WO2024081768A1 - Bacteria engineered to produce active epidermal growth factor (egf) and their medical uses - Google Patents
Bacteria engineered to produce active epidermal growth factor (egf) and their medical uses Download PDFInfo
- Publication number
- WO2024081768A1 WO2024081768A1 PCT/US2023/076665 US2023076665W WO2024081768A1 WO 2024081768 A1 WO2024081768 A1 WO 2024081768A1 US 2023076665 W US2023076665 W US 2023076665W WO 2024081768 A1 WO2024081768 A1 WO 2024081768A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- seq
- disease
- pharmaceutical composition
- subject
- egf
- Prior art date
Links
- 241000894006 Bacteria Species 0.000 title claims abstract description 407
- VBEQCZHXXJYVRD-GACYYNSASA-N uroanthelone Chemical compound C([C@@H](C(=O)N[C@H](C(=O)N[C@@H](CS)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CS)C(=O)N[C@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)C(C)C)[C@@H](C)O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)CNC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)CNC(=O)[C@H]1N(CCC1)C(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C1=CC=C(O)C=C1 VBEQCZHXXJYVRD-GACYYNSASA-N 0.000 title claims abstract description 152
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 128
- 238000000034 method Methods 0.000 claims abstract description 108
- 230000003248 secreting effect Effects 0.000 claims abstract description 35
- 108090000623 proteins and genes Proteins 0.000 claims description 458
- 108090000765 processed proteins & peptides Proteins 0.000 claims description 214
- 102000004196 processed proteins & peptides Human genes 0.000 claims description 187
- 229920001184 polypeptide Polymers 0.000 claims description 178
- 101800003838 Epidermal growth factor Proteins 0.000 claims description 159
- 102400001368 Epidermal growth factor Human genes 0.000 claims description 157
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 claims description 145
- 230000028327 secretion Effects 0.000 claims description 143
- 230000001939 inductive effect Effects 0.000 claims description 138
- 210000001035 gastrointestinal tract Anatomy 0.000 claims description 137
- 230000014509 gene expression Effects 0.000 claims description 122
- 201000010099 disease Diseases 0.000 claims description 88
- 208000035475 disorder Diseases 0.000 claims description 57
- 206010061218 Inflammation Diseases 0.000 claims description 56
- 230000004054 inflammatory process Effects 0.000 claims description 56
- 239000012634 fragment Substances 0.000 claims description 49
- 102000040430 polynucleotide Human genes 0.000 claims description 47
- 108091033319 polynucleotide Proteins 0.000 claims description 47
- 239000002157 polynucleotide Substances 0.000 claims description 47
- 208000025865 Ulcer Diseases 0.000 claims description 41
- 230000035876 healing Effects 0.000 claims description 40
- 241000588724 Escherichia coli Species 0.000 claims description 37
- 230000000451 tissue damage Effects 0.000 claims description 35
- 231100000827 tissue damage Toxicity 0.000 claims description 35
- 208000024891 symptom Diseases 0.000 claims description 34
- 210000001072 colon Anatomy 0.000 claims description 31
- 230000037430 deletion Effects 0.000 claims description 30
- 238000012217 deletion Methods 0.000 claims description 30
- 230000003870 intestinal permeability Effects 0.000 claims description 30
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 claims description 25
- 229910052799 carbon Inorganic materials 0.000 claims description 25
- 230000001965 increasing effect Effects 0.000 claims description 25
- 230000007812 deficiency Effects 0.000 claims description 24
- 230000003247 decreasing effect Effects 0.000 claims description 21
- 239000003937 drug carrier Substances 0.000 claims description 21
- 230000003902 lesion Effects 0.000 claims description 20
- 208000011231 Crohn disease Diseases 0.000 claims description 19
- 206010028124 Mucosal ulceration Diseases 0.000 claims description 19
- 108050006400 Cyclin Proteins 0.000 claims description 17
- 230000000087 stabilizing effect Effects 0.000 claims description 17
- 208000022559 Inflammatory bowel disease Diseases 0.000 claims description 15
- 201000006704 Ulcerative Colitis Diseases 0.000 claims description 15
- 206010009900 Colitis ulcerative Diseases 0.000 claims description 14
- 229960000511 lactulose Drugs 0.000 claims description 14
- PFCRQPBOOFTZGQ-UHFFFAOYSA-N lactulose keto form Natural products OCC(=O)C(O)C(C(O)CO)OC1OC(CO)C(O)C(O)C1O PFCRQPBOOFTZGQ-UHFFFAOYSA-N 0.000 claims description 14
- 208000011580 syndromic disease Diseases 0.000 claims description 14
- 210000005205 gut mucosa Anatomy 0.000 claims description 12
- 241000193171 Clostridium butyricum Species 0.000 claims description 11
- 108010079246 OMPA outer membrane proteins Proteins 0.000 claims description 11
- 230000001363 autoimmune Effects 0.000 claims description 11
- 238000001574 biopsy Methods 0.000 claims description 11
- 230000006872 improvement Effects 0.000 claims description 11
- 208000023275 Autoimmune disease Diseases 0.000 claims description 10
- 241000193403 Clostridium Species 0.000 claims description 10
- 230000004888 barrier function Effects 0.000 claims description 10
- 210000002865 immune cell Anatomy 0.000 claims description 10
- 241000606125 Bacteroides Species 0.000 claims description 9
- 238000001839 endoscopy Methods 0.000 claims description 9
- 230000008595 infiltration Effects 0.000 claims description 9
- 238000001764 infiltration Methods 0.000 claims description 9
- 206010012735 Diarrhoea Diseases 0.000 claims description 8
- 208000007465 Giant cell arteritis Diseases 0.000 claims description 8
- 102100032132 Neuroendocrine convertase 1 Human genes 0.000 claims description 8
- 208000031981 Thrombocytopenic Idiopathic Purpura Diseases 0.000 claims description 8
- 201000003710 autoimmune thrombocytopenic purpura Diseases 0.000 claims description 8
- 235000013305 food Nutrition 0.000 claims description 8
- 208000030159 metabolic disease Diseases 0.000 claims description 8
- 210000000664 rectum Anatomy 0.000 claims description 8
- 206010043207 temporal arteritis Diseases 0.000 claims description 8
- 208000020506 Albright hereditary osteodystrophy Diseases 0.000 claims description 6
- 208000009299 Benign Mucous Membrane Pemphigoid Diseases 0.000 claims description 6
- 241000186000 Bifidobacterium Species 0.000 claims description 6
- 102000004219 Brain-derived neurotrophic factor Human genes 0.000 claims description 6
- 108090000715 Brain-derived neurotrophic factor Proteins 0.000 claims description 6
- 206010072579 Granulomatosis with polyangiitis Diseases 0.000 claims description 6
- 101001128694 Homo sapiens Neuroendocrine convertase 1 Proteins 0.000 claims description 6
- 241000186660 Lactobacillus Species 0.000 claims description 6
- 102000001796 Melanocortin 4 receptors Human genes 0.000 claims description 6
- 108010069820 Pro-Opiomelanocortin Proteins 0.000 claims description 6
- 239000000683 Pro-Opiomelanocortin Substances 0.000 claims description 6
- 102100027467 Pro-opiomelanocortin Human genes 0.000 claims description 6
- 108090000544 Proprotein convertase 1 Proteins 0.000 claims description 6
- 108010021436 Type 4 Melanocortin Receptor Proteins 0.000 claims description 6
- 208000002552 acute disseminated encephalomyelitis Diseases 0.000 claims description 6
- 229940077737 brain-derived neurotrophic factor Drugs 0.000 claims description 6
- 229940039696 lactobacillus Drugs 0.000 claims description 6
- 208000008795 neuromyelitis optica Diseases 0.000 claims description 6
- 208000018065 pseudohypoparathyroidism type 1A Diseases 0.000 claims description 6
- 241001608472 Bifidobacterium longum Species 0.000 claims description 5
- 241000194036 Lactococcus Species 0.000 claims description 5
- 206010067584 Type 1 diabetes mellitus Diseases 0.000 claims description 5
- 230000008901 benefit Effects 0.000 claims description 5
- 229940009291 bifidobacterium longum Drugs 0.000 claims description 5
- 230000001684 chronic effect Effects 0.000 claims description 5
- 125000002099 lactulose group Chemical group 0.000 claims description 5
- 208000008190 Agammaglobulinemia Diseases 0.000 claims description 4
- 208000003343 Antiphospholipid Syndrome Diseases 0.000 claims description 4
- 208000031212 Autoimmune polyendocrinopathy Diseases 0.000 claims description 4
- 208000030939 Chronic inflammatory demyelinating polyneuropathy Diseases 0.000 claims description 4
- 241000530936 Clostridium novyi NT Species 0.000 claims description 4
- 208000035186 Hemolytic Autoimmune Anemia Diseases 0.000 claims description 4
- 206010020983 Hypogammaglobulinaemia Diseases 0.000 claims description 4
- 201000009794 Idiopathic Pulmonary Fibrosis Diseases 0.000 claims description 4
- 206010021245 Idiopathic thrombocytopenic purpura Diseases 0.000 claims description 4
- 208000001019 Inborn Errors Metabolism Diseases 0.000 claims description 4
- 208000003456 Juvenile Arthritis Diseases 0.000 claims description 4
- 206010059176 Juvenile idiopathic arthritis Diseases 0.000 claims description 4
- 208000012309 Linear IgA disease Diseases 0.000 claims description 4
- 208000003250 Mixed connective tissue disease Diseases 0.000 claims description 4
- 208000012902 Nervous system disease Diseases 0.000 claims description 4
- 208000025966 Neurological disease Diseases 0.000 claims description 4
- 208000000733 Paroxysmal Hemoglobinuria Diseases 0.000 claims description 4
- 206010034277 Pemphigoid Diseases 0.000 claims description 4
- 108010090127 Periplasmic Proteins Proteins 0.000 claims description 4
- 102100036050 Phosphatidylinositol N-acetylglucosaminyltransferase subunit A Human genes 0.000 claims description 4
- RJKFOVLPORLFTN-LEKSSAKUSA-N Progesterone Chemical compound C1CC2=CC(=O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H](C(=O)C)[C@@]1(C)CC2 RJKFOVLPORLFTN-LEKSSAKUSA-N 0.000 claims description 4
- 206010049416 Short-bowel syndrome Diseases 0.000 claims description 4
- 206010042276 Subacute endocarditis Diseases 0.000 claims description 4
- 206010043561 Thrombocytopenic purpura Diseases 0.000 claims description 4
- 208000025851 Undifferentiated connective tissue disease Diseases 0.000 claims description 4
- 208000017379 Undifferentiated connective tissue syndrome Diseases 0.000 claims description 4
- 206010046851 Uveitis Diseases 0.000 claims description 4
- 208000027625 autoimmune inner ear disease Diseases 0.000 claims description 4
- 230000004663 cell proliferation Effects 0.000 claims description 4
