 단락에 서술된 구현예만이 "본 발명의 최선의 형태"라고 이해되면 안 된다. 통상의 기술자라면 본 단락에 서술된 예시에 대한 많은 변형 및 보다 바람직한 구현예들을 떠올릴 수 있을 것이며, 그러한 내용 또한 본 발명의 실시를 위한 최선의 형태에 포함된다고 보아야 한다.Hereinafter, the best mode for carrying out the invention is disclosed by way of example. This includes some embodiments of the invention disclosed in this specification, but not all embodiments. The embodiments described in this paragraph are merely examples, and the embodiments described in this paragraph should not be construed as the "best mode of the invention." Those skilled in the art will be able to think of many modifications and more desirable embodiments of the embodiments described in this paragraph, and such contents should also be considered to be included in the best mode for carrying out the invention.
본 명세서에서는 다음을 포함하는 비표적 핵산 절단 방법을 제공한다:The present disclosure provides a non-target nucleic acid cleavage method comprising:
Cas12a 단백질, 가이드 RNA, 및 샘플을 섞는 과정;Process of mixing Cas12a protein, guide RNA, and sample;
여기서, 상기 샘플은 표적 핵산 및 상기 비표적 핵산을 포함하고,wherein the sample comprises a target nucleic acid and a non-target nucleic acid,
상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10; 및 서열번호 109 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10; and SEQ ID NO: 109;
상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,
상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.
상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 단백질-RNA 복합체를 이루도록 할 수 있고,The above scaffold can allow the guide RNA to interact with the Cas12a protein to form a protein-RNA complex,
상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,
상기 가이드 도메인은 상기 비표적 핵산과는 혼성화될 수 없음,The above guide domain cannot hybridize with the non-target nucleic acid;
상기 과정의 수행 결과, 상기 Cas12a 단백질 및 상기 가이드 RNA가 결합하여 단백질-RNA 복합체를 형성하고,As a result of performing the above process, the Cas12a protein and the guide RNA combine to form a protein-RNA complex,
상기 단백질-RNA 복합체는 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,The above protein-RNA complex binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.
상기 단백질-RNA 복합체에 의해 상기 비표적 핵산이 절단됨.The non-target nucleic acid is cleaved by the protein-RNA complex.
본 명세서에서는 다음을 포함하는 비표적 핵산 절단 방법을 제공한다:The present disclosure provides a non-target nucleic acid cleavage method comprising:
리보뉴클레오프로틴 (Ribonucleoprotein), 및 샘플을 섞는 과정;Ribonucleoprotein, and the process of mixing samples;
여기서, 상기 샘플은 표적 핵산 및 상기 비표적 핵산을 포함하고,wherein the sample comprises a target nucleic acid and a non-target nucleic acid,
상기 리보뉴클레오프로틴은 Cas12a 단백질 및 가이드 RNA를 포함하고,The above ribonucleoprotein comprises Cas12a protein and guide RNA,
상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,
상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,
상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.
상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴을 이루도록 할 수 있고,The above scaffold can enable the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein,
상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,
상기 가이드 도메인은 상기 비표적 핵산과는 혼성화될 수 없음,The above guide domain cannot hybridize with the non-target nucleic acid;
상기 리보뉴클레오프로틴은 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,The ribonucleoprotein binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.
상기 리보뉴클레오프로틴을 통해 상기 비표적 핵산이 절단됨.The non-target nucleic acid is cleaved by the ribonucleoprotein.
일 실시예로, 상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열로 구성될 수 있다.In one embodiment, the Cas12a protein may be composed of an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10.
일 실시예로, 상기 가이드 RNA의 스캐폴드는 서열번호 11 내지 서열번호 20 중에서 선택된 RNA 서열을 포함할 수 있다.In one embodiment, the scaffold of the guide RNA may comprise an RNA sequence selected from SEQ ID NO: 11 to SEQ ID NO: 20.
일 실시예로, 상기 Cas12a 단백질, 및 가이드 RNA의 스캐폴드는 다음 중 선택된 조합일 수 있다:In one embodiment, the scaffold of the Cas12a protein and the guide RNA can be a selected combination of:
Cas12a 단백질은 서열번호 1의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 11의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 1, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 11;
Cas12a 단백질은 서열번호 2의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 12의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 2, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 12;
Cas12a 단백질은 서열번호 3의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 13의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 13;
Cas12a 단백질은 서열번호 4의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 14의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 14;
Cas12a 단백질은 서열번호 5의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 15의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 15;
Cas12a 단백질은 서열번호 6의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 16의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 16;
Cas12a 단백질은 서열번호 7의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 17의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 17;
Cas12a 단백질은 서열번호 8의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 18의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 18;
Cas12a 단백질은 서열번호 9의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 19의 RNA 서열을 포함함; 또는The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 19; or
Cas12a 단백질은 서열번호 10의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 20의 RNA 서열을 포함함.The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 20.
일 실시예로,As an example,
상기 가이드 RNA는 스템-루프를 더 포함하고,The above guide RNA further comprises a stem-loop,
상기 스템-루프는 상기 스캐폴드의 5'말단에 연결되어 있으며,The above stem-loop is connected to the 5' end of the above scaffold,
상기 스템-루프는 서열번호 21의 RNA 서열을 포함할 수 있다.The above stem-loop may comprise an RNA sequence of SEQ ID NO: 21.
일 실시예로,As an example,
상기 표적 핵산은 이중가닥 DNA 또는 단일가닥 DNA이며, 상기 비표적 핵산은 이중가닥 DNA 또는 단일가닥 DNA일 수 있다.The target nucleic acid may be double-stranded DNA or single-stranded DNA, and the non-target nucleic acid may be double-stranded DNA or single-stranded DNA.
본 명세서에서는 다음을 포함하는, 샘플 내 표적 핵산 검출 방법을 제공한다:The present specification provides a method for detecting a target nucleic acid in a sample, comprising:
Cas12a 단백질, 가이드 RNA, 검출용 조성물 및 샘플을 섞는 과정;Process of mixing Cas12a protein, guide RNA, detection composition and sample;
여기서, 상기 검출용 조성물은 프로브 핵산을 포함하고,Here, the detection composition comprises a probe nucleic acid,
상기 프로브 핵산은 절단 시 검출 가능한 신호를 생성하는 것이고,The above probe nucleic acid produces a detectable signal upon cleavage,
상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,
상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,
상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.
상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 단백질-RNA 복합체를 이루도록 할 수 있고,The above scaffold can allow the guide RNA to interact with the Cas12a protein to form a protein-RNA complex,
상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,
상기 과정의 수행 결과, 상기 Cas12a 단백질 및 상기 가이드 RNA가 결합하여 단백질-RNA 복합체를 형성하고,As a result of performing the above process, the Cas12a protein and the guide RNA combine to form a protein-RNA complex,
상기 샘플 내에 상기 표적 핵산이 포함되어 있는 경우, 상기 단백질-RNA 복합체는 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,When the target nucleic acid is contained in the sample, the protein-RNA complex binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.
상기 단백질-RNA 복합체에 의해 상기 프로브 핵산이 절단되는 경우, 상기 검출 가능한 신호가 측정되며,When the probe nucleic acid is cleaved by the protein-RNA complex, the detectable signal is measured.
상기 검출 가능한 신호를 측정하여, 상기 샘플 내 상기 표적 핵산이 존재하는 지 여부, 및/또는 상기 샘플 내에 포함된 상기 표적 핵산의 양을 결정할 수 있음.By measuring the detectable signal, it is possible to determine whether the target nucleic acid is present in the sample and/or the amount of the target nucleic acid contained in the sample.
본 명세서에서는 다음을 포함하는, 샘플 내 표적 핵산 검출 방법을 제공한다:The present specification provides a method for detecting a target nucleic acid in a sample, comprising:
리보뉴클레오프로틴 (Ribonucleoprotein), 검출용 조성물 및 샘플을 섞는 과정;A process of mixing ribonucleoprotein, a composition for detection and a sample;
여기서, 상기 검출용 조성물은 프로브 핵산을 포함하고,Here, the detection composition comprises a probe nucleic acid,
상기 프로브 핵산은 절단 시 검출 가능한 신호를 생성하는 것이고,The above probe nucleic acid produces a detectable signal upon cleavage,
상기 리보뉴클레오프로틴은 Cas12a 단백질 및 가이드 RNA를 포함하고,The above ribonucleoprotein comprises Cas12a protein and guide RNA,
상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,
상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,
상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.
상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴을 이루도록 할 수 있고,The above scaffold can enable the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein,
상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,
상기 샘플 내에 상기 표적 핵산이 포함되어 있는 경우, 상기 리보뉴클레오프로틴은 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,If the target nucleic acid is contained in the sample, the ribonucleoprotein binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.
상기 리보뉴클레오프로틴에 의해 상기 프로브 핵산이 절단되는 경우, 상기 검출 가능한 신호가 측정되며,When the probe nucleic acid is cleaved by the ribonucleoprotein, the detectable signal is measured,
상기 검출 가능한 신호를 측정하여, 상기 샘플 내 상기 표적 핵산이 존재하는 지 여부, 및/또는 상기 샘플 내에 포함된 상기 표적 핵산의 양을 결정할 수 있음.By measuring the detectable signal, it is possible to determine whether the target nucleic acid is present in the sample and/or the amount of the target nucleic acid contained in the sample.
본 명세서에서는 다음을 포함하는, 샘플 내 표적 핵산 검출 방법을 제공한다:The present specification provides a method for detecting a target nucleic acid in a sample, comprising:
검출용 조성물 및 샘플을 섞는 과정;Process of mixing the composition for detection and the sample;
여기서, 상기 검출용 조성물은 리보뉴클레오프로틴 (Ribonucleoprotein), 및 프로브 핵산을 포함하고,Here, the detection composition comprises ribonucleoprotein and probe nucleic acid,
상기 프로브 핵산은 절단 시 검출 가능한 신호를 생성하는 것이고,The above probe nucleic acid produces a detectable signal upon cleavage,
상기 리보뉴클레오프로틴은 Cas12a 단백질 및 가이드 RNA를 포함하고,The above ribonucleoprotein comprises Cas12a protein and guide RNA,
상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,
상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,
상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.
상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴을 이루도록 할 수 있고,The above scaffold can enable the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein,
상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,
상기 샘플 내에 상기 표적 핵산이 포함되어 있는 경우, 상기 리보뉴클레오프로틴은 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,If the target nucleic acid is contained in the sample, the ribonucleoprotein binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.
상기 리보뉴클레오프로틴에 의해 상기 프로브 핵산이 절단되는 경우, 상기 검출 가능한 신호가 측정되며,When the probe nucleic acid is cleaved by the ribonucleoprotein, the detectable signal is measured,
상기 검출 가능한 신호를 측정하여, 상기 샘플 내 상기 표적 핵산이 존재하는 지 여부, 및/또는 상기 샘플 내에 포함된 상기 표적 핵산의 양을 결정할 수 있음.By measuring the detectable signal, it is possible to determine whether the target nucleic acid is present in the sample and/or the amount of the target nucleic acid contained in the sample.
일 실시예로, 상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열로 구성된 것일 수 있다.In one embodiment, the Cas12a protein may be composed of an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10.
일 실시계로, 상기 가이드 RNA의 스캐폴드는 서열번호 11 내지 서열번호 20 중에서 선택된 RNA 서열을 포함할 수 있다.In one embodiment, the scaffold of the guide RNA may comprise an RNA sequence selected from SEQ ID NO: 11 to SEQ ID NO: 20.
일 실시예로, 상기 Cas12a 단백질, 및 가이드 RNA의 스캐폴드는 다음 중 선택된 조합일 수 있다:In one embodiment, the scaffold of the Cas12a protein and the guide RNA can be a selected combination of:
Cas12a 단백질은 서열번호 1의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 11의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 1, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 11;
Cas12a 단백질은 서열번호 2의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 12의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 2, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 12;
Cas12a 단백질은 서열번호 3의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 13의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 13;
Cas12a 단백질은 서열번호 4의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 14의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 14;
Cas12a 단백질은 서열번호 5의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 15의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 15;
Cas12a 단백질은 서열번호 6의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 16의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 16;
Cas12a 단백질은 서열번호 7의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 17의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 17;
Cas12a 단백질은 서열번호 8의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 18의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 18;
Cas12a 단백질은 서열번호 9의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 19의 RNA 서열을 포함함; 또는The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 19; or
Cas12a 단백질은 서열번호 10의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 20의 RNA 서열을 포함함.The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 20.
일 실시예로, 상기 가이드 RNA는 스템-루프를 더 포함하고, 상기 스템-루프는 상기 스캐폴드의 5'말단에 연결되어 있으며, 상기 스템-루프는 서열번호 21의 RNA 서열을 포함할 수 있다.In one embodiment, the guide RNA further comprises a stem-loop, wherein the stem-loop is connected to the 5' end of the scaffold, and wherein the stem-loop comprises an RNA sequence of SEQ ID NO: 21.
일 실시예로, 상기 표적 핵산은 이중가닥 DNA 또는 단일가닥 DNA이며, 상기 비표적 핵산은 이중가닥 DNA 또는 단일가닥 DNA일 수 있다.In one embodiment, the target nucleic acid may be double-stranded DNA or single-stranded DNA, and the non-target nucleic acid may be double-stranded DNA or single-stranded DNA.
일 실시예로, 상기 프로브 핵산이 절단되는 경우 생성되는 상기 검출 가능한 신호는 형광 신호일 수 있다.In one embodiment, the detectable signal generated when the probe nucleic acid is cleaved may be a fluorescent signal.
본 명세서에서는 다음을 포함하는 표적 핵산 검출용 조성물을 제공한다:The present specification provides a composition for detecting a target nucleic acid, comprising:
Cas12a 단백질; 프로그램 가능한 가이드 RNA; 및 프로브 핵산;Cas12a protein; programmable guide RNA; and probe nucleic acid;
여기서, 상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,Here, the Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,
상기 프로그램 가능한 가이드 RNA는 5'-[직접 반복부]-[가이드 도메인]-3' 구조를 가지며,The above programmable guide RNA has a 5'-[direct repeat]-[guide domain]-3' structure,
상기 직접 반복부는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴 (Ribonucleoprotein; RNP)을 형성할 수 있도록 하고,The above direct repeat portion enables the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein (RNP),
상기 가이드 도메인은 상기 표적 핵산을 표적하도록 인위적으로 설계된 것이고,The above guide domain is artificially designed to target the target nucleic acid,
상기 프로브 핵산은 절단되는 경우 검출 가능한 신호를 생성하는 것임.The above probe nucleic acid is one which, when cleaved, produces a detectable signal.
일 실시예로, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA는 결합하여 RNP를 형성하고 있을 수 있다.In one embodiment, the Cas12a protein and the programmable guide RNA may be combined to form an RNP.
일 실시예로, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 11 내지 서열번호 20 중에서 선택된 RNA 서열을 포함할 수 있다.In one embodiment, the direct repeat portion of the guide RNA may comprise an RNA sequence selected from SEQ ID NO: 11 to SEQ ID NO: 20.
일 실시예로,As an example,
상기 Cas12a 단백질이 서열번호 1의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 11의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of sequence number 1, the direct repeat portion of the guide RNA comprises an RNA sequence of sequence number 11,
상기 Cas12a 단백질이 서열번호 2의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 12의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of sequence number 2, the direct repeat portion of the guide RNA comprises an RNA sequence of sequence number 12,
상기 Cas12a 단백질이 서열번호 3의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 13의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 13,
상기 Cas12a 단백질이 서열번호 4의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 14의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 14,
상기 Cas12a 단백질이 서열번호 5의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 15의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 15,
상기 Cas12a 단백질이 서열번호 6의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 16의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 16,
상기 Cas12a 단백질이 서열번호 7의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 17의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 17,
상기 Cas12a 단백질이 서열번호 8의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 18의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 18,
상기 Cas12a 단백질이 서열번호 9의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 19의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 19,
상기 Cas12a 단백질이 서열번호 10의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 20의 RNA 서열을 포함할 수 있다.When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, the direct repeat portion of the guide RNA may comprise an RNA sequence of SEQ ID NO: 20.
일 실시예로, 상기 프로브 핵산이 절단되는 경우 생성되는 검출 가능한 신호는 형광 신호인, 표적 핵산 검출용 조성물.In one embodiment, a composition for detecting a target nucleic acid, wherein the detectable signal generated when the probe nucleic acid is cleaved is a fluorescent signal.
본 명세서에서는 다음을 포함하는 표적 핵산 검출 키트를 제공한다:The present specification provides a target nucleic acid detection kit comprising:
Cas12a 단백질; 프로그램 가능한 가이드 RNA; 및 프로브 핵산;Cas12a protein; programmable guide RNA; and probe nucleic acid;
여기서, 상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,Here, the Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,
상기 프로그램 가능한 가이드 RNA는 5'-[직접 반복부]-[가이드 도메인]-3' 구조를 가지며,The above programmable guide RNA has a 5'-[direct repeat]-[guide domain]-3' structure,
상기 직접 반복부는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴 (Ribonucleoprotein; RNP)을 형성할 수 있도록 하고,The above direct repeat portion enables the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein (RNP),
상기 가이드 도메인은 상기 표적 핵산을 표적하도록 인위적으로 설계된 것이고,The above guide domain is artificially designed to target the target nucleic acid,
상기 프로브 핵산은 절단되는 경우 검출 가능한 신호를 생성하는 것임.The above probe nucleic acid is one which, when cleaved, produces a detectable signal.
일 실시예로, 상기 표적 핵산 검출 키트는 2개 이상의 용기를 포함하고,In one embodiment, the target nucleic acid detection kit comprises two or more containers,
상기 Cas12a 단백질 및 상기 프로브 핵산은 서로 다른 용기에 포함되어 있을 수 있다.The above Cas12a protein and the probe nucleic acid may be contained in different containers.
일 실시예로, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 11 내지 서열번호 20 중에서 선택된 RNA 서열을 포함할 수 있다.In one embodiment, the direct repeat portion of the guide RNA may comprise an RNA sequence selected from SEQ ID NO: 11 to SEQ ID NO: 20.
일 실시예로,As an example,
상기 Cas12a 단백질이 서열번호 1의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 11의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of sequence number 1, the direct repeat portion of the guide RNA comprises an RNA sequence of sequence number 11,
상기 Cas12a 단백질이 서열번호 2의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 12의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of sequence number 2, the direct repeat portion of the guide RNA comprises an RNA sequence of sequence number 12,
상기 Cas12a 단백질이 서열번호 3의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 13의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 13,
상기 Cas12a 단백질이 서열번호 4의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 14의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 14,
상기 Cas12a 단백질이 서열번호 5의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 15의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 15,
상기 Cas12a 단백질이 서열번호 6의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 16의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 16,
상기 Cas12a 단백질이 서열번호 7의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 17의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 17,
상기 Cas12a 단백질이 서열번호 8의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 18의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 18,
상기 Cas12a 단백질이 서열번호 9의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 19의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 19,
상기 Cas12a 단백질이 서열번호 10의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 20의 RNA 서열을 포함할 수 있다.When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, the direct repeat portion of the guide RNA may comprise an RNA sequence of SEQ ID NO: 20.
일 실시예로, 상기 프로브 핵산이 절단되는 경우 생성되는 검출 가능한 신호는 형광 신호일 수 있다.In one embodiment, the detectable signal generated when the probe nucleic acid is cleaved may be a fluorescent signal.
일 실시예로, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA는 결합하여 RNP를 형성하고 있을 수 있다.In one embodiment, the Cas12a protein and the programmable guide RNA may be combined to form an RNP.
본 명세서에서는 다음을 포함하는 Cas12a 조성물을 제공한다:The present disclosure provides a Cas12a composition comprising:
Cas12a 단백질 또는 상기 Cas12a 단백질을 암호화하는 핵산; 및Cas12a protein or a nucleic acid encoding said Cas12a protein; and
프로그램 가능한 가이드 RNA 또는 상기 프로그램 가능한 가이드 RNA를 암호화하는 핵산;A programmable guide RNA or a nucleic acid encoding said programmable guide RNA;
여기서, 상기 프로그램 가능한 가이드 RNA는 5'-[직접 반복부]-[가이드 도메인]-3' 구조를 가지며,Here, the programmable guide RNA has a 5'-[direct repeat]-[guide domain]-3' structure,
상기 직접 반복부는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴 (Ribonucleoprotein; RNP)을 형성할 수 있도록 하고,The above direct repeat portion enables the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein (RNP),
상기 가이드 도메인은 상기 표적 핵산을 표적하도록 인위적으로 설계된 것이고,The above guide domain is artificially designed to target the target nucleic acid,
상기 직접 반복부 및 상기 Cas12a 단백질은 다음 중 선택된 조합임:The above direct repeat portion and the Cas12a protein are a selected combination of:
Cas12a 단백질은 서열번호 1의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 11의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 1, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 11;
Cas12a 단백질은 서열번호 2의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 12의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 2, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 12;
Cas12a 단백질은 서열번호 3의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 13의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 13;
Cas12a 단백질은 서열번호 4의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 14의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 14;
Cas12a 단백질은 서열번호 5의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 15의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 15;
Cas12a 단백질은 서열번호 6의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 16의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 16;
Cas12a 단백질은 서열번호 7의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 17의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 17;
Cas12a 단백질은 서열번호 8의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 18의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 18;
Cas12a 단백질은 서열번호 9의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 19의 RNA 서열을 포함함; 또는The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 19; or
Cas12a 단백질은 서열번호 10의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 20의 RNA 서열을 포함함.The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 20.
일 실시예로, 상기 Cas12a 조성물은 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA를 포함할 수 있다.In one embodiment, the Cas12a composition may comprise the Cas12a protein and the programmable guide RNA.
일 실시예로, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA가 결합하여 리보뉴클레오프로틴을 형성하고 있을 수 있다.In one example, the Cas12a protein and the programmable guide RNA may be combined to form a ribonucleoprotein.
본 명세서에서는 상기 Cas12a 조성물을 상기 비표적 핵산 절단 방법에 사용하는 용도를 제공한다.The present specification provides a use of the Cas12a composition in the non-target nucleic acid cleavage method.
본 명세서에서는 상기 Cas12a 조성물의 상기 표적 핵산 검출 방법에 사용하는 용도를 제공한다.The present specification provides a use of the Cas12a composition in the method for detecting a target nucleic acid.
이하, 첨부된 도면을 참조하여, 발명의 내용을 특정한 구현예와 예시들을 통해 더욱 상세하게 설명한다. 상기 첨부된 도면은 발명의 일부 구현예를 포함하지만, 모든 구현예를 포함하고 있지는 않다는 점에 유의해야 한다. 본 명세서에 의해 개시되는 발명의 내용은 다양하게 구현될 수 있으며, 여기에 설명되는 특정 구현예로 제한되지 않는다. 이러한 구현예들은 본 명세서에 적용되는 법적 요건을 만족시키기 위해 제공되는 것으로 보아야 한다. 본 명세서에 개시된 발명이 속한 기술분야에 있어 통상의 기술자라면, 본 명세서에 개시된 발명의 내용에 대한 많은 변형 및 다른 구현예들을 떠올릴 수 있을 것이다. 따라서, 본 명세서에서 개시된 발명의 내용은 여기에 기재된 특정 구현예로 제한되지 않으며, 이에 대한 변형 및 다른 구현예들도 청구범위 내에 포함되는 것으로 이해되어야 한다.Hereinafter, with reference to the attached drawings, the content of the invention will be described in more detail through specific implementation examples and examples. It should be noted that the attached drawings include some implementation examples of the invention, but not all implementation examples. The content of the invention disclosed by this specification can be implemented in various ways and is not limited to the specific implementation examples described herein. It should be understood that these implementation examples are provided to satisfy the legal requirements applicable to this specification. Those skilled in the art will be able to think of many modifications and other implementation examples of the content of the invention disclosed herein. Therefore, the content of the invention disclosed herein is not limited to the specific implementation examples described herein, and modifications and other implementations thereof are also intended to be included within the scope of the claims.
용어의 정의Definition of terms
약approximately
본 명세서에서 사용되는 "약"이라는 용어는 참조 양, 수준, 값, 수, 빈도, 퍼센트, 치수, 크기, 양, 중량 또는 길이에 대해 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1%, 또는 0% 정도로 변하는 양, 수준, 값, 수, 빈도, 퍼센트, 치수, 크기, 양, 중량 또는 길이를 의미한다.The term "about" as used herein means an amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length that varies by about 30, 25, 20, 15, 10, 9, 8, 7, 6, 5, 4, 3, 2, 1%, or 0% with respect to a reference amount, level, value, number, frequency, percentage, dimension, size, amount, weight, or length.
NLS (Nuclear Localization Sequence)NLS (Nuclear Localization Sequence)
본 명세서에서 "NLS"라 함은, 핵 수송(nuclear transport) 작용으로 세포 핵 외부의 물질을 핵 내부로 수송할 때, 수송 대상인 단백질에 붙어 일종의 "태그"역할을 하는 일정 길이의 펩타이드, 또는 그 서열을 의미한다. 구체적으로, 상기 NLS는 아미노산 서열 PKKKRKV(서열번호 88)을 갖는 SV40 바이러스 대형 T-항원의 NLS; 뉴클레오플라스민(nucleoplasmin)으로부터의 NLS(예를 들어, 서열 KRPAATKKAGQAKKKK(서열번호 89)를 갖는 뉴클레오플라스민 이분(bipartite) NLS); 아미노산 서열 PAAKRVKLD(서열번호 90) 또는 RQRRNELKRSP(서열번호 91)를 갖는 c-myc NLS; 서열 NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY(서열번호 92)를 갖는 hRNPA1 M9 NLS; 임포틴-알파로부 터의 IBB 도메인의 서열 RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV(서열번호 93); 마이오마(myoma) T 단백질의 서열 VSRKRPRP(서열번호 94) 및 PPKKARED(서열번호 95); 인간 p53의 서열 PQPKKKPL(서열번호 96); 마우스 c-abl IV의 서열 SALIKKKKKMAP(서열번호 97); 인플루엔자 바이러스 NS1의 서열 DRLRR(서열번호 98) 및 PKQKKRK(서열번호 99); 간염 바이러스 델타 항원의 서열 RKLKKKIKKL(서열번호 100); 마우스 Mx1 단백질의 서열 REKKKFLKRR(서열번호 101); 인간 폴리(ADP-리보스) 중합효소의 서열 KRKGDEVDGVDEVAKKKSKK(서열번호 102); 또는 스테로이드 호르몬 수용체(인간) 글루코코르티코이드의 서열 RKCLQAGMNLEARKTKK(서열번호 103)로부터 유래된 NLS 서열일 수 있으나, 이에 제한되지 않는다. 본 명세서에서 사용되는 "NLS"라는 용어는 통상의 기술자가 인식할 수 있는 의미를 모두 포함하며, 문맥에 따라 적절하게 해석될 수 있다.The term "NLS" herein refers to a peptide of a certain length, or its sequence, which acts as a kind of "tag" by attaching to a protein that is the target of transport when transporting a material outside the nucleus into the nucleus by nuclear transport. Specifically, the NLS is an NLS of the SV40 virus large T antigen having the amino acid sequence PKKKRKV (SEQ ID NO: 88); an NLS from nucleoplasmin (e.g., a nucleoplasmin bipartite NLS having the sequence KRPAATKKAGQAKKKK (SEQ ID NO: 89)); a c-myc NLS having the amino acid sequence PAAKRVKLD (SEQ ID NO: 90) or RQRRNELKRSP (SEQ ID NO: 91); an hRNPA1 M9 NLS having the sequence NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 92); The sequence RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 93) of the IBB domain from importin-alpha; the sequences VSRKRPRP (SEQ ID NO: 94) and PPKKARED (SEQ ID NO: 95) of myoma T protein; the sequence PQPKKKPL (SEQ ID NO: 96) of human p53; the sequence SALIKKKKKMAP (SEQ ID NO: 97) of mouse c-abl IV; the sequences DRLRR (SEQ ID NO: 98) and PKQKKRK (SEQ ID NO: 99) of influenza virus NS1; the sequence RKLKKKIKKL (SEQ ID NO: 100) of hepatitis virus delta antigen; the sequence REKKKFLKRR (SEQ ID NO: 101) of mouse Mx1 protein; The NLS sequence may be derived from, but is not limited to, the sequence KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 102) of human poly(ADP-ribose) polymerase; or the sequence RKCLQAGMNLEARKTKK (SEQ ID NO: 103) of the steroid hormone receptor (human) glucocorticoid. The term "NLS" as used herein has all meanings that can be recognized by a person skilled in the art and may be appropriately interpreted depending on the context.
아미노산 서열 표기Amino acid sequence notation
달리 서술하지 않는 한, 본 명세서에서 아미노산 서열을 기재할 때는 아미노산 일문자 표기법, 또는 세문자 표기법을 사용하여, N-터미널에서 C-터미널 방향으로 기재한다. 예를 들어, RNVP로 표기하는 경우, N-터미널에서 C-터미널 방향으로 아르기닌(arginine), 아스파라긴(asparagine), 발린(valine), 및 프롤린(proline)이 차례로 연결된 펩타이드를 의미한다. 또 다른 예를 들어, Thr-Leu-Lys로 표기하는 경우, N-터미널에서 C-터미널 방향으로 트레오닌(Threonine), 류신(Leucine), 및 리신(Lysine)이 차례로 연결된 펩타이드를 의미한다. 상기 일문자 표기법으로 나타낼 수 없는 아미노산의 경우, 다른 문자를 사용하여 표기하며, 추가적으로 보충하여 설명한다.Unless otherwise stated, when describing an amino acid sequence in this specification, the amino acid single-letter notation or three-letter notation is used, and is described in the direction from the N-terminal to the C-terminal. For example, in the case of notation as RNVP, it means a peptide in which arginine, asparagine, valine, and proline are sequentially connected in the direction from the N-terminal to the C-terminal. As another example, in the case of notation as Thr-Leu-Lys, it means a peptide in which threonine, leucine, and lysine are sequentially connected in the direction from the N-terminal to the C-terminal. In the case of amino acids that cannot be expressed in the single-letter notation, other letters are used and additional explanations are provided.
각각의 아미노산 표기 방법은 다음과 같다: 알라닌(Alanine; Ala, A); 아르기닌(Arginine; Arg, R); 아스파라긴(Asparagine; Asn, N); 아스파르트산(Aspartic acid; Asp, D); 시스테인(Cysteine; Cys, C); 글루탐산(Glutamic acid; Glu, E); 글루타민(Glutamine; Gln, Q); 글리신(Glycine; Gly, G); 히스티딘(Histidine; His, H); 이소류신(Isoleucine; Ile, I); 류신(Leucine; Leu, L); 리신(Lysine; Lys K); 메티오닌(Methionine; Met, M); 페닐알라닌(Phenylalanine; Phe, F); 프롤린(Proline; Pro, P); 세린(Serine; Ser, S); 트레오닌(Threonine; Thr, T); 트립토판(Tryptophan; Trp, W); 티로신(Tyrosine; Tyr, Y); 및 발린(Valine; Val, V).The notation for each amino acid is as follows: Alanine (Ala, A); Arginine (Arg, R); Asparagine (Asn, N); Aspartic acid (Asp, D); Cysteine (Cys, C); Glutamic acid (Glu, E); Glutamine (Gln, Q); Glycine (Gly, G); Histidine (His, H); Isoleucine (Ile, I); Leucine (Leu, L); Lysine (Lys K); Methionine (Met, M); Phenylalanine (Phe, F); Proline (Pro, P); Serine (Ser, S); Threonine (Thr, T); Tryptophan (Trp, W); Tyrosine (Ty, Y); and Valine (Val, V).
핵산 서열 표기Nucleic acid sequence notation
본 명세서에서 사용되는 A, T, C, G 및 U 기호는 당업계 통상의 기술자가 이해하는 의미로 해석된다. 문맥 및 기술에 따라 DNA 또는 RNA 상에서 염기, 뉴클레오사이드 또는 뉴클레오타이드로 적절히 해석될 수 있다. 예를 들어, 염기를 의미하는 경우는 각각 아데닌(A), 티민(T), 시토신(C), 구아닌(G) 또는 우라실(U) 자체로 해석될 수 있고, 뉴클레오사이드를 의미하는 경우는 각각 아데노신(A), 티미딘(T), 시티딘(C), 구아노신(G) 또는 유리딘(U)으로 해석될 수 있으며, 서열에서 뉴클레오타이드를 의미하는 경우는 상기 각각의 뉴클레오사이드를 포함하는 뉴클레오타이드를 의미하는 것으로 해석되어야 한다.The symbols A, T, C, G, and U used herein are to be interpreted as having the meanings understood by a person skilled in the art. They may be appropriately interpreted as bases, nucleosides, or nucleotides on DNA or RNA, depending on the context and technology. For example, when referring to a base, they may be interpreted as adenine (A), thymine (T), cytosine (C), guanine (G), or uracil (U) themselves, respectively, and when referring to a nucleoside, they may be interpreted as adenosine (A), thymidine (T), cytidine (C), guanosine (G), or uridine (U), respectively, and when referring to a nucleotide in a sequence, they should be interpreted to mean a nucleotide including each of the above nucleosides.
표적 유전자 또는 표적 핵산target gene or target nucleic acid
본 명세서에서 사용되는 "표적 유전자" 또는 "표적 핵산"은 기본적으로, 유전자 편집의 대상이 되는 세포 내 유전자, 또는 핵산을 의미한다. 상기 표적 유전자 또는 표적 핵산은 혼용될 수 있으며, 서로 동일한 대상을 지칭할 수 있다. 상기 표적 유전자 또는 표적 핵산은 달리 기재되지 않은 한, 대상 세포가 가진 고유한 유전자 또는 핵산, 혹은 외부 유래의 유전자 또는 핵산 모두를 의미할 수 있으며, 유전자 편집의 대상이 될 수 있다면 특별히 제한되지 않는다. 상기 표적 유전자 또는 표적 핵산은 단일가닥 DNA, 이중가닥 DNA, 및/또는 RNA일 수 있다. 또한, 상기 용어는 당업계 통상의 기술자가 인식할 수 있는 의미를 모두 포함하며, 문맥에 따라 적절히 해석될 수 있다.The "target gene" or "target nucleic acid" used in this specification basically means a gene or nucleic acid within a cell that is the target of gene editing. The target gene or target nucleic acid may be used interchangeably and may refer to the same subject. Unless otherwise specified, the target gene or target nucleic acid may refer to both a unique gene or nucleic acid possessed by the target cell, or an externally derived gene or nucleic acid, and is not particularly limited as long as it can be the target of gene editing. The target gene or target nucleic acid may be single-stranded DNA, double-stranded DNA, and/or RNA. In addition, the above terms include all meanings that can be recognized by a person skilled in the art, and may be appropriately interpreted according to the context.
표적 서열Target sequence
본 명세서에서 사용되는 "표적 서열"은 CRISPR/Cas 복합체가 표적 유전자 또는 표적 핵산을 절단하기 위해 인식하는 특정 서열을 의미한다. 상기 표적 서열은 그 목적에 따라 적절히 선택될 수 있다. 구체적으로, "표적 서열"은 표적 유전자 또는 표적 핵산 서열 내에 포함된 서열이며, 본 명세서에서 제공하는 가이드 RNA, 또는 엔지니어링 된 가이드 RNA에 포함된 스페이서 서열과 상보성을 가지는 서열을 의미한다. 일반적으로, 상기 스페이서 서열은 표적 유전자 또는 표적 핵산의 서열 및 CRISPR/Cas 시스템의 이펙터 단백질이 인식하는 PAM 서열을 고려하여 결정된다. 상기 표적 서열은 CRISPR/Cas 복합체의 가이드 RNA와 상보적으로 결합하는 특정 가닥만을 지칭할 수 있으며, 상기 특정 가닥 부분을 포함하는 표적 이중 가닥 전체를 지칭할 수도 있으며, 이는 문맥에 따라 적절히 해석된다. 또한, 상기 용어는 당업계 통상의 기술자가 인식할 수 있는 의미를 모두 포함하며, 문맥에 따라 적절히 해석될 수 있다.As used herein, the term "target sequence" refers to a specific sequence recognized by the CRISPR/Cas complex to cleave a target gene or target nucleic acid. The target sequence may be appropriately selected depending on the purpose. Specifically, the term "target sequence" refers to a sequence included in a target gene or target nucleic acid sequence, and a sequence having complementarity with a spacer sequence included in a guide RNA provided herein, or an engineered guide RNA. In general, the spacer sequence is determined in consideration of the sequence of the target gene or target nucleic acid and the PAM sequence recognized by the effector protein of the CRISPR/Cas system. The target sequence may refer only to a specific strand that complementarily binds to the guide RNA of the CRISPR/Cas complex, or may refer to the entire target double strand including the specific strand portion, which is appropriately interpreted depending on the context. In addition, the term includes all meanings that can be recognized by a person skilled in the art, and may be appropriately interpreted depending on the context.
벡터vector
본 명세서에서 사용되는 "벡터"는 달리 특정되지 않는 한, 유전 물질을 세포 내로 운반할 수 있는 모든 물질을 통틀어 일컫는다. 예를 들어, 벡터는 대상이 되는 유전 물질, 예를 들어 CRISPR/Cas 시스템의 이펙터 단백질을 암호화하는 핵산, 및/또는 가이드 RNA를 암호화하는 핵산을 포함하는 DNA 분자일 수 있으나, 이에 제한되는 것은 아니다. 상기 용어는 당업계 통상의 기술자가 인식할 수 있는 의미를 모두 포함하며, 문맥에 따라 적절히 해석될 수 있다.As used herein, "vector" refers to any material capable of transporting genetic material into a cell, unless otherwise specified. For example, a vector may be, but is not limited to, a DNA molecule containing the genetic material of interest, for example, a nucleic acid encoding an effector protein of a CRISPR/Cas system, and/or a nucleic acid encoding a guide RNA. The above terms include all meanings that can be recognized by a person skilled in the art, and may be appropriately interpreted according to the context.
배경기술 - CRISPR/Cas12a 시스템Background - CRISPR/Cas12a system
CRISPR/Cas12a 시스템 개괄Overview of the CRISPR/Cas12a System
CRISPR/Cas12a 시스템은 CRISPR/Cas9 시스템과 더불어 많은 연구가 이뤄진 CRISPR/Cas 시스템이다. 상기 CRISPR/Cas12a 시스템도 CRISPR/Cas9 시스템과 마찬가지로 이중가닥 핵산에 대해 표적-특이적 절단 활성을 가지는 것으로 알려져 있으며, 따라서 진핵 세포 내 유전자 편집 용도로 활용성이 높다. CRISPR/Cas12a 시스템은 CRISPR/Cas9 시스템과 비교하여 1) Cas12a 단백질이 핵산 절단 도메인을 한 종류만 가지고(RuvC 도메인), 2) 가이드 RNA가 crRNA로만 이뤄져 있으며, 3) 유전자 절단 시 4-5개의 뉴클레오타이드 오버행(overhang)을 발생시키는, sticky end 형태로 핵산을 절단한다는 특징이 있다. 이하 이러한 CRISPR/Cas12a 시스템 및 그 구성요소에 대해 더 자세히 설명한다.The CRISPR/Cas12a system is a CRISPR/Cas system that has been studied extensively along with the CRISPR/Cas9 system. The CRISPR/Cas12a system, like the CRISPR/Cas9 system, is known to have target-specific cleavage activity for double-stranded nucleic acids, and therefore has high utility for gene editing in eukaryotic cells. Compared to the CRISPR/Cas9 system, the CRISPR/Cas12a system has the following characteristics: 1) the Cas12a protein has only one type of nucleic acid cleavage domain (RuvC domain), 2) the guide RNA consists only of crRNA, and 3) it cleaves nucleic acids in a sticky end form that generates 4-5 nucleotide overhangs during gene cleavage. The CRISPR/Cas12a system and its components will be described in more detail below.
CRISPR/Cas12a 분류CRISPR/Cas12a classification
CRISPR/Cas12a 시스템은 Class 2 중 type V CRISPR/Cas 시스템 중 A 서브타입에 속하며, CRISPR/Cpf1 시스템으로 불리기도 한다.The CRISPR/Cas12a system belongs to the A subtype of the Class 2 type V CRISPR/Cas system, and is also called the CRISPR/Cpf1 system.
CRISPR/Cas12a 시스템 구성 및 기능CRISPR/Cas12a system configuration and function
CRISPR/Cas12a 시스템은 Cas12a 단백질 및 이에 대한 가이드 RNA를 포함한다. 상기 Cas12a 단백질 및 상기 가이드 RNA는 복합체를 이루어 작용하며, 표적-특이적 핵산 절단 활성 및 부수적 절단 활성을 나타낸다. 상기 Cas12a 단백질은 PAM 서열을 인식하고, 상기 가이드 RNA가 표적하는 표적 서열의 핵산을 절단하는 기능을 한다. 상기 가이드 RNA는 표적 서열의 핵산을 표적하는 기능을 한다.The CRISPR/Cas12a system comprises a Cas12a protein and a guide RNA therefor. The Cas12a protein and the guide RNA act as a complex and exhibit target-specific nucleic acid cleavage activity and secondary cleavage activity. The Cas12a protein recognizes a PAM sequence and functions to cleave a nucleic acid of a target sequence targeted by the guide RNA. The guide RNA functions to target a nucleic acid of a target sequence.
Cas12a 단백질의 구조Structure of the Cas12a protein
Cas12a 단백질은 크게 REC(RECognition) lobe 및 NUC(NUClease) lob로 나눌 수 있으며, NUC lob는 다시 RuvC 도메인, NUC 도메인, WED 도메인, PI (PAM Interacting) 도메인, 및 BH (Bridge Helix) 도메인으로 나뉜다. 구체적인 Cas12a 단백질의 구조는 여러 연구자들이 이미 보고한 바 있으며, Paul et.al (CRISPR-Cas12a: Functional overview and applications. Biomedical Journal, Vol.43, Issue 1, pp.8-17, 2020)에 자세히 설명되어 있다. 이 중 WED II, WED III, REC1, 및 PI 도메인은 상기 Cas12a 단백질이 PAM 서열을 인식하도록 하는 데 중요한 역할을 한다. 한편, 상기 Cas12a 단백질이 표적 서열의 핵산을 절단하는 데 중요한 역할을 하는 도메인은 RuvC 도메인 및 NUC 도메인이다.The Cas12a protein can be broadly divided into REC (RECognition) lobe and NUC (NUClease) lob, and the NUC lob is further divided into the RuvC domain, NUC domain, WED domain, PI (PAM Interacting) domain, and BH (Bridge Helix) domain. The specific structure of the Cas12a protein has already been reported by several researchers and is described in detail in Paul et.al (CRISPR-Cas12a: Functional overview and applications. Biomedical Journal, Vol.43, Issue 1, pp.8-17, 2020). Among these, the WED II, WED III, REC1, and PI domains play an important role in allowing the Cas12a protein to recognize the PAM sequence. Meanwhile, the domains that play an important role in the Cas12a protein cleaving the nucleic acid of the target sequence are the RuvC domain and the NUC domain.
가이드 RNA의 구조Structure of guide RNA
CRISPR/Cas12a 시스템의 가이드 RNA는 CRISPR/Cas9 시스템의 가이드 RNA와는 달리 단일 RNA 분자로 이뤄져 있으며, 이를 crRNA라 한다. 상기 가이드 RNA는 직접 반복부(direct repeat) 및 가이드 도메인을 포함한다. 구체적으로, 상기 가이드 RNA는 3'말단에서 5'말단 방향으로, 상기 직접 반복부 및 상기 가이드 도메인이 차례로 연결되어 있다. 상기 직접 반복부은 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 복합체를 이루는 데 관여하는 부분이고, 상기 가이드 도메인은 표적 서열의 핵산과 결합하여 CRISPR/Cas12a 시스템이 표적-특이적인 절단 활성 및 부수적 절단 활성을 보일 수 있도록 하는 부분이다.Unlike the guide RNA of the CRISPR/Cas9 system, the guide RNA of the CRISPR/Cas12a system is composed of a single RNA molecule, called crRNA. The guide RNA includes a direct repeat and a guide domain. Specifically, the guide RNA has the direct repeat and the guide domain sequentially connected in the direction from the 3' end to the 5' end. The direct repeat is a part involved in the guide RNA interacting with the Cas12a protein to form a complex, and the guide domain is a part that binds to the nucleic acid of the target sequence to enable the CRISPR/Cas12a system to exhibit target-specific cleavage activity and secondary cleavage activity.
CRISPR/Cas12a 시스템의 표적-특이적 핵산 절단 활성 및 PAM (Protospacer Adjacent Motif)Target-specific nucleic acid cleavage activity and PAM (Protospacer Adjacent Motif) of the CRISPR/Cas12a system
CRISPR/Cas12a 시스템은 표적-특이적인 핵산 절단 활성을 가지는데, 이러한 표적-특이적인 핵산 절단 활성을 나타내기 위해서는 두 가지 조건이 필요하다. 첫째로, 핵산 내에 Cas12a 단백질이 인식할 수 있는 일정 길이의 염기 서열이 있어야 한다. 둘째로, 상기 일정 길이의 염기 서열 주변에 가이드 RNA에 포함된 가이드 도메인과 상보적으로 결합할 수 있는 서열이 있어야 한다. 위 두 가지 조건이 만족되어 1) Cas12a 단백질이 상기 일정 길이의 염기 서열을 인식하고, 2) 상기 가이드 도메인이 상기 일정 길이의 염기 서열 주변 서열 부분과 상보적으로 결합하는 경우, 핵산 절단 활성이 나타난다. 이때, 상기 Cas12a 단백질에 의해 인식되는 일정 길이의 염기 서열을 Protospacer Adjacent Motif(PAM) 서열이라 한다.The CRISPR/Cas12a system has target-specific nucleic acid cleavage activity, but two conditions are required to exhibit this target-specific nucleic acid cleavage activity. First, there must be a base sequence of a certain length that the Cas12a protein can recognize in the nucleic acid. Second, there must be a sequence that can complementarily bind to the guide domain included in the guide RNA around the base sequence of the certain length. When the above two conditions are satisfied and 1) the Cas12a protein recognizes the base sequence of the certain length, and 2) the guide domain complementarily binds to a portion of the sequence around the base sequence of the certain length, nucleic acid cleavage activity is exhibited. At this time, the base sequence of a certain length recognized by the Cas12a protein is called a Protospacer Adjacent Motif (PAM) sequence.
상기 PAM 서열은 상기 Cas12a 단백질에 따라 정해지는 고유한 서열이다. 상기 Cas12a 단백질의 PAM 서열을 알고 있다면, 이를 사용하여 PAM 서열 주변의 미리 결정된 표적 서열의 핵산을 표적화하는 CRISPR/Cas12a 시스템을 설계할 수 있다.The above PAM sequence is a unique sequence determined by the Cas12a protein. If the PAM sequence of the Cas12a protein is known, it can be used to design a CRISPR/Cas12a system that targets a nucleic acid of a predetermined target sequence around the PAM sequence.
CRISPR/Cas12a 시스템의 부수적 절단 활성(collateral cleavage activity)Collateral cleavage activity of the CRISPR/Cas12a system
어떤 CRISPR/Cas12a 시스템은 표적-특이적 핵산 절단 활성 외 부수적인 절단 기능(collateral cleavage function)을 가진다. 이는, 상기 CRISPR/Cas12a 시스템이 표적 핵산을 인식하여 활성화되는 경우, 주변에 존재하는 단일가닥 핵산을 무작위로 절단하는 효과를 일컫는다. 구체적으로, CRISPR/Cas12a 시스템은 DNA를 표적으로 하여, 표적 DNA와 결합 시 부수적으로 주변에 존재하는 단일가닥 DNA를 무작위로 절단하는 활성이 있다는 것이 연구자들에 의해 보고되었다(J. S. Chen, et al., CRISPR-Cas12a target binding unleashes indiscriminate single-stranded DNase activity. Science, 360(2018) 436). 이러한 부수적 절단 활성을 이용하면, CRISPR/Cas12a 시스템을 이용하여 샘플에 표적 핵산이 존재하는 지 여부를 검출할 수 있다.Some CRISPR/Cas12a systems have a collateral cleavage function in addition to the target-specific nucleic acid cleavage activity. This refers to the effect of randomly cleaving single-stranded nucleic acids in the vicinity when the CRISPR/Cas12a system recognizes the target nucleic acid and is activated. Specifically, researchers have reported that the CRISPR/Cas12a system has the activity of randomly cleaving single-stranded DNA in the vicinity when binding to the target DNA when targeting DNA (J. S. Chen, et al., CRISPR-Cas12a target binding unleashes indiscriminate single-stranded DNase activity. Science, 360(2018) 436). By utilizing this collateral cleavage activity, it is possible to detect whether a target nucleic acid exists in a sample using the CRISPR/Cas12a system.
공지 데이터베이스로부터 신규 CRISPR/Cas12a 시스템 발굴Discovering a novel CRISPR/Cas12a system from the public database
본 명세서에서는 공지된 데이터베이스로부터 발굴된 신규 CRISPR/Cas12a 시스템을 개시한다. 본 명세서의 발명자들은 공지된 데이터베이스의 미생물 게놈 정보로부터 특정된 Cas12a 단백질 및 이에 대한 가이드 RNA를 합성하고, CRISPR/Cas12a 복합체를 제조하여 표적-특이적 핵산 절단 기능 및 부수적 절단 기능이 있음을 확인하여 본 발명을 완성하였다.In this specification, a novel CRISPR/Cas12a system discovered from a known database is disclosed. The inventors of this specification synthesized a Cas12a protein and a guide RNA therefor specified from microbial genome information of a known database, and prepared a CRISPR/Cas12a complex, and confirmed that it has a target-specific nucleic acid cleavage function and ancillary cleavage function, thereby completing the present invention.
구체적으로, 상기 발명자들은 NCBI (National Center for Biotechnology Information)에 공지된 데이터를 활용하였다. 우선, NCBI에 공지된 낙타 위의 메타지놈 (metagenome) 시퀀싱 데이터 (Accession: PRJNA746430)를 기초로, 이를 어셈블하여 낙타 위에 포함된 각 미생물에 대한 게놈 정보를 얻었다. 그 후, 공지된 Cas12a 단백질과의 상동성 정보를 토대로 낙타 위에 포함된 미생물의 유전자 중, CRISPR/Cas12a 시스템을 암호화하는 유전자들을 찾아내고, 이의 각 구성요소 (즉, Cas12a 단백질, 가이드 RNA 등)의 아미노산 서열을 특정하였다. 상기 발명자들은 이렇게 얻어진 CRISPR/Cas12a 시스템 후보군 중, 특히 부수적 절단 기능(collateral cleavage function)이 우수한 후보를 선별하여 본 발명에 이르렀다.Specifically, the inventors utilized data known to the National Center for Biotechnology Information (NCBI). First, based on the camel stomach metagenome sequencing data (Accession: PRJNA746430) known to the NCBI, they assembled it to obtain genome information on each microorganism contained in the camel stomach. Then, based on the homology information with the known Cas12a protein, they found genes encoding the CRISPR/Cas12a system among the genes of the microorganisms contained in the camel stomach, and specified the amino acid sequence of each component thereof (i.e., Cas12a protein, guide RNA, etc.). The inventors selected a candidate having an excellent collateral cleavage function among the CRISPR/Cas12a system candidates thus obtained, and thus reached the present invention.
신규 CRISPR/Cas12a 시스템A novel CRISPR/Cas12a system
신규 CRISPR/Cas12a 시스템 개괄Overview of the Novel CRISPR/Cas12a System
본 명세서에서는 상기 공지 데이터베이스에서 발굴된 CRISPR/Cas12a 시스템 중, 부수적 절단 기능(collateral cleavage activity)이 있음이 확인된 11종의 신규 CRISPR/Cas12a 시스템을 개시한다. 본 명세서의 발명자들은 상기 공지 데이터베이스에서 발굴된 CRISPR/Cas12a 시스템의 Cas12a 단백질 및 가이드 RNA를 직접 합성하였다. 상기 발명자들은 상기 합성된 Cas12a 단백질 및 가이드 RNA를 이용하여 상기 Cas12a 단백질이 인식하는 PAM 서열을 규명하고, 해당 CRISPR/Cas12a 시스템이 부수적 절단 기능(collateral cleavage function)을 가지는 것을 확인하여 본 발명을 완성하였다. 또한, 가이드 RNA에 추가적인 구성 요소(스템-루프)를 더해 최적화하였다.In this specification, 11 novel CRISPR/Cas12a systems, among the CRISPR/Cas12a systems discovered from the above-mentioned public database, are disclosed, which have been confirmed to have collateral cleavage activity. The inventors of the present specification directly synthesized the Cas12a protein and guide RNA of the CRISPR/Cas12a system discovered from the above-mentioned public database. The inventors used the synthesized Cas12a protein and guide RNA to identify the PAM sequence recognized by the Cas12a protein, and confirmed that the corresponding CRISPR/Cas12a system has collateral cleavage function, thereby completing the present invention. In addition, the guide RNA was optimized by adding an additional component (stem-loop).
본 명세서에서 개시하는 상기 신규 CRISPR/Cas12a 시스템은 그 구성요소로 Cas12a 단백질 및 프로그램 가능한 가이드 RNA를 포함한다. 상기 신규 CRISPR/Cas12a 시스템은 프로그램 가능한 가이드 RNA의 표적 핵산과 결합하는 경우, 주변에 존재하는 단일가닥 DNA를 무작위로 절단하는 부수적 절단 기능(collateral cleavage function)을 가진다. 상기 신규 CRISPR/Cas12a 시스템은 부수적 절단 기능을 가지므로, 표적 핵산을 검출하는 용도로 사용될 수 있다.The novel CRISPR/Cas12a system disclosed herein comprises a Cas12a protein and a programmable guide RNA as its components. The novel CRISPR/Cas12a system has a collateral cleavage function that randomly cleaves single-stranded DNA present in the vicinity when the programmable guide RNA binds to a target nucleic acid. Since the novel CRISPR/Cas12a system has a collateral cleavage function, it can be used for the purpose of detecting a target nucleic acid.
이하 본 명세서에서 개시하는 CRISPR/Cas12a 시스템에 대해 더 자세히 설명한다.The CRISPR/Cas12a system disclosed herein is described in more detail below.
Cas12a 단백질 - 아미노산 서열Cas12a protein - amino acid sequence
본 명세서에서 개시하는 신규 CRISPR/Cas12a 시스템은 신규 Cas12a 단백질을 포함한다. 상기 신규 Cas12a 단백질은 Cas12a 단백질의 오소로그(ortholog)로, 공지된 데이터베이스로부터 특정된 것이나, 기존 문헌에서 그 기능이나 용도가 밝혀진 바 없다. 상기 신규 Cas12a 단백질은 각각 서열번호 1 내지 서열번호 10의 아미노산 서열로 표현되는 Cas12a 단백질이다.The novel CRISPR/Cas12a system disclosed herein comprises a novel Cas12a protein. The novel Cas12a protein is an ortholog of the Cas12a protein, which has been identified from a known database, but its function or use has not been elucidated in the existing literature. The novel Cas12a protein is a Cas12a protein represented by an amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 10, respectively.
Cas12a 단백질 - PAM 서열Cas12a protein - PAM sequence
본 명세서의 발명자들은 실험을 통해 상기 신규 Cas12a 단백질이 인식할 수 있는 PAM 서열을 밝혔다. PAM 서열에 대해서는 《배경기술 - CRISPR/Cas12a 시스템》 단락에서 서술하였다.The inventors of the present invention have experimentally discovered a PAM sequence that the novel Cas12a protein can recognize. The PAM sequence is described in the section “Background Art - CRISPR/Cas12a System.”
일 구현예로, 상기 서열번호 1 내지 서열번호 10의 아미노산 서열로 표현되는 Cas12a 단백질은 5'-TTTV-3'의 PAM 서열을 인식할 수 있다.In one embodiment, the Cas12a protein represented by the amino acid sequence of SEQ ID NO: 1 to SEQ ID NO: 10 can recognize the PAM sequence of 5'-TTTV-3'.