- 201000005795 chronic inflammatory demyelinating polyneuritis Diseases 0.000 claims description 4
- 230000001010 compromised effect Effects 0.000 claims description 4
- 201000001981 dermatomyositis Diseases 0.000 claims description 4
- 208000016245 inborn errors of metabolism Diseases 0.000 claims description 4
- 208000015978 inherited metabolic disease Diseases 0.000 claims description 4
- 210000003750 lower gastrointestinal tract Anatomy 0.000 claims description 4
- 206010025135 lupus erythematosus Diseases 0.000 claims description 4
- 230000004770 neurodegeneration Effects 0.000 claims description 4
- 208000015122 neurodegenerative disease Diseases 0.000 claims description 4
- 230000000926 neurological effect Effects 0.000 claims description 4
- 201000003045 paroxysmal nocturnal hemoglobinuria Diseases 0.000 claims description 4
- 208000002574 reactive arthritis Diseases 0.000 claims description 4
- 208000008467 subacute bacterial endocarditis Diseases 0.000 claims description 4
- 208000001072 type 2 diabetes mellitus Diseases 0.000 claims description 4
- 210000002438 upper gastrointestinal tract Anatomy 0.000 claims description 4
- 206010068783 Alstroem syndrome Diseases 0.000 claims description 3
- 201000005932 Alstrom Syndrome Diseases 0.000 claims description 3
- 208000031229 Cardiomyopathies Diseases 0.000 claims description 3
- 208000008020 Cohen syndrome Diseases 0.000 claims description 3
- 206010056979 Colitis microscopic Diseases 0.000 claims description 3
- 201000004624 Dermatitis Diseases 0.000 claims description 3
- 241000588722 Escherichia Species 0.000 claims description 3
- 208000001914 Fragile X syndrome Diseases 0.000 claims description 3
- 108090001126 Furin Proteins 0.000 claims description 3
- 101000601647 Homo sapiens Paired box protein Pax-6 Proteins 0.000 claims description 3
- 101000621309 Homo sapiens Wilms tumor protein Proteins 0.000 claims description 3
- 241000270878 Hyla Species 0.000 claims description 3
- 102000016267 Leptin Human genes 0.000 claims description 3
- 108010092277 Leptin Proteins 0.000 claims description 3
- 208000036626 Mental retardation Diseases 0.000 claims description 3
- 208000001145 Metabolic Syndrome Diseases 0.000 claims description 3
- 201000010769 Prader-Willi syndrome Diseases 0.000 claims description 3
- 241000194017 Streptococcus Species 0.000 claims description 3
- 208000026911 Tuberous sclerosis complex Diseases 0.000 claims description 3
- 201000000692 Ulnar-mammary syndrome Diseases 0.000 claims description 3
- 102100022748 Wilms tumor protein Human genes 0.000 claims description 3
- 201000000690 abdominal obesity-metabolic syndrome Diseases 0.000 claims description 3
- 208000008303 aniridia Diseases 0.000 claims description 3
- 208000008609 collagenous colitis Diseases 0.000 claims description 3
- 230000007547 defect Effects 0.000 claims description 3
- 201000008243 diversion colitis Diseases 0.000 claims description 3
- 231100000414 gastrointestinal toxicity Toxicity 0.000 claims description 3
- 208000027138 indeterminate colitis Diseases 0.000 claims description 3
- BPHPUYQFMNQIOC-NXRLNHOXSA-N isopropyl beta-D-thiogalactopyranoside Chemical compound CC(C)S[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O BPHPUYQFMNQIOC-NXRLNHOXSA-N 0.000 claims description 3
- 229940039781 leptin Drugs 0.000 claims description 3
- NRYBAZVQPHGZNS-ZSOCWYAHSA-N leptin Chemical compound O=C([C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CO)NC(=O)CNC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](N)CC(C)C)CCSC)N1CCC[C@H]1C(=O)NCC(=O)N[C@@H](CS)C(O)=O NRYBAZVQPHGZNS-ZSOCWYAHSA-N 0.000 claims description 3
- 102000005861 leptin receptors Human genes 0.000 claims description 3
- 108010019813 leptin receptors Proteins 0.000 claims description 3
- 208000004341 lymphocytic colitis Diseases 0.000 claims description 3
- 210000004877 mucosa Anatomy 0.000 claims description 3
- 208000008338 non-alcoholic fatty liver disease Diseases 0.000 claims description 3
- 208000006078 pseudohypoparathyroidism Diseases 0.000 claims description 3
- 230000005855 radiation Effects 0.000 claims description 3
- 208000009999 tuberous sclerosis Diseases 0.000 claims description 3
- 208000032194 Acute haemorrhagic leukoencephalitis Diseases 0.000 claims description 2
- 208000026872 Addison Disease Diseases 0.000 claims description 2
- 208000032671 Allergic granulomatous angiitis Diseases 0.000 claims description 2
- 206010001935 American trypanosomiasis Diseases 0.000 claims description 2
- 208000028185 Angioedema Diseases 0.000 claims description 2
- 206010002556 Ankylosing Spondylitis Diseases 0.000 claims description 2
- 206010003267 Arthritis reactive Diseases 0.000 claims description 2
- 208000032116 Autoimmune Experimental Encephalomyelitis Diseases 0.000 claims description 2
- 206010071576 Autoimmune aplastic anaemia Diseases 0.000 claims description 2
- 206010003827 Autoimmune hepatitis Diseases 0.000 claims description 2
- 206010071577 Autoimmune hyperlipidaemia Diseases 0.000 claims description 2
- 206010064539 Autoimmune myocarditis Diseases 0.000 claims description 2
- 206010069002 Autoimmune pancreatitis Diseases 0.000 claims description 2
- 208000022106 Autoimmune polyendocrinopathy type 2 Diseases 0.000 claims description 2
- 206010003840 Autonomic nervous system imbalance Diseases 0.000 claims description 2
- 208000023328 Basedow disease Diseases 0.000 claims description 2
- 208000009137 Behcet syndrome Diseases 0.000 claims description 2
- 208000008439 Biliary Liver Cirrhosis Diseases 0.000 claims description 2
- 208000033222 Biliary cirrhosis primary Diseases 0.000 claims description 2
- 208000005024 Castleman disease Diseases 0.000 claims description 2
- 208000024699 Chagas disease Diseases 0.000 claims description 2
- 206010008609 Cholangitis sclerosing Diseases 0.000 claims description 2
- 208000006344 Churg-Strauss Syndrome Diseases 0.000 claims description 2
- 208000015943 Coeliac disease Diseases 0.000 claims description 2
- 208000010007 Cogan syndrome Diseases 0.000 claims description 2
- 208000011038 Cold agglutinin disease Diseases 0.000 claims description 2
- 206010009868 Cold type haemolytic anaemia Diseases 0.000 claims description 2
- 208000013586 Complex regional pain syndrome type 1 Diseases 0.000 claims description 2
- 206010011258 Coxsackie myocarditis Diseases 0.000 claims description 2
- 208000019707 Cryoglobulinemic vasculitis Diseases 0.000 claims description 2
- 206010012468 Dermatitis herpetiformis Diseases 0.000 claims description 2
- 206010048768 Dermatosis Diseases 0.000 claims description 2
- 208000021866 Dressler syndrome Diseases 0.000 claims description 2
- 201000009273 Endometriosis Diseases 0.000 claims description 2
- 206010014954 Eosinophilic fasciitis Diseases 0.000 claims description 2
- 208000018428 Eosinophilic granulomatosis with polyangiitis Diseases 0.000 claims description 2
- 206010064212 Eosinophilic oesophagitis Diseases 0.000 claims description 2
- 206010015226 Erythema nodosum Diseases 0.000 claims description 2
- 208000004332 Evans syndrome Diseases 0.000 claims description 2
- 206010018364 Glomerulonephritis Diseases 0.000 claims description 2
- 208000024869 Goodpasture syndrome Diseases 0.000 claims description 2
- 208000015023 Graves' disease Diseases 0.000 claims description 2
- 208000035895 Guillain-Barré syndrome Diseases 0.000 claims description 2
- 208000030836 Hashimoto thyroiditis Diseases 0.000 claims description 2
- 206010019263 Heart block congenital Diseases 0.000 claims description 2
- 201000004331 Henoch-Schoenlein purpura Diseases 0.000 claims description 2
- 206010019617 Henoch-Schonlein purpura Diseases 0.000 claims description 2
- 206010019939 Herpes gestationis Diseases 0.000 claims description 2
- 208000031814 IgA Vasculitis Diseases 0.000 claims description 2
- 208000010159 IgA glomerulonephritis Diseases 0.000 claims description 2
- 206010021263 IgA nephropathy Diseases 0.000 claims description 2
- 208000021330 IgG4-related disease Diseases 0.000 claims description 2
- 208000014919 IgG4-related retroperitoneal fibrosis Diseases 0.000 claims description 2
- 206010061598 Immunodeficiency Diseases 0.000 claims description 2
- 208000029462 Immunodeficiency disease Diseases 0.000 claims description 2
- 208000031781 Immunoglobulin G4 related sclerosing disease Diseases 0.000 claims description 2
- 208000004187 Immunoglobulin G4-Related Disease Diseases 0.000 claims description 2
- 206010022557 Intermediate uveitis Diseases 0.000 claims description 2
- 208000005615 Interstitial Cystitis Diseases 0.000 claims description 2
- 201000010743 Lambert-Eaton myasthenic syndrome Diseases 0.000 claims description 2
- 208000032514 Leukocytoclastic vasculitis Diseases 0.000 claims description 2
- 206010024434 Lichen sclerosus Diseases 0.000 claims description 2
- 108090001030 Lipoproteins Proteins 0.000 claims description 2
- 102000004895 Lipoproteins Human genes 0.000 claims description 2
- 208000027530 Meniere disease Diseases 0.000 claims description 2
- 206010049567 Miller Fisher syndrome Diseases 0.000 claims description 2
- 208000024599 Mooren ulcer Diseases 0.000 claims description 2
- 208000012192 Mucous membrane pemphigoid Diseases 0.000 claims description 2
- 208000000112 Myalgia Diseases 0.000 claims description 2
- 201000002481 Myositis Diseases 0.000 claims description 2
- 206010071579 Neuronal neuropathy Diseases 0.000 claims description 2
- 208000003435 Optic Neuritis Diseases 0.000 claims description 2
- 206010053869 POEMS syndrome Diseases 0.000 claims description 2
- 206010048705 Paraneoplastic cerebellar degeneration Diseases 0.000 claims description 2
- 208000004788 Pars Planitis Diseases 0.000 claims description 2
- 208000008223 Pemphigoid Gestationis Diseases 0.000 claims description 2
- 241000721454 Pemphigus Species 0.000 claims description 2
- 208000031845 Pernicious anaemia Diseases 0.000 claims description 2
- 208000000766 Pityriasis Lichenoides Diseases 0.000 claims description 2
- 206010048895 Pityriasis lichenoides et varioliformis acuta Diseases 0.000 claims description 2
- 206010065159 Polychondritis Diseases 0.000 claims description 2
- 208000031732 Post-Lyme Disease Syndrome Diseases 0.000 claims description 2
- 208000004347 Postpericardiotomy Syndrome Diseases 0.000 claims description 2
- 208000012654 Primary biliary cholangitis Diseases 0.000 claims description 2
- 208000037534 Progressive hemifacial atrophy Diseases 0.000 claims description 2
- 201000004681 Psoriasis Diseases 0.000 claims description 2
- 201000001263 Psoriatic Arthritis Diseases 0.000 claims description 2