프로그램 가능한 가이드 RNA - 가이드 RNA 구조Programmable Guide RNA - Guide RNA Structure
본 명세서에서는 신규 Cas12a 단백질에 대한 프로그램 가능한 가이드 RNA를 개시한다. 상기 가이드 RNA는 상기 신규 Cas12a 단백질과 복합체를 형성할 수 있으며, 표적 서열을 가진 핵산을 표적할 수 있다. 《배경기술 - CRISPR/Cas12a 시스템》 단락에서 서술한 바와 같이, CRISPR/Cas12a 시스템의 가이드 RNA는 CRISPR/Cas9 시스템과는 달리 가이드 RNA에 tracrRNA가 없으므로, 본 명세서에서 가이드 RNA 및 crRNA는 혼용하여 사용될 수 있다. 상기 가이드 RNA는 직접 반복부(direct repeat) 및 가이드 도메인을 포함하며, 스템-루프(stem-loop)를 추가적으로 더 포함할 수 있다. 상기 직접 반복부는 Cas12a 단백질과 상호작용하여 상기 Cas12a 단백질과 상기 가이드 RNA가 복합체를 형성하는 데 관여하는 구성이다. 상기 가이드 도메인은 상기 CRISPR/Cas12a 시스템이 표적-특이적 핵산 절단 활성 및/또는 부수적 절단 활성을 나타낼 수 있도록 하는 구성이다. 상기 가이드 도메인은 표적 서열을 가진 핵산을 표적할 수 있도록 설계된다. 상기 스템-루프는 상기 가이드 RNA의 안정성을 높여줄 수 있는 구성이다.Disclosed herein is a programmable guide RNA for a novel Cas12a protein. The guide RNA can form a complex with the novel Cas12a protein and target a nucleic acid having a target sequence. As described in the section “Background Art - CRISPR/Cas12a System”, unlike the CRISPR/Cas9 system, the guide RNA of the CRISPR/Cas12a system does not have a tracrRNA, so the guide RNA and crRNA can be used interchangeably in the present specification. The guide RNA includes a direct repeat and a guide domain, and may additionally include a stem-loop. The direct repeat is a structure that interacts with the Cas12a protein to allow the Cas12a protein and the guide RNA to form a complex. The guide domain is a structure that enables the CRISPR/Cas12a system to exhibit target-specific nucleic acid cleavage activity and/or ancillary cleavage activity. The above guide domain is designed to target a nucleic acid having a target sequence. The above stem-loop is a configuration that can increase the stability of the guide RNA.
프로그램 가능한 가이드 RNA - 직접 반복부Programmable Guide RNA - Direct Repeats
전술한 바, 상기 프로그램 가능한 가이드 RNA의 직접 반복부는 Cas12a 단백질과 상호작용하여 상기 가이드 RNA가 상기 Cas12a 단백질과 복합체를 형성하는 데 관여하는 구성이다. 상기 직접 반복부의 핵산 서열은 상기 Cas12a 단백질의 종류에 따라 달라질 수 있다. 상기 직접 반복부는, "스캐폴드"라고도 지칭될 수 있다.As described above, the direct repeat portion of the programmable guide RNA is a structure that interacts with the Cas12a protein and participates in forming a complex between the guide RNA and the Cas12a protein. The nucleic acid sequence of the direct repeat portion may vary depending on the type of the Cas12a protein. The direct repeat portion may also be referred to as a “scaffold.”
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 1의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 11로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 1, the direct repeat portion is represented by SEQ ID NO: 11.
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 2의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 12로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 2, the direct repeat portion is represented by SEQ ID NO: 12.
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 3의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 13로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 3, the direct repeat portion is represented by SEQ ID NO: 13.
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 4의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 14로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 4, the direct repeat portion is represented by SEQ ID NO: 14.
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 5의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 15로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 5, the direct repeat portion is represented by SEQ ID NO: 15.
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 6의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 16로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 6, the direct repeat portion is represented by SEQ ID NO: 16.
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 7의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 17로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 7, the direct repeat portion is represented by SEQ ID NO: 17.
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 8의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 18로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 8, the direct repeat portion is represented by SEQ ID NO: 18.
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 9의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 19로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 9, the direct repeat portion is represented by SEQ ID NO: 19.
일 구현예로, 일 구현예로, 본 명세서의 신규 CRISPR/Cas12a 시스템에 포함된 Cas12a 단백질이 서열번호 10의 아미노산 서열로 표현되는 경우, 상기 직접 반복부는 서열번호 20로 표현된다.In one embodiment, in one embodiment, when the Cas12a protein included in the novel CRISPR/Cas12a system of the present specification is represented by the amino acid sequence of SEQ ID NO: 10, the direct repeat portion is represented by SEQ ID NO: 20.
프로그램 가능한 가이드 RNA - 가이드 도메인Programmable guide RNA - guide domain
상기 프로그램 가능한 가이드 RNA는 가이드 도메인을 포함한다. 상기 가이드 도메인은 표적 서열의 핵산을 표적할 수 있는 구성으로, CRISPR/Cas12a 시스템의 표적-특이적 핵산 절단 효과 및/또는 부수적 절단 효과 활성화에 관여한다. 구체적으로, 상기 가이드 도메인은 표적 핵산과 상보적으로 결합할 수 있다. 본 명세서에서 개시하는 신규 CRISPR/Cas12a 시스템을 유전자 편집 용도 및/또는 표적 서열의 핵산 검출 용도로 사용하기 위해서, 상기 가이드 도메인은 편집하고자 하는 유전자, 또는 표적 서열의 핵산을 표적할 수 있도록 인공적으로 설계된 것이다.The above programmable guide RNA comprises a guide domain. The guide domain is a structure capable of targeting a nucleic acid of a target sequence and is involved in activating a target-specific nucleic acid cleavage effect and/or a collateral cleavage effect of the CRISPR/Cas12a system. Specifically, the guide domain can complementarily bind to the target nucleic acid. In order to use the novel CRISPR/Cas12a system disclosed herein for the purpose of gene editing and/or nucleic acid detection of the target sequence, the guide domain is artificially designed to target a gene to be edited or a nucleic acid of the target sequence.
프로그램 가능한 가이드 RNA - 가이드 도메인 및 표적 서열의 관계Programmable guide RNA - relationship between guide domain and target sequence
신규 CRISPR/Cas12a 시스템이 특정 핵산을 절단하기 위해서는, 우선 상기 가이드 도메인이 표적 서열의 핵산과 결합할 수 있어야 한다. 따라서, 상기 가이드 도메인은 표적 서열과 상보적인 서열을 가지거나, 경우에 따라서는 표적 서열과 동등한(equivalent) 서열을 가질 수 있다. 전술한 가이드 도메인 및 표적 서열의 관계는 표적 서열을 가진 핵산의 종류 및/또는 표적 서열의 핵산 내 위치에 따라 달라진다.In order for the novel CRISPR/Cas12a system to cleave a specific nucleic acid, first of all, the guide domain must be able to bind to the nucleic acid of the target sequence. Therefore, the guide domain may have a sequence complementary to the target sequence, or in some cases, may have a sequence equivalent to the target sequence. The relationship between the above-mentioned guide domain and the target sequence varies depending on the type of nucleic acid having the target sequence and/or the location of the target sequence within the nucleic acid.
일 구현예로, 상기 표적 서열의 핵산이 단일가닥 핵산인 경우, 상기 가이드 도메인은 상기 표적 서열과 상보적인 서열을 가질 수 있다. 또 다른 구현예로, 상기 표적 서열의 핵산이 이중가닥 핵산이고, 상기 표적 서열이 CRISPR/Cas12a 시스템의 PAM 서열이 위치하는 가닥과 동일한 가닥에 위치하는 경우, 상기 가이드 도메인은 상기 표적 서열과 동등한(equivalent) 서열일 수 있다. 또 다른 구현예로, 상기 표적 서열의 핵산이 이중가닥 핵산이고, 상기 표적 서열이 CRISPR/Cas12a 시스템의 PAM 서열이 위치하는 가닥과 다른 가닥에 위치하는 경우, 상기 가이드 도메인은 상기 표적 서열과 상보적인 서열일 수 있다.In one embodiment, when the nucleic acid of the target sequence is a single-stranded nucleic acid, the guide domain may have a sequence complementary to the target sequence. In another embodiment, when the nucleic acid of the target sequence is a double-stranded nucleic acid, and the target sequence is located on the same strand as the strand on which the PAM sequence of the CRISPR/Cas12a system is located, the guide domain may be a sequence equivalent to the target sequence. In another embodiment, when the nucleic acid of the target sequence is a double-stranded nucleic acid, and the target sequence is located on a different strand from the strand on which the PAM sequence of the CRISPR/Cas12a system is located, the guide domain may be a sequence complementary to the target sequence.
프로그램 가능한 가이드 RNA - 스템-루프Programmable Guide RNA - Stem-Loop
상기 프로그램 가능한 가이드 RNA는 선택적으로, 스템-루프를 더 포함할 수 있다. 상기 스템-루프는 스템-루프를 구성할 수 있는 RNA 단편을 의미한다. 상기 스템-루프는 상기 가이드 RNA의 상기 직접 반복부의 5'말단에 연결되어 있을 수 있다. 상기 스템-루프는 상기 가이드 RNA가 쉽게 분해되지 않도록 할 수 있으며, 더 안정적으로 기능을 발휘할 수 있도록 한다. 상기 프로그램 가능한 가이드 RNA가 상기 스템-루프를 포함하고 있는 경우, 상기 직접 반복부 및 상기 스템-루프 부분을 통틀어 "스캐폴드"라고 지칭할 수 있다.The above programmable guide RNA may optionally further include a stem-loop. The stem-loop refers to an RNA fragment capable of forming a stem-loop. The stem-loop may be linked to the 5' end of the direct repeat portion of the guide RNA. The stem-loop may prevent the guide RNA from being easily degraded and may allow it to function more stably. When the above programmable guide RNA includes the stem-loop, the direct repeat portion and the stem-loop portion may be collectively referred to as a "scaffold."
CRISPR/Cas12a 복합체CRISPR/Cas12a complex
본 명세서에서는 신규 CRISPR/Cas12a 복합체를 개시한다. 상기 신규 CRISPR/Cas12a 복합체는 신규 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA가 복합체를 이루고 있는 것이며, 직접적으로 표적-특이적 핵산 절단 기능 및/또는 부수적 절단 기능을 가진다.Disclosed herein is a novel CRISPR/Cas12a complex. The novel CRISPR/Cas12a complex comprises a novel Cas12a protein and a programmable guide RNA in a complex, and has direct target-specific nucleic acid cleavage function and/or accessory cleavage function.
여기서, 상기 신규 Cas12a 단백질은 《Cas12a 단백질》 단락에서 서술된 것과 같다. 또한, 상기 프로그램 가능한 가이드 RNA는 《프로그램 가능한 가이드 RNA》 단락에서 서술된 것과 같다.Here, the novel Cas12a protein is as described in the “Cas12a protein” section. In addition, the programmable guide RNA is as described in the “Programmable guide RNA” section.
신규 CRISPR/Cas12a 시스템의 기능 - 부수적 절단 기능Features of the new CRISPR/Cas12a system - collateral cutting function
상기 신규 CRISPR/Cas12a 시스템은 외부의 특정 핵산 (즉, 표적 핵산)과 결합하는 경우, 전술한 부수적 절단 기능이 활성화되어 주변에 존재하는 핵산을 무작위로 절단할 수 있다. 여기서, 상기 "외부의 특정 핵산"은 상기 프로그램 가능한 가이드 RNA의 가이드 도메인이 상보적으로 결합할 수 있는 핵산을 의미한다. 따라서, 상기 신규 CRISPR/Cas12a 시스템은 상기 프로그램 가능한 가이드 RNA의 가이드 도메인을 목적에 맞게 디자인하여 그 부수적 절단 기능을 활용할 수 있다.When the novel CRISPR/Cas12a system binds to an external specific nucleic acid (i.e., a target nucleic acid), the aforementioned ancillary cleavage function is activated to randomly cleave nucleic acids present in the vicinity. Here, the “external specific nucleic acid” refers to a nucleic acid to which the guide domain of the programmable guide RNA can complementarily bind. Therefore, the novel CRISPR/Cas12a system can utilize the ancillary cleavage function by designing the guide domain of the programmable guide RNA according to the purpose.
신규 CRISPR/Cas12a 시스템의 기능 - 표적-특이적 핵산 절단 기능Function of the novel CRISPR/Cas12a system - Target-specific nucleic acid cleavage function
상기 신규 CRISPR/Cas12a 시스템은 외부의 특정 핵산 (즉, 표적 핵산)과 결합하여 상기 핵산을 절단할 수 있다. 표적-특이적 핵산 절단 기능에 대해서는 전술하였다.The novel CRISPR/Cas12a system can bind to a specific external nucleic acid (i.e., a target nucleic acid) and cleave the nucleic acid. The target-specific nucleic acid cleavage function has been described above.
여기서, 상기 "외부의 특정 핵산"은 상기 프로그램 가능한 가이드 RNA의 가이드 도메인이 상보적으로 결합할 수 있는 핵산을 의미한다. 따라서, 상기 신규 CRISPR/Cas12a 시스템은 상기 프로그램 가능한 가이드 RNA의 가이드 도메인을 목적에 맞게 디자인하여 그 표적-특이적 절단 기능을 활용할 수 있다.Here, the "external specific nucleic acid" refers to a nucleic acid to which the guide domain of the programmable guide RNA can complementarily bind. Therefore, the novel CRISPR/Cas12a system can utilize its target-specific cleavage function by designing the guide domain of the programmable guide RNA according to the purpose.
신규 CRISPR/Cas12a 시스템의 용도 #1 - 비표적 핵산 절단 용도Uses of the Novel CRISPR/Cas12a System #1 - Non-targeted Nucleic Acid Cleavage
상기 신규 CRISPR/Cas12a 시스템은 부수적 절단 기능을 가지는 것이 특징이며, 따라서 비표적 핵산 절단 용도에 사용될 수 있다. 여기서, "비표적 핵산"이란, 상기 신규 CRISPR/Cas12a 시스템의 가이드 RNA의 가이드 도메인과 상보적으로 결합할 수 없는, 임의의 서열을 가지는 핵산을 의미한다.The novel CRISPR/Cas12a system described above is characterized by having a secondary cleavage function, and thus can be used for non-target nucleic acid cleavage purposes. Here, the term "non-target nucleic acid" means a nucleic acid having any sequence that cannot complementarily bind to the guide domain of the guide RNA of the novel CRISPR/Cas12a system.
예를 들어, 상기 신규 CRISPR/Cas12a 시스템으로 비표적 핵산을 절단하려고 하는 경우, 상기 비표적 핵산에 상기 신규 CRISPR/Cas12a 시스템을 첨가한 후, 상기 신규 CRISPR/Cas12a 시스템의 가이드 RNA와 결합할 수 있는 특정 서열의 핵산 (즉, 표적 핵산)을 추가하여, 상기 신규 CRISPR/Cas12a 시스템과 결합하도록 유도한다. 상기 표적 핵산이 상기 신규 CRISPR/Cas12a 시스템과 결합하면, 그 부수적 절단 기능이 활성화되고, 그 결과, 상기 비표적 핵산이 절단될 수 있다.For example, in the case where a non-target nucleic acid is to be cut by the novel CRISPR/Cas12a system, after the novel CRISPR/Cas12a system is added to the non-target nucleic acid, a nucleic acid having a specific sequence that can bind to the guide RNA of the novel CRISPR/Cas12a system (i.e., a target nucleic acid) is added to induce binding to the novel CRISPR/Cas12a system. When the target nucleic acid binds to the novel CRISPR/Cas12a system, its secondary cleavage function is activated, and as a result, the non-target nucleic acid can be cleaved.
신규 CRISPR/Cas12a 시스템의 용도 #2 - 표적 핵산 검출 용도Uses of the Novel CRISPR/Cas12a System #2 - Target Nucleic Acid Detection
상기 신규 CRISPR/Cas12a 시스템의 부수적 절단 기능을 이용하면, 상기 신규 CRISPR/Cas12a 시스템을 표적 핵산 검출 용도로 사용할 수 있다. 이하, 표적 핵산 검출 용도로 사용되는 조성물 및 표적 핵산 검출 방법에 대해 서술한다.By utilizing the ancillary cleavage function of the novel CRISPR/Cas12a system, the novel CRISPR/Cas12a system can be used for target nucleic acid detection purposes. Hereinafter, a composition used for target nucleic acid detection purposes and a method for target nucleic acid detection are described.
신규 CRISPR/Cas12a 시스템을 포함하는 표적 핵산 검출용 조성물Composition for detecting target nucleic acid comprising novel CRISPR/Cas12a system
표적 핵산 검출용 조성물 개괄Overview of Composition for Detection of Target Nucleic Acid
본 명세서에서는 표적 핵산 검출용 조성물을 개시한다. 상기 표적 핵산 검출용 조성물은 신규 CRISPR/Cas12a 복합체 및 프로브 핵산을 포함하는 검출제(detecting agent)를 포함하며, 선택적으로, 신호 증폭용 조성물을 추가로 더 포함할 수 있다. 상기 표적 핵산 검출용 조성물은 CRISPR/Cas12a 시스템의 부수적 절단 활성을 이용하여 표적 서열을 가지는 핵산을 검출할 수 있도록 설계되었다.The present specification discloses a composition for detecting a target nucleic acid. The composition for detecting a target nucleic acid comprises a detecting agent comprising a novel CRISPR/Cas12a complex and a probe nucleic acid, and optionally may further comprise a composition for signal amplification. The composition for detecting a target nucleic acid is designed to detect a nucleic acid having a target sequence by utilizing the secondary cleavage activity of the CRISPR/Cas12a system.
표적 핵산 검출용 조성물 구성 #1 - 신규 CRISPR/Cas12a 복합체Composition for target nucleic acid detection #1 - Novel CRISPR/Cas12a complex
상기 표적 핵산 검출용 조성물은 신규 CRISPR/Cas12a 복합체를 포함한다. 상기 신규 CRISPR/Cas12a 조성물은 《신규 CRISPR/Cas12a 시스템》 단락에서 서술된 바와 같다.The composition for detecting the target nucleic acid comprises a novel CRISPR/Cas12a complex. The novel CRISPR/Cas12a composition is as described in the section “Novel CRISPR/Cas12a System”.
표적 핵산 검출용 조성물 구성 #2 - 프로브 핵산을 포함하는 검출제Composition for detecting target nucleic acid #2 - Detecting agent comprising probe nucleic acid
상기 표적 핵산 검출용 조성물은 프로브 핵산을 포함하는 검출제(detecting agent)를 포함한다. 여기서, 상기 프로브 핵산은 DNA 및/또는 RNA일 수 있다. 상기 프로브 핵산은 DNA 및/또는 RNA에 추가적인 구성이 결합된 것일 수 있다. 상기 프로브 핵산이 절단되는 경우 상기 검출제는 검출 가능한 신호를 생성하는 것을 특징으로 한다. 상기 프로브 핵산이 생성할 수 있는 검출 가능한 신호는 프로브 핵산이 절단되었다는 것을 확인할 수 있다면 특별히 제한되지 않는다. 따라서, 통상의 기술자가 공지된 기술을 참조하여 프로브 핵산 및 검출제의 기타 구성을 적절히 선택할 수 있다.The composition for detecting the target nucleic acid comprises a detecting agent comprising a probe nucleic acid. Here, the probe nucleic acid may be DNA and/or RNA. The probe nucleic acid may be a DNA and/or RNA with an additional component bound thereto. The detecting agent is characterized in that when the probe nucleic acid is cleaved, a detectable signal is generated. The detectable signal that the probe nucleic acid can generate is not particularly limited as long as it can confirm that the probe nucleic acid has been cleaved. Therefore, a person skilled in the art can appropriately select other components of the probe nucleic acid and the detecting agent with reference to known techniques.
표적 핵산 검출용 조성물 구성 #3 - 프로브 핵산 서열 예시Composition for target nucleic acid detection #3 - Probe nucleic acid sequence example
일 구현예로, 상기 프로브 핵산 서열은 다음 중 선택된 하나 이상일 수 있다:In one embodiment, the probe nucleic acid sequence may be one or more selected from the following:
5'-TTATT-3'; 5'-TTATTATT-3'; 5'-TTTTTTTT-3'; 5'-AAAAAAAA-3'; 5'-GGGGGGGG-3'; 5'-CCCCCCCC-3'; TAGCATGTCA(서열번호 85); CCAAGGTTCCAAGGTTCCAAGGTTC(서열번호 86); 및 CAGTCAGTCAGTCAGTCAGTCAGTC(서열번호 87).5'-TTATT-3'; 5'-TTATTATT-3'; 5'-TTTTTTTT-3'; 5'-AAAAAAAA-3'; 5'-GGGGGGGG-3'; 5'-CCCCCCCC-3'; TAGCATGTCA (SEQ ID NO: 85); CCAAGGTTCCAAGGTTCCAAGGTTC (SEQ ID NO: 86); and CAGTCAGTCAGTCAGTCAGTCAGTCAGTC (SEQ ID NO: 87).
표적 핵산 검출용 조성물 구성 #4 - 신호 증폭을 위한 추가 구성Composition for target nucleic acid detection #4 - Additional composition for signal amplification
상기 표적 핵산 검출용 조성물은 신호 증폭을 위한 추가적인 구성을 포함할 수 있다. 이는, 상기 CRISPR/Cas12a 복합체의 부수적 절단 기능을 직접/간접적으로 활용하고, 상기 검출제에서 생성되는 검출 가능한 신호를 증폭할 수 있는 것이라면 달리 제한되지 않는다. 따라서, 통상의 기술자가 공지된 기술을 참조하여 신호 증폭을 위한 추가 구성을 적절히 선택할 수 있다.The composition for detecting the target nucleic acid may include an additional component for signal amplification. This is not limited to anything else as long as it can directly/indirectly utilize the secondary cleavage function of the CRISPR/Cas12a complex and amplify a detectable signal generated from the detection agent. Accordingly, a person skilled in the art can appropriately select an additional component for signal amplification by referring to known techniques.
검출 가능한 신호 예시Examples of detectable signals
상기 프로브 핵산이 생성할 수 있는 검출 가능한 신호는, 프로브 핵산이 절단되었다는 것을 확인할 수 있다면 특별히 제한되지 않는다.The detectable signal that the above probe nucleic acid can generate is not particularly limited as long as it can confirm that the probe nucleic acid has been cleaved.
일 구현예로, 상기 검출 가능한 신호는 형광 신호일 수 있다. 일 예로, 상기 형광 신호는 상기 프로브 핵산의 절단 전에는 검출되지 않다가, 상기 프로브 핵산의 절단 후에 검출되는 것일 수 있다. 또 다른 예로, 상기 형광 신호는 상기 프로브 핵산의 절단 전보다 상기 프로브 핵산의 절단 후 강해지는 것일 수 있다. 또 다른 예로, 상기 형광 신호는 상기 프로브 핵산의 절단 전보다 상기 프로브 핵산의 절단 후 약해지는 것일 수 있다. 또 다른 예로, 상기 형광 신호는 상기 프로브 핵산의 절단 전에는 검출되다가, 상기 프로브 핵산의 절단 후에 검출되지 않는 것일 수 있다. 여기서, 상기 형광 신호를 생성하는 구성은 통상의 기술자가 공지된 구성을 적절히 선택한 것일 수 있다.In one embodiment, the detectable signal may be a fluorescent signal. In one embodiment, the fluorescent signal may not be detected before cleavage of the probe nucleic acid, but may be detected after cleavage of the probe nucleic acid. In another embodiment, the fluorescent signal may be stronger after cleavage of the probe nucleic acid than before cleavage of the probe nucleic acid. In another embodiment, the fluorescent signal may be weaker after cleavage of the probe nucleic acid than before cleavage of the probe nucleic acid. In another embodiment, the fluorescent signal may be detected before cleavage of the probe nucleic acid, but may not be detected after cleavage of the probe nucleic acid. Here, the configuration for generating the fluorescent signal may be a configuration appropriately selected by a person skilled in the art known in the art.
표적 핵산 검출용 키트Kit for detection of target nucleic acid
본 명세서에서는 표적 핵산 검출용 키트를 개시한다. 상기 표적 핵산 검출용 키트는 신규 CRISPR/Cas12a 단백질, 프로그램 가능한 가이드 RNA, 프로브 핵산을 포함하는 검출제 (detecting agent)를 포함하며, 선택적으로 신호 증폭용 조성물을 추가로 더 포함할 수 있다. 상기 표적 핵산 검출용 키트는 한 개, 또는 복수 개의 용기 (vessel) - 경우에 따라, 웰(well); 플레이트(plate); 반응기(reactor); 바이알(vial); 시험관(test-tube); 카세트(cassette); 및/또는 미디어(media)일 수 있음 - 을 포함할 수 있다. 상기 표적 핵산 검출용 키트의 신규 CRISPR/Cas12a 단백질, 프로그램 가능한 가이드 RNA, 프로브 핵산을 포함하는 검출제 (detecting agent), 및 선택적으로 신호 증폭용 조성물은 각각 독립된 용기에 포함되어 있을 수 있다. 상기 표적 핵산 검출용 키트의 전술한 구성요소 중 둘 이상은 동일한 용기에 포함되어 있을 수 있다. 상기 표적 핵산 검출용 키트의 전술한 구성요소 중 둘 이상은 서로 상이한 용기에 포함되어 있을 수 있다. 예를 들어, 상기 표적 핵산 검출용 키트의 전술한 구성요소 중 상기 신규 CRISPR/Cas12a 단백질은 상기 프로브 핵산을 포함하는 검출제와 서로 다른 용기에 포함되어 있을 수 있다.The present specification discloses a kit for detecting a target nucleic acid. The kit for detecting a target nucleic acid comprises a novel CRISPR/Cas12a protein, a programmable guide RNA, a detecting agent comprising a probe nucleic acid, and optionally, a signal amplification composition. The kit for detecting a target nucleic acid may comprise one or more vessels, which may be, in some cases, a well; a plate; a reactor; a vial; a test-tube; a cassette; and/or media. The novel CRISPR/Cas12a protein, the programmable guide RNA, the detecting agent comprising a probe nucleic acid, and optionally, a signal amplification composition of the kit for detecting a target nucleic acid may be contained in separate vessels. Two or more of the aforementioned components of the kit for detecting a target nucleic acid may be contained in the same vessel. Two or more of the aforementioned components of the kit for detecting a target nucleic acid may be contained in different vessels. For example, among the above-mentioned components of the kit for detecting the target nucleic acid, the novel CRISPR/Cas12a protein may be contained in a different container from the detection agent containing the probe nucleic acid.
표적 핵산 검출 방법Target nucleic acid detection method
표적 핵산 검출 방법 개괄Overview of Target Nucleic Acid Detection Methods
본 명세서에서는 신규 CRISPR/Cas12a 시스템을 이용한 표적 핵산 검출 방법을 개시한다. 상기 표적 핵산 검출 방법은 샘플 내에 특정 핵산 서열을 가지는 표적 핵산의 존재여부, 포함량 등의 정보를 알아내기 위한 방법이다. 상기 표적 핵산 검출 방법은 상기 신규 CRISPR/Cas12a 시스템의 부수적 절단 기능을 활용한다. 상기 부수적 절단 기능은 상기 신규 CRISPR/Cas12a 시스템이 표적 핵산과 결합하는 경우에만 활성화되므로, 이러한 성질을 활용하면 표적 핵산이 존재하는지 여부, 얼마나 많이 존재하는 지 등을 확인할 수 있다.The present specification discloses a target nucleic acid detection method using a novel CRISPR/Cas12a system. The target nucleic acid detection method is a method for finding out information such as the presence or absence and the amount of a target nucleic acid having a specific nucleic acid sequence in a sample. The target nucleic acid detection method utilizes the secondary cleavage function of the novel CRISPR/Cas12a system. Since the secondary cleavage function is activated only when the novel CRISPR/Cas12a system binds to a target nucleic acid, by utilizing this property, it is possible to determine whether a target nucleic acid exists and how much of it exists.
일 구현예로, 상기 표적 핵산 검출 방법은 샘플, 신규 CRISPR/Cas12a 복합체, 및 프로브 핵산을 포함하는 검출제를 혼합하는 과정을 포함한다. 상기 방법에 등장하는 각 구성요소는 이하 더 구체적으로 설명한다.In one embodiment, the method for detecting a target nucleic acid comprises a process of mixing a sample, a novel CRISPR/Cas12a complex, and a detection agent comprising a probe nucleic acid. Each component appearing in the method is described in more detail below.
샘플Sample
상기 샘플은 표적 핵산을 포함하고 있을 것으로, 또는 표적 핵산을 포함하지 않을 것으로 예상되는 검체를 의미한다. 상기 샘플은 대상의 신체에서 채취한 것으로, 표적 핵산을 포함하고 있을 가능성이 있다면 달리 제한되지 않는다.The above sample means a specimen that is expected to contain the target nucleic acid or is not expected to contain the target nucleic acid. The above sample is taken from the subject's body and is not otherwise limited as long as it is likely to contain the target nucleic acid.
일 구현예로, 상기 샘플은 액체, 고체, 및/또는 기체 형태일 수 있다. 또 다른 구현예로, 상기 샘플은 두가지 이상의 물질이 혼합된 것일 수 있다. 또 다른 구현예로, 상기 샘플은 대상의 신체 조직 및/또는 체액일 수 있다. 여기서, 상기 대상은 인간, 비인간 동물, 및/또는 식물일 수 있다. 상기 체액은 인간의 혈액, 땀, 소변, 및/또는 기타 분비물일 수 있다.In one embodiment, the sample can be in a liquid, solid, and/or gaseous form. In another embodiment, the sample can be a mixture of two or more substances. In another embodiment, the sample can be a body tissue and/or a bodily fluid of the subject. Here, the subject can be a human, a non-human animal, and/or a plant. The bodily fluid can be human blood, sweat, urine, and/or other secretions.
신규 CRISPR/Cas12a 복합체Novel CRISPR/Cas12a complex
상기 신규 CRISPR/Cas12a 복합체는 상기 《신규 CRISPR/Cas12a 시스템》 단락에서 설명된 바와 같다. 본 표적 핵산 검출 방법은, 표적 핵산 검출 방법을 수행하기 시작하는 시점에 신규 CRISPR/Cas12a 복합체가 형성되어 있는 경우 뿐 아니라, 표적 핵산 검출 방법을 수행하기 시작하는 시점에서는 신규 CRISPR/Cas12a 단백질 및 프로그램 가능한 가이드 RNA가 복합체를 형성하지 않고 따로따로 존재하다가, 특정 시점에 상기 신규 CRISPR/Cas12a 복합체가 형성되는 경우 또한 포괄한다. 여기서, 상기 신규 CRISPR/Cas12a 복합체의 프로그램 가능한 가이드 RNA는 상기 표적 핵산 검출 방법의 상기 표적 핵산을 표적(target)한다. 이때, 상기 프로그램 가능한 가이드 RNA는 상기 표적 핵산과 상보적으로 결합할 수 있다. 상기 신규 CRISPR/Cas12a 복합체가 상기 표적 핵산과 결합하는 경우, 상기 신규 CRISPR/Cas12a 복합체의 부수적 절단 기능(collateral cleavage activity)가 활성화된다.The novel CRISPR/Cas12a complex is as described in the above paragraph “Novel CRISPR/Cas12a System”. The present target nucleic acid detection method encompasses not only the case where the novel CRISPR/Cas12a complex is formed at the time when the target nucleic acid detection method starts to be performed, but also the case where the novel CRISPR/Cas12a protein and the programmable guide RNA do not form a complex but exist separately at the time when the target nucleic acid detection method starts to be performed, and then the novel CRISPR/Cas12a complex is formed at a specific time. Here, the programmable guide RNA of the novel CRISPR/Cas12a complex targets the target nucleic acid of the target nucleic acid detection method. At this time, the programmable guide RNA can complementarily bind to the target nucleic acid. When the novel CRISPR/Cas12a complex binds to the target nucleic acid, the collateral cleavage activity of the novel CRISPR/Cas12a complex is activated.
프로브 핵산을 포함하는 검출제A detection agent comprising a probe nucleic acid
상기 프로브 핵산을 포함하는 검출제는 상기 《표적 핵산 검출용 조성물》 단락에서 설명된 바와 같다. 여기서, 상기 프로브 핵산이 절단되는 경우, 상기 프로브 핵산을 포함하는 검출제는 검출 가능한 신호를 생성한다.The detection agent comprising the above probe nucleic acid is as described in the above paragraph “Composition for detecting target nucleic acid”. Here, when the probe nucleic acid is cleaved, the detection agent comprising the probe nucleic acid generates a detectable signal.
각 구성요소 혼합Mix each component
본 명세서에서 제공하는 표적 핵산 검출 방법은 샘플, 신규 CRISPR/Cas12a 복합체, 및 프로브 핵산을 포함하는 검출제를 혼합하는 과정을 포함한다. 상기 표적 핵산 검출 방법은 상기 신규 CRISPR/Cas12a 복합체가 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되는 현상을 이용하는 방법이다. 따라서, 상기 혼합 과정은 1) 샘플 내 표적 핵산이 존재하는 경우, 상기 표적 핵산이 신규 CRISPR/Cas12a 복합체와 결합할 수 있고, 2) 부수적 절단 기능이 활성화된 CRISPR/Cas12a 복합체가 프로브 핵산을 포함하는 검출제와 같이 상호작용할 수 있다면, 다양한 형태로 구현될 수 있다. 예를 들어, 상기 혼합 과정은 상기 세 구성요소가 동시에 혼합되는 것일 수 있고, 시차를 두고 순차적으로 혼합되는 것일 수 있다. 또 다른 예를 들어, 상기 혼합 과정은 상기 세 구성요소 중 두 구성요소가 이미 혼합되어 있는 상태에서 수행될 수 있다.The target nucleic acid detection method provided herein includes a process of mixing a sample, a novel CRISPR/Cas12a complex, and a detection agent including a probe nucleic acid. The target nucleic acid detection method utilizes a phenomenon in which the novel CRISPR/Cas12a complex binds to the target nucleic acid and activates a secondary cleavage function. Therefore, the mixing process can be implemented in various forms, as long as 1) when a target nucleic acid exists in the sample, the target nucleic acid can bind to the novel CRISPR/Cas12a complex, and 2) the CRISPR/Cas12a complex with the secondary cleavage function activated can interact with the detection agent including the probe nucleic acid. For example, the mixing process can be a process in which the three components are mixed simultaneously, or can be a process in which the three components are mixed sequentially with a time difference. For another example, the mixing process can be performed in a state in which two of the three components are already mixed.
키트 사용 가능Kit available
상기 표적 핵산 검출 방법은 하나 이상의 키트에서 수행될 수 있다. 이 경우, 상기 각 구성요소의 혼합은 상기 키트 내에서 일어나며, 상기 혼합 과정은 상기 각 구성요소를 상기 키트에 제공하는 과정을 포함한다. 상기 키트는 상기 각 구성요소가 적절히 혼합될 수 있는 것이라면 달리 제한되지 않으며, 통상의 기술자가 공지 기술을 참조하여 적절하게 선택할 수 있다. 예를 들어, 상기 키트는 용기(vessel); 웰(well); 플레이트(plate); 반응기(reactor); 바이알(vial); 시험관(test-tube); 카세트(cassette); 및 미디어(media) 중 선택된 적어도 하나일 수 있으나, 이에 제한되는 것은 아니다.The above target nucleic acid detection method can be performed in one or more kits. In this case, the mixing of each component occurs within the kit, and the mixing process includes a process of providing each component to the kit. The kit is not particularly limited as long as each component can be appropriately mixed, and a person skilled in the art can appropriately select it by referring to known techniques. For example, the kit can be at least one selected from a vessel; a well; a plate; a reactor; a vial; a test-tube; a cassette; and media, but is not limited thereto.
신호 검출 및 표적 핵산에 대한 정보 획득Signal detection and information acquisition about target nucleic acids
상기 방법의 수행 결과, 상기 검출제로부터 검출 가능한 신호가 생성되는데, 상기 검출 가능한 신호는 표적 핵산에 대한 정보를 반영하고 있다. 따라서, 상기 방법은 상기 검출가능한 신호를 측정하여, 상기 표적 핵산에 대한 정보를 도출하는 과정을 추가로 포함할 수 있다.As a result of performing the above method, a detectable signal is generated from the detector, and the detectable signal reflects information about the target nucleic acid. Therefore, the method may additionally include a process of measuring the detectable signal to derive information about the target nucleic acid.
상기 표적 핵산에 대한 정보란, 예를 들어, 상기 샘플 내 미리 결정된 표적 서열의 존재 여부, 상기 샘플 내 미리 결정된 표적 서열의 양(amount), 상기 샘플 내 미리 결정된 표적 서열의 농도(concentration), 상기 샘플 내 미리 결정된 표적 서열의 개수(count), 및 상기 샘플 내 미리 결정된 표적 서열의 발현량(expression level) 등일 수 있으나, 이에 제한되는 것은 아니다.Information about the target nucleic acid may include, but is not limited to, for example, the presence or absence of a predetermined target sequence in the sample, the amount of the predetermined target sequence in the sample, the concentration of the predetermined target sequence in the sample, the count of the predetermined target sequence in the sample, and the expression level of the predetermined target sequence in the sample.
발명의 가능한 실시예Possible embodiments of the invention
이하 본 명세서에서 제공하는 발명의 가능한 실시예들을 나열한다. 본 단락에서 제공하는 이하의 실시예들은 단지 발명의 일 예시에 해당될 뿐이다. 따라서, 본 명세서에서 제공하는 발명을 하기 실시예로 제한하여 해석할 수 없다. 실시예 번호와 함께 기재된 간략한 설명 또한, 각 실시예 간 구분의 편의를 위한 것일 뿐 본 명세서에서 개시하는 발명에 대한 제한으로 해석될 수 없다.Hereinafter, possible embodiments of the invention provided in this specification are listed. The following embodiments provided in this paragraph are merely examples of the invention. Therefore, the invention provided in this specification should not be construed as being limited to the following embodiments. The brief descriptions described with the embodiment numbers are also only for the convenience of distinguishing between each embodiment and should not be construed as limitations to the invention disclosed in this specification.
신규 Cas12a 단백질Novel Cas12a protein
실시예 1, 신규 Cas12a 단백질Example 1, novel Cas12a protein
다음 중 선택된 아미노산 서열로 표현되는 신규 Cas12a 단백질:A novel Cas12a protein represented by an amino acid sequence selected from the following:
HQLLEDVISVGNENLTPSYIVLEKLSREMKRGRQKIEKQVYQKFELALASKLGFYVNKDIEEEKPGSIQMPLQFVPPVNTFDQIDKKDSFGIMLYTRANYTSVTDPLTGWRKTIYITNGNNEDILKELTEAFDDIFFDGVDYVFSYVEKNSGQRWNIYSGNHGKSLDRFEYNKDTKCYESYNIVEVLDVLFADFNKSSSLLEQMRRGVKLKKAEENRTAYDSLRKAINMIQQIRNTGNEIKDNNFLQSPIRKDGKHFDTRNANDFRDLNLHFIKDADANGAYNIARKGLIMDAHYKYWMEQGKPNVKKKNKKEKEVSALSLYVSDREWDMWLLNREMWEKHLSEFSLRKQD(서열번호 1); QVYQNFEKALITKLNYLVFKEIQDYNTAGSVLIGYQLTDKFVSFEKMGKQTGALFYVPAAYTSKIDPTTGFANLFNTRKCTNVESRKVFLMTFDAIKYNAVRKSFAFSFDYAKFQTSAKSFQNKWTVYTSQKRLVFNPLTRQDTAVNPTQMIVDALNKRGVSLSDEFDLKAYLQNTDAIKANAEFFKTIFIALEYTLQMRNSNSSSGEDYIESPVLNKSGEFFRSSEDNPALPIDADANGAYHIAMKGLFLLLNVFNQGKKDLKIEHQAWFEFMQKRNM(서열번호 2); GFINQIQFSTKSTLSAKRDLLCNIDSIRYDPSEECYIFRIDYTKVGDRTKEFKNVWDIYTRGDRIVYSTKERCDKHLHPTEIMTKALESAGIGKEGELKEKICSADSKVIEAVVYALDLTLRLRNEDRETDYILSPVRNADGKFFCTLDGDLSLPLDSDANGAYNIALKGLLMLKMTEESNGPDADKYDISLVTNSDWLTFCQTGHRTWKS(서열번호 3); FVNLFGSRQLTYTSVSAAKAFFGTMREIGYDAQRDCYRFAFRYSDYDLYQQDHRDSWTVFTAGKGRIAHTVKNGRHTFEEIDVTERMKELFQRFGLDPYAADLRGAIDAADKKDFFSELLWLFKVTVQLRYEDSEQDFILSPIEKDGRFFDSRQAKKDEPQDGDANGAYHIALQGLRLARERIKDGRVQKDPKGKQTLNWLRFAQRKDYLE(서열번호 4); LTNAFESFEKMGKQNGFIFYVPAYLTSKIDPTTGFADLLHPSSKQSKESMRDFVGRFDSITFNKTENYFEFELDYNKFPRCNTDYRKKWTVCTYGSRIKTFRNPEKNSEWDNKTVELTPAFMALFEKYSIDVNGDIKAQIMSVDKKDFFVELIGLLRLTLQMRNSETGKVDRDYLISPVKNSEGVFYNSDDYKGIENASLPKDADANGAYNIARKGLWIIEQIKACENDAELNKIRLAISNAEWLEYAQKK(서열번호 5); KYESVEKAKSVIESFDFIRYNKGSDMFEIGLDYSKTERGITSYKKKWTICTNGNRIRIFRNKAKNNEWDDETVYLTEAFKKLFNEYGIDISADIKEQLLAKTDKDFFNGFINLLSLTLQMRNSIPNSDTDYLISPVRGKDGKFYCSDDYQGKNALLPENADANGAYNIARKALWCIEQIKAADDDKLNEVKLAIKNKEWLEYAQKG(서열번호 6); LEDLNSEMKRGRQKIEKQVYQNLELALAKKFNFVVDKEAKQGELGSVSKALQLTPPVNNYQDIEGKKQFGVMLYTRANYTSITDPTTGWRKTIYIKNGKDEEIRKQILEKFTDFGFAGKDYYFEYTEENAGHTWRMYSGKNGEPLPRFQNKKQMEQDKNIWVPEQINVKEILDKLFANFDKGRSFKEQVNEEVKLEKIEGRSETAWQSLRYALNMIQQIRNSGVEKTDDNFLYSPVRNENGEHFDTRNHENNGDLSPIVDADANGAFNIARKGLIMDAHIKHWINSGRPKIKKDGKETPDLDLFISDREWDLWLLDREEWKKYLPVFASKSKKDADKTTSTKSPKRKKK(서열번호 7); ENNAIVVLEDLNFGFKRGRFCVERQVYQKFEKMLIDKLNYLVFKNKPEGDVGGVLKGYQLAEKFDSFQKLGKQSGFLFYIPAAYTSKIDPTTGFANLFNMTELTSAEKKKEFLSHFEDITYDGKNDRFLFSFDYKNFKCFQTDYIKKWTVYSQGKRIVYDKESKSAKEISPVEIIKAALAKQNIALTDQLDVLSAINSAEASPKSASFFGDICYAFEKTLQMRNSIPNTDEDYLVSPVLNKKGEFYDSRSCGDTLPKNADANGAYHIALKGLYLIKNVFDAGGKDLKISHEDWFKFAQSRNS(서열번호 8); LLHPKYTSVEESHNLFGNFDDIRYNAVTDMFEFDLDYSKFPKSKADFKKKWTVCTNSDRIMTFRNPAKNSEWDNKRVILTDEFKKLFEEFGVDYKSNLREKILGISNPDFNKRLVKFLALTLQMRNSVTGSTNPEDDYLISPVRDKNGVFYDSRNFIGNDAVLPADADANGAYNIARKGLWAIDVIKSTSSDMLDKADLSISNAEWLEYVQK(서열번호 9); 및HQLLEDVISVGNENLTPSYIVLEKLSREMKRGRQKIEKQVYQKFELALASKLGFYVNKDIEEEKPGSIQMPLQFVPPVNTFDQIDKKDSFGIMLYTRANYTSVTDPLTGWRKTIYITNGNNEDILKELTEAFDDIFFDGVDYVFSYVEKNSGQRWNIYSGNHGKSLDRFEYNKDTKCYESYNIVEVLDVLFADFNKSSSLLE QMRRGVKLKKAEENRTAYDSLRKAINMIQQIRNTGNEIKDNNFLQSPIRKDGKHFDTRNANDFRDLNLHFIKDADANGAYNIARKGLIMDAHYKYWMEQGKPNVKKKNKKEKEVSALSLYVSDREWDMWLLNREMWEKHLSEFSLRKQD (SEQ ID NO: 1); QVYQNFEKALITKLNYLVFKEIQDYNTAGSVLIGYQLTDKFVSFEKMGKQTGALFYVPAAYTSKIDPTTGFANLFNTRKCTNVESRKVFLMTFDAIKYNAVRKSFAFSFDYAKFQTSAKSFQNKWTVYTSQKRLVFNPLTRQDTAVNPTQMIVDALNKRGVSLSDEFDLKAYLQNTDAIKANAEFFKTIFIAL EYTLQMRNSNSSSGEDYIESPVLNKSGEFFRSSEDNPALPIDADANGAYHIAMKGLFLLLNVFNQGKKDLKIEHQAWFEFMQKRNM (SEQ ID NO: 2); GFINQIQFSTKSTLSAKRDLLCNIDSIRYDPSEECYIFRIDYTKVGDRTKEFKNVWDIYTRGDRIVYSTKERCDKHLHPTEIMTKALESAGIGKEGELKEKICSADSKVIEAVVYALDLTLRLRNEDRETDYILSPVRNADGKFFCTLDGDLSLPLDSDANGAYNIALKGLLMLKMTEESNGPDADKYDISLVTNSDWLTFCQTGHRTWKS (SEQ ID NO: 3); FVNLFGSRQLTYTSVSAAKAFFGTMREIGYDAQRDCYRFAFRYSDYDLYQQDHRDSWTVFTAGKGRIAHTVKNGRHTFEEIDVTERMKELFQRFGLDPYAADLRGAIDAADKKDFFSELLWLFKVTVQLRYEDSEQDFILSPIEKDGRFFDSRQAKKDEPQDGDANGAYHIALQGLRLARERIKDGRVQKDPKGKQTLNWLRFA QRKDYLE (SEQ ID NO: 4); LTNAFESFEKMGKQNGFIFYVPAYLTSKIDPTTGFADLLHPSSKQSKESMRDFVGRFDSITFNKTENYFEFELDYNKFPRCNTDYRKKWTVCTYGSRIKTFRNPEKNSEWDNKTVELTPAFMALFEKYSIDVNGDIKAQIMSVDKKDFFVELIGLLRLTLQMRNSETGKVDRDYLISPVKNSEGVFYNSDDYKGIENASLPKDADANGAYNI ARKGLWIIEQIKACENDAELNKIRLAISNAEWLEYAQKK (SEQ ID NO: 5); KYESVEKAKSVIESFDFIRYNKGSDMFEIGLDYSKTERGITSYKKKWTICTNGNRIRIFRNKAKNNEWDDETVYLTEAFKKLFNEYGIDISADIKEQLLAKTDKDFFNGFINLLSLTLQMRNSIPNSDTDYLISPVRGKDGKFYCSDDYQGKNALLPENADANGAYNIARKALWCIEQIKAADDDKLNEVKLAIKNKEWLEYAQKG (SEQ ID NO: 6); LEDLNSEMKRGRQKIEKQVYQNLELALAKKFNFVVDKEAKQGELGSVSKALQLTPPVNNYQDIEGKKQFGVMLYTRANYTSITDPTTGWRKTIYIKNGKDEEIRKQILEKFTDFGFAGKDYYFEYTEENAGHTWRMYSGKNGEPLPRFQNKKQMEQDKNIWVPEQINVKEILDKLFANFDKGRSFKEQVNE EVKLEKIEGRSETAWQSLRYALNMIQQIRNSGVEKTDDNFLYSPVRNENGEHFDTRNHENNGDLSPIVDADANGAFNIARKGLIMDAHIKHWINSGRPKIKKDGKETPDLDLFISDREWDLWLLDREEWKKYLPVFASKSKKDADKTTSTKSPKRKKK (SEQ ID NO: 7); ENNAIVVLEDLNFGFKRGRFCVERQVYQKFEKMLIDKLNYLVFKNKPEGDVGGVLKGYQLAEKFDSFQKLGKQSGFLFYIPAAYTSKIDPTTGFANLFNMTELTSAEKKKEFLSHFEDITYDGKNDRFLFSFDYKNFKCFQTDYIKKWTVYSQGKRIVYDKESKSAKEISPVEIIKAALAKQNIALTDQLDVLSAINSAEASPK SASFFGDICYAFEKTLQMRNSIPNTDEDYLVSPVLNKKGEFYDSRSCGDTLPKNADANGAYHIALKGLYLIKNVFDAGGKDLKISHEDWFKFAQSRNS (SEQ ID NO: 8); LLHPKYTSVEESHNLFGNFDDIRYNAVTDMFEFDLDYSKFPKSKADFKKKWTVCTNSDRIMTFRNPAKNSEWDNKRVILTDEFKKLFEEFGVDYKSNLREKILGISNPDFNKRLVKFLALTLQMRNSVTGSTNPEDDYLISPVRDKNGVFYDSRNFIGNDAVLPADADANGAYNIARKGLWAIDVIKSTSSDMLDKADLSISNAEWLEYVQK( SEQ ID NO: 9); and
GMLHALQLANKFKSFSKMGKQCGCLFYIPAWNTSKIDPVTGFVNLLDTRYESVKASKEFFSHFDCITFNATMDWFEFSFDYDNFHKKAEGTQTQWTVFSRGSRIHTFRNPEKNNQWDDEEINLTDKFKELFAKYSINYRGNLKDAMQDSNEATFFKELMGLMKLLMQMRNSKANSEIDYMLSPVSDKNGNFYDSRVCGGSLPENADANGAYNIARKGLMLIRNIQAAPDDKKPSLTITNKDWLCFAQTKPYLED(서열번호 10).GMLHALQLANKFKSFSKMGKQCGCLFYIPAWNTSKIDPVTGFVNLLDTRYESVKASKEFFSHFDCITFNATMDWFEFSFDYDNFHKKAEGTQTQWTVFSRGSRIHTFRNPEKNNQWDDEEINLTDKFKELFAKYSINYRGNLKDAMQDSNEATFFKELMGLMKLLMQMRNSKANSEIDYMLSPVSDKNGNFYDSRVCGGSLP ENADANGAYNIARKGLMLIRNIQAAPDDKKPSLTITNKDWLCFAQTKPYLED (SEQ ID NO: 10).
실시예 2, 유사한 서열 포함Example 2, including similar sequences
서열번호 1 내지 서열번호 10 중 선택된 아미노산 서열과 약 70% 이상, 약 71% 이상, 약 72% 이상, 약 73% 이상, 약 74% 이상, 약 75% 이상, 약 76% 이상, 약 77% 이상, 약 78% 이상, 약 79% 이상, 약 80% 이상, 약 81% 이상, 약 82% 이상, 약 83% 이상, 약 84% 이상, 약 85% 이상, 약 86% 이상, 약 87% 이상, 약 88% 이상, 약 89% 이상, 약 90% 이상, 약 91% 이상, 약 92% 이상, 약 93% 이상, 약 94% 이상, 약 95% 이상, 약 96% 이상, 약 97% 이상, 약 98% 이상, 약 99% 이상 일치하거나(identical), 동일하거나(same), 매칭되거나(matched), 및/또는 동등한(equivalent) 서열을 가지는 Cas12a 단백질,An amino acid sequence selected from among SEQ ID NOs: 1 to 10 is about 70% or more, about 71% or more, about 72% or more, about 73% or more, about 74% or more, about 75% or more, about 76% or more, about 77% or more, about 78% or more, about 79% or more, about 80% or more, about 81% or more, about 82% or more, about 83% or more, about 84% or more, about 85% or more, about 86% or more, about 87% or more, about 88% or more, about 89% or more, about 90% or more, about 91% or more, about 92% or more, about 93% or more, about 94% or more, about 95% or more, about 96% or more, about 97% or more, about 98% or more, or about 99% or more identical, same, or matched, and/or a Cas12a protein having an equivalent sequence;
여기서, 용어 "약"의 의미는 《용어의 정의》의 "약" 단락에서 정의된 것과 같다.Here, the meaning of the term "medicine" is as defined in the "medicine" section of the "Definitions of Terms".
실시예 3, PAM 서열Example 3, PAM sequence
실시예 1 내지 실시예 2 중 어느 하나에 있어서, 상기 Cas12a 단백질은 5'-TTTV-3'의 PAM (Protospacer Adjacent Motif) 서열을 인식할 수 있음.In any one of Examples 1 to 2, the Cas12a protein can recognize a PAM (Protospacer Adjacent Motif) sequence of 5'-TTTV-3'.
실시예 4, NLS 포함Example 4, including NLS
실시예 1 내지 실시예 3 중 어느 하나에 있어서, 상기 Cas12a 단백질은 상기 선택된 아미노산 서열의 N말단 및/또는 C말단에 적어도 하나의 NLS (Nuclear Localization Signal)를 더 포함함.In any one of Examples 1 to 3, the Cas12a protein further comprises at least one NLS (Nuclear Localization Signal) at the N-terminus and/or C-terminus of the selected amino acid sequence.
실시예 5, NLS 한정Example 5, NLS limited
실시예 4에 있어서, 상기 NLS는 각각 독립적으로 PKKKRKV(서열번호 88), KRPAATKKAGQAKKKK(서열번호 89), PAAKRVKLD(서열번호 90), RQRRNELKRSP(서열번호 91), NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY(서열번호 92), RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV(서열번호 93), VSRKRPRP(서열번호 94), PPKKARED(서열번호 95), PQPKKKPL(서열번호 96), SALIKKKKKMAP(서열번호 97), DRLRR(서열번호 98), PKQKKRK(서열번호 99), RKLKKKIKKL(서열번호 100), REKKKFLKRR(서열번호 101), KRKGDEVDGVDEVAKKKSKK(서열번호 102), 및 RKCLQAGMNLEARKTKK(서열번호 103) 중 선택된 하나 이상임.In Example 4, the NLS is each independently PKKKRKV (SEQ ID NO: 88), KRPAATKKAGQAKKKK (SEQ ID NO: 89), PAAKRVKLD (SEQ ID NO: 90), RQRRNELKRSP (SEQ ID NO: 91), NQSSNFGPMKGGNFGGRSSGPYGGGGQYFAKPRNQGGY (SEQ ID NO: 92), RMRIZFKNKGKDTAELRRRRVEVSVELRKAKKDEQILKRRNV (SEQ ID NO: 93), VSRKRPRP (SEQ ID NO: 94), PPKKARED (SEQ ID NO: 95), PQPKKKPL (SEQ ID NO: 96), SALIKKKKKMAP (SEQ ID NO: 97), DRLRR (SEQ ID NO: 98), PKQKKRK (SEQ ID NO: 99), RKLKKKIKKL (SEQ ID NO: 100), At least one selected from REKKKFLKRR (SEQ ID NO: 101), KRKGDEVDGVDEVAKKKSKK (SEQ ID NO: 102), and RKCLQAGMNLEARKTKK (SEQ ID NO: 103).
프로그램 가능한 가이드 RNAProgrammable Guide RNA
실시예 6, 프로그램 가능한 가이드 RNAExample 6, Programmable Guide RNA
다음을 포함하는 프로그램 가능한 가이드 RNA:Programmable guide RNA containing:
UAAUUUCUACUAUUCGUAGAU(서열번호 11), UUAAUUUCUACUUUCGUAGAU(서열번호 12), CAAUUUCUACUUUCAGUAGAU(서열번호 13), UUAAUUUCUACUUGUGUAGAU(서열번호 14), UAAAUUUCUACUAUUGUAGAU(서열번호 15), AUAAUUUCUACUAUUGUAGAU(서열번호 16), AAAAUUUCUACUAUUGUAGAU(서열번호 17), AAAAUUUCUACUCUUGUAGAU(서열번호 18), AUAAUUUCUACUGUUGUAGAU(서열번호 19), 및 AUAAUUUCUACUGUUGUAGAU(서열번호 20) 중 선택된 핵산 서열로 표현되는 직접 반복부(direct repeat; DR); 및A direct repeat (DR) represented by a nucleic acid sequence selected from among UAAUUUCUACUAUUCGUAGAU (SEQ ID NO: 11), UUAAUUUCUACUUUCGUAGAU (SEQ ID NO: 12), CAAUUUCUACUUUCAGUAGAU (SEQ ID NO: 13), UUAAUUUCUACUUGUGUAGAU (SEQ ID NO: 14), UAAAUUUCUACUAUUGUAGAU (SEQ ID NO: 15), AUAAUUUCUACUAUUGUAGAU (SEQ ID NO: 16), AAAAUUUCUACUAUUGUAGAU (SEQ ID NO: 17), AAAAUUUCUACUCUUGUAGAU (SEQ ID NO: 18), AUAAUUUCUACUGUUGUAGAU (SEQ ID NO: 19), and AUAAUUUCUACUGUUGUAGAU (SEQ ID NO: 20); and
가이드 도메인,Guide domain,
여기서, 상기 직접 반복부는 Cas12a 단백질과 상호작용하여 상기 가이드 RNA가 상기 Cas12a 단백질과 복합체를 이루도록 할 수 있고,Here, the direct repeat portion can interact with the Cas12a protein to allow the guide RNA to form a complex with the Cas12a protein,
상기 가이드 도메인은 미리 결정된 표적 서열의 표적 핵산을 표적하거나 (target), 및/또는 상기 미리 결정된 표적 서열의 표적 핵산과 혼성화될 (hybridize) 수 있도록 인공적으로 설계된 것이며,The above guide domain is artificially designed to target a target nucleic acid of a predetermined target sequence and/or to be able to hybridize with a target nucleic acid of the predetermined target sequence.