- 208000036824 Psoriatic arthropathy Diseases 0.000 claims description 2
- 208000003670 Pure Red-Cell Aplasia Diseases 0.000 claims description 2
- 208000012322 Raynaud phenomenon Diseases 0.000 claims description 2
- 201000001947 Reflex Sympathetic Dystrophy Diseases 0.000 claims description 2
- 208000033464 Reiter syndrome Diseases 0.000 claims description 2
- 208000005793 Restless legs syndrome Diseases 0.000 claims description 2
- 206010038979 Retroperitoneal fibrosis Diseases 0.000 claims description 2
- 208000025747 Rheumatic disease Diseases 0.000 claims description 2
- 206010039705 Scleritis Diseases 0.000 claims description 2
- 206010039710 Scleroderma Diseases 0.000 claims description 2
- 208000021386 Sjogren Syndrome Diseases 0.000 claims description 2
- 206010072148 Stiff-Person syndrome Diseases 0.000 claims description 2
- 208000002286 Susac Syndrome Diseases 0.000 claims description 2
- 206010042742 Sympathetic ophthalmia Diseases 0.000 claims description 2
- 208000001106 Takayasu Arteritis Diseases 0.000 claims description 2
- 206010071574 Testicular autoimmunity Diseases 0.000 claims description 2
- 206010051526 Tolosa-Hunt syndrome Diseases 0.000 claims description 2
- 241000223109 Trypanosoma cruzi Species 0.000 claims description 2
- 208000026928 Turner syndrome Diseases 0.000 claims description 2
- 108700036309 Type I Plasminogen Deficiency Proteins 0.000 claims description 2
- 108010064721 Type I Secretion Systems Proteins 0.000 claims description 2
- 206010064996 Ulcerative keratitis Diseases 0.000 claims description 2
- 208000024780 Urticaria Diseases 0.000 claims description 2
- 206010047115 Vasculitis Diseases 0.000 claims description 2
- 206010047642 Vitiligo Diseases 0.000 claims description 2
- 208000004631 alopecia areata Diseases 0.000 claims description 2
- 206010002022 amyloidosis Diseases 0.000 claims description 2
- 208000006673 asthma Diseases 0.000 claims description 2
- 201000000448 autoimmune hemolytic anemia Diseases 0.000 claims description 2
- 208000006424 autoimmune oophoritis Diseases 0.000 claims description 2
- 201000009780 autoimmune polyendocrine syndrome type 2 Diseases 0.000 claims description 2
- 206010071578 autoimmune retinopathy Diseases 0.000 claims description 2
- 208000010928 autoimmune thyroid disease Diseases 0.000 claims description 2
- 230000003376 axonal effect Effects 0.000 claims description 2
- 208000000594 bullous pemphigoid Diseases 0.000 claims description 2
- 208000025302 chronic primary adrenal insufficiency Diseases 0.000 claims description 2
- 201000010002 cicatricial pemphigoid Diseases 0.000 claims description 2
- 201000004395 congenital heart block Diseases 0.000 claims description 2
- 201000003278 cryoglobulinemia Diseases 0.000 claims description 2
- 230000003210 demyelinating effect Effects 0.000 claims description 2
- 208000019479 dysautonomia Diseases 0.000 claims description 2
- 206010014599 encephalitis Diseases 0.000 claims description 2
- 201000000708 eosinophilic esophagitis Diseases 0.000 claims description 2
- 208000002980 facial hemiatrophy Diseases 0.000 claims description 2
- ZZUFCTLCJUWOSV-UHFFFAOYSA-N furosemide Chemical compound C1=C(Cl)C(S(=O)(=O)N)=CC(C(O)=O)=C1NCC1=CC=CO1 ZZUFCTLCJUWOSV-UHFFFAOYSA-N 0.000 claims description 2
- 208000018090 giant cell myocarditis Diseases 0.000 claims description 2
- 208000007475 hemolytic anemia Diseases 0.000 claims description 2
- 201000006362 hypersensitivity vasculitis Diseases 0.000 claims description 2
- 230000007813 immunodeficiency Effects 0.000 claims description 2
- 208000015446 immunoglobulin a vasculitis Diseases 0.000 claims description 2
- 230000004957 immunoregulator effect Effects 0.000 claims description 2
- 201000008319 inclusion body myositis Diseases 0.000 claims description 2
- 208000036971 interstitial lung disease 2 Diseases 0.000 claims description 2
- 201000002215 juvenile rheumatoid arthritis Diseases 0.000 claims description 2
- 201000011486 lichen planus Diseases 0.000 claims description 2
- 206010071570 ligneous conjunctivitis Diseases 0.000 claims description 2
- 206010063344 microscopic polyangiitis Diseases 0.000 claims description 2
- 201000006417 multiple sclerosis Diseases 0.000 claims description 2
- 206010028417 myasthenia gravis Diseases 0.000 claims description 2
- 201000003631 narcolepsy Diseases 0.000 claims description 2
- 201000008383 nephritis Diseases 0.000 claims description 2
- 201000001119 neuropathy Diseases 0.000 claims description 2
- 230000007823 neuropathy Effects 0.000 claims description 2
- 208000004235 neutropenia Diseases 0.000 claims description 2
- 208000015200 ocular cicatricial pemphigoid Diseases 0.000 claims description 2
- 201000005580 palindromic rheumatism Diseases 0.000 claims description 2
- 208000033808 peripheral neuropathy Diseases 0.000 claims description 2
- 201000006292 polyarteritis nodosa Diseases 0.000 claims description 2
- 208000005987 polymyositis Diseases 0.000 claims description 2
- 208000018290 primary dysautonomia Diseases 0.000 claims description 2
- 201000000742 primary sclerosing cholangitis Diseases 0.000 claims description 2
- 239000000186 progesterone Substances 0.000 claims description 2
- 229960003387 progesterone Drugs 0.000 claims description 2
- 208000005069 pulmonary fibrosis Diseases 0.000 claims description 2
- 208000009954 pyoderma gangrenosum Diseases 0.000 claims description 2
- 230000000306 recurrent effect Effects 0.000 claims description 2
- 208000009169 relapsing polychondritis Diseases 0.000 claims description 2
- 230000000552 rheumatic effect Effects 0.000 claims description 2
- 201000003068 rheumatic fever Diseases 0.000 claims description 2
- 206010039073 rheumatoid arthritis Diseases 0.000 claims description 2
- 201000000306 sarcoidosis Diseases 0.000 claims description 2
- 208000010157 sclerosing cholangitis Diseases 0.000 claims description 2
- 208000017520 skin disease Diseases 0.000 claims description 2
- 201000000596 systemic lupus erythematosus Diseases 0.000 claims description 2
- 208000009174 transverse myelitis Diseases 0.000 claims description 2
- 230000002568 urticarial effect Effects 0.000 claims description 2
- 102000009339 Proliferating Cell Nuclear Antigen Human genes 0.000 claims 5
- 230000001105 regulatory effect Effects 0.000 description 193
- 229940116977 epidermal growth factor Drugs 0.000 description 124
- 108091023040 Transcription factor Proteins 0.000 description 121
- 102000040945 Transcription factor Human genes 0.000 description 121
- 210000004027 cell Anatomy 0.000 description 120
- 239000001301 oxygen Substances 0.000 description 120
- 229910052760 oxygen Inorganic materials 0.000 description 120
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 109
- 230000001580 bacterial effect Effects 0.000 description 80
- 239000007845 reactive nitrogen species Substances 0.000 description 68
- 239000003642 reactive oxygen metabolite Substances 0.000 description 63
- 150000007523 nucleic acids Chemical group 0.000 description 59
- 102000004169 proteins and genes Human genes 0.000 description 57
- 108020001507 fusion proteins Proteins 0.000 description 51
- 235000018102 proteins Nutrition 0.000 description 51
- 108091028043 Nucleic acid sequence Proteins 0.000 description 50
- 102000037865 fusion proteins Human genes 0.000 description 50
- 230000027455 binding Effects 0.000 description 43
- 239000013612 plasmid Substances 0.000 description 40
- 230000007613 environmental effect Effects 0.000 description 38
- 230000001419 dependent effect Effects 0.000 description 37
- 101150084418 EGF gene Proteins 0.000 description 33
- 238000004519 manufacturing process Methods 0.000 description 32
- 241000699670 Mus sp. Species 0.000 description 30
- 230000002103 transcriptional effect Effects 0.000 description 30
- 244000005700 microbiome Species 0.000 description 27
- 230000004048 modification Effects 0.000 description 27
- 238000012986 modification Methods 0.000 description 27
- 108091026890 Coding region Proteins 0.000 description 25
- 210000000349 chromosome Anatomy 0.000 description 25
- 238000011282 treatment Methods 0.000 description 22
- TVZRAEYQIKYCPH-UHFFFAOYSA-N 3-(trimethylsilyl)propane-1-sulfonic acid Chemical compound C[Si](C)(C)CCCS(O)(=O)=O TVZRAEYQIKYCPH-UHFFFAOYSA-N 0.000 description 21
- 125000003275 alpha amino acid group Chemical group 0.000 description 20
- 230000035772 mutation Effects 0.000 description 20
- 238000013518 transcription Methods 0.000 description 20
- 230000035897 transcription Effects 0.000 description 20
- 235000001014 amino acid Nutrition 0.000 description 19
- 238000001727 in vivo Methods 0.000 description 19
- 210000004921 distal colon Anatomy 0.000 description 18
- 230000036269 ulceration Effects 0.000 description 18
- 230000000694 effects Effects 0.000 description 17
- 230000000670 limiting effect Effects 0.000 description 17
- 229940024606 amino acid Drugs 0.000 description 16
- 150000001413 amino acids Chemical class 0.000 description 16
- 230000006870 function Effects 0.000 description 16
- 210000004379 membrane Anatomy 0.000 description 16
- 239000012528 membrane Substances 0.000 description 16
- -1 short chain fatty acid butyrate Chemical class 0.000 description 16
- 241000894007 species Species 0.000 description 16
- MHAJPDPJQMAIIY-UHFFFAOYSA-N Hydrogen peroxide Chemical compound OO MHAJPDPJQMAIIY-UHFFFAOYSA-N 0.000 description 15
- 230000008859 change Effects 0.000 description 15
- 108010074051 C-Reactive Protein Proteins 0.000 description 14
- 102100032752 C-reactive protein Human genes 0.000 description 14
- 108010004171 colibactin Proteins 0.000 description 14
- ZWKHDAZPVITMAI-ROUUACIJSA-N colibactin Chemical compound C[C@H]1CCC(=N1)C1=C(CC(=O)NCC(=O)c2csc(n2)C(=O)C(=O)c2csc(CNC(=O)CC3=C(C(=O)NC33CC3)C3=N[C@@H](C)CC3)n2)C2(CC2)NC1=O ZWKHDAZPVITMAI-ROUUACIJSA-N 0.000 description 14
- 230000000529 probiotic effect Effects 0.000 description 14
- 239000002207 metabolite Substances 0.000 description 13
- 239000002773 nucleotide Substances 0.000 description 13
- 125000003729 nucleotide group Chemical group 0.000 description 13
- 239000006041 probiotic Substances 0.000 description 13
- 235000018291 probiotics Nutrition 0.000 description 13
- 238000006467 substitution reaction Methods 0.000 description 13
- 230000001225 therapeutic effect Effects 0.000 description 13
- 102100036691 Proliferating cell nuclear antigen Human genes 0.000 description 12
- 239000012636 effector Substances 0.000 description 12
- 238000000338 in vitro Methods 0.000 description 12