상기 직접 반복부 및 상기 가이드 도메인이 5'말단에서 3'말단 방향으로 차례로 연결되어 있음.The above direct repeat portion and the above guide domain are sequentially connected in the 5' end to the 3' end direction.
실시예 7, 스템-루프 포함Example 7, with stem loop
실시예 6에 있어서,In Example 6,
상기 프로그램 가능한 가이드 RNA는 스템-루프를 더 포함하고,The above programmable guide RNA further comprises a stem-loop,
상기 스템-루프는 상기 직접 반복부의 5'말단에 연결됨.The above stem-loop is connected to the 5' end of the above direct repeat.
실시예 8, 스템-루프 서열 한정Example 8, Stem-loop sequence limitation
실시예 7에 있어서, 상기 스템-루프는 GUUUCAAAGAUUAAAU(서열번호 21)의 핵산 서열을 가짐.In Example 7, the stem-loop has a nucleic acid sequence of GUUUCAAAGAUUAAAU (SEQ ID NO: 21).
실시예 9, 가이드 도메인 길이 한정Example 9, limiting the length of the guide domain
실시예 6 내지 실시예 8 중 어느 하나에 있어서, 상기 가이드 도메인은 1nt, 2nt, 3nt, 4nt, 5nt, 6nt, 7nt, 8nt, 9nt, 10nt, 11nt, 12nt, 13nt, 14nt, 15nt, 16nt, 17nt, 18nt, 19nt, 20nt, 21nt, 22nt, 23nt, 24nt, 25nt, 26nt, 27nt, 28nt, 29nt, 또는 30nt 길이인 것을 특징으로 하는 프로그램 가능한 가이드 RNA.A programmable guide RNA according to any one of Examples 6 to 8, wherein the guide domain is 1 nt, 2 nt, 3 nt, 4 nt, 5 nt, 6 nt, 7 nt, 8 nt, 9 nt, 10 nt, 11 nt, 12 nt, 13 nt, 14 nt, 15 nt, 16 nt, 17 nt, 18 nt, 19 nt, 20 nt, 21 nt, 22 nt, 23 nt, 24 nt, 25 nt, 26 nt, 27 nt, 28 nt, 29 nt, or 30 nt in length.
실시예 10, 가이드 도메인 및 표적 서열의 관계Example 10, Relationship between guide domain and target sequence
실시예 6 내지 실시예 9 중 어느 하나에 있어서, 상기 가이드 도메인은 상기 미리 결정된 표적 서열의 핵산과 동등한(equivalent) 서열을 가지거나, 또는 상기 미리 결정된 표적 서열의 핵산과 상보적인(complementary) 서열을 가지는 것을 특징으로 하는 프로그램 가능한 가이드 RNA.A programmable guide RNA according to any one of embodiments 6 to 9, wherein the guide domain has a sequence equivalent to a nucleic acid of the predetermined target sequence or a sequence complementary to a nucleic acid of the predetermined target sequence.
실시예 11, 가이드 도메인 및 표적 서열의 관계Example 11, Relationship between guide domain and target sequence
실시예 6 내지 실시예 10 중 어느 하나에 있어서,In any one of Examples 6 to 10,
상기 미리 결정된 표적 서열의 핵산은 이중가닥 핵산이고,The nucleic acid of the above predetermined target sequence is a double-stranded nucleic acid,
상기 이중가닥 핵산은 표적 서열의 핵산을 포함하는 제1 가닥 및 상기 제1 가닥과 상보적인 핵산 서열을 가지는 제2 가닥을 포함하고,The double-stranded nucleic acid comprises a first strand comprising a nucleic acid of a target sequence and a second strand having a nucleic acid sequence complementary to the first strand,
상기 가이드 도메인은 상기 제1 가닥과 상보적으로 결합하거나, 상기 제2 가닥과 상보적으로 결합할 수 있는 것임.The above guide domain can complementarily bind to the first strand or complementarily bind to the second strand.
실시예 12, PAM 서열 포함Example 12, including PAM sequence
실시예 11에 있어서,In Example 11,
상기 가이드 도메인이 상기 제1 가닥과 상보적으로 결합하는 경우, 상기 제2 가닥은 5'-TTTV-3' 서열을 포함하고,When the above guide domain complementarily binds to the first strand, the second strand comprises a 5'-TTTV-3' sequence,
상기 가이드 도메인이 상기 제2 가닥과 상보적으로 결합하는 경우, 상기 제1 가닥은 5'-TTTV-3' 서열을 포함함.When the above guide domain complementarily binds to the second strand, the first strand comprises a 5'-TTTV-3' sequence.
실시예 13, 미스매치 포함Example 13, including mismatch
실시예 11에 있어서, 상기 가이드 도메인은 상기 상보적으로 결합하는 가닥의 서열과 비교해 0개, 1개, 2개, 3개, 4개, 또는 5개의 미스매치를 가짐.In Example 11, the guide domain has 0, 1, 2, 3, 4, or 5 mismatches compared to the sequence of the complementarily binding strand.
실시예 14, 표적 핵산 구체화Example 14, Target Nucleic Acid Specification
실시예 6 내지 실시예 13 중 어느 하나에 있어서, 상기 표적 핵산은 이중가닥 DNA, 단일가닥 DNA, 및 RNA 중 선택된 것임.In any one of Examples 6 to 13, the target nucleic acid is selected from double-stranded DNA, single-stranded DNA, and RNA.
프로브 핵산을 포함하는 검출제A detection agent comprising a probe nucleic acid
실시예 15, 프로브 핵산을 포함하는 검출제Example 15, Detector Comprising Probe Nucleic Acid
프로브 핵산을 포함하는 검출제 (detecting agent)로, 상기 프로브 핵산이 절단되는 경우 검출 가능한 신호를 생성함.A detecting agent comprising a probe nucleic acid, which produces a detectable signal when the probe nucleic acid is cleaved.
실시예 16, 프로브 핵산 구성Example 16, Probe Nucleic Acid Composition
실시예 15에 있어서, 상기 프로브 핵산은 핵산 및 한 분자 이상의 신호 생성자를 포함함.In Example 15, the probe nucleic acid comprises a nucleic acid and one or more molecules of a signal generator.
실시예 17, 프로브 핵산 서열 한정Example 17, Probe Nucleic Acid Sequence Definition
실시예 15 내지 실시예 16 중 어느 하나에 있어서, 상기 프로브 핵산의 핵산 서열은 다음 중 선택된 하나 이상임:In any one of Examples 15 to 16, the nucleic acid sequence of the probe nucleic acid is at least one selected from the following:
5'-TTATT-3'; 5'-TTATTATT-3'; 5'-TTTTTTTT-3'; 5'-AAAAAAAA-3'; 5'-GGGGGGGG-3'; 5'-CCCCCCCC-3'; TAGCATGTCA(서열번호 85); CCAAGGTTCCAAGGTTCCAAGGTTC(서열번호 86); 및 CAGTCAGTCAGTCAGTCAGTCAGTC(서열번호 87).5'-TTATT-3'; 5'-TTATTATT-3'; 5'-TTTTTTTT-3'; 5'-AAAAAAAA-3'; 5'-GGGGGGGG-3'; 5'-CCCCCCCC-3'; TAGCATGTCA (SEQ ID NO: 85); CCAAGGTTCCAAGGTTCCAAGGTTC (SEQ ID NO: 86); and CAGTCAGTCAGTCAGTCAGTCAGTCAGTC (SEQ ID NO: 87).
실시예 18, 신호 증폭 물질 추가Example 18, addition of signal amplifying agent
실시예 15 내지 실시예 17 중 어느 하나에 있어서, 상기 검출제는 신호 증폭 물질을 더 포함함.In any one of Examples 15 to 17, the detector further comprises a signal amplifying substance.
실시예 19, 검출 가능한 신호 한정Example 19, Limiting the detectable signal
실시예 15 내지 실시예 18 중 어느 하나에 있어서, 상기 검출 가능한 신호는 형광 신호임.In any one of Examples 15 to 18, the detectable signal is a fluorescence signal.
실시예 20, 핵산 구체화Example 20, Nucleic Acid Specification
실시예 15 내지 실시예 19 중 어느 하나에 있어서, 상기 프로브 핵산에 포함된 핵산은 단일가닥 DNA, 이중가닥 DNA, 및 RNA 중 선택된 하나 이상임.In any one of Examples 15 to 19, the nucleic acid contained in the probe nucleic acid is at least one selected from single-stranded DNA, double-stranded DNA, and RNA.
신규 CRISPR/Cas12a 복합체Novel CRISPR/Cas12a complex
실시예 21, 신규 CRISPR/Cas12a 복합체Example 21, Novel CRISPR/Cas12a Complex
다음을 포함하는 신규 CRISPR/Cas12a 복합체:A novel CRISPR/Cas12a complex containing:
실시예 1 내지 실시예 5 중 어느 하나의 Cas12a 단백질; 및The Cas12a protein of any one of Examples 1 to 5; and
실시예 6 내지 실시예 14 중 어느 하나의 프로그램 가능한 가이드 RNA,A programmable guide RNA of any one of Examples 6 to 14,
여기서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA가 결합하여 리보뉴클레오프로틴(ribonucleoprotein)을 이루고 있는 것을 특징으로 하고,Here, the Cas12a protein and the programmable guide RNA are combined to form a ribonucleoprotein,
상기 CRISPR/Cas12a 복합체는 부수적 절단 기능 (collateral cleavage function)을 가지며,The above CRISPR/Cas12a complex has a collateral cleavage function,
상기 CRISPR/Cas12a 복합체가 상기 프로그램 가능한 가이드 RNA의 가이드 도메인이 표적하는 표적 핵산과 결합하는 경우, 부수적 절단 기능이 활성화됨.When the CRISPR/Cas12a complex binds to a target nucleic acid targeted by the guide domain of the programmable guide RNA, the secondary cleavage function is activated.
실시예 22, Cas12a 단백질 및 직접 반복부 매칭Example 22, Cas12a protein and direct repeat matching
실시예 21에 있어서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA의 직접 반복부는 다음 중 선택된 조합임:In Example 21, the direct repeat portion of the Cas12a protein and the programmable guide RNA is a combination selected from the following:
서열번호 1의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 11의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 1 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 11;
서열번호 2의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 12의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 2 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 12;
서열번호 3의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 13의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 3 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 13;
서열번호 4의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 14의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 4 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 14;
서열번호 5의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 15의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 5 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 15;
서열번호 6의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 16의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 6 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 16;
서열번호 7의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 17의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 7 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 17;
서열번호 8의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 18의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 8 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 18;
서열번호 9의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 19의 핵산 서열을 가지는 직접 반복부; 및A Cas12a protein having an amino acid sequence of SEQ ID NO: 9 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 19; and
서열번호 10의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 20의 핵산 서열을 가지는 직접 반복부.A Cas12a protein having an amino acid sequence of SEQ ID NO: 10 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 20.
실시예 23, 직접 반복부와 유사한 서열Example 23, sequence similar to direct repeat
실시예 21에 있어서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA의 직접 반복부는 다음 중 선택된 조합임:In Example 21, the direct repeat portion of the Cas12a protein and the programmable guide RNA is a combination selected from the following:
서열번호 1의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 11의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 1 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 11;
서열번호 2의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 12의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 2 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 12;
서열번호 3의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 13의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 3 and a direct repeat portion having a sequence similar to a nucleic acid sequence of SEQ ID NO: 13;
서열번호 4의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 14의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 4 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 14;
서열번호 5의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 15의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 5 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 15;
서열번호 6의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 16의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 6 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 16;
서열번호 7의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 17의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 7 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 17;
서열번호 8의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 18의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 8 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 18;
서열번호 9의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 19의 핵산 서열과 유사한 서열을 가지는 직접 반복부; 및A Cas12a protein having an amino acid sequence of SEQ ID NO: 9 and a direct repeat portion having a sequence similar to a nucleic acid sequence of SEQ ID NO: 19; and
서열번호 10의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 20의 핵산 서열과 유사한 서열을 가지는 직접 반복부,A Cas12a protein having an amino acid sequence of SEQ ID NO: 10 and a direct repeat portion having a sequence similar to a nucleic acid sequence of SEQ ID NO: 20;
여기서, 상기 서열번호 11 내지 서열번호 20의 핵산 서열과 유사한 서열이라 함은, 상기 핵산 서열과 약 70% 이상, 약 71% 이상, 약 72% 이상, 약 73% 이상, 약 74% 이상, 약 75% 이상, 약 76% 이상, 약 77% 이상, 약 78% 이상, 약 79% 이상, 약 80% 이상, 약 81% 이상, 약 82% 이상, 약 83% 이상, 약 84% 이상, 약 85% 이상, 약 86% 이상, 약 87% 이상, 약 88% 이상, 약 89% 이상, 약 90% 이상, 약 91% 이상, 약 92% 이상, 약 93% 이상, 약 94% 이상, 약 95% 이상, 약 96% 이상, 약 97% 이상, 약 98% 이상, 약 99% 이상 일치하거나(identical), 동일하거나(same), 매칭되거나(matched), 및/또는 동등한(equivalent) 핵산 서열을 의미하며, 여기서, 용어 "약"의 의미는 《용어의 정의》의 "약" 단락에서 정의된 것과 같다.Here, a sequence similar to the nucleic acid sequence of the above SEQ ID NOs: 11 to 20 means a sequence that is about 70% or more, about 71% or more, about 72% or more, about 73% or more, about 74% or more, about 75% or more, about 76% or more, about 77% or more, about 78% or more, about 79% or more, about 80% or more, about 81% or more, about 82% or more, about 83% or more, about 84% or more, about 85% or more, about 86% or more, about 87% or more, about 88% or more, about 89% or more, about 90% or more, about 91% or more, about 92% or more, about 93% or more, about 94% or more, about 95% or more, about 96% or more, about 97% or more, about 98% or more, about 99% or more identical to the above nucleic acid sequence, Same, matched, and/or equivalent nucleic acid sequences, wherein the term "about" has the same meaning as defined in the "About" section of the Definitions section.
신규 CRISPR/Cas12a 벡터Novel CRISPR/Cas12a vector
실시예 24, 발현 벡터Example 24, Expression Vector
다음 중 선택된 하나 이상을 포함하는 신규 CRISPR/Cas12a 시스템 구성요소 발현 벡터:Expression vectors of novel CRISPR/Cas12a system components comprising one or more of the following:
실시예 1 내지 실시예 5 중 어느 하나의 Cas12a 단백질을 암호화하는 핵산; 및A nucleic acid encoding the Cas12a protein of any one of Examples 1 to 5; and
실시예 6 내지 실시예 14 중 어느 하나의 프로그램 가능한 가이드 RNA를 암호화하는 핵산.A nucleic acid encoding a programmable guide RNA of any one of Examples 6 to 14.
여기서, 상기 발현 벡터는 세포 내 및/또는 세포 외에서 상기 Cas12a 단백질 및 상기 가이드 RNA가 발현되도록 할 수 있으며,Here, the expression vector can enable the Cas12a protein and the guide RNA to be expressed intracellularly and/or extracellularly,
상기 발현 결과, 실시예 21 내지 실시예 23 중 어느 하나의 CRISPR/Cas12a 복합체가 형성될 수 있고,As a result of the above expression, a CRISPR/Cas12a complex of any one of Examples 21 to 23 can be formed,
상기 CRISPR/Cas12a 복합체는 부수적 절단 기능 (collateral cleavage function)을 가지며,The above CRISPR/Cas12a complex has a collateral cleavage function,
상기 CRISPR/Cas12a 복합체가 상기 프로그램 가능한 가이드 RNA의 가이드 도메인이 표적하는 표적 핵산과 결합하는 경우, 부수적 절단 기능이 활성화됨.When the CRISPR/Cas12a complex binds to a target nucleic acid targeted by the guide domain of the programmable guide RNA, the secondary cleavage function is activated.
실시예 25, Cas12a 단백질 및 직접 반복부 매칭Example 25, Cas12a protein and direct repeat matching
실시예 24에 있어서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA의 직접 반복부는 다음 중 선택된 조합임:In Example 24, the direct repeat portion of the Cas12a protein and the programmable guide RNA is a combination selected from the following:
서열번호 1의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 11의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 1 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 11;
서열번호 2의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 12의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 2 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 12;
서열번호 3의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 13의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 3 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 13;
서열번호 4의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 14의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 4 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 14;
서열번호 5의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 15의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 5 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 15;
서열번호 6의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 16의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 6 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 16;
서열번호 7의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 17의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 7 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 17;
서열번호 8의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 18의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 8 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 18;
서열번호 9의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 19의 핵산 서열을 가지는 직접 반복부; 및A Cas12a protein having an amino acid sequence of SEQ ID NO: 9 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 19; and
서열번호 10의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 20의 핵산 서열을 가지는 직접 반복부.A Cas12a protein having an amino acid sequence of SEQ ID NO: 10 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 20.
실시예 26, 직접 반복부와 유사한 서열Example 26, sequence similar to direct repeat
실시예 24에 있어서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA의 직접 반복부는 다음 중 선택된 조합임:In Example 24, the direct repeat portion of the Cas12a protein and the programmable guide RNA is a combination selected from the following:
서열번호 1의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 11의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 1 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 11;
서열번호 2의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 12의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 2 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 12;
서열번호 3의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 13의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 3 and a direct repeat portion having a sequence similar to a nucleic acid sequence of SEQ ID NO: 13;
서열번호 4의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 14의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 4 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 14;
서열번호 5의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 15의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 5 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 15;
서열번호 6의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 16의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 6 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 16;
서열번호 7의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 17의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 7 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 17;
서열번호 8의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 18의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 8 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 18;
서열번호 9의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 19의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 9 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 19;
서열번호 10의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 20의 핵산 서열과 유사한 서열을 가지는 직접 반복부,A Cas12a protein having an amino acid sequence of SEQ ID NO: 10 and a direct repeat portion having a sequence similar to a nucleic acid sequence of SEQ ID NO: 20;
여기서, 상기 서열번호 11 내지 서열번호 20, 및 서열번호 110의 핵산 서열과 유사한 서열이라 함은, 상기 핵산 서열과 약 70% 이상, 약 71% 이상, 약 72% 이상, 약 73% 이상, 약 74% 이상, 약 75% 이상, 약 76% 이상, 약 77% 이상, 약 78% 이상, 약 79% 이상, 약 80% 이상, 약 81% 이상, 약 82% 이상, 약 83% 이상, 약 84% 이상, 약 85% 이상, 약 86% 이상, 약 87% 이상, 약 88% 이상, 약 89% 이상, 약 90% 이상, 약 91% 이상, 약 92% 이상, 약 93% 이상, 약 94% 이상, 약 95% 이상, 약 96% 이상, 약 97% 이상, 약 98% 이상, 약 99% 이상 일치하거나(identical), 동일하거나(same), 매칭되거나(matched), 및/또는 동등한(equivalent) 핵산 서열을 의미하며, 여기서, 용어 "약"의 의미는 《용어의 정의》의 "약" 단락에서 정의된 것과 같다.Here, the sequence similar to the nucleic acid sequence of the above SEQ ID NOs: 11 to 20 and SEQ ID NO: 110 means a sequence similar to the nucleic acid sequence of about 70% or more, about 71% or more, about 72% or more, about 73% or more, about 74% or more, about 75% or more, about 76% or more, about 77% or more, about 78% or more, about 79% or more, about 80% or more, about 81% or more, about 82% or more, about 83% or more, about 84% or more, about 85% or more, about 86% or more, about 87% or more, about 88% or more, about 89% or more, about 90% or more, about 91% or more, about 92% or more, about 93% or more, about 94% or more, about 95% or more, about 96% or more, about 97% or more, about 98% or more, about It means a nucleic acid sequence that is more than 99% identical, same, matched, and/or equivalent, wherein the term "about" has the same meaning as defined in the "About" section of the Definition of Terms.
실시예 27, Cas12a 암호화 핵산 한정Example 27, Cas12a encoding nucleic acid limitation
실시예 24 내지 실시예 26 중 어느 하나에 있어서, 상기 Cas12a 단백질을 암호화하는 핵산은 서열번호 32 내지 서열번호 41 중 선택된 핵산 서열을 가짐.In any one of Examples 24 to 26, the nucleic acid encoding the Cas12a protein has a nucleic acid sequence selected from SEQ ID NO: 32 to SEQ ID NO: 41.
실시예 28, 추가 구성Example 28, Additional Configuration
실시예 24 내지 실시예 27 중 어느 하나에 있어서, 상기 발현 벡터는 다음 중 선택된 하나 이상을 추가로 포함하는 것을 특징으로 하는 발현 벡터:An expression vector according to any one of Examples 24 to 27, characterized in that the expression vector further comprises at least one selected from the following:
프로모터; 인핸서; 인트론; 폴리아데닐화 신호; 코작 공통(Kozak consensus) 서열; 내부 리보솜 유입 부위(IRES; Internal Ribosome Entry Site); 스플라이스 억셉터; 2A 서열 및/또는 복제원점(replication origin).Promoter; enhancer; intron; polyadenylation signal; Kozak consensus sequence; internal ribosome entry site (IRES); splice acceptor; 2A sequence and/or replication origin.
실시예 29, 프로모터 한정Example 29, Promoter Only
실시예 24 내지 실시예 28 중 어느 하나에 있어서, 상기 발현 벡터는 프로모터를 포함하고, 상기 프로모터는 SV40 초기 프로모터, mouse mammary tumor virus long terminal repeat(LTR) 프로모터, adenovirus major late 프로모터 (Ad MLP), herpes simplex virus (HSV) 프로모터, CMV immediate early promoter region (CMVIE)와 같은 cytomegalovirus (CMV) 프로모터, rous sarcoma virus (RSV) 프로모터, human U6 small nuclear 프로모터 (U6) (Miyagishi et al., Nature Biotechnology 20, 497 - 500 (2002)), enhanced U6 프로모터 (e.g., Xia et al., Nucleic Acids Res. 2003 Sep 1;31(17)), human H1 프로모터 (H1), 및 7SK에서 선택된 하나 이상인 발현 벡터.An expression vector according to any one of embodiments 24 to 28, wherein the expression vector comprises a promoter, wherein the promoter is at least one selected from the group consisting of the SV40 early promoter, the mouse mammary tumor virus long terminal repeat (LTR) promoter, the adenovirus major late promoter (Ad MLP), the herpes simplex virus (HSV) promoter, the cytomegalovirus (CMV) promoter such as the CMV immediate early promoter region (CMVIE), the rous sarcoma virus (RSV) promoter, the human U6 small nuclear promoter (U6) (Miyagishi et al., Nature Biotechnology 20, 497-500 (2002)), the enhanced U6 promoter (e.g., Xia et al., Nucleic Acids Res. 2003 Sep 1;31(17)), the human H1 promoter (H1), and 7SK.
실시예 30, 복제원점 한정Example 30, replication origin limitation
실시예 24 내지 실시예 29 중 어느 하나에 있어서, 상기 발현 벡터는 복제원점을 포함하고, 상기 복제원점은 f1 복제원점, SV40 복제원점, pMB1 복제원점, 아데노 복제원점, AAV 복제원점, 및 BBV 복제원점에서 선택된 하나 이상인 발현 벡터.An expression vector according to any one of Examples 24 to 29, wherein the expression vector comprises an origin of replication, and the origin of replication is at least one selected from an f1 origin of replication, an SV40 origin of replication, a pMB1 origin of replication, an adeno origin of replication, an AAV origin of replication, and a BBV origin of replication.
실시예 31, 비/바이러스 벡터Example 31, non/viral vector
실시예 24 내지 실시예 30 중 어느 하나에 있어서, 상기 발현 벡터는 비바이러스 벡터, 또는 바이러스 벡터인 것을 특징으로 하는 발현 벡터.An expression vector according to any one of Examples 24 to 30, characterized in that the expression vector is a non-viral vector or a viral vector.
실시예 32, 바이러스 종류 한정Example 32, virus type limitation
실시예 31에 있어서, 레트로바이러스, 렌티바이러스, 아데노바이러스, 아데노-연관 바이러스, 백시니아바이러스, 폭스바이러스 및 단순포진 바이러스 중 선택된 것인 발현 벡터.In Example 31, an expression vector selected from retrovirus, lentivirus, adenovirus, adeno-associated virus, vaccinia virus, poxvirus and herpes simplex virus.
실시예 33, 비바이러스 벡터 종류 한정Example 33, Nonviral vector type limitation
실시예 31에 있어서, 플라스미드, 파지, 네이키드 DNA, DNA 복합체, mRNA, 및 PCR 앰플리콘(amplicon) 중 선택된 것인 발현 벡터.In Example 31, an expression vector selected from a plasmid, a phage, naked DNA, a DNA complex, mRNA, and a PCR amplicon.
실시예 34, 벡터의 용도Example 34, Use of Vectors
실시예 24 내지 실시예 33 중 어느 하나에 있어서, 상기 벡터는 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA 중 선택된 하나 이상을 발현시키기 위한 것임.In any one of Examples 24 to 33, the vector is for expressing at least one selected from the Cas12a protein and the programmable guide RNA.
신규 CRISPR/Cas12a 조성물Novel CRISPR/Cas12a compositions
실시예 35, 신규 CRISPR/Cas12a 조성물Example 35, novel CRISPR/Cas12a composition
다음을 포함하는 신규 CRISPR/Cas12a 조성물:Novel CRISPR/Cas12a compositions comprising:
실시예 1 내지 실시예 5 중 어느 하나의 Cas12a 단백질, 또는 상기 Cas12a 단백질을 암호화하는 핵산; 및The Cas12a protein of any one of Examples 1 to 5, or a nucleic acid encoding said Cas12a protein; and
실시예 6 내지 실시예 14 중 어느 하나의 프로그램 가능한 가이드 RNA, 또는 상기 가이드 RNA를 암호화하는 핵산,A programmable guide RNA of any one of Examples 6 to 14, or a nucleic acid encoding said guide RNA;
여기서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA는 상호작용하여 CRISPR/Cas12a 복합체를 이룰 수 있고,Here, the Cas12a protein and the programmable guide RNA can interact to form a CRISPR/Cas12a complex,
상기 CRISPR/Cas12a 복합체는 부수적 절단 기능 (collateral cleavage function)을 가지며,The above CRISPR/Cas12a complex has a collateral cleavage function,
상기 CRISPR/Cas12a 복합체가 상기 프로그램 가능한 가이드 RNA의 가이드 도메인이 표적하는 표적 핵산과 결합하는 경우, 부수적 절단 기능이 활성화됨.When the CRISPR/Cas12a complex binds to a target nucleic acid targeted by the guide domain of the programmable guide RNA, the secondary cleavage function is activated.
실시예 36, Cas12a 단백질 및 직접 반복부 매칭Example 36, Cas12a protein and direct repeat matching
실시예 35에 있어서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA의 직접 반복부는 다음 중 선택된 조합임:In Example 35, the direct repeat portion of the Cas12a protein and the programmable guide RNA is a combination selected from the following:
서열번호 1의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 11의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 1 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 11;
서열번호 2의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 12의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 2 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 12;
서열번호 3의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 13의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 3 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 13;
서열번호 4의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 14의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 4 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 14;
서열번호 5의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 15의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 5 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 15;
서열번호 6의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 16의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 6 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 16;
서열번호 7의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 17의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 7 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 17;
서열번호 8의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 18의 핵산 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 8 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 18;
서열번호 9의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 19의 핵산 서열을 가지는 직접 반복부; 및A Cas12a protein having an amino acid sequence of SEQ ID NO: 9 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 19; and
서열번호 10의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 20의 핵산 서열을 가지는 직접 반복부.A Cas12a protein having an amino acid sequence of SEQ ID NO: 10 and a direct repeat portion having a nucleic acid sequence of SEQ ID NO: 20.
실시예 37, 직접 반복부와 유사한 서열Example 37, sequence similar to direct repeat
실시예 35에 있어서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA의 직접 반복부는 다음 중 선택된 조합임:In Example 35, the direct repeat portion of the Cas12a protein and the programmable guide RNA is a combination selected from the following:
서열번호 1의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 11의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 1 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 11;
서열번호 2의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 12의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 2 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 12;
서열번호 3의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 13의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 3 and a direct repeat portion having a sequence similar to a nucleic acid sequence of SEQ ID NO: 13;
서열번호 4의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 14의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 4 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 14;
서열번호 5의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 15의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 5 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 15;
서열번호 6의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 16의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 6 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 16;
서열번호 7의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 17의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 7 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 17;
서열번호 8의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 18의 핵산 서열과 유사한 서열을 가지는 직접 반복부;A Cas12a protein having an amino acid sequence of SEQ ID NO: 8 and a direct repeat portion having a sequence similar to the nucleic acid sequence of SEQ ID NO: 18;
서열번호 9의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 19의 핵산 서열과 유사한 서열을 가지는 직접 반복부; 및A Cas12a protein having an amino acid sequence of SEQ ID NO: 9 and a direct repeat portion having a sequence similar to a nucleic acid sequence of SEQ ID NO: 19; and
서열번호 10의 아미노산 서열을 가지는 Cas12a 단백질 및 서열번호 20의 핵산 서열과 유사한 서열을 가지는 직접 반복부,A Cas12a protein having an amino acid sequence of SEQ ID NO: 10 and a direct repeat portion having a sequence similar to a nucleic acid sequence of SEQ ID NO: 20;
여기서, 상기 서열번호 11 내지 서열번호 20, 및 서열번호 110의 핵산 서열과 유사한 서열이라 함은, 상기 핵산 서열과 약 70% 이상, 약 71% 이상, 약 72% 이상, 약 73% 이상, 약 74% 이상, 약 75% 이상, 약 76% 이상, 약 77% 이상, 약 78% 이상, 약 79% 이상, 약 80% 이상, 약 81% 이상, 약 82% 이상, 약 83% 이상, 약 84% 이상, 약 85% 이상, 약 86% 이상, 약 87% 이상, 약 88% 이상, 약 89% 이상, 약 90% 이상, 약 91% 이상, 약 92% 이상, 약 93% 이상, 약 94% 이상, 약 95% 이상, 약 96% 이상, 약 97% 이상, 약 98% 이상, 약 99% 이상 일치하거나(identical), 동일하거나(same), 매칭되거나(matched), 및/또는 동등한(equivalent) 핵산 서열을 의미하며, 여기서, 용어 "약"의 의미는 《용어의 정의》의 "약" 단락에서 정의된 것과 같다.Here, the sequence similar to the nucleic acid sequence of the above SEQ ID NOs: 11 to 20 and SEQ ID NO: 110 means a sequence similar to the nucleic acid sequence of about 70% or more, about 71% or more, about 72% or more, about 73% or more, about 74% or more, about 75% or more, about 76% or more, about 77% or more, about 78% or more, about 79% or more, about 80% or more, about 81% or more, about 82% or more, about 83% or more, about 84% or more, about 85% or more, about 86% or more, about 87% or more, about 88% or more, about 89% or more, about 90% or more, about 91% or more, about 92% or more, about 93% or more, about 94% or more, about 95% or more, about 96% or more, about 97% or more, about 98% or more, about It means a nucleic acid sequence that is more than 99% identical, same, matched, and/or equivalent, wherein the term "about" has the same meaning as defined in the "About" section of the Definition of Terms.
실시예 38, 복합체 포함Example 38, including complex
실시예 35 내지 실시예 37 중 어느 하나에 있어서, 상기 CRISPR/Cas12a 조성물은 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA를 실시예 21 내지 실시예 23 중 어느 하나의 CRISPR/Cas12a 복합체 형태로 포함함.In any one of Examples 35 to 37, the CRISPR/Cas12a composition comprises the Cas12a protein and the programmable guide RNA in the form of a CRISPR/Cas12a complex of any one of Examples 21 to 23.
실시예 39, 벡터 포함Example 39, including vectors
실시예 35 내지 실시예 38 중 어느 하나에 있어서, 상기 CRISPR/Cas12a 조성물은 상기 Cas12a 단백질을 암호화하는 핵산 및 상기 프로그램 가능한 가이드 RNA를 암호화하는 핵산을 실시예 24 내지 실시예 34 중 어느 하나의 발현벡터 형태로 포함함.In any one of Examples 35 to 38, the CRISPR/Cas12a composition comprises a nucleic acid encoding the Cas12a protein and a nucleic acid encoding the programmable guide RNA in the form of an expression vector of any one of Examples 24 to 34.
비표적 핵산 절단 방법Non-target nucleic acid cleavage method
실시예 40, 비표적 핵산 절단 방법Example 40, Non-target Nucleic Acid Cleavage Method
다음을 포함하는 비표적 핵산 절단 방법:Non-target nucleic acid cleavage methods comprising:
실시예 35 내지 실시예 39 중 어느 하나의 CRISPR/Cas12a 조성물 및 샘플을 섞거나 (mix), 반응시키거나 (react), 혼합하거나 (blend or admix), 상기 CRISPR/Cas12a 조성물을 상기 샘플에 첨가하거나 (add), 및/또는 상기 샘플을 상기 CRISPR/Cas12a 조성물에 첨가하는 과정;A process of mixing, reacting, blending or admixing the CRISPR/Cas12a composition and the sample of any one of Examples 35 to 39, adding the CRISPR/Cas12a composition to the sample, and/or adding the sample to the CRISPR/Cas12a composition;
여기서, 상기 샘플은 표적 핵산 및 상기 비표적 핵산을 포함하고,wherein the sample comprises a target nucleic acid and a non-target nucleic acid,
상기 CRISPR/Cas12a 조성물의 상기 프로그램 가능한 가이드 RNA의 가이드 도메인은 상기 표적 핵산과 혼성화되거나 및/또는 상보적으로 결합할 수 있고,The guide domain of the programmable guide RNA of the CRISPR/Cas12a composition can hybridize and/or complementarily bind to the target nucleic acid,
상기 CRISPR/Cas12a 조성물의 상기 프로그램 가능한 가이드 RNA의 가이드 도메인은 가이드 도메인은 상기 비표적 핵산과는 혼성화될 수 없거나 및/또는 상보적으로 결합할 수 없음.The guide domain of the programmable guide RNA of the CRISPR/Cas12a composition is such that the guide domain cannot hybridize with and/or cannot complementarily bind to the non-target nucleic acid.
표적 핵산 검출용 조성물Composition for detecting target nucleic acid
실시예 41, 표적 핵산 검출용 조성물Example 41, Composition for detecting target nucleic acid
다음을 포함하는 표적 핵산 검출용 조성물:Composition for detecting target nucleic acid comprising:
실시예 35 내지 실시예 39 중 어느 하나의 CRISPR/Cas12a 조성물; 및A CRISPR/Cas12a composition of any one of Examples 35 to 39; and
실시예 15 내지 실시예 20 중 어느 하나의, 프로브 핵산을 포함하는 검출제.A detection agent comprising a probe nucleic acid according to any one of Examples 15 to 20.
표적 핵산 검출용 키트Kit for detection of target nucleic acid
실시예 42, 표적 핵산 검출용 키트Example 42, Kit for detection of target nucleic acid
다음을 포함하는 표적 핵산 검출용 키트:Kit for detection of target nucleic acids comprising:
실시예 1 내지 실시예 5 중 어느 하나의 Cas12a 단백질;The Cas12a protein of any one of Examples 1 to 5;
실시예 6 내지 실시예 14 중 어느 하나의 프로그램 가능한 가이드 RNA; 및A programmable guide RNA of any one of Examples 6 to 14; and
실시예 15 내지 실시예 20 중 어느 하나의 검출제.A detector according to any one of Examples 15 to 20.
실시예 43, 하나 이상의 용기 포함Example 43, comprising one or more containers
실시예 42에 있어서, 상기 표적 핵산 검출용 키트는 하나 이상의 용기(vessel); 웰(well); 플레이트(plate); 반응기(reactor); 바이알(vial); 시험관(test-tube); 카세트(cassette); 및/또는 미디어(media)를 포함함.In Example 42, the kit for detecting the target nucleic acid comprises one or more vessels; wells; plates; reactors; vials; test tubes; cassettes; and/or media.
실시예 44, 용기 내 포함 관계 한정Example 44, Limited inclusion relationship within the container
실시예 43에 있어서, 상기 표적 핵산 검출용 키트는 다음 특징을 가짐:In Example 43, the kit for detecting target nucleic acid has the following features:
상기 표적 핵산 검출용 키트는 제1 컨테이너 (container), 제2 컨테이너, 및 제3 컨테이너를 포함하고,The above target nucleic acid detection kit comprises a first container, a second container, and a third container,
상기 Cas12a 단백질은 상기 제1 컨테이너에 포함되어 있고,The above Cas12a protein is contained in the first container,
상기 프로그램 가능한 가이드 RNA는 상기 제2 컨테이너에 포함되어 있으며,The above programmable guide RNA is contained in the second container,
상기 검출제는 상기 제3 컨테이너에 포함되어 있음;The above detection agent is contained in the third container;
상기 표적 핵산 검출용 키트는 제4 컨테이너 및 제5 컨테이너를 포함하고,The above target nucleic acid detection kit comprises a fourth container and a fifth container,
상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA는 상기 제4 컨테이너에 포함되어 있고,The above Cas12a protein and the above programmable guide RNA are contained in the fourth container,
상기 검출제는 상기 제5 컨테이너에 포함되어 있음;The above detection agent is contained in the fifth container;
상기 표적 핵산 검출용 키트는 제6 컨테이너 및 제7 컨테이너에 포함되어 있으며,The above target nucleic acid detection kit is contained in the 6th container and the 7th container,
상기 Cas12a 단백질은 상기 제6 컨테이너에 포함되어 있고,The above Cas12a protein is contained in the sixth container,
상기 프로그램 가능한 가이드 RNA 및 상기 검출제는 제7 컨테이너에 포함되어 있음;The above programmable guide RNA and the above detection agent are contained in the seventh container;
상기 표적 핵산 검출용 키트는 제8 컨테이너 및 제9 컨테이너에 포함되어 있으며,The above target nucleic acid detection kit is contained in the 8th container and the 9th container,
상기 Cas12a 단백질 및 상기 검출제는 제8 컨테이너에 포함되어 있고,The above Cas12a protein and the above detection agent are contained in the 8th container,
상기 프로그램 가능한 가이드 RNA는 상기 제9 컨테이너에 포함되어 있음; 또는wherein said programmable guide RNA is contained in said ninth container; or
상기 표적 핵산 검출용 키트는 제10 컨테이너를 포함하고,The above target nucleic acid detection kit comprises a 10th container,
상기 Cas12a 단백질, 상기 가이드 RNA, 및 상기 검출제는 제10 컨테이너에 포함되어 있음,The Cas12a protein, the guide RNA, and the detection agent are contained in the 10th container,
여기서, 상기 각각의 컨테이너는 용기(vessel); 웰(well); 플레이트(plate); 반응기(reactor); 바이알(vial); 시험관(test-tube); 카세트(cassette); 및 미디어(media) 중 선택된 것으로 대체될 수 있음.Here, each of the above containers can be replaced with a selected one from among a vessel; a well; a plate; a reactor; a vial; a test-tube; a cassette; and media.
실시예 45, Cas12a 및 가이드 RNA가 같은 컨테이너에 포함된 경우Example 45, where Cas12a and guide RNA are contained in the same container
실시예 44에 있어서, 상기 Cas12a 및 상기 프로그램 가능한 가이드 RNA가 동일한 컨테이너에 포함된 경우, 상기 Cas12a 및 상기 프로그램 가능한 가이드 RNA가 결합하여 단백질-RNA 복합체를 형성하고 있을 수 있음,In Example 44, when the Cas12a and the programmable guide RNA are contained in the same container, the Cas12a and the programmable guide RNA may be combined to form a protein-RNA complex.
여기서, 상기 단백질-RNA 복합체는 신규 CRISPR/Cas12a 복합체, 또는 리보뉴클레오프로틴 (Ribonucleoprotein; RNP)로도 지칭될 수 있음.Here, the protein-RNA complex may also be referred to as a novel CRISPR/Cas12a complex, or ribonucleoprotein (RNP).
실시예 46, Cas12a 단백질 및 검출제가 상이한 컨테이너에 존재함Example 46, Cas12a protein and detection agent are present in different containers
실시예 44 내지 실시예 45 중 어느 하나에 있어서, 상기 Cas12a 단백질 및 상기 검출제는 서로 상이한 컨테이너에 포함되어 있는 것을 특징으로 함.In any one of Examples 44 to 45, the Cas12a protein and the detection agent are contained in different containers.
표적 핵산 검출 방법Target nucleic acid detection method
실시예 47, 표적 핵산 검출 방법Example 47, Method for detecting target nucleic acid
다음을 포함하는, 샘플 내에 표적 서열을 가지는 표적 핵산이 존재하는 지 여부를 검출하는 방법:A method for detecting whether a target nucleic acid having a target sequence is present in a sample, comprising:
상기 샘플, 실시예 35 내지 실시예 39 중 어느 하나의 CRISPR/Cas12a 조성물, 및 실시예 15 내지 실시예 20 중 어느 하나의 검출제를 혼합하는 과정,A process of mixing the above sample, the CRISPR/Cas12a composition of any one of Examples 35 to 39, and the detection agent of any one of Examples 15 to 20,
여기서, 상기 CRISPR/Cas12a 조성물의 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA는 CRISPR/Cas12a 복합체를 형성할 수 있고,Here, the Cas12a protein of the CRISPR/Cas12a composition and the programmable guide RNA can form a CRISPR/Cas12a complex,
상기 CRISPR/Cas12a 조성물의 프로그램 가능한 가이드 RNA의 가이드 도메인은 상기 표적 핵산을 표적하며,The guide domain of the programmable guide RNA of the above CRISPR/Cas12a composition targets the target nucleic acid,
이에 따라, 상기 샘플 내 상기 표적 서열의 표적 핵산이 존재하는 경우, 상기 CRISPR/Cas12a 복합체의 부수적 절단 활성(collateral cleavage activity)이 활성화되고,Accordingly, when the target nucleic acid of the target sequence is present in the sample, the collateral cleavage activity of the CRISPR/Cas12a complex is activated,
상기 프로브 핵산은 절단되는 경우, 검출가능한 신호를 생성함.The above probe nucleic acid, when cleaved, produces a detectable signal.
실시예 48, 혼합 양상Example 48, mixed aspect
실시예 47에 있어서, 상기 혼합하는 과정은 다음 중 선택됨:In Example 47, the mixing process is selected from the following:
상기 샘플, 상기 CRISPR/Cas12a 조성물, 및 상기 검출제를 동시에 혼합함;Simultaneously mixing the above sample, the CRISPR/Cas12a composition, and the detection agent;
상기 샘플 및 상기 CRISPR/Cas12a 조성물을 혼합하고, 그 후 상기 검출제를 혼합함;Mixing the above sample and the CRISPR/Cas12a composition, and then mixing the above detection agent;
상기 샘플 및 상기 검출제를 혼합하고, 그 후 상기 CRISPR/Cas12a 조성물을 혼합함;Mixing the above sample and the above detector, and then mixing the CRISPR/Cas12a composition;
상기 CRISPR/Cas12a 조성물 및 상기 검출제를 혼합하고, 그 후 상기 샘플을 혼합함;Mixing the CRISPR/Cas12a composition and the detection agent, and then mixing the sample;
상기 샘플과 상기 CRISPR/Cas12a 조성물의 혼합물, 및 상기 검출제를 혼합함;Mixing the above sample and the CRISPR/Cas12a composition, and the detection agent;
상기 샘플과 상기 검출제의 혼합물, 및 상기 CRISPR/Cas12a 조성물을 혼합함; 및Mixing the mixture of the above sample and the above detector, and the CRISPR/Cas12a composition; and
상기 CRISPR/Cas12a 조성물과 상기 검출제의 혼합물, 및 상기 샘플을 혼합함.Mixing the mixture of the CRISPR/Cas12a composition and the detection agent, and the sample.
실시예 49, 검출용 조성물Example 49, composition for detection
실시예 48에 있어서, 상기 CRISPR/Cas12a 조성물과 상기 검출제의 혼합물은 실시예 41의 표적 핵산 검출용 조성물임.In Example 48, the mixture of the CRISPR/Cas12a composition and the detection agent is the composition for detecting target nucleic acid of Example 41.
실시예 50, 검출가능한 신호 분석Example 50, Detectable Signal Analysis
실시예 47 내지 실시예 49 중 어느 하나에 있어서, 상기 방법은 다음 과정을 추가적으로 포함함:In any one of Examples 47 to 49, the method further comprises the following steps:
상기 검출 가능한 신호를 수득하거나(obtain), 측정하거나(measure), 및/또는 계수하는(count) 과정,A process of obtaining, measuring, and/or counting the above detectable signal,
여기서, 상기 과정의 수행 결과, 다음 중 선택된 적어도 하나의 지표를 결정하거나(determine), 평가하거나(evaluate), 계산하거나(calculate), 예측하거나(predict/forecast), 및/또는 도출할(derive) 수 있음:Here, as a result of performing the above process, at least one indicator selected from the following can be determined, evaluated, calculated, predicted/forecast, and/or derived:
상기 샘플 내 미리 결정된 표적 서열의 존재 여부; 상기 샘플 내 미리 결정된 표적 서열의 양(amount); 상기 샘플 내 미리 결정된 표적 서열의 농도(concentration); 상기 샘플 내 미리 결정된 표적 서열의 개수(count); 및 상기 샘플 내 미리 결정된 표적 서열의 발현량(expression level),The presence or absence of a predetermined target sequence in the sample; the amount of the predetermined target sequence in the sample; the concentration of the predetermined target sequence in the sample; the count of the predetermined target sequence in the sample; and the expression level of the predetermined target sequence in the sample.
여기서, 상기 지표들은 각각의 절대값 및 상대값을 모두 포함함.Here, the above indicators include both absolute and relative values.
실시예 51, 키트 사용Example 51, Use of the Kit
실시예 47 내지 실시예 50 중 어느 하나에 있어서, 상기 혼합하는 과정은 하나 이상의 키트에서 이뤄짐.In any one of Examples 47 to 50, the mixing process is performed in one or more kits.
실시예 52, 키트 한정Example 52, Kit Limited
실시예 51에 있어서, 상기 키트는 다음 중 선택된 적어도 하나임:In Example 51, the kit comprises at least one selected from the following:
용기(vessel); 웰(well); 플레이트(plate); 반응기(reactor); 바이알(vial); 시험관(test-tube); 카세트(cassette); 미디어(media); 및 상기 예시의 적절한 조합.A vessel; a well; a plate; a reactor; a vial; a test-tube; a cassette; media; and any suitable combination of the above examples.
CRISPR/Cas12a 시스템의 용도Uses of the CRISPR/Cas12a System
실시예 53, 표적 핵산 검출 용도Example 53, for use in detecting target nucleic acid
실시예 1 내지 실시예 5 중 어느 하나의 Cas12a 단백질, 실시예 6 내지 실시예 14 중 어느 하나의 프로그램 가능한 가이드 RNA, 및/또는 실시예 35 내지 실시예 39 중 어느 하나의 CRISPR/Cas12a 조성물의 실시예 47 내지 실시예 52 중 어느 하나의 표적 핵산 검출 용도.Use of the Cas12a protein of any one of Examples 1 to 5, the programmable guide RNA of any one of Examples 6 to 14, and/or the CRISPR/Cas12a composition of any one of Examples 35 to 39 for detecting a target nucleic acid of any one of Examples 47 to 52.
실시예 54, 비표적 핵산 절단 용도Example 54, Non-target nucleic acid cleavage use
실시예 1 내지 실시예 5 중 어느 하나의 Cas12a 단백질, 실시예 6 내지 실시예 14 중 어느 하나의 프로그램 가능한 가이드 RNA, 및/또는 실시예 35 내지 실시예 39 중 어느 하나의 CRISPR/Cas12a 조성물의 실시예 40의 비표적 핵산 절단 용도.Use of the Cas12a protein of any one of Examples 1 to 5, the programmable guide RNA of any one of Examples 6 to 14, and/or the CRISPR/Cas12a composition of any one of Examples 35 to 39 for non-target nucleic acid cleavage of Example 40.
실험예Experimental example
이하, 실험예 및 실시예를 통해 본 명세서가 제공하는 발명에 대해 더욱 상세히 설명한다. 이들 실시예는 오로지 본 명세서에 의해 개시되는 내용을 예시하기 위한 것으로, 본 명세서에 의해 개시되는 내용의 범위가 이들 실시예에 의해 제한되는 것으로 해석되지 않는 것은 당업계에서 통상의 지식을 가진 자에게 있어서 자명할 것이다.Hereinafter, the invention provided by this specification will be described in more detail through experimental examples and examples. It will be apparent to those skilled in the art that these examples are only intended to illustrate the content disclosed by this specification, and the scope of the content disclosed by this specification is not to be construed as being limited by these examples.
실험예 1. 실험 방법 및 재료Experimental Example 1. Experimental Method and Materials
실험예 1.1. 공지된 데이터베이스로부터 CRISPR/Cas12a 시스템 발굴Experimental Example 1.1. Discovery of CRISPR/Cas12a System from Known Databases
NCBI (National Center for Biotechnology Information)의 데이터베이스에 공개된 초식동물 (낙타, 소, 양) 반추위의 메타지놈 (metagenome) 데이터를 사용하였다.We used metagenome data from the rumen of herbivores (camels, cattle, and sheep) published in the NCBI (National Center for Biotechnology Information) database.
상기 NGS데이터를 가지고, 다음과 같은 방법으로 CRISPR/Cas12a 시스템을 특정하였다:Using the above NGS data, the CRISPR/Cas12a system was specified in the following way:
(1) MEGAHIT v.1.2.9(NGS assembly software)로 시퀀스 데이터를 어셈블리하여 미생물의 게놈 정보를 도출하였다. (Li D, Liu CM, Luo R, Sadakane K, Lam TW. MEGAHIT: an ultra-fast single-node solution for large and complex metagenomics assembly via succinct de Bruijn graph. Bioinformatics. 2015 May 15;31(10):1674-6. doi: 10.1093/bioinformatics/btv033. Epub 2015 Jan 20. PMID: 25609793).(1) The sequence data were assembled with MEGAHIT v.1.2.9 (NGS assembly software) to derive the genome information of microorganisms. (Li D, Liu CM, Luo R, Sadakane K, Lam TW. MEGAHIT: an ultra-fast single-node solution for large and complex metagenomics assembly via succinct de Bruijn graph. Bioinformatics. 2015 May 15;31(10):1674-6. doi: 10.1093/bioinformatics/btv033. Epub 2015 Jan 20. PMID: 25609793).
(2) 공지된 Cas12a 서열 (예를 들어, Lachnospiraceae bacterium 유래 Cas12a) 정보를 참고하고, (BLAST) 툴을 사용하여 상동성(homology) 분석을 통해 상기 미생물의 게놈 정보에 포함된 Cas12a 단백질 후보군을 특정하였다.(2) With reference to the known Cas12a sequence information (e.g., Cas12a derived from Lachnospiraceae bacterium), a homology analysis using the (BLAST) tool was performed to identify a group of Cas12a protein candidates included in the genome information of the microorganism.
(3) (2)와 동일한 방법으로, 각 Cas12a 단백질 후보군에 대한 가이드 RNA 후보군을 특정하였다.(3) In the same manner as (2), guide RNA candidates for each Cas12a protein candidate were specified.
이하, 상기 방법으로 도출된 CRISPR/Cas12a 시스템의 서열정보를 이용하여 실험을 진행하였다.Below, an experiment was conducted using the sequence information of the CRISPR/Cas12a system derived by the above method.
실험예 1.2. 신규 Cas12a 단백질 발현 벡터 제조Experimental Example 1.2. Production of a novel Cas12a protein expression vector
실험예 1.1에서 발굴한 신규 Cas12a 단백질의 아미노산 서열에 대해, 대장균 (E. Coli) 코돈 최적화한 핵산 서열을 특정하고, 이를 pET28 벡터에 클로닝하여 신규 Cas12a 단백질 발현 벡터를 제조하였다. 여기서, 상기 벡터는 상기 신규 Cas12a 단백질의 C말단에 6-His-tag 및 SV40 유래 NLS (nuclear localization signal)를 포함하고, N말단에 SV40 유래 NLS를 포함하는 융합 단백질을 발현할 수 있는 것이다.In Experimental Example 1.1, an E. coli codon-optimized nucleic acid sequence was specified for the amino acid sequence of the novel Cas12a protein discovered, and this was cloned into a pET28 vector to produce a novel Cas12a protein expression vector. Here, the vector can express a fusion protein including a 6-His-tag and an SV40-derived NLS (nuclear localization signal) at the C-terminus of the novel Cas12a protein, and an SV40-derived NLS at the N-terminus.
실험예 1.3. 신규 Cas12a 단백질 검증Experimental Example 1.3. Verification of a Novel Cas12a Protein
실험예 1.2에 따라 제조한 발현 벡터를 상이한 대장균 균주(NiCo21(DE3), T7 Express lysY/Iq)에 형질전환하여 그 발현을 시험하였다. 상기 발현 벡터를 형질전환시킨 대장균 콜로니는 37℃에서 50 mg/ml의 암피실린을 함유하는 Luria-Bertani broth에서 밤새 배양했다. 상기 대장균 콜로니를 위와 동일한 배지 200 ml에 1:200으로 희석시켰고, OD600이 0.70 내지 0.75가 될 때까지 37℃에서 배양시켰다. 상기 배양물을 실온에서 1시간 동안 상온에서 인큐베이션했고, 23℃에서 220 rpm으로 진탕하면서 0.5 mM isopropyl-b-D-1-thiogalactopyranoside와 함께 16시간 내지 18시간 배양하여 Cas12a 단백질의 발현을 유도하였다.The expression vector prepared according to Experimental Example 1.2 was transformed into different E. coli strains (NiCo21 (DE3), T7 Express lysY / Iq) to test its expression. The E. coli colonies transformed with the expression vector were cultured overnight in Luria-Bertani broth containing 50 mg / ml of ampicillin at 37 ° C. The E. coli colonies were diluted 1:200 in 200 ml of the same medium as above and cultured at 37 ° C until the OD600 reached 0.70 to 0.75. The cultures were incubated at room temperature for 1 hour and then cultured with 0.5 mM isopropyl-b-D-1-thiogalactopyranoside for 16 to 18 hours at 23 ° C with shaking at 220 rpm to induce the expression of the Cas12a protein.
발현된 Cas12a 단백질은 Restriction Digest Analysis로 검증되었다. 요약하면, 1ug의 플라스미드 샘플(NiCo21(DE3), T7 Express lysY/Iq Competent E.coli)을 1uL의 제한 효소, 2uL의 소화 완충액 및 뉴클레아제가 없는 물과 최종 부피 20ul로 혼합하고 배양하였다. 30분 동안 37℃ 1X TAE(Tris acetate EDTA) 완충액을 사용하여 1% 아가로스 겔에서 분리된 반응 생성물의 Ethidium Bromide 염색으로 시각화하여 발현된 Cas12a 단백질을 검증하였다 (도 1).The expressed Cas12a protein was verified by Restriction Digest Analysis. Briefly, 1 ug of plasmid sample (NiCo21(DE3), T7 Express lysY/Iq Competent E. coli) was mixed with 1 uL of restriction enzyme, 2 uL of digestion buffer, and nuclease-free water in a final volume of 20 μl and incubated. The expressed Cas12a protein was verified by visualizing the reaction products separated on a 1% agarose gel using 1X TAE (Tris acetate EDTA) buffer at 37 °C for 30 min by ethidium bromide staining (Fig. 1).