- GVUGOAYIVIDWIO-UFWWTJHBSA-N nepidermin Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)NCC(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C=CC(O)=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(O)=O)NC(=O)CNC(=O)[C@@H](NC(=O)[C@@H](NC(=O)[C@H](CS)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CS)NC(=O)[C@H](C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CCSC)NC(=O)[C@H](CS)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CS)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)CNC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]1N(CCC1)C(=O)[C@H](CS)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](N)CC(N)=O)C(C)C)[C@@H](C)CC)C(C)C)C(C)C)C1=CC=C(O)C=C1 GVUGOAYIVIDWIO-UFWWTJHBSA-N 0.000 description 12
- 210000000813 small intestine Anatomy 0.000 description 12
- 108060003951 Immunoglobulin Proteins 0.000 description 11
- 230000004913 activation Effects 0.000 description 11
- 102000018358 immunoglobulin Human genes 0.000 description 11
- 230000002757 inflammatory effect Effects 0.000 description 11
- 210000001519 tissue Anatomy 0.000 description 11
- 101100203377 Bacillus subtilis (strain 168) slp gene Proteins 0.000 description 10
- 239000002028 Biomass Substances 0.000 description 10
- 108020004705 Codon Proteins 0.000 description 10
- 101100242529 Drosophila melanogaster Pal2 gene Proteins 0.000 description 10
- 102000004190 Enzymes Human genes 0.000 description 10
- 108090000790 Enzymes Proteins 0.000 description 10
- 101150012565 LRIT1 gene Proteins 0.000 description 10
- 241000124008 Mammalia Species 0.000 description 10
- 101100477497 Mus musculus Shcbp1 gene Proteins 0.000 description 10
- IQFYYKKMVGJFEH-XLPZGREQSA-N Thymidine Chemical compound O=C1NC(=O)C(C)=CN1[C@@H]1O[C@H](CO)[C@@H](O)C1 IQFYYKKMVGJFEH-XLPZGREQSA-N 0.000 description 10
- 230000003213 activating effect Effects 0.000 description 10
- 229940088598 enzyme Drugs 0.000 description 10
- 210000003608 fece Anatomy 0.000 description 10
- 238000012239 gene modification Methods 0.000 description 10
- 230000005017 genetic modification Effects 0.000 description 10
- 235000013617 genetically modified food Nutrition 0.000 description 10
- 239000000411 inducer Substances 0.000 description 10
- 101150077062 pal gene Proteins 0.000 description 10
- 239000003053 toxin Substances 0.000 description 10
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 9
- 244000052616 bacterial pathogen Species 0.000 description 9
- 210000004369 blood Anatomy 0.000 description 9
- 239000008280 blood Substances 0.000 description 9
- 230000006378 damage Effects 0.000 description 9
- 230000006698 induction Effects 0.000 description 9
- JCQLYHFGKNRPGE-FCVZTGTOSA-N lactulose Chemical compound OC[C@H]1O[C@](O)(CO)[C@@H](O)[C@@H]1O[C@H]1[C@H](O)[C@@H](O)[C@@H](O)[C@@H](CO)O1 JCQLYHFGKNRPGE-FCVZTGTOSA-N 0.000 description 9
- 238000005259 measurement Methods 0.000 description 9
- 231100000765 toxin Toxicity 0.000 description 9
- 108700012359 toxins Proteins 0.000 description 9
- 108010006533 ATP-Binding Cassette Transporters Proteins 0.000 description 8
- 102000005416 ATP-Binding Cassette Transporters Human genes 0.000 description 8
- 101000851176 Homo sapiens Pro-epidermal growth factor Proteins 0.000 description 8
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical compound O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 8
- 210000003578 bacterial chromosome Anatomy 0.000 description 8
- 239000000090 biomarker Substances 0.000 description 8
- 230000015572 biosynthetic process Effects 0.000 description 8
- 230000012010 growth Effects 0.000 description 8
- 238000003780 insertion Methods 0.000 description 8
- 230000037431 insertion Effects 0.000 description 8
- 230000008569 process Effects 0.000 description 8
- 210000002966 serum Anatomy 0.000 description 8
- 230000014616 translation Effects 0.000 description 8
- 101100162202 Aspergillus parasiticus (strain ATCC 56775 / NRRL 5862 / SRRC 143 / SU-1) aflF gene Proteins 0.000 description 7
- 101100026210 Drosophila melanogaster Clbn gene Proteins 0.000 description 7
- 101100028324 Streptomyces rimosus subsp. rimosus (strain ATCC 10970 / DSM 40260 / JCM 4667 / NRRL 2234) oxyS gene Proteins 0.000 description 7
- 241000700605 Viruses Species 0.000 description 7
- 230000001147 anti-toxic effect Effects 0.000 description 7
- PYMYPHUHKUWMLA-UHFFFAOYSA-N arabinose Natural products OCC(O)C(O)C(O)C=O PYMYPHUHKUWMLA-UHFFFAOYSA-N 0.000 description 7
- PYMYPHUHKUWMLA-WDCZJNDASA-N arabinose Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)C=O PYMYPHUHKUWMLA-WDCZJNDASA-N 0.000 description 7
- SRBFZHDQGSBBOR-UHFFFAOYSA-N beta-D-Pyranose-Lyxose Natural products OC1COC(O)C(O)C1O SRBFZHDQGSBBOR-UHFFFAOYSA-N 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 238000002474 experimental method Methods 0.000 description 7
- 230000010354 integration Effects 0.000 description 7
- 210000004400 mucous membrane Anatomy 0.000 description 7
- 101150076456 norB gene Proteins 0.000 description 7
- 102000039446 nucleic acids Human genes 0.000 description 7
- 108020004707 nucleic acids Proteins 0.000 description 7
- 238000013519 translation Methods 0.000 description 7
- 241001515965 unidentified phage Species 0.000 description 7
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 6
- 101100295756 Acinetobacter baumannii (strain ATCC 19606 / DSM 30007 / JCM 6841 / CCUG 19606 / CIP 70.34 / NBRC 109757 / NCIMB 12457 / NCTC 12156 / 81) omp38 gene Proteins 0.000 description 6
- 108700010070 Codon Usage Proteins 0.000 description 6
- 102000004127 Cytokines Human genes 0.000 description 6
- 108090000695 Cytokines Proteins 0.000 description 6
- 241000192125 Firmicutes Species 0.000 description 6
- 108091026922 FnrS RNA Proteins 0.000 description 6
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 6
- 208000032843 Hemorrhage Diseases 0.000 description 6
- 241000350158 Prioria balsamifera Species 0.000 description 6
- 101150042295 arfA gene Proteins 0.000 description 6
- 230000006696 biosynthetic metabolic pathway Effects 0.000 description 6
- 230000000740 bleeding effect Effects 0.000 description 6
- 210000004534 cecum Anatomy 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 210000002919 epithelial cell Anatomy 0.000 description 6
- 239000008103 glucose Substances 0.000 description 6
- 230000000968 intestinal effect Effects 0.000 description 6
- 108020004999 messenger RNA Proteins 0.000 description 6
- 101150087557 omcB gene Proteins 0.000 description 6
- 101150115693 ompA gene Proteins 0.000 description 6
- 230000036961 partial effect Effects 0.000 description 6
- 239000000243 solution Substances 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 239000003981 vehicle Substances 0.000 description 6
- 244000063299 Bacillus subtilis Species 0.000 description 5
- 235000014469 Bacillus subtilis Nutrition 0.000 description 5
- DWRXFEITVBNRMK-UHFFFAOYSA-N Beta-D-1-Arabinofuranosylthymine Natural products O=C1NC(=O)C(C)=CN1C1C(O)C(O)C(CO)O1 DWRXFEITVBNRMK-UHFFFAOYSA-N 0.000 description 5
- 241000186016 Bifidobacterium bifidum Species 0.000 description 5
- 241000193452 Clostridium tyrobutyricum Species 0.000 description 5
- 108020004414 DNA Proteins 0.000 description 5
- 102000001301 EGF receptor Human genes 0.000 description 5
- 108060006698 EGF receptor Proteins 0.000 description 5
- 102000006496 Immunoglobulin Heavy Chains Human genes 0.000 description 5
- 108010019476 Immunoglobulin Heavy Chains Proteins 0.000 description 5
- 240000001046 Lactobacillus acidophilus Species 0.000 description 5
- 235000013956 Lactobacillus acidophilus Nutrition 0.000 description 5
- 240000006024 Lactobacillus plantarum Species 0.000 description 5
- 235000013965 Lactobacillus plantarum Nutrition 0.000 description 5
- 101100178822 Mycobacterium tuberculosis (strain ATCC 25618 / H37Rv) htrA1 gene Proteins 0.000 description 5
- 101710116435 Outer membrane protein Proteins 0.000 description 5
- 101100277437 Rhizobium meliloti (strain 1021) degP1 gene Proteins 0.000 description 5
- 241000235070 Saccharomyces Species 0.000 description 5
- 241000607142 Salmonella Species 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 239000003242 anti bacterial agent Substances 0.000 description 5
- IQFYYKKMVGJFEH-UHFFFAOYSA-N beta-L-thymidine Natural products O=C1NC(=O)C(C)=CN1C1OC(CO)C(O)C1 IQFYYKKMVGJFEH-UHFFFAOYSA-N 0.000 description 5
- 229940002008 bifidobacterium bifidum Drugs 0.000 description 5
- 230000003115 biocidal effect Effects 0.000 description 5
- 230000007423 decrease Effects 0.000 description 5
- 101150018266 degP gene Proteins 0.000 description 5
- 239000000975 dye Substances 0.000 description 5
- 210000000981 epithelium Anatomy 0.000 description 5
- 208000002551 irritable bowel syndrome Diseases 0.000 description 5
- 229940039695 lactobacillus acidophilus Drugs 0.000 description 5
- 229940072205 lactobacillus plantarum Drugs 0.000 description 5
- 210000002429 large intestine Anatomy 0.000 description 5
- 210000000440 neutrophil Anatomy 0.000 description 5
- 210000000056 organ Anatomy 0.000 description 5
- 239000002245 particle Substances 0.000 description 5
- 230000000754 repressing effect Effects 0.000 description 5
- 230000004044 response Effects 0.000 description 5
- 230000019491 signal transduction Effects 0.000 description 5
- 230000004083 survival effect Effects 0.000 description 5
- 238000002560 therapeutic procedure Methods 0.000 description 5
- 229940104230 thymidine Drugs 0.000 description 5
- 108091006106 transcriptional activators Proteins 0.000 description 5
- 241000606124 Bacteroides fragilis Species 0.000 description 4
- 241000606123 Bacteroides thetaiotaomicron Species 0.000 description 4
- 241000901050 Bifidobacterium animalis subsp. lactis Species 0.000 description 4
- 241000186015 Bifidobacterium longum subsp. infantis Species 0.000 description 4
- 244000201986 Cassia tora Species 0.000 description 4
- 238000002965 ELISA Methods 0.000 description 4
- 101100495405 Escherichia coli cvaC gene Proteins 0.000 description 4
- 239000004471 Glycine Substances 0.000 description 4
- 101100082540 Haemophilus influenzae (strain ATCC 51907 / DSM 11121 / KW20 / Rd) pcp gene Proteins 0.000 description 4
- 101500025419 Homo sapiens Epidermal growth factor Proteins 0.000 description 4
- 241000186604 Lactobacillus reuteri Species 0.000 description 4
- 229910002651 NO3 Inorganic materials 0.000 description 4
- 241000588652 Neisseria gonorrhoeae Species 0.000 description 4
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 4
- 108700006385 OmpF Proteins 0.000 description 4
- 102000004085 Proprotein convertase 1 Human genes 0.000 description 4