실험예 1.4. 신규 Cas12a 단백질 발현 및 정제Experimental Example 1.4. Expression and Purification of Novel Cas12a Protein
실험예 1.2에 의해 제조되고, 실험예 1.3에 의해 검증된 신규 Cas12a 오쏘로그(ortholog)의 발현을 상이한 대장균 균주(NiCo21(DE3), T7 Express lysY/Iq Competent E.coli)에서 시험하였다. 구체적으로, 상기 대장균 세포를 제조자의 지시에 따라 실험예 1.2에서 제조된 플라스미드 벡터로 형질전환시켰다. 단일 콜로니는 37C에서 100ug ml-1의 암피실린을 함유하는 Luria-Bertani 액체배지에서 하룻밤 성장시켰다. 세포를 250ml의 동일한 배지에 1:200으로 희석하고 OD600이 0.70 내지 0.75가 될 때까지 37C에서 성장시켰다. 배양물을 실온에서 1시간 동안 인큐베이션하고, 23℃에서 진탕(220rpm)하면서 16-18시간의 인큐베이션에 의해 0.5mM 이소프로필-b-D-1-티오갈락토피라노시드로 단백질 발현을 유도하였다. 세포 펠릿을 10% SDS-PAGE를 사용하여 단백질 발현에 대해 분석하였다 (도 2). 단백질 정제는 Ni-NTA Fast start 키트(Qiagen; 30600)로 수행한 후 HiTrap HP SP(GE Healthcare; 17115101)에서 후속 정제하였다. 정제된 Cas12a 단백질은 -80°C에서 20mM 아세트산나트륨(pH 6.0), 500mM NaCl, 0.1mM EDTA, 0.1mM TCEP 및 50%(v/v) 글리세롤에 보관되었다.Expression of the novel Cas12a ortholog prepared by Example 1.2 and verified by Example 1.3 was tested in different E. coli strains (NiCo21(DE3), T7 Express lysY/Iq Competent E. coli). Specifically, the E. coli cells were transformed with the plasmid vector prepared in Example 1.2 according to the manufacturer's instructions. A single colony was grown overnight in Luria-Bertani broth containing 100 ug ml-1 ampicillin at 37C. The cells were diluted 1:200 in 250 ml of the same medium and grown at 37C until the OD600 reached 0.70 to 0.75. Cultures were incubated at room temperature for 1 h and protein expression was induced with 0.5 mM isopropyl-b-D-1-thiogalactopyranoside by incubation for 16–18 h at 23 °C with shaking (220 rpm). Cell pellets were analyzed for protein expression using 10% SDS-PAGE (Fig. 2). Protein purification was performed with the Ni-NTA Fast start kit (Qiagen; 30600) followed by subsequent purification on a HiTrap HP SP (GE Healthcare; 17115101). The purified Cas12a protein was stored in 20 mM sodium acetate (pH 6.0), 500 mM NaCl, 0.1 mM EDTA, 0.1 mM TCEP and 50% (v/v) glycerol at -80 °C.
실험예 1.5. 프로그램 가능한 가이드 RNA 제조Experimental Example 1.5. Production of programmable guide RNA
sgRNA의 합성은 MEGAscript쪠 T7 전사 키트 (ThermoFisher Scientific)를 사용하여 시험관 내 전사에 의해 수행되었다. sgRNA 전사를 위한 템플릿은 합성된 단편 (CloneAmp HiFi PCR Premix, Takara)을 PCR 증폭하여 생성되었다. 그런 다음 DNA 템플릿을 DNaseI (ThermoFisher Scientific)로 제거하고 전사된 RNA 산물을 PCR 정제 키트 (MEGAclear쪠 Transcription Clean-Up Kit)로 정리하고 뉴클레아제를 포함하지 않느 물로 용출하였다.sgRNA synthesis was performed by in vitro transcription using the MEGAscript® T7 transcription kit (ThermoFisher Scientific). The template for sgRNA transcription was generated by PCR amplification of the synthesized fragment (CloneAmp HiFi PCR Premix, Takara). The DNA template was then removed with DNaseI (ThermoFisher Scientific), and the transcribed RNA product was purified with a PCR purification kit (MEGAclear® Transcription Clean-Up Kit) and eluted with nuclease-free water.
상기 방법에 사용된 프라이머는 [표 1]에 나타내었다.The primers used in the above method are shown in [Table 1].
LABELLABEL | PRIMER SEQUENCE 5' to 3'PRIMER SEQUENCE 5' to 3' | SEQ ID NOSEQ ID NO |
NSG-01-FWDNSG-01-FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatTAATTTCTACTATTCGTAGATGAAATTAATACGACTCACTATAGGgtttcaaagattaaatTAATTTCTACTATTCGTAGAT | 5252 |
NSG-01-RG1-REVNSG-01-RG1-REV | gagaatctcttgcggctattATCTACGAATAGTAGAAATTAgagaatctcttgcggctattATCTACGAATAGTAGAAATTA | 6262 |
NSG-01-RG2-REVNSG-01-RG2-REV | tgcaggatgacaagatggagATCTACGAATAGTAGAAATTAtgcaggatgacaagatggagATCTACGAATAGTAGAAATTA | 6363 |
NSG-02-FWDNSG-02-FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatTTAATTTCTACTTTCGTAGATGAAATTAATACGACTCACTATAGGgtttcaaagattaaatTTAATTTCTACTTTCGTAGAT | 5353 |
NSG-02-RG1-REVNSG-02-RG1-REV | gagaatctcttgcggctattATCTACGAAAGTAGAAATTAAgagaatctcttgcggctattATCTACGAAAAGTAGAAATTAA | 6464 |
NSG-02-RG2-REVNSG-02-RG2-REV | tgcaggatgacaagatggagATCTACGAAAGTAGAAATTAAtgcaggatgacaagatggagATCTACGAAAAGTAGAAATTAA | 6565 |
NSG-03-FWDNSG-03-FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatCAATTTCTACTTTCAGTAGATGAAATTAATACGACTCACTATAGGgtttcaaagattaaatCAATTTCTACTTTCAGTAGAT | 5454 |
NSG-03-RG1-REVNSG-03-RG1-REV | gagaatctcttgcggctattATCTACTGAAAGTAGAAA gagaatctcttgcggctattATCTACTGAAAGTAGAAA | 6666 |
NSG-03-RG2-REVNSG-03-RG2-REV | tgcaggatgacaagatggagATCTACTGAAAGTAGAAA tgcaggatgacaagatggagATCTACTGAAAGTAGAAA | 6767 |
NSG-04-FWDNSG-04-FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatTTAATTTCTACTTGTGTAGATGAAATTAATACGACTCACTATAGGgtttcaaagattaaatTTAATTTCTACTTGTGTAGAT | 5555 |
NSG-04-RG1-REVNSG-04-RG1-REV | gagaatctcttgcggctattATCTACACAAGTAGAAAT gagaatctcttgcggctattATCTACACAAGTAGAAAT | 6868 |
NSG-04-RG2-REVNSG-04-RG2-REV | tgcaggatgacaagatggagATCTACACAAGTAGAAAT tgcaggatgacaagatggagATCTACACAAGTAGAAAT | 6969 |
NSG-05-FWDNSG-05-FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatTAAATTTCTACTATTGTAGAT GAAATTAATACGACTCACTATAGGgtttcaaagattaaatTAAATTTCTACTATTGTAGAT | 5656 |
NSG-05-RG1-REVNSG-05-RG1-REV | gagaatctcttgcggctattATCTACAATAGTAGAAATTTAgagaatctcttgcggctattATCTACAATAGTAGAAATTTA | 7070 |
NSG-05-RG2-REVNSG-05-RG2-REV | tgcaggatgacaagatggagATCTACAATAGTAGAAATTTAtgcaggatgacaagatggagATCTACAATAGTAGAAATTTA | 7171 |
NSG-06-FWDNSG-06-FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatATAATTTCTACTATTGTAGAT GAAATTAATACGACTCACTATAGGgtttcaaagattaaatATAATTTCTACTATTGTAGAT | 5757 |
NSG-06-RG1-REVNSG-06-RG1-REV | gagaatctcttgcggctattATCTACAATAGTAGAAATTATgagaatctcttgcggctattATCTACAATAGTAGAAAATTAT | 7272 |
NSG-06-RG2-REVNSG-06-RG2-REV | tgcaggatgacaagatggagATCTACAATAGTAGAAATTATtgcaggatgacaagatggagATCTACAATAGTAGAAAATTAT | 7373 |
NSG-07-FWDNSG-07-FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatAAAATTTCTACTATTGTAGATGAAATTAATACGACTCACTATAGGgtttcaaagattaaatAAAATTTCTACTATTGTAGAT | 5858 |
NSG-07-RG1-REVNSG-07-RG1-REV | gagaatctcttgcggctattATCTACAATAGTAGAAATTTTgagaatctcttgcggctattATCTACAATAGTAGAAATTTT | 7474 |
NSG-07-RG2-REVNSG-07-RG2-REV | tgcaggatgacaagatggagATCTACAATAGTAGAAATTTTtgcaggatgacaagatggagATCTACAATAGTAGAAATTTT | 7575 |
NSG-08-FWDNSG-08-FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatAAAATTTCTACTCTTGTAGAT GAAATTAATACGACTCACTATAGGgtttcaaagattaaatAAAATTTCTACTCTTGTAGAT | 5959 |
NSG-08-RG1-REVNSG-08-RG1-REV | gagaatctcttgcggctattATCTACAAGAGTAGAAAT gagaatctcttgcggctattATCTACAAGAGTAGAAAT | 7676 |
NSG-08-RG2-REVNSG-08-RG2-REV | tgcaggatgacaagatggagATCTACAAGAGTAGAAAT tgcaggatgacaagatggagATCTACAAGAGTAGAAAT | 7777 |
NSG-09-FWDNSG-10-FWDNSG-09-FWDNSG-10-FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatATAATTTCTACTGTTGTAGAT GAAATTAATACGACTCACTATAGGgtttcaaagattaaatATAATTTCTACTGTTGTAGAT | 6060 |
NSG-09-RG1-REVNSG-10-RG1-REVNSG-09-RG1-REVNSG-10-RG1-REV | gagaatctcttgcggctattATCTACAACAGTAGAAATTATgagaatctcttgcggctattATCTACAACAGTAGAAAATTAT | 7878 |
NSG-09-RG2-REVNSG-10-RG2-REVNSG-09-RG2-REVNSG-10-RG2-REV | tgcaggatgacaagatggagATCTACAACAGTAGAAATTATtgcaggatgacaagatggagATCTACAACAGTAGAAAATTAT | 7979 |
Lba_FWDLba_FWD | GAAATTAATACGACTCACTATAGGgtttcaaagattaaatTAATTTCTACTAAGTGTAGAT GAAATTAATACGACTCACTATAGGgtttcaaagattaaatTAATTTCTACTAAGTGTAGAT | 104104 |
Lba_RG1_REVLba_RG1_REV | gagaatctcttgcggctattATCTACACTTAGTAGAAATTAgagaatctcttgcggctattATCTACACTTAGTAGAAATTA | 105105 |
Lba_RG2_REVLba_RG2_REV | tgcaggatgacaagatggagATCTACACTTAGTAGAAATTAtgcaggatgacaagatggagATCTACACTTAGTAGAAATTA | 106106 |
상기 가이드 RNA의 농도 및 순도는 NanoDrop으로 측정되었고, RNA 무결성은 1X TAE(Tris acetate EDTA) 완충액으로 2% 아가로스 겔에서 분리된 반응 생성물의 Ethidium Bromide 염색을 통해 가시화되었다 (도 3).The concentration and purity of the above guide RNA were measured by NanoDrop, and RNA integrity was visualized by ethidium bromide staining of the reaction products separated on a 2% agarose gel with 1X TAE (Tris acetate EDTA) buffer (Fig. 3).
실험예 1.6. CRISPR/Cas12a 복합체 제조Experimental Example 1.6. Preparation of CRISPR/Cas12a complex
각각의 신규 CRISPR/Cas12a 복합체는 0.5uM의 Cas12a 단백질 및 1uM의 crRNA를 50mM NaCl, 10mM Tris-HCl, 10mM MgCl2, 100ug/mL BSA (pH=7.9)를 함유하는 NEB r2.1 완충액에서 실온에서 15분 동안 배양하여 각각 개별적으로 제조되었다.Each novel CRISPR/Cas12a complex was individually prepared by incubating 0.5uM Cas12a protein and 1uM crRNA in NEB r2.1 buffer containing 50mM NaCl, 10mM Tris-HCl, 10mM MgCl2, 100ug/mL BSA (pH=7.9) at room temperature for 15 minutes.
실험예 1.7. CRISPR/Cas12a 복합체의 PAM 서열Experimental Example 1.7. PAM sequence of CRISPR/Cas12a complex
대부분의 Cas12a 단백질은 5'-TTTV-3'의 PAM을 인식하는 것으로 알려져 있으며, 실험예 1.1 내지 실험예 1.6에 따라 제조된 CRISPR/Cas12a 시스템 또한, 실험 결과 5'-TTTV-3'의 PAM을 인식하는 것으로 밝혀졌다.Most Cas12a proteins are known to recognize the PAM of 5'-TTTV-3', and the CRISPR/Cas12a system manufactured according to Experimental Examples 1.1 to 1.6 was also found to recognize the PAM of 5'-TTTV-3' as a result of the experiment.
이하의 실험은 상기 신규 Cas12a 단백질들이 5'-TTTV-3' 외 다른 PAM 서열을 인식할 수 있는 지 여부를 판별하기 위해 진행할 수 있는 실험이다.The following experiments can be conducted to determine whether the novel Cas12a proteins can recognize PAM sequences other than 5'-TTTV-3'.
실험예 1.1 내지 실험예 1.6에 의해 제조된 CRISPR/Cas12a 복합체의 PAM 서열을 규명하기 위해, 다음과 같은 실험을 진행한다.To elucidate the PAM sequence of the CRISPR/Cas12a complex manufactured by Experimental Examples 1.1 to 1.6, the following experiments are conducted.
시퀀싱을 위한 충분한 DNA를 생성하기 위해, 절단 시 인식되는 PAM 서열을 보유한 DNA 단편들을 어댑터의 프라이머 및 PAM 서열에 인접한 다른 프라이머를 사용해서 PCR로 증폭시킨다. 생성된 PCR 증폭 Cas12a PAM 라이브러리는 앰플리콘의 어댑터 쪽에 인덱스 서열 및 싱글-리드 딥 시퀀스(single-read deep sequence)를 추가하여 PCR 증폭한다. 적절한 적용범위를 보장하기 위하여, PAM 라이브러리는 초기 무작위 PAM 라이브러리의 다양성보다 더 큰 깊이 (예를 들어, 5배 이상)로 시퀀싱한다 (> 80000 리드). 7nt PAM 서열의 양 측에 있는 12nt 길이의 서열이 완전히 일치되는 경우에만 PAM 서열 식별 데이터로 사용하고, Cas12a-가이드 RNA가 완벽하게 표적 부위를 인식하고, 절단한 경우에 한해 PAM 서열을 분석한다. 상기 PAM 서열 분석 범위는 반응 혼합물의 다른 구성요소에 따른 비-특이적 노이즈의 영향을 줄이기 위해 가장 빈번한 상위 특정 비율 (예를 들어, 10%) 이내의 PAM으로 제한한다.To generate sufficient DNA for sequencing, DNA fragments containing the PAM sequence recognized upon cleavage are amplified by PCR using the adapter primer and another primer adjacent to the PAM sequence. The resulting PCR-amplified Cas12a PAM library is PCR-amplified by adding an index sequence and a single-read deep sequence to the adapter side of the amplicon. To ensure adequate coverage, the PAM library is sequenced to a depth greater than the diversity of the initial random PAM library (e.g., 5x or more) (>80,000 reads). Only when the 12 nt long sequences on both sides of the 7 nt PAM sequence are perfectly matched, they are used as PAM sequence identification data, and the PAM sequence is analyzed only when the Cas12a-guide RNA perfectly recognizes and cleaves the target site. The PAM sequence analysis range is limited to the most frequent upper specific fraction (e.g., 10%) of PAMs to reduce the influence of non-specific noise due to other components of the reaction mixture.
실험예 2. 신규 CRISPR/Cas12a 시스템의 표적-특이적 핵산 절단 기능 확인Experimental Example 2. Confirmation of the target-specific nucleic acid cleavage function of the novel CRISPR/Cas12a system
실험예 1.1 내지 실험예 1.6에 따라 얻어진 각 신규 CRISPR/Cas12a 복합체의 표적-특이적 핵산 절단 기능을 확인하였다. 실험예 사용한 CRISPR/Cas12a 복합체의 서열 정보는 다음 [표 2]에 나타내였다:The target-specific nucleic acid cleavage function of each novel CRISPR/Cas12a complex obtained according to Experimental Examples 1.1 to 1.6 was confirmed. The sequence information of the CRISPR/Cas12a complex used in the Experimental Examples is shown in the following [Table 2]:
LABELLABEL |
Cas12a protein (SEQ ID NO)Cas12a protein (SEQ ID NO) |
Stem-loopStem-loop |
guide RNA Direct repeatguide RNA Direct repeat |
Guide domain of guide RNAGuide domain of guide RNA |
NSG-01NSG-01 | 11 | GUUUCAAAGAUUAAAU (SEQ ID NO: 21)GUUUCAAAGAUUAAAU (SEQ ID NO: 21) |
UAAUUUCUACUAUUCGUAGAU (SEQ ID NO: 11)UAAUUUCUACUAUUCGUAGAU (SEQ ID NO: 11) |
AATAGCCGCAAGAGATTCTC (SEQ ID NO: 107) for RG1 or CTCCATCTTGTCATCCTGCA (SEQ ID NO: 108) for RG2AATAGCCGCAAGAGATTCTC (SEQ ID NO: 107) for RG1 or CTCCATCTTGTCATCCTGCA (SEQ ID NO: 108) for RG2 |
NSG-02NSG-02 | 22 | SEQ ID NO: 21SEQ ID NO: 21 | UUAAUUUCUACUUUCGUAGAU(SEQ ID NO: 12)UUAAUUUCUACUUUCGUAGAU(SEQ ID NO: 12) |
SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2 |
NSG-03NSG-03 | 33 | SEQ ID NO: 21SEQ ID NO: 21 | CAAUUUCUACUUUCAGUAGAU(SEQ ID NO: 13)CAAUUUCUACUUUCAGUAGAU(SEQ ID NO: 13) |
SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2 |
NSG-04NSG-04 | 44 | SEQ ID NO: 21SEQ ID NO: 21 | UUAAUUUCUACUUGUGUAGAU(SEQ ID NO: 14)UUAAUUUCUACUUGUGUAGAU(SEQ ID NO: 14) |
SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2 |
NSG-05NSG-05 | 55 | SEQ ID NO: 21SEQ ID NO: 21 | UAAAUUUCUACUAUUGUAGAU(SEQ ID NO: 15)UAAAUUUCUACUAUUGUAGAU(SEQ ID NO: 15) |
SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2 |
NSG-06NSG-06 | 66 | SEQ ID NO: 21SEQ ID NO: 21 | AUAAUUUCUACUAUUGUAGAU(SEQ ID NO: 16)AUAAUUUCUACUAUUGUAGAU(SEQ ID NO: 16) |
SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2 |
NSG-07NSG-07 | 77 | SEQ ID NO: 21SEQ ID NO: 21 | AAAAUUUCUACUAUUGUAGAU(SEQ ID NO: 17)AAAAUUUCUACUAUUGUAGAU(SEQ ID NO: 17) |
SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2 |
NSG-08NSG-08 | 88 | SEQ ID NO: 21SEQ ID NO: 21 | AAAAUUUCUACUCUUGUAGAU(SEQ ID NO: 18)AAAAUUUCUACUCUUGUAGAU(SEQ ID NO: 18) |
SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2 |
NSG-09NSG-09 | 99 | SEQ ID NO: 21SEQ ID NO: 21 | AUAAUUUCUACUGUUGUAGAU(SEQ ID NO: 19)AUAAUUUCUACUGUUGUAGAU(SEQ ID NO: 19) |
SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2 |
NSG-10NSG-10 | 1010 | SEQ ID NO: 21SEQ ID NO: 21 | AUAAUUUCUACUGUUGUAGAU(SEQ ID NO: 20)AUAAUUUCUACUGUUGUAGAU(SEQ ID NO: 20) |
SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2SEQ ID NO: 107 for RG1 Or SEQ ID NO: 108 for RG2 |
* 여기서, 상기 가이드 RNA는 5'말단에서 3'말단 방향으로 Stem-loop, Direct repeat, 및 Guide domain이 차례로 연결된 형태이다.* Here, the guide RNA is in the form of a Stem-loop, Direct repeat, and Guide domain sequentially connected in the direction from the 5' end to the 3' end.
** 여기서, 상기 Guide sequence는 5'-TTTV-3'의 PAM 서열을 기준으로 특정한 것이다.** Here, the Guide sequence is specific based on the PAM sequence of 5'-TTTV-3'.
구체적으로, 실험예 1.6에 따라 얻어진 신규 CRISPR/Cas12a 복합체에 서열번호 82의 SCN1A 유전자의 DNA 템플릿을 넣고 각 배양조건 하 1시간 동안 반응을 진행시켰다. 각 배양조건 및 실험 결과를 다음 [표 3]에 나타내었다:Specifically, the DNA template of the SCN1A gene with sequence number 82 was added to the novel CRISPR/Cas12a complex obtained according to Experimental Example 1.6, and the reaction was performed for 1 hour under each culture condition. Each culture condition and experimental results are shown in [Table 3] below:
LABELLABEL | pH = 7.9pH = 7.9 | pH = 6.5pH = 6.5 | pH = 4.5pH = 4.5 | ||||||
25 ℃25 ℃ | 37 ℃37℃ | 60 ℃60℃ | 25 ℃25 ℃ | 37 ℃37℃ | 60 ℃60℃ | 25 ℃25 ℃ | 37 ℃37℃ | 60 ℃60℃ | |
NSG-01NSG-01 | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++ | ++++++ | ++ |
NSG-02NSG-02 | ++++++ | ++++++ | ++++ | ++++++ | ++++++ | ++++++ | ++++ | ++++++ | ++++ |
NSG-03NSG-03 | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++ | ++++ | ++ |
NSG-04NSG-04 | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++ | ++++++ | ++++ |
NSG-05NSG-05 | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++ | ++ | ++++ | ++ |
NSG-06NSG-06 | ++++++ | ++++++ | ++ | ++++++ | ++++++ | ++++++ | ++ | ++++ | ++ |
NSG-07NSG-07 | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++ | ++++++ | ++++ |
NSG-08NSG-08 | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++ | ++++++ | -- |
NSG-09NSG-09 | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++ | ++++ | ++ |
NSG-10NSG-10 | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++++ | ++++ | ++++++ | ++ |
* 각 기호의 의미는 다음과 같다: (+++) Excellent cleavage activity; (++) Medium cleavage activity; (+ ) Poor cleavage activity; ( - ) No cleavage activity* The meaning of each symbol is as follows: (+++) Excellent cleavage activity; (++) Medium cleavage activity; (+ ) Poor cleavage activity; ( - ) No cleavage activity
** 각 pH 배양조건은 다음과 같다: pH = 7.9 (NEB buffer 2.1), pH=6.5 (50 mM NaCl, 10mM Tris-HCl, 10 mM MgCl2, 100 ug/mL BSA) 및 pH=4.5 (50 mM NaCl, 10mM sodium acetate, 10 mM MgCl2, 0.1 mM DTT)** Each pH culture condition is as follows: pH = 7.9 (NEB buffer 2.1), pH = 6.5 (50 mM NaCl, 10 mM Tris-HCl, 10 mM MgCl2, 100 ug/mL BSA), and pH = 4.5 (50 mM NaCl, 10 mM sodium acetate, 10 mM MgCl2, 0.1 mM DTT)
각 CRISPR/Cas12a 복합체의 표적-특이적 핵산 절단 기능은 1X TAE(Tris acetate EDTA) 완충액을 사용하여 1% 아가로스 겔에서 분리된 반응 생성물의 Ethidium Bromide 염색으로 가시화되었다 (도 4 내지 도 12).The target-specific nucleic acid cleavage function of each CRISPR/Cas12a complex was visualized by ethidium bromide staining of reaction products separated on 1% agarose gels using 1X Tris acetate EDTA (TAE) buffer (Figs. 4 to 12).
실험 결과, [표 2]의 신규 CRISPR/Cas12a 복합체는 DNA에 대해 표적-특이적 핵산 절단 기능을 가지는 것으로 나타났다.Experimental results showed that the novel CRISPR/Cas12a complex in [Table 2] has a target-specific nucleic acid cleavage function for DNA.
실험예 3. 신규 CRISPR/Cas12a 시스템의 부수적 절단 기능 확인Experimental Example 3. Confirmation of the secondary cutting function of the novel CRISPR/Cas12a system
실험예 3.1. SCN1A 유전자의 dsDNA 템플릿 제조Experimental Example 3.1. Preparation of dsDNA template of SCN1A gene
SCN1A 유전자의 선형 dsDNA는 인간 HEK 세포의 gDNA, AGGTTCTTTCCAGCTTCCAA(서열번호 83)의 포워드 프라이머, 및 TGCCTTTATACGCACAGTCT(서열번호 84)의 리버스 프라이머를 총 부피 20uL의 뉴클레아제가 없는 물에서 사용하여 PCR 증폭 방법으로 합성되었다. 생성된 주형 DNA는 부수적 활성 테스트 분석을 위해 LaboPass(TM) Gel 및 PCR Clean-up Kit(LaboPass, CMA0112)로 정제되었다.Linear dsDNA of the SCN1A gene was synthesized by PCR amplification using gDNA of human HEK cells, the forward primer of AGGTTCTTTCCAGCTTCCAA (SEQ ID NO: 83), and the reverse primer of TGCCTTTATACGCACAGTCT (SEQ ID NO: 84) in nuclease-free water in a total volume of 20 uL. The generated template DNA was purified with LaboPass(TM) Gel and PCR Clean-up Kit (LaboPass, CMA0112) for ancillary activity test analysis.
실험예 3.2. 신규 CRISPR/Cas12a 시스템의 부수적 절단 기능 확인Experimental Example 3.2. Confirmation of the secondary cutting function of the novel CRISPR/Cas12a system
상기 [표 2]의 CRISPR/Cas12a 복합체가 부수적 절단 기능을 가지는 지 실험을 통해 확인하였다. 구체적으로, 우선 [표 2]의 각 CRISPR/Cas12a 복합체를 실험예 1.1 내지 실험예 1.6을 참조하여 각각 총 20uL 제조하였다. 그 후, 상기 제조된 복합체를 30uL의 nuclease free water, 검출제로써 50 nM의 DNase Alert substrate (final concentration; IDT, 11-04-03-04), 및 다양한 함량의 표적 DNA (각각 0.2 ng/uL; 0.5 ng/uL; 1.0 ng/uL 및 2.0 ng/uL)와 혼합하였다. 상기 혼합물을 384-웰(SPL)에 로드하고 형광 플레이트 판독기(TECAN, Infinite 200 Pro M Plex)에서 37°C에서 최대 90분 동안 배양하고 3분마다 형광 측정을 수행하였다 (λex:535nm; λem :570nM, gain: 114).It was experimentally confirmed whether the CRISPR/Cas12a complex of the above [Table 2] has a secondary cleavage function. Specifically, first, each CRISPR/Cas12a complex of [Table 2] was prepared in a total of 20 uL with reference to Experimental Examples 1.1 to 1.6. Thereafter, the prepared complex was mixed with 30 uL of nuclease free water, 50 nM DNase Alert substrate (final concentration; IDT, 11-04-03-04) as a detector, and various contents of target DNA (0.2 ng/uL; 0.5 ng/uL; 1.0 ng/uL, and 2.0 ng/uL, respectively). The above mixture was loaded into 384-well (SPL) and incubated at 37°C for up to 90 min in a fluorescence plate reader (TECAN, Infinite 200 Pro M Plex), and fluorescence measurements were performed every 3 min (λex: 535 nm; λem: 570 nM, gain: 114).
실험 결과를 도 13 내지 도 23에 나타내었다.The experimental results are shown in Figs. 13 to 23.
실험 결과, [표 2]의 CRISPR/Cas12a 복합체는 모두 표적 핵산과 결합하는 경우 부수적 절단 기능이 활성화되는 것을 확인하였다.Experimental results showed that all CRISPR/Cas12a complexes in [Table 2] activated the secondary cleavage function when bound to the target nucleic acid.
본 명세서에서 특정한 신규 CRISPR/Cas12a 시스템은 표적 핵산이 존재할 때 부수적 절단 기능 (collateral-editing function)이 활성화되는 것이 특징이며, 해당 효과를 이용하면 표적 핵산의 존재여부 및 정량적 성질을 측정하는 데 사용될 수 있다. 달리 표현하면, 본 명세서에서 개시하는 신규 CRISPR/Cas12a 시스템은 특정 핵산을 바이오마커로 가지는 질환을 진단하는 데 사용될 수 있다.The novel CRISPR/Cas12a system disclosed herein is characterized by the activation of a collateral-editing function when a target nucleic acid is present, and this effect can be used to measure the presence and quantitative properties of the target nucleic acid. In other words, the novel CRISPR/Cas12a system disclosed herein can be used to diagnose a disease having a specific nucleic acid as a biomarker.