- 108010076504 Protein Sorting Signals Proteins 0.000 description 4
- 244000057717 Streptococcus lactis Species 0.000 description 4
- 235000014897 Streptococcus lactis Nutrition 0.000 description 4
- 239000004098 Tetracycline Substances 0.000 description 4
- 238000003556 assay Methods 0.000 description 4
- 229940004120 bifidobacterium infantis Drugs 0.000 description 4
- 229940009289 bifidobacterium lactis Drugs 0.000 description 4
- 230000008238 biochemical pathway Effects 0.000 description 4
- 230000004071 biological effect Effects 0.000 description 4
- 230000033228 biological regulation Effects 0.000 description 4
- 230000001276 controlling effect Effects 0.000 description 4
- 101150083941 degS gene Proteins 0.000 description 4
- 239000000539 dimer Substances 0.000 description 4
- LZDSILRDTDCIQT-UHFFFAOYSA-N dinitrogen trioxide Chemical compound [O-][N+](=O)N=O LZDSILRDTDCIQT-UHFFFAOYSA-N 0.000 description 4
- 230000009266 disease activity Effects 0.000 description 4
- 230000003628 erosive effect Effects 0.000 description 4
- 230000002550 fecal effect Effects 0.000 description 4
- 229940116978 human epidermal growth factor Drugs 0.000 description 4
- 208000027866 inflammatory disease Diseases 0.000 description 4
- 230000028709 inflammatory response Effects 0.000 description 4
- 239000003112 inhibitor Substances 0.000 description 4
- 230000002401 inhibitory effect Effects 0.000 description 4
- 101150013110 katG gene Proteins 0.000 description 4
- 229940001882 lactobacillus reuteri Drugs 0.000 description 4
- 101150074251 lpp gene Proteins 0.000 description 4
- 230000007246 mechanism Effects 0.000 description 4
- 239000000178 monomer Substances 0.000 description 4
- 235000015097 nutrients Nutrition 0.000 description 4
- 230000007170 pathology Effects 0.000 description 4
- NCAIGTHBQTXTLR-UHFFFAOYSA-N phentermine hydrochloride Chemical compound [Cl-].CC(C)([NH3+])CC1=CC=CC=C1 NCAIGTHBQTXTLR-UHFFFAOYSA-N 0.000 description 4
- 230000035755 proliferation Effects 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 229960002181 saccharomyces boulardii Drugs 0.000 description 4
- 210000002784 stomach Anatomy 0.000 description 4
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 4
- 238000003786 synthesis reaction Methods 0.000 description 4
- 229960002180 tetracycline Drugs 0.000 description 4
- 229930101283 tetracycline Natural products 0.000 description 4
- 235000019364 tetracycline Nutrition 0.000 description 4
- 150000003522 tetracyclines Chemical class 0.000 description 4
- 101150014665 tolB gene Proteins 0.000 description 4
- 230000001960 triggered effect Effects 0.000 description 4
- 231100000397 ulcer Toxicity 0.000 description 4
- 241001148471 unidentified anaerobic bacterium Species 0.000 description 4
- 210000002700 urine Anatomy 0.000 description 4
- 230000002792 vascular Effects 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- 241000193830 Bacillus <bacterium> Species 0.000 description 3
- 101100462127 Bacillus subtilis (strain 168) ohrA gene Proteins 0.000 description 3
- 208000034332 Body integrity dysphoria Diseases 0.000 description 3
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 3
- 241000194031 Enterococcus faecium Species 0.000 description 3
- 101100119895 Escherichia coli (strain K12) fdnG gene Proteins 0.000 description 3
- 108700039887 Essential Genes Proteins 0.000 description 3
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 3
- 208000018522 Gastrointestinal disease Diseases 0.000 description 3
- 241000282412 Homo Species 0.000 description 3
- 244000199885 Lactobacillus bulgaricus Species 0.000 description 3
- 235000013960 Lactobacillus bulgaricus Nutrition 0.000 description 3
- 241000186605 Lactobacillus paracasei Species 0.000 description 3
- 102000001109 Leukocyte L1 Antigen Complex Human genes 0.000 description 3
- 108010069316 Leukocyte L1 Antigen Complex Proteins 0.000 description 3
- 229930195725 Mannitol Natural products 0.000 description 3
- MSFSPUZXLOGKHJ-UHFFFAOYSA-N Muraminsaeure Natural products OC(=O)C(C)OC1C(N)C(O)OC(CO)C1O MSFSPUZXLOGKHJ-UHFFFAOYSA-N 0.000 description 3
- 108090000913 Nitrate Reductases Proteins 0.000 description 3
- 108091005804 Peptidases Proteins 0.000 description 3
- 108010013639 Peptidoglycan Proteins 0.000 description 3
- 108010030975 Polyketide Synthases Proteins 0.000 description 3
- 240000004808 Saccharomyces cerevisiae Species 0.000 description 3
- 108010012901 Succinate Dehydrogenase Proteins 0.000 description 3
- OUUQCZGPVNCOIJ-UHFFFAOYSA-M Superoxide Chemical compound [O-][O] OUUQCZGPVNCOIJ-UHFFFAOYSA-M 0.000 description 3
- 108020004566 Transfer RNA Proteins 0.000 description 3
- 108010092282 Trimethylamine dehydrogenase Proteins 0.000 description 3
- 208000027418 Wounds and injury Diseases 0.000 description 3
- 230000003110 anti-inflammatory effect Effects 0.000 description 3
- 239000012472 biological sample Substances 0.000 description 3
- 230000001628 butyrogenic effect Effects 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 230000002759 chromosomal effect Effects 0.000 description 3
- 206010009887 colitis Diseases 0.000 description 3
- 101150051280 dmsA gene Proteins 0.000 description 3
- 239000003651 drinking water Substances 0.000 description 3
- 235000020188 drinking water Nutrition 0.000 description 3
- 239000002158 endotoxin Substances 0.000 description 3
- 206010016256 fatigue Diseases 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 210000003405 ileum Anatomy 0.000 description 3
- 230000001976 improved effect Effects 0.000 description 3
- 230000004968 inflammatory condition Effects 0.000 description 3
- 208000014674 injury Diseases 0.000 description 3
- 229940004208 lactobacillus bulgaricus Drugs 0.000 description 3
- 229920006008 lipopolysaccharide Polymers 0.000 description 3
- 210000004185 liver Anatomy 0.000 description 3
- 230000001320 lysogenic effect Effects 0.000 description 3
- 235000010355 mannitol Nutrition 0.000 description 3
- 239000000594 mannitol Substances 0.000 description 3
- 239000002609 medium Substances 0.000 description 3
- 230000004060 metabolic process Effects 0.000 description 3
- 239000000203 mixture Substances 0.000 description 3
- JCXJVPUVTGWSNB-UHFFFAOYSA-N nitrogen dioxide Inorganic materials O=[N]=O JCXJVPUVTGWSNB-UHFFFAOYSA-N 0.000 description 3
- 108010000785 non-ribosomal peptide synthase Proteins 0.000 description 3
- 101150029849 nsrR gene Proteins 0.000 description 3
- 235000016709 nutrition Nutrition 0.000 description 3
- 101150073640 ompF gene Proteins 0.000 description 3
- 238000005457 optimization Methods 0.000 description 3
- 230000001590 oxidative effect Effects 0.000 description 3
- 230000001717 pathogenic effect Effects 0.000 description 3
- 210000001322 periplasm Anatomy 0.000 description 3
- 230000035699 permeability Effects 0.000 description 3
- CMFNMSMUKZHDEY-UHFFFAOYSA-N peroxynitrous acid Chemical compound OON=O CMFNMSMUKZHDEY-UHFFFAOYSA-N 0.000 description 3
- 230000026731 phosphorylation Effects 0.000 description 3
- 238000006366 phosphorylation reaction Methods 0.000 description 3
- 239000000047 product Substances 0.000 description 3
- 230000009467 reduction Effects 0.000 description 3
- 230000010076 replication Effects 0.000 description 3
- 230000029058 respiratory gaseous exchange Effects 0.000 description 3
- 230000002441 reversible effect Effects 0.000 description 3
- SUKJFIGYRHOWBL-UHFFFAOYSA-N sodium hypochlorite Chemical compound [Na+].Cl[O-] SUKJFIGYRHOWBL-UHFFFAOYSA-N 0.000 description 3
- 125000003003 spiro group Chemical group 0.000 description 3
- 235000000346 sugar Nutrition 0.000 description 3
- 239000006228 supernatant Substances 0.000 description 3
- 101150061964 tolA gene Proteins 0.000 description 3
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 3
- 108091006107 transcriptional repressors Proteins 0.000 description 3
- 238000012546 transfer Methods 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- 208000016261 weight loss Diseases 0.000 description 3
- 230000004580 weight loss Effects 0.000 description 3
- 208000004998 Abdominal Pain Diseases 0.000 description 2
- 101100059196 Alkalihalobacillus pseudofirmus (strain ATCC BAA-2126 / JCM 17055 / OF4) katE gene Proteins 0.000 description 2
- 241000193749 Bacillus coagulans Species 0.000 description 2
- 101100404144 Bacillus subtilis (strain 168) nasD gene Proteins 0.000 description 2
- 108010062877 Bacteriocins Proteins 0.000 description 2
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 2
- 108010078791 Carrier Proteins Proteins 0.000 description 2
- 241000193163 Clostridioides difficile Species 0.000 description 2
- 241000193470 Clostridium sporogenes Species 0.000 description 2
- 108091035707 Consensus sequence Proteins 0.000 description 2
- IVOMOUWHDPKRLL-KQYNXXCUSA-N Cyclic adenosine monophosphate Chemical compound C([C@H]1O2)OP(O)(=O)O[C@H]1[C@@H](O)[C@@H]2N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-KQYNXXCUSA-N 0.000 description 2
- 230000004544 DNA amplification Effects 0.000 description 2
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 2
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 2
- MYMOFIZGZYHOMD-UHFFFAOYSA-N Dioxygen Chemical compound O=O MYMOFIZGZYHOMD-UHFFFAOYSA-N 0.000 description 2
- 241000588921 Enterobacteriaceae Species 0.000 description 2
- 241000194033 Enterococcus Species 0.000 description 2
- 241001302654 Escherichia coli Nissle 1917 Species 0.000 description 2
- 101000870597 Escherichia coli O78:H11 (strain H10407 / ETEC) Secretin GspD 2 Proteins 0.000 description 2
- 108700039691 Genetic Promoter Regions Proteins 0.000 description 2
- 102100024977 Glutamine-tRNA ligase Human genes 0.000 description 2
- 101000635799 Homo sapiens Run domain Beclin-1-interacting and cysteine-rich domain-containing protein Proteins 0.000 description 2
- 206010020710 Hyperphagia Diseases 0.000 description 2
- XEEYBQQBJWHFJM-UHFFFAOYSA-N Iron Chemical compound [Fe] XEEYBQQBJWHFJM-UHFFFAOYSA-N 0.000 description 2
- 241001026509 Kata Species 0.000 description 2
- 244000199866 Lactobacillus casei Species 0.000 description 2
- 235000013958 Lactobacillus casei Nutrition 0.000 description 2
- 241001468157 Lactobacillus johnsonii Species 0.000 description 2
- 241000218588 Lactobacillus rhamnosus Species 0.000 description 2
- 108010051335 Lipocalin-2 Proteins 0.000 description 2
- 102000013519 Lipocalin-2 Human genes 0.000 description 2
- 102100025169 Max-binding protein MNT Human genes 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 101100509674 Mycolicibacterium smegmatis (strain ATCC 700084 / mc(2)155) katG3 gene Proteins 0.000 description 2
- 229910019093 NaOCl Inorganic materials 0.000 description 2
- GQPLMRYTRLFLPF-UHFFFAOYSA-N Nitrous Oxide Chemical compound [O-][N+]#N GQPLMRYTRLFLPF-UHFFFAOYSA-N 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- 206010036774 Proctitis Diseases 0.000 description 2
- 206010036783 Proctitis ulcerative Diseases 0.000 description 2
- ONIBWKKTOPOVIA-UHFFFAOYSA-N Proline Natural products OC(=O)C1CCCN1 ONIBWKKTOPOVIA-UHFFFAOYSA-N 0.000 description 2
- 239000004365 Protease Substances 0.000 description 2
- 101710149951 Protein Tat Proteins 0.000 description 2
- 108020004511 Recombinant DNA Proteins 0.000 description 2
- 108010008281 Recombinant Fusion Proteins Proteins 0.000 description 2
- 102000007056 Recombinant Fusion Proteins Human genes 0.000 description 2
- 102000018120 Recombinases Human genes 0.000 description 2
- 108010091086 Recombinases Proteins 0.000 description 2
- 102100030852 Run domain Beclin-1-interacting and cysteine-rich domain-containing protein Human genes 0.000 description 2
- 241000191940 Staphylococcus Species 0.000 description 2
- IVOMOUWHDPKRLL-UHFFFAOYSA-N UNPD107823 Natural products O1C2COP(O)(=O)OC2C(O)C1N1C(N=CN=C2N)=C2N=C1 IVOMOUWHDPKRLL-UHFFFAOYSA-N 0.000 description 2
- 101000870604 Vibrio cholerae serotype O1 (strain ATCC 39315 / El Tor Inaba N16961) Secretin GspD Proteins 0.000 description 2
- 230000002159 abnormal effect Effects 0.000 description 2
- 230000001154 acute effect Effects 0.000 description 2
- 101150024831 ahpC gene Proteins 0.000 description 2
- 230000004075 alteration Effects 0.000 description 2
- 230000001668 ameliorated effect Effects 0.000 description 2
- 230000009604 anaerobic growth Effects 0.000 description 2
- 210000002255 anal canal Anatomy 0.000 description 2
- 230000000844 anti-bacterial effect Effects 0.000 description 2
- 239000012298 atmosphere Substances 0.000 description 2
- 229940054340 bacillus coagulans Drugs 0.000 description 2
- 230000003385 bacteriostatic effect Effects 0.000 description 2
- 210000004082 barrier epithelial cell Anatomy 0.000 description 2
- 208000034158 bleeding Diseases 0.000 description 2
- 230000037396 body weight Effects 0.000 description 2
- 239000006227 byproduct Substances 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 230000005779 cell damage Effects 0.000 description 2
- 230000010261 cell growth Effects 0.000 description 2
- 239000003795 chemical substances by application Substances 0.000 description 2
- 230000000112 colonic effect Effects 0.000 description 2
- 229940095074 cyclic amp Drugs 0.000 description 2
- 210000000805 cytoplasm Anatomy 0.000 description 2
- 230000002950 deficient Effects 0.000 description 2
- 230000003111 delayed effect Effects 0.000 description 2
- 230000002939 deleterious effect Effects 0.000 description 2
- 229940079593 drug Drugs 0.000 description 2
- 210000001198 duodenum Anatomy 0.000 description 2
- 230000008030 elimination Effects 0.000 description 2
- 238000003379 elimination reaction Methods 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 239000003623 enhancer Substances 0.000 description 2
- 230000002255 enzymatic effect Effects 0.000 description 2
- 210000003979 eosinophil Anatomy 0.000 description 2
- 230000004890 epithelial barrier function Effects 0.000 description 2
- 210000003238 esophagus Anatomy 0.000 description 2
- 238000005755 formation reaction Methods 0.000 description 2
- 230000005714 functional activity Effects 0.000 description 2
- 210000003736 gastrointestinal content Anatomy 0.000 description 2
- 238000003304 gavage Methods 0.000 description 2
- 235000021472 generally recognized as safe Nutrition 0.000 description 2
- 210000004907 gland Anatomy 0.000 description 2
- 108010051239 glutaminyl-tRNA synthetase Proteins 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 239000001963 growth medium Substances 0.000 description 2
- 239000003228 hemolysin Substances 0.000 description 2
- QWPPOHNGKGFGJK-UHFFFAOYSA-N hypochlorous acid Chemical compound ClO QWPPOHNGKGFGJK-UHFFFAOYSA-N 0.000 description 2
- 210000000936 intestine Anatomy 0.000 description 2
- 150000002500 ions Chemical class 0.000 description 2
- 210000001630 jejunum Anatomy 0.000 description 2
- 101150115163 katA gene Proteins 0.000 description 2
- 101150108683 katG2 gene Proteins 0.000 description 2
- 230000002147 killing effect Effects 0.000 description 2
- 229940017800 lactobacillus casei Drugs 0.000 description 2
- 239000010410 layer Substances 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000002101 lytic effect Effects 0.000 description 2
- 239000003550 marker Substances 0.000 description 2
- 239000000463 material Substances 0.000 description 2
- 229910052751 metal Inorganic materials 0.000 description 2
- 239000002184 metal Substances 0.000 description 2
- 125000002496 methyl group Chemical group [H]C([H])([H])* 0.000 description 2
- 230000000813 microbial effect Effects 0.000 description 2
- 101150044129 nirB gene Proteins 0.000 description 2
- 230000009437 off-target effect Effects 0.000 description 2
- 150000001451 organic peroxides Chemical class 0.000 description 2
- 230000003647 oxidation Effects 0.000 description 2
- 238000007254 oxidation reaction Methods 0.000 description 2
- 230000007918 pathogenicity Effects 0.000 description 2
- 230000037361 pathway Effects 0.000 description 2
- 150000002978 peroxides Chemical class 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- 230000035790 physiological processes and functions Effects 0.000 description 2
- 210000004180 plasmocyte Anatomy 0.000 description 2
- 230000002265 prevention Effects 0.000 description 2
- 230000000644 propagated effect Effects 0.000 description 2
- 150000003254 radicals Chemical class 0.000 description 2
- 210000003289 regulatory T cell Anatomy 0.000 description 2
- 230000000717 retained effect Effects 0.000 description 2
- 230000000979 retarding effect Effects 0.000 description 2
- 210000003705 ribosome Anatomy 0.000 description 2
- 239000000523 sample Substances 0.000 description 2
- 238000013077 scoring method Methods 0.000 description 2
- 101150033650 soxS gene Proteins 0.000 description 2
- 210000000952 spleen Anatomy 0.000 description 2
- 230000006641 stabilisation Effects 0.000 description 2
- 238000011105 stabilization Methods 0.000 description 2
- 230000000638 stimulation Effects 0.000 description 2
- 229960005322 streptomycin Drugs 0.000 description 2
- 150000008163 sugars Chemical class 0.000 description 2
- 230000001629 suppression Effects 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 101150061166 tetR gene Proteins 0.000 description 2
- RWQNBRDOKXIBIV-UHFFFAOYSA-N thymine Chemical compound CC1=CNC(=O)NC1=O RWQNBRDOKXIBIV-UHFFFAOYSA-N 0.000 description 2
- 101150110352 torT gene Proteins 0.000 description 2
- 230000005945 translocation Effects 0.000 description 2
- 238000011144 upstream manufacturing Methods 0.000 description 2
- 101150096946 ydfZ gene Proteins 0.000 description 2
- GMKMEZVLHJARHF-UHFFFAOYSA-N (2R,6R)-form-2.6-Diaminoheptanedioic acid Natural products OC(=O)C(N)CCCC(N)C(O)=O GMKMEZVLHJARHF-UHFFFAOYSA-N 0.000 description 1
- HKZAAJSTFUZYTO-LURJTMIESA-N (2s)-2-[[2-[[2-[[2-[(2-aminoacetyl)amino]acetyl]amino]acetyl]amino]acetyl]amino]-3-hydroxypropanoic acid Chemical compound NCC(=O)NCC(=O)NCC(=O)NCC(=O)N[C@@H](CO)C(O)=O HKZAAJSTFUZYTO-LURJTMIESA-N 0.000 description 1
- MGWGWNFMUOTEHG-UHFFFAOYSA-N 4-(3,5-dimethylphenyl)-1,3-thiazol-2-amine Chemical compound CC1=CC(C)=CC(C=2N=C(N)SC=2)=C1 MGWGWNFMUOTEHG-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- RZVAJINKPMORJF-UHFFFAOYSA-N Acetaminophen Chemical compound CC(=O)NC1=CC=C(O)C=C1 RZVAJINKPMORJF-UHFFFAOYSA-N 0.000 description 1
- 102100027211 Albumin Human genes 0.000 description 1
- 108010088751 Albumins Proteins 0.000 description 1
- 241001233887 Ania Species 0.000 description 1
- 101710109637 Antigen 43 Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 241000180579 Arca Species 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 1
- 101100427060 Bacillus spizizenii (strain ATCC 23059 / NRRL B-14472 / W23) thyA1 gene Proteins 0.000 description 1
- 101100402524 Bacillus subtilis (strain 168) mrgA gene Proteins 0.000 description 1
- 101100197953 Bacillus subtilis (strain 168) rlbA gene Proteins 0.000 description 1
- 108091032955 Bacterial small RNA Proteins 0.000 description 1
- 241000186018 Bifidobacterium adolescentis Species 0.000 description 1
- 241000003117 Bifidobacterium breve UCC2003 Species 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- 241000589875 Campylobacter jejuni Species 0.000 description 1
- 102000014914 Carrier Proteins Human genes 0.000 description 1
- 241000863012 Caulobacter Species 0.000 description 1
- 206010008631 Cholera Diseases 0.000 description 1
- 241000588923 Citrobacter Species 0.000 description 1
- 241001112696 Clostridia Species 0.000 description 1
- 241001112695 Clostridiales Species 0.000 description 1
- 241000193401 Clostridium acetobutylicum Species 0.000 description 1
- 241000193454 Clostridium beijerinckii Species 0.000 description 1
- 241000193167 Clostridium cochlearium Species 0.000 description 1
- 241001509499 Clostridium felsineum Species 0.000 description 1
- 241001147791 Clostridium paraputrificum Species 0.000 description 1
- 241000193468 Clostridium perfringens Species 0.000 description 1
- 241001656801 Clostridium roseum Species 0.000 description 1
- 241000186528 Clostridium tertium Species 0.000 description 1
- 241000193449 Clostridium tetani Species 0.000 description 1
- 241001147721 Clostridium thermobutyricum Species 0.000 description 1
- 241000272925 Clostridium tyrobutyricum DSM 2637 = ATCC 25755 = JCM 11008 Species 0.000 description 1
- 108010073254 Colicins Proteins 0.000 description 1
- 208000018458 Colitis-Associated Neoplasms Diseases 0.000 description 1
- 206010010904 Convulsion Diseases 0.000 description 1
- 241000186216 Corynebacterium Species 0.000 description 1
- 241000186226 Corynebacterium glutamicum Species 0.000 description 1
- 241000195493 Cryptophyta Species 0.000 description 1
- 101710154303 Cyclic AMP receptor protein Proteins 0.000 description 1
- ZAQJHHRNXZUBTE-WUJLRWPWSA-N D-xylulose Chemical compound OC[C@@H](O)[C@H](O)C(=O)CO ZAQJHHRNXZUBTE-WUJLRWPWSA-N 0.000 description 1
- 230000006820 DNA synthesis Effects 0.000 description 1
- 102000052510 DNA-Binding Proteins Human genes 0.000 description 1
- 101710096438 DNA-binding protein Proteins 0.000 description 1
- 206010011878 Deafness Diseases 0.000 description 1