Claims (32)
- 다음을 포함하는 비표적 핵산 절단 방법:Non-target nucleic acid cleavage methods comprising:Cas12a 단백질, 가이드 RNA, 및 샘플을 섞는 과정;Process of mixing Cas12a protein, guide RNA, and sample;여기서, 상기 샘플은 표적 핵산 및 상기 비표적 핵산을 포함하고,wherein the sample comprises a target nucleic acid and a non-target nucleic acid,상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 단백질-RNA 복합체를 이루도록 할 수 있고,The above scaffold can allow the guide RNA to interact with the Cas12a protein to form a protein-RNA complex,상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,상기 가이드 도메인은 상기 비표적 핵산과는 혼성화될 수 없음,The above guide domain cannot hybridize with the non-target nucleic acid;상기 과정의 수행 결과, 상기 Cas12a 단백질 및 상기 가이드 RNA가 결합하여 단백질-RNA 복합체를 형성하고,As a result of performing the above process, the Cas12a protein and the guide RNA combine to form a protein-RNA complex,상기 단백질-RNA 복합체는 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,The above protein-RNA complex binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.상기 단백질-RNA 복합체에 의해 상기 비표적 핵산이 절단됨.The non-target nucleic acid is cleaved by the protein-RNA complex.
- 다음을 포함하는 비표적 핵산 절단 방법:Non-target nucleic acid cleavage methods comprising:리보뉴클레오프로틴 (Ribonucleoprotein), 및 샘플을 섞는 과정;Ribonucleoprotein, and the process of mixing samples;여기서, 상기 샘플은 표적 핵산 및 상기 비표적 핵산을 포함하고,wherein the sample comprises a target nucleic acid and a non-target nucleic acid,상기 리보뉴클레오프로틴은 Cas12a 단백질 및 가이드 RNA를 포함하고,The above ribonucleoprotein comprises Cas12a protein and guide RNA,상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴을 이루도록 할 수 있고,The above scaffold can enable the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein,상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,상기 가이드 도메인은 상기 비표적 핵산과는 혼성화될 수 없음,The above guide domain cannot hybridize with the non-target nucleic acid;상기 리보뉴클레오프로틴은 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,The ribonucleoprotein binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.상기 리보뉴클레오프로틴을 통해 상기 비표적 핵산이 절단됨.The non-target nucleic acid is cleaved by the ribonucleoprotein.
- 제1항 내지 제2항 중 어느 하나에 있어서, 상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열로 구성된, 비표적 핵산 절단 방법.A method for non-target nucleic acid cleavage in any one of claims 1 to 2, wherein the Cas12a protein consists of an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10.
- 제1항 내지 제3항 중 어느 하나에 있어서, 상기 가이드 RNA의 스캐폴드는 서열번호 11 내지 서열번호 20 중에서 선택된 RNA 서열을 포함하는, 비표적 핵산 절단 방법.A method for non-target nucleic acid cleavage in any one of claims 1 to 3, wherein the scaffold of the guide RNA comprises an RNA sequence selected from SEQ ID NO: 11 to SEQ ID NO: 20.
- 제4항에 있어서, 상기 Cas12a 단백질, 및 가이드 RNA의 스캐폴드는 다음 중 선택된 조합인, 비표적 핵산 절단 방법:In the fourth paragraph, the Cas12a protein and the scaffold of the guide RNA are a combination selected from the following, a non-target nucleic acid cleavage method:Cas12a 단백질은 서열번호 1의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 11의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 1, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 11;Cas12a 단백질은 서열번호 2의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 12의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 2, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 12;Cas12a 단백질은 서열번호 3의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 13의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 13;Cas12a 단백질은 서열번호 4의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 14의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 14;Cas12a 단백질은 서열번호 5의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 15의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 15;Cas12a 단백질은 서열번호 6의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 16의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 16;Cas12a 단백질은 서열번호 7의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 17의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 17;Cas12a 단백질은 서열번호 8의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 18의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 18;Cas12a 단백질은 서열번호 9의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 19의 RNA 서열을 포함함; 또는The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 19; orCas12a 단백질은 서열번호 10의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 20의 RNA 서열을 포함함.The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 20.
- 제4항 내지 제5항 중 어느 하나에 있어서,In any one of paragraphs 4 and 5,상기 가이드 RNA는 스템-루프를 더 포함하고,The above guide RNA further comprises a stem-loop,상기 스템-루프는 상기 스캐폴드의 5'말단에 연결되어 있으며,The above stem-loop is connected to the 5' end of the above scaffold,상기 스템-루프는 서열번호 21의 RNA 서열을 포함하는,The above stem-loop comprises an RNA sequence of sequence number 21.비표적 핵산 절단 방법.A method for non-target nucleic acid cleavage.
- 제1항 내지 제6항 중 어느 하나에 있어서,In any one of paragraphs 1 to 6,상기 표적 핵산은 이중가닥 DNA 또는 단일가닥 DNA이며, 상기 비표적 핵산은 이중가닥 DNA 또는 단일가닥 DNA인,The target nucleic acid is double-stranded DNA or single-stranded DNA, and the non-target nucleic acid is double-stranded DNA or single-stranded DNA.비표적 핵산 절단 방법.A method for non-target nucleic acid cleavage.
- 다음을 포함하는, 샘플 내 표적 핵산 검출 방법:A method for detecting a target nucleic acid in a sample, comprising:Cas12a 단백질, 가이드 RNA, 검출용 조성물 및 샘플을 섞는 과정;Process of mixing Cas12a protein, guide RNA, detection composition and sample;여기서, 상기 검출용 조성물은 프로브 핵산을 포함하고,Here, the detection composition comprises a probe nucleic acid,상기 프로브 핵산은 절단 시 검출 가능한 신호를 생성하는 것이고,The above probe nucleic acid produces a detectable signal upon cleavage,상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 단백질-RNA 복합체를 이루도록 할 수 있고,The above scaffold can allow the guide RNA to interact with the Cas12a protein to form a protein-RNA complex,상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,상기 과정의 수행 결과, 상기 Cas12a 단백질 및 상기 가이드 RNA가 결합하여 단백질-RNA 복합체를 형성하고,As a result of performing the above process, the Cas12a protein and the guide RNA combine to form a protein-RNA complex,상기 샘플 내에 상기 표적 핵산이 포함되어 있는 경우, 상기 단백질-RNA 복합체는 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,When the target nucleic acid is contained in the sample, the protein-RNA complex binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.상기 단백질-RNA 복합체에 의해 상기 프로브 핵산이 절단되는 경우, 상기 검출 가능한 신호가 측정되며,When the probe nucleic acid is cleaved by the protein-RNA complex, the detectable signal is measured.상기 검출 가능한 신호를 측정하여, 상기 샘플 내 상기 표적 핵산이 존재하는 지 여부, 및/또는 상기 샘플 내에 포함된 상기 표적 핵산의 양을 결정할 수 있음.By measuring said detectable signal, it is possible to determine whether said target nucleic acid is present in said sample, and/or the amount of said target nucleic acid contained in said sample.
- 다음을 포함하는, 샘플 내 표적 핵산 검출 방법:A method for detecting a target nucleic acid in a sample, comprising:리보뉴클레오프로틴 (Ribonucleoprotein), 검출용 조성물 및 샘플을 섞는 과정;A process of mixing ribonucleoprotein, a composition for detection and a sample;여기서, 상기 검출용 조성물은 프로브 핵산을 포함하고,Here, the detection composition comprises a probe nucleic acid,상기 프로브 핵산은 절단 시 검출 가능한 신호를 생성하는 것이고,The above probe nucleic acid produces a detectable signal upon cleavage,상기 리보뉴클레오프로틴은 Cas12a 단백질 및 가이드 RNA를 포함하고,The above ribonucleoprotein comprises Cas12a protein and guide RNA,상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴을 이루도록 할 수 있고,The above scaffold can enable the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein,상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,상기 샘플 내에 상기 표적 핵산이 포함되어 있는 경우, 상기 리보뉴클레오프로틴은 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,If the target nucleic acid is contained in the sample, the ribonucleoprotein binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.상기 리보뉴클레오프로틴에 의해 상기 프로브 핵산이 절단되는 경우, 상기 검출 가능한 신호가 측정되며,When the probe nucleic acid is cleaved by the ribonucleoprotein, the detectable signal is measured,상기 검출 가능한 신호를 측정하여, 상기 샘플 내 상기 표적 핵산이 존재하는 지 여부, 및/또는 상기 샘플 내에 포함된 상기 표적 핵산의 양을 결정할 수 있음.By measuring said detectable signal, it is possible to determine whether said target nucleic acid is present in said sample, and/or the amount of said target nucleic acid contained in said sample.
- 다음을 포함하는, 샘플 내 표적 핵산 검출 방법:A method for detecting a target nucleic acid in a sample, comprising:검출용 조성물 및 샘플을 섞는 과정;Process of mixing the composition for detection and the sample;여기서, 상기 검출용 조성물은 리보뉴클레오프로틴 (Ribonucleoprotein), 및 프로브 핵산을 포함하고,Here, the detection composition comprises ribonucleoprotein and probe nucleic acid,상기 프로브 핵산은 절단 시 검출 가능한 신호를 생성하는 것이고,The above probe nucleic acid produces a detectable signal upon cleavage,상기 리보뉴클레오프로틴은 Cas12a 단백질 및 가이드 RNA를 포함하고,The above ribonucleoprotein comprises Cas12a protein and guide RNA,상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,The above Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,상기 가이드 RNA는 가이드 도메인 및 스캐폴드를 포함하고,The above guide RNA comprises a guide domain and a scaffold,상기 가이드 RNA는 5'말단에서 3'말단 방향으로, 스캐폴드 및 가이드 도메인이 순차적으로 연결되어 있고,The above guide RNA has scaffold and guide domains sequentially connected from the 5' end to the 3' end.상기 스캐폴드는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴을 이루도록 할 수 있고,The above scaffold can enable the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein,상기 가이드 도메인은 상기 표적 핵산과 혼성화될 수 있고,The above guide domain can hybridize with the target nucleic acid,상기 샘플 내에 상기 표적 핵산이 포함되어 있는 경우, 상기 리보뉴클레오프로틴은 상기 가이드 도메인을 통해 상기 표적 핵산과 결합하여 부수적 절단 기능이 활성화되며,If the target nucleic acid is contained in the sample, the ribonucleoprotein binds to the target nucleic acid through the guide domain, thereby activating the secondary cleavage function.상기 리보뉴클레오프로틴에 의해 상기 프로브 핵산이 절단되는 경우, 상기 검출 가능한 신호가 측정되며,When the probe nucleic acid is cleaved by the ribonucleoprotein, the detectable signal is measured,상기 검출 가능한 신호를 측정하여, 상기 샘플 내 상기 표적 핵산이 존재하는 지 여부, 및/또는 상기 샘플 내에 포함된 상기 표적 핵산의 양을 결정할 수 있음.By measuring said detectable signal, it is possible to determine whether said target nucleic acid is present in said sample, and/or the amount of said target nucleic acid contained in said sample.
- 제8항 내지 제10항 중 어느 하나에 있어서, 상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열로 구성된, 표적 핵산 검출 방법.A method for detecting a target nucleic acid, wherein in any one of claims 8 to 10, the Cas12a protein is composed of an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10.
- 제8항 내지 제11항 중 어느 하나에 있어서, 상기 가이드 RNA의 스캐폴드는 서열번호 11 내지 서열번호 20 중에서 선택된 RNA 서열을 포함하는, 표적 핵산 검출 방법.A method for detecting a target nucleic acid, wherein the scaffold of the guide RNA comprises an RNA sequence selected from SEQ ID NO: 11 to SEQ ID NO: 20, in any one of claims 8 to 11.
- 제12항에 있어서, 상기 Cas12a 단백질, 및 가이드 RNA의 스캐폴드는 다음 중 선택된 조합인, 표적 핵산 검출 방법:In the 12th paragraph, the Cas12a protein and the scaffold of the guide RNA are a selected combination of the following, a method for detecting a target nucleic acid:Cas12a 단백질은 서열번호 1의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 11의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 1, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 11;Cas12a 단백질은 서열번호 2의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 12의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 2, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 12;Cas12a 단백질은 서열번호 3의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 13의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 13;Cas12a 단백질은 서열번호 4의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 14의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 14;Cas12a 단백질은 서열번호 5의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 15의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 15;Cas12a 단백질은 서열번호 6의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 16의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 16;Cas12a 단백질은 서열번호 7의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 17의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 17;Cas12a 단백질은 서열번호 8의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 18의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 18;Cas12a 단백질은 서열번호 9의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 19의 RNA 서열을 포함함; 또는The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 19; orCas12a 단백질은 서열번호 10의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 20의 RNA 서열을 포함함.The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 20.
- 제12항 내지 제13항 중 어느 하나에 있어서,In any one of Articles 12 to 13,상기 가이드 RNA는 스템-루프를 더 포함하고,The above guide RNA further comprises a stem-loop,상기 스템-루프는 상기 스캐폴드의 5'말단에 연결되어 있으며,The above stem-loop is connected to the 5' end of the above scaffold,상기 스템-루프는 서열번호 21의 RNA 서열을 포함하는,The above stem-loop comprises an RNA sequence of sequence number 21.표적 핵산 검출 방법.Method for detecting target nucleic acid.
- 제8항 내지 제14항 중 어느 하나에 있어서,In any one of Articles 8 to 14,상기 표적 핵산은 이중가닥 DNA 또는 단일가닥 DNA이며, 상기 비표적 핵산은 이중가닥 DNA 또는 단일가닥 DNA인,The target nucleic acid is double-stranded DNA or single-stranded DNA, and the non-target nucleic acid is double-stranded DNA or single-stranded DNA.표적 핵산 검출 방법.Method for detecting target nucleic acid.
- 제8항 내지 제15항 중 어느 하나에 있어서, 상기 프로브 핵산이 절단되는 경우 생성되는 상기 검출 가능한 신호는 형광 신호인, 표적 핵산 검출 방법.A method for detecting a target nucleic acid according to any one of claims 8 to 15, wherein the detectable signal generated when the probe nucleic acid is cleaved is a fluorescent signal.
- 다음을 포함하는 표적 핵산 검출용 조성물:Composition for detecting target nucleic acid comprising:Cas12a 단백질; 프로그램 가능한 가이드 RNA; 및 프로브 핵산;Cas12a protein; programmable guide RNA; and probe nucleic acid;여기서, 상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,Here, the Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,상기 프로그램 가능한 가이드 RNA는 5'-[직접 반복부]-[가이드 도메인]-3' 구조를 가지며,The above programmable guide RNA has a 5'-[direct repeat]-[guide domain]-3' structure,상기 직접 반복부는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴 (Ribonucleoprotein; RNP)을 형성할 수 있도록 하고,The above direct repeat portion enables the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein (RNP),상기 가이드 도메인은 상기 표적 핵산을 표적하도록 인위적으로 설계된 것이고,The above guide domain is artificially designed to target the target nucleic acid,상기 프로브 핵산은 절단되는 경우 검출 가능한 신호를 생성하는 것임.The above probe nucleic acid is one which, when cleaved, produces a detectable signal.
- 제17항에 있어서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA는 결합하여 RNP를 형성하고 있는, 표적 핵산 검출용 조성물.A composition for detecting a target nucleic acid, wherein in claim 17, the Cas12a protein and the programmable guide RNA are combined to form an RNP.
- 제17항 내지 제18항 중 어느 하나에 있어서, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 11 내지 서열번호 20 중에서 선택된 RNA 서열을 포함하는, 표적 핵산 검출용 조성물.A composition for detecting a target nucleic acid, wherein the direct repeat portion of the guide RNA in any one of claims 17 to 18 comprises an RNA sequence selected from SEQ ID NO: 11 to SEQ ID NO: 20.
- 제19항에 있어서,In Article 19,상기 Cas12a 단백질이 서열번호 1의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 11의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of sequence number 1, the direct repeat portion of the guide RNA comprises an RNA sequence of sequence number 11,상기 Cas12a 단백질이 서열번호 2의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 12의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of sequence number 2, the direct repeat portion of the guide RNA comprises an RNA sequence of sequence number 12,상기 Cas12a 단백질이 서열번호 3의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 13의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 13,상기 Cas12a 단백질이 서열번호 4의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 14의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 14,상기 Cas12a 단백질이 서열번호 5의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 15의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 15,상기 Cas12a 단백질이 서열번호 6의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 16의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 16,상기 Cas12a 단백질이 서열번호 7의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 17의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 17,상기 Cas12a 단백질이 서열번호 8의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 18의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 18,상기 Cas12a 단백질이 서열번호 9의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 19의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 19,상기 Cas12a 단백질이 서열번호 10의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 20의 RNA 서열을 포함하는,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 20.표적 핵산 검출용 조성물.A composition for detecting a target nucleic acid.
- 제17항 내지 제20항 중 어느 하나에 있어서, 상기 프로브 핵산이 절단되는 경우 생성되는 검출 가능한 신호는 형광 신호인, 표적 핵산 검출용 조성물.A composition for detecting a target nucleic acid, wherein the detectable signal generated when the probe nucleic acid is cleaved in any one of claims 17 to 20 is a fluorescent signal.
- 다음을 포함하는 표적 핵산 검출 키트:Target nucleic acid detection kit containing:Cas12a 단백질; 프로그램 가능한 가이드 RNA; 및 프로브 핵산;Cas12a protein; programmable guide RNA; and probe nucleic acid;여기서, 상기 Cas12a 단백질은 서열번호 1 내지 서열번호 10 중에서 선택된 아미노산 서열을 포함하고,Here, the Cas12a protein comprises an amino acid sequence selected from SEQ ID NO: 1 to SEQ ID NO: 10,상기 프로그램 가능한 가이드 RNA는 5'-[직접 반복부]-[가이드 도메인]-3' 구조를 가지며,The above programmable guide RNA has a 5'-[direct repeat]-[guide domain]-3' structure,상기 직접 반복부는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴 (Ribonucleoprotein; RNP)을 형성할 수 있도록 하고,The above direct repeat portion enables the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein (RNP),상기 가이드 도메인은 상기 표적 핵산을 표적하도록 인위적으로 설계된 것이고,The above guide domain is artificially designed to target the target nucleic acid,상기 프로브 핵산은 절단되는 경우 검출 가능한 신호를 생성하는 것임.The above probe nucleic acid is one which, when cleaved, produces a detectable signal.
- 제22항에 있어서, 상기 표적 핵산 검출 키트는 2개 이상의 용기를 포함하고,In claim 22, the target nucleic acid detection kit comprises two or more containers,상기 Cas12a 단백질 및 상기 프로브 핵산은 서로 다른 용기에 포함되어 있는 것을 특징으로 하는, 표적 핵산 검출 키트.A target nucleic acid detection kit, characterized in that the Cas12a protein and the probe nucleic acid are contained in different containers.
- 제22항 내지 제23항 중 어느 하나에 있어서, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 11 내지 서열번호 20 중에서 선택된 RNA 서열을 포함하는, 표적 핵산 검출 키트.A kit for detecting a target nucleic acid, wherein the direct repeat portion of the guide RNA in any one of claims 22 to 23 comprises an RNA sequence selected from SEQ ID NO: 11 to SEQ ID NO: 20.
- 제24항에 있어서,In Article 24,상기 Cas12a 단백질이 서열번호 1의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 11의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of sequence number 1, the direct repeat portion of the guide RNA comprises an RNA sequence of sequence number 11,상기 Cas12a 단백질이 서열번호 2의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 12의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of sequence number 2, the direct repeat portion of the guide RNA comprises an RNA sequence of sequence number 12,상기 Cas12a 단백질이 서열번호 3의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 13의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 13,상기 Cas12a 단백질이 서열번호 4의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 14의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 14,상기 Cas12a 단백질이 서열번호 5의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 15의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 15,상기 Cas12a 단백질이 서열번호 6의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 16의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 16,상기 Cas12a 단백질이 서열번호 7의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 17의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 17,상기 Cas12a 단백질이 서열번호 8의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 18의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 18,상기 Cas12a 단백질이 서열번호 9의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 19의 RNA 서열을 포함하고,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 19,상기 Cas12a 단백질이 서열번호 10의 아미노산 서열을 포함하는 경우, 상기 가이드 RNA의 상기 직접 반복부는 서열번호 20의 RNA 서열을 포함하는,When the above Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, the direct repeat portion of the guide RNA comprises an RNA sequence of SEQ ID NO: 20.표적 핵산 검출 키트.Target nucleic acid detection kit.
- 제22항 내지 제25항 중 어느 하나에 있어서, 상기 프로브 핵산이 절단되는 경우 생성되는 검출 가능한 신호는 형광 신호인, 표적 핵산 검출용 조성물.A composition for detecting a target nucleic acid, wherein the detectable signal generated when the probe nucleic acid is cleaved in any one of claims 22 to 25 is a fluorescent signal.
- 제22항 내지 제26항 중 어느 하나에 있어서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA는 결합하여 RNP를 형성하고 있는, 표적 핵산 검출 키트.A target nucleic acid detection kit according to any one of claims 22 to 26, wherein the Cas12a protein and the programmable guide RNA are combined to form an RNP.
- 다음을 포함하는 Cas12a 조성물:A Cas12a composition comprising:Cas12a 단백질 또는 상기 Cas12a 단백질을 암호화하는 핵산; 및Cas12a protein or a nucleic acid encoding said Cas12a protein; and프로그램 가능한 가이드 RNA 또는 상기 프로그램 가능한 가이드 RNA를 암호화하는 핵산;A programmable guide RNA or a nucleic acid encoding said programmable guide RNA;여기서, 상기 프로그램 가능한 가이드 RNA는 5'-[직접 반복부]-[가이드 도메인]-3' 구조를 가지며,Here, the programmable guide RNA has a 5'-[direct repeat]-[guide domain]-3' structure,상기 직접 반복부는 상기 가이드 RNA가 상기 Cas12a 단백질과 상호작용하여 리보뉴클레오프로틴 (Ribonucleoprotein; RNP)을 형성할 수 있도록 하고,The above direct repeat portion enables the guide RNA to interact with the Cas12a protein to form a ribonucleoprotein (RNP),상기 가이드 도메인은 상기 표적 핵산을 표적하도록 인위적으로 설계된 것이고,The above guide domain is artificially designed to target the target nucleic acid,상기 직접 반복부 및 상기 Cas12a 단백질은 다음 중 선택된 조합임:The above direct repeat portion and the Cas12a protein are a selected combination of:Cas12a 단백질은 서열번호 1의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 11의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 1, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 11;Cas12a 단백질은 서열번호 2의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 12의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 2, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 12;Cas12a 단백질은 서열번호 3의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 13의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 3, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 13;Cas12a 단백질은 서열번호 4의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 14의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 4, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 14;Cas12a 단백질은 서열번호 5의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 15의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 5, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 15;Cas12a 단백질은 서열번호 6의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 16의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 6, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 16;Cas12a 단백질은 서열번호 7의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 17의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 7, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 17;Cas12a 단백질은 서열번호 8의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 18의 RNA 서열을 포함함;The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 8, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 18;Cas12a 단백질은 서열번호 9의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 19의 RNA 서열을 포함함; 또는The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 9, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 19; orCas12a 단백질은 서열번호 10의 아미노산 서열을 포함하고, 가이드 RNA의 스캐폴드는 서열번호 20의 RNA 서열을 포함함.The Cas12a protein comprises an amino acid sequence of SEQ ID NO: 10, and the guide RNA scaffold comprises an RNA sequence of SEQ ID NO: 20.
- 제28항에 있어서, 상기 Cas12a 조성물은 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA를 포함하는, Cas12a 조성물.In claim 28, the Cas12a composition comprises the Cas12a protein and the programmable guide RNA.
- 제29항에 있어서, 상기 Cas12a 단백질 및 상기 프로그램 가능한 가이드 RNA가 결합하여 리보뉴클레오프로틴을 형성하고 있는, Cas12a 조성물.A Cas12a composition in claim 29, wherein the Cas12a protein and the programmable guide RNA are combined to form a ribonucleoprotein.
- 제28항 내지 제30항 중 어느 하나에 따른 Cas12a 조성물의 제1항 내지 제7항 중 어느 하나의 비표적 핵산 절단 방법에 사용하는 용도.Use of a Cas12a composition according to any one of claims 28 to 30 in a non-target nucleic acid cleavage method according to any one of claims 1 to 7.
- 제28항 내지 제30항 중 어느 하나에 따른 Cas12a 조성물의 제8항 내지 제16항 중 어느 하나의 표적 핵산 검출 방법에 사용하는 용도.Use of a Cas12a composition according to any one of claims 28 to 30 in a method for detecting a target nucleic acid according to any one of claims 8 to 16.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
KR20230017883 | 2023-02-10 | ||
KR10-2023-0017883 | 2023-02-10 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2024167317A1 true WO2024167317A1 (en) | 2024-08-15 |
Family
ID=92262951
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/KR2024/001849 WO2024167317A1 (en) | 2023-02-10 | 2024-02-07 | Novel crispr/cas12a composition and use thereof for detecting target nucleic acid |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2024167317A1 (en) |
-
2024
- 2024-02-07 WO PCT/KR2024/001849 patent/WO2024167317A1/en unknown
Similar Documents
Publication | Publication Date | Title |
---|---|---|
WO2021086083A2 (en) | Engineered guide rna for increasing efficiency of crispr/cas12f1 system, and use of same | |
WO2019009682A2 (en) | Target-specific crispr mutant | |
WO2017217768A1 (en) | Method for screening targeted genetic scissors by using multiple target system of on-target and off-target activity and use thereof | |
WO2018062866A2 (en) | CELL-PERMEABLE (CP)-Cas9 RECOMBINANT PROTEIN AND USES THEREOF | |
WO2022075813A1 (en) | Engineered guide rna for increasing efficiency of crispr/cas12f1 system, and use of same | |
WO2022220503A1 (en) | Gene expression regulatory system using crispr system | |
WO2020235974A2 (en) | Single base substitution protein, and composition comprising same | |
WO2017188797A1 (en) | Method for evaluating, in vivo, activity of rna-guided nuclease in high-throughput manner | |
WO2016021973A1 (en) | Genome editing using campylobacter jejuni crispr/cas system-derived rgen | |
WO2015068957A1 (en) | Method for the detection of multiple target nucleic acids using clamping probes and detection probes | |
WO2022075816A1 (en) | Engineered guide rna for increasing efficiency of crispr/cas12f1 (cas14a1) system, and use thereof | |
WO2018001258A1 (en) | Probe for nucleic acid enrichment and capture, and design method thereof | |
WO2015167278A1 (en) | A protein secretory factor with high secretory efficiency and an expression vector comprising the same | |
WO2015199387A2 (en) | Helicobacter pylori α-1,2 fucosyltransferase gene and protein with improved soluble protein expression, and application to production of α-1,2 fucosyloligosaccharide | |
WO2022075808A1 (en) | Engineered guide rna comprising u-rich tail for increasing efficiency of crispr/cas12f1 system, and use thereof | |
WO2017188669A2 (en) | Method for detecting target nucleic acid sequence using cleaved complementary tag fragment and composition thereof | |
WO2011157222A1 (en) | Joint detection methods for lymphoma fusion genes and diagnostic kits thereof | |
WO2019022520A1 (en) | Nucleic acid complex pair, competitive structure, and pcr kit using both | |
CN1330666C (en) | Hypoxia-inducible factor I-alpha HIF-I-alpha variants and methods for identifying HIF-I-alpha modulators | |
WO2020105873A1 (en) | Dignostic kit and whole genome sequence identification method which use amplification of whole genome of human alpha coronavirus | |
WO2015199386A1 (en) | Helicobacter pylori α-1,2 fucosyltransferase gene and protein with improved soluble protein expression, and application to production of α-1,2 fucosyloligosaccharide | |
WO2024167317A1 (en) | Novel crispr/cas12a composition and use thereof for detecting target nucleic acid | |
CN100580092C (en) | Gene chip for detection and typing of bird flu virus | |
WO2011120398A1 (en) | Joint detection method for leukemia fusion genes and diagnostic kits thereof | |
WO2023059115A1 (en) | Target system for genome editing and uses thereof |