- 206010012741 Diarrhoea haemorrhagic Diseases 0.000 description 1
- 101100030906 Dickeya chrysanthemi prtD gene Proteins 0.000 description 1
- 101100409540 Dictyostelium discoideum psmA3 gene Proteins 0.000 description 1
- 101100465553 Dictyostelium discoideum psmB6 gene Proteins 0.000 description 1
- 108010016626 Dipeptides Proteins 0.000 description 1
- 210000001783 ELP Anatomy 0.000 description 1
- 102000016942 Elastin Human genes 0.000 description 1
- 108010014258 Elastin Proteins 0.000 description 1
- 241000792859 Enema Species 0.000 description 1
- 241000588914 Enterobacter Species 0.000 description 1
- 241000701832 Enterobacteria phage T3 Species 0.000 description 1
- 206010015150 Erythema Diseases 0.000 description 1
- 101100390720 Escherichia coli (strain K12) fhuF gene Proteins 0.000 description 1
- 101100126128 Escherichia coli (strain K12) insE6 gene Proteins 0.000 description 1
- 241000660147 Escherichia coli str. K-12 substr. MG1655 Species 0.000 description 1
- 101100153154 Escherichia phage T5 thy gene Proteins 0.000 description 1
- 241000186394 Eubacterium Species 0.000 description 1
- 206010063560 Excessive granulation tissue Diseases 0.000 description 1
- 108010007457 Extracellular Signal-Regulated MAP Kinases Proteins 0.000 description 1
- 108010014531 FMN Reductase Proteins 0.000 description 1
- 101150099538 FNR gene Proteins 0.000 description 1
- 241001608234 Faecalibacterium Species 0.000 description 1
- 241000605980 Faecalibacterium prausnitzii Species 0.000 description 1
- 108091006020 Fc-tagged proteins Proteins 0.000 description 1
- VTLYFUHAOXGGBS-UHFFFAOYSA-N Fe3+ Chemical compound [Fe+3] VTLYFUHAOXGGBS-UHFFFAOYSA-N 0.000 description 1
- MBMLMWLHJBBADN-UHFFFAOYSA-N Ferrous sulfide Chemical class [Fe]=S MBMLMWLHJBBADN-UHFFFAOYSA-N 0.000 description 1
- 102000009123 Fibrin Human genes 0.000 description 1
- 108010073385 Fibrin Proteins 0.000 description 1
- BWGVNKXGVNDBDI-UHFFFAOYSA-N Fibrin monomer Chemical compound CNC(=O)CNC(=O)CN BWGVNKXGVNDBDI-UHFFFAOYSA-N 0.000 description 1
- 108010057573 Flavoproteins Proteins 0.000 description 1
- 102000003983 Flavoproteins Human genes 0.000 description 1
- 241000233866 Fungi Species 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 108700028146 Genetic Enhancer Elements Proteins 0.000 description 1
- 102000005720 Glutathione transferase Human genes 0.000 description 1
- 108010070675 Glutathione transferase Proteins 0.000 description 1
- 101100508941 Halobacterium salinarum (strain ATCC 700922 / JCM 11081 / NRC-1) ppa gene Proteins 0.000 description 1
- 241000193159 Hathewaya histolytica Species 0.000 description 1
- 108010006464 Hemolysin Proteins Proteins 0.000 description 1
- 206010019663 Hepatic failure Diseases 0.000 description 1
- 108010072039 Histidine kinase Proteins 0.000 description 1
- 206010020565 Hyperaemia Diseases 0.000 description 1
- 208000031226 Hyperlipidaemia Diseases 0.000 description 1
- 206010058359 Hypogonadism Diseases 0.000 description 1
- 206010022489 Insulin Resistance Diseases 0.000 description 1
- 108091092195 Intron Proteins 0.000 description 1
- 206010022971 Iron Deficiencies Diseases 0.000 description 1
- 102000008133 Iron-Binding Proteins Human genes 0.000 description 1
- 108010035210 Iron-Binding Proteins Proteins 0.000 description 1
- 241000588748 Klebsiella Species 0.000 description 1
- ONIBWKKTOPOVIA-BYPYZUCNSA-N L-Proline Chemical compound OC(=O)[C@@H]1CCCN1 ONIBWKKTOPOVIA-BYPYZUCNSA-N 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- 108010063045 Lactoferrin Proteins 0.000 description 1
- 102100032241 Lactotransferrin Human genes 0.000 description 1
- 235000019687 Lamb Nutrition 0.000 description 1
- 108091026898 Leader sequence (mRNA) Proteins 0.000 description 1
- 241000589248 Legionella Species 0.000 description 1
- 208000007764 Legionnaires' Disease Diseases 0.000 description 1
- 101100278567 Lelliottia amnigena dsbL gene Proteins 0.000 description 1
- 241000186781 Listeria Species 0.000 description 1
- 241000186779 Listeria monocytogenes Species 0.000 description 1
- 208000019693 Lung disease Diseases 0.000 description 1
- 208000002720 Malnutrition Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- 241000736262 Microbiota Species 0.000 description 1
- 102100024193 Mitogen-activated protein kinase 1 Human genes 0.000 description 1
- 102000008109 Mixed Function Oxygenases Human genes 0.000 description 1
- 108010074633 Mixed Function Oxygenases Proteins 0.000 description 1
- 241000699666 Mus <mouse, genus> Species 0.000 description 1
- 241000186359 Mycobacterium Species 0.000 description 1
- 241000186366 Mycobacterium bovis Species 0.000 description 1
- 102000003896 Myeloperoxidases Human genes 0.000 description 1
- 108090000235 Myeloperoxidases Proteins 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- 206010054107 Nodule Diseases 0.000 description 1
- 208000008589 Obesity Diseases 0.000 description 1
- 108010038807 Oligopeptides Proteins 0.000 description 1
- 102000015636 Oligopeptides Human genes 0.000 description 1
- 102000004316 Oxidoreductases Human genes 0.000 description 1
- 108090000854 Oxidoreductases Proteins 0.000 description 1
- CBENFWSGALASAD-UHFFFAOYSA-N Ozone Chemical compound [O-][O+]=O CBENFWSGALASAD-UHFFFAOYSA-N 0.000 description 1
- 229910019142 PO4 Inorganic materials 0.000 description 1
- 101150056612 PPIA gene Proteins 0.000 description 1
- 208000002193 Pain Diseases 0.000 description 1
- 241000599931 Paris quadrifolia Species 0.000 description 1
- 208000031481 Pathologic Constriction Diseases 0.000 description 1
- 206010034960 Photophobia Diseases 0.000 description 1
- 229920001213 Polysorbate 20 Polymers 0.000 description 1
- 208000004880 Polyuria Diseases 0.000 description 1
- 208000002389 Pouchitis Diseases 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 108010029485 Protein Isoforms Proteins 0.000 description 1
- 102000001708 Protein Isoforms Human genes 0.000 description 1
- 102100029812 Protein S100-A12 Human genes 0.000 description 1
- 241000202386 Pseudobutyrivibrio Species 0.000 description 1
- 108700014910 Pseudomonas aeruginosa DNR Proteins 0.000 description 1
- 241000589540 Pseudomonas fluorescens Species 0.000 description 1
- 241000589755 Pseudomonas mendocina Species 0.000 description 1
- 241000589776 Pseudomonas putida Species 0.000 description 1
- 241000589615 Pseudomonas syringae Species 0.000 description 1
- 101710193192 Putative transcriptional regulator Proteins 0.000 description 1
- 206010037660 Pyrexia Diseases 0.000 description 1
- 101100169519 Pyrococcus abyssi (strain GE5 / Orsay) dapAL gene Proteins 0.000 description 1
- 238000010240 RT-PCR analysis Methods 0.000 description 1
- 208000001647 Renal Insufficiency Diseases 0.000 description 1
- 108091027981 Response element Proteins 0.000 description 1
- 101100091507 Rhizobium etli (strain CFN 42 / ATCC 51251) rosR gene Proteins 0.000 description 1
- 101100313751 Rickettsia conorii (strain ATCC VR-613 / Malish 7) thyX gene Proteins 0.000 description 1
- 241000605947 Roseburia Species 0.000 description 1
- 241000192031 Ruminococcus Species 0.000 description 1
- 241001138501 Salmonella enterica Species 0.000 description 1
- 241000293869 Salmonella enterica subsp. enterica serovar Typhimurium Species 0.000 description 1
- 241001468001 Salmonella virus SP6 Species 0.000 description 1
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 1
- 241000607768 Shigella Species 0.000 description 1
- 239000005708 Sodium hypochlorite Substances 0.000 description 1
- 229920002472 Starch Polymers 0.000 description 1
- 102100029856 Steroidogenic factor 1 Human genes 0.000 description 1
- 241001136694 Subdoligranulum Species 0.000 description 1
- 101100329526 Synechocystis sp. (strain PCC 6803 / Kazusa) csd gene Proteins 0.000 description 1
- 108091036066 Three prime untranslated region Proteins 0.000 description 1
- 102000004338 Transferrin Human genes 0.000 description 1
- 108090000901 Transferrin Proteins 0.000 description 1
- 108700019146 Transgenes Proteins 0.000 description 1
- 108010058153 Twin-Arginine-Translocation System Proteins 0.000 description 1
- 241000607598 Vibrio Species 0.000 description 1
- 241000607626 Vibrio cholerae Species 0.000 description 1
- 206010047513 Vision blurred Diseases 0.000 description 1
- 208000021017 Weight Gain Diseases 0.000 description 1
- 241000607734 Yersinia <bacteria> Species 0.000 description 1
- 241001522212 [Clostridium] populeti Species 0.000 description 1
- 241001656794 [Clostridium] saccharolyticum Species 0.000 description 1
- 230000003187 abdominal effect Effects 0.000 description 1
- 238000010521 absorption reaction Methods 0.000 description 1
- 238000009825 accumulation Methods 0.000 description 1
- 230000021736 acetylation Effects 0.000 description 1
- 238000006640 acetylation reaction Methods 0.000 description 1
- 239000012190 activator Substances 0.000 description 1
- 239000004480 active ingredient Substances 0.000 description 1
- 239000002671 adjuvant Substances 0.000 description 1
- 241001148470 aerobic bacillus Species 0.000 description 1
- 230000004103 aerobic respiration Effects 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 125000000539 amino acid group Chemical group 0.000 description 1
- 208000007502 anemia Diseases 0.000 description 1
- 208000022531 anorexia Diseases 0.000 description 1
- 239000002260 anti-inflammatory agent Substances 0.000 description 1
- 229940121363 anti-inflammatory agent Drugs 0.000 description 1
- 230000000692 anti-sense effect Effects 0.000 description 1
- 210000000436 anus Anatomy 0.000 description 1
- 230000004596 appetite loss Effects 0.000 description 1
- 238000013459 approach Methods 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 238000003491 array Methods 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 230000037429 base substitution Effects 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 210000000013 bile duct Anatomy 0.000 description 1
- 108091008324 binding proteins Proteins 0.000 description 1
- 230000000975 bioactive effect Effects 0.000 description 1
- 239000003181 biological factor Substances 0.000 description 1
- 230000031018 biological processes and functions Effects 0.000 description 1
- 230000000903 blocking effect Effects 0.000 description 1
- 208000027503 bloody stool Diseases 0.000 description 1
- 210000004899 c-terminal region Anatomy 0.000 description 1
- 108091006374 cAMP receptor proteins Proteins 0.000 description 1
- NKWPZUCBCARRDP-UHFFFAOYSA-L calcium bicarbonate Chemical compound [Ca+2].OC([O-])=O.OC([O-])=O NKWPZUCBCARRDP-UHFFFAOYSA-L 0.000 description 1
- 229910000020 calcium bicarbonate Inorganic materials 0.000 description 1
- PGFBRHFANBMLLX-UHFFFAOYSA-K calcium sodium dihydrogen phosphate carbonate Chemical compound [Na+].[Ca+2].OC([O-])=O.OP([O-])([O-])=O PGFBRHFANBMLLX-UHFFFAOYSA-K 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- 230000009015 carbon catabolite repression of transcription Effects 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 210000002421 cell wall Anatomy 0.000 description 1
- 235000010980 cellulose Nutrition 0.000 description 1
- 229920002678 cellulose Polymers 0.000 description 1
- 239000001913 cellulose Substances 0.000 description 1
- 238000012512 characterization method Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003638 chemical reducing agent Substances 0.000 description 1
- 208000019425 cirrhosis of liver Diseases 0.000 description 1
- 238000003776 cleavage reaction Methods 0.000 description 1
- 230000000295 complement effect Effects 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000002591 computed tomography Methods 0.000 description 1
- 239000002872 contrast media Substances 0.000 description 1
- 238000011443 conventional therapy Methods 0.000 description 1
- 101150000386 cpfC gene Proteins 0.000 description 1
- 238000005520 cutting process Methods 0.000 description 1
- 230000009089 cytolysis Effects 0.000 description 1
- 239000000824 cytostatic agent Substances 0.000 description 1
- 230000001085 cytostatic effect Effects 0.000 description 1
- 231100000599 cytotoxic agent Toxicity 0.000 description 1
- 239000002619 cytotoxin Substances 0.000 description 1
- 101150011371 dapA gene Proteins 0.000 description 1
- 206010061428 decreased appetite Diseases 0.000 description 1
- 230000007123 defense Effects 0.000 description 1
- 238000001212 derivatisation Methods 0.000 description 1
- 238000001514 detection method Methods 0.000 description 1
- 238000001784 detoxification Methods 0.000 description 1
- 238000011161 development Methods 0.000 description 1
- 230000018109 developmental process Effects 0.000 description 1
- 230000004069 differentiation Effects 0.000 description 1
- 238000009792 diffusion process Methods 0.000 description 1
- 230000029087 digestion Effects 0.000 description 1
- 239000003085 diluting agent Substances 0.000 description 1
- 238000006471 dimerization reaction Methods 0.000 description 1
- 230000000447 dimerizing effect Effects 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- 229910001882 dioxygen Inorganic materials 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 208000016097 disease of metabolism Diseases 0.000 description 1
- 230000003828 downregulation Effects 0.000 description 1
- 101150009558 dsbA gene Proteins 0.000 description 1
- 101150026863 dsbG gene Proteins 0.000 description 1
- 208000001848 dysentery Diseases 0.000 description 1
- 229940121647 egfr inhibitor Drugs 0.000 description 1
- 229920002549 elastin Polymers 0.000 description 1
- 239000007920 enema Substances 0.000 description 1
- 229940079360 enema for constipation Drugs 0.000 description 1
- 230000002708 enhancing effect Effects 0.000 description 1
- 239000000147 enterotoxin Substances 0.000 description 1
- 231100000655 enterotoxin Toxicity 0.000 description 1
- 231100000321 erythema Toxicity 0.000 description 1
- 230000005284 excitation Effects 0.000 description 1
- 230000029142 excretion Effects 0.000 description 1
- 230000002349 favourable effect Effects 0.000 description 1
- 229910001447 ferric ion Inorganic materials 0.000 description 1
- 229950003499 fibrin Drugs 0.000 description 1
- 230000004992 fission Effects 0.000 description 1
- GNBHRKFJIUUOQI-UHFFFAOYSA-N fluorescein Chemical compound O1C(=O)C2=CC=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 GNBHRKFJIUUOQI-UHFFFAOYSA-N 0.000 description 1
- 238000002866 fluorescence resonance energy transfer Methods 0.000 description 1
- 239000007850 fluorescent dye Substances 0.000 description 1
- 230000037406 food intake Effects 0.000 description 1
- 210000000232 gallbladder Anatomy 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000012246 gene addition Methods 0.000 description 1
- 238000003208 gene overexpression Methods 0.000 description 1
- 231100000024 genotoxic Toxicity 0.000 description 1
- 230000001738 genotoxic effect Effects 0.000 description 1
- 150000004676 glycans Chemical class 0.000 description 1
- 230000013595 glycosylation Effects 0.000 description 1
- 238000006206 glycosylation reaction Methods 0.000 description 1
- 210000002175 goblet cell Anatomy 0.000 description 1
- 101150077538 gor gene Proteins 0.000 description 1
- 238000005469 granulation Methods 0.000 description 1
- 230000003179 granulation Effects 0.000 description 1
- 210000001126 granulation tissue Anatomy 0.000 description 1
- 208000035474 group of disease Diseases 0.000 description 1
- 230000036433 growing body Effects 0.000 description 1
- 101150002138 grxA gene Proteins 0.000 description 1
- 101150107068 gsiB gene Proteins 0.000 description 1
- 239000002271 gyrase inhibitor Substances 0.000 description 1
- 150000003278 haem Chemical class 0.000 description 1
- 230000036541 health Effects 0.000 description 1
- 230000007407 health benefit Effects 0.000 description 1
- 230000010370 hearing loss Effects 0.000 description 1
- 231100000888 hearing loss Toxicity 0.000 description 1
- 208000016354 hearing loss disease Diseases 0.000 description 1
- 101150042363 hemH gene Proteins 0.000 description 1
- 208000035861 hematochezia Diseases 0.000 description 1
- 230000002962 histologic effect Effects 0.000 description 1
- 230000003284 homeostatic effect Effects 0.000 description 1
- 230000013632 homeostatic process Effects 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 101150099805 htpG gene Proteins 0.000 description 1
- 150000002432 hydroperoxides Chemical class 0.000 description 1
- OUUQCZGPVNCOIJ-UHFFFAOYSA-N hydroperoxyl Chemical compound O[O] OUUQCZGPVNCOIJ-UHFFFAOYSA-N 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- TUJKJAMUKRIRHC-UHFFFAOYSA-N hydroxyl Chemical compound [OH] TUJKJAMUKRIRHC-UHFFFAOYSA-N 0.000 description 1
- 206010020718 hyperplasia Diseases 0.000 description 1
- WQYVRQLZKVEZGA-UHFFFAOYSA-N hypochlorite Chemical compound Cl[O-] WQYVRQLZKVEZGA-UHFFFAOYSA-N 0.000 description 1
- 238000010191 image analysis Methods 0.000 description 1
- 230000005965 immune activity Effects 0.000 description 1
- 230000001900 immune effect Effects 0.000 description 1
- 210000000987 immune system Anatomy 0.000 description 1
- 230000036039 immunity Effects 0.000 description 1
- 238000003018 immunoassay Methods 0.000 description 1
- 238000003125 immunofluorescent labeling Methods 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 230000008676 import Effects 0.000 description 1
- 230000002779 inactivation Effects 0.000 description 1
- 208000015181 infectious disease Diseases 0.000 description 1
- 230000002458 infectious effect Effects 0.000 description 1
- 208000000509 infertility Diseases 0.000 description 1
- 230000036512 infertility Effects 0.000 description 1
- 231100000535 infertility Toxicity 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 210000005027 intestinal barrier Anatomy 0.000 description 1
- 230000007358 intestinal barrier function Effects 0.000 description 1
- 210000004966 intestinal stem cell Anatomy 0.000 description 1
- 229910052742 iron Inorganic materials 0.000 description 1
- BKWBIMSGEOYWCJ-UHFFFAOYSA-L iron;iron(2+);sulfanide Chemical compound [SH-].[SH-].[Fe].[Fe+2] BKWBIMSGEOYWCJ-UHFFFAOYSA-L 0.000 description 1
- 230000007794 irritation Effects 0.000 description 1
- 238000006317 isomerization reaction Methods 0.000 description 1
- 208000017169 kidney disease Diseases 0.000 description 1
- 201000006370 kidney failure Diseases 0.000 description 1
- CSSYQJWUGATIHM-IKGCZBKSSA-N l-phenylalanyl-l-lysyl-l-cysteinyl-l-arginyl-l-arginyl-l-tryptophyl-l-glutaminyl-l-tryptophyl-l-arginyl-l-methionyl-l-lysyl-l-lysyl-l-leucylglycyl-l-alanyl-l-prolyl-l-seryl-l-isoleucyl-l-threonyl-l-cysteinyl-l-valyl-l-arginyl-l-arginyl-l-alanyl-l-phenylal Chemical compound C([C@H](N)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CS)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(C)C)C(=O)NCC(=O)N[C@@H](C)C(=O)N1CCC[C@H]1C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CS)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(O)=O)C1=CC=CC=C1 CSSYQJWUGATIHM-IKGCZBKSSA-N 0.000 description 1
- 101150066555 lacZ gene Proteins 0.000 description 1
- 229940078795 lactoferrin Drugs 0.000 description 1
- 235000021242 lactoferrin Nutrition 0.000 description 1
- 208000013469 light sensitivity Diseases 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 208000019423 liver disease Diseases 0.000 description 1
- 208000007903 liver failure Diseases 0.000 description 1
- 231100000835 liver failure Toxicity 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 210000004698 lymphocyte Anatomy 0.000 description 1
- 230000001071 malnutrition Effects 0.000 description 1
- 235000000824 malnutrition Nutrition 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 230000000873 masking effect Effects 0.000 description 1
- 230000035800 maturation Effects 0.000 description 1
- 230000001404 mediated effect Effects 0.000 description 1
- KBOPZPXVLCULAV-UHFFFAOYSA-N mesalamine Chemical compound NC1=CC=C(O)C(C(O)=O)=C1 KBOPZPXVLCULAV-UHFFFAOYSA-N 0.000 description 1
- 229960004963 mesalazine Drugs 0.000 description 1
- GMKMEZVLHJARHF-SYDPRGILSA-N meso-2,6-diaminopimelic acid Chemical compound [O-]C(=O)[C@@H]([NH3+])CCC[C@@H]([NH3+])C([O-])=O GMKMEZVLHJARHF-SYDPRGILSA-N 0.000 description 1
- 101150086633 metAA gene Proteins 0.000 description 1
- 101150087366 mglB gene Proteins 0.000 description 1
- 101150055934 mgrA gene Proteins 0.000 description 1
- 244000000010 microbial pathogen Species 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 208000018962 mouth sore Diseases 0.000 description 1
- 230000008937 mucosal improvement Effects 0.000 description 1
- 230000004678 mucosal integrity Effects 0.000 description 1
- 230000003387 muscular Effects 0.000 description 1
- 238000002703 mutagenesis Methods 0.000 description 1
- 231100000350 mutagenesis Toxicity 0.000 description 1
- 230000012666 negative regulation of transcription by glucose Effects 0.000 description 1
- 230000008599 nitrosative stress Effects 0.000 description 1
- 239000001272 nitrous oxide Substances 0.000 description 1
- 102000042567 non-coding RNA Human genes 0.000 description 1
- 231100001222 nononcogenic Toxicity 0.000 description 1
- 101150002988 norR gene Proteins 0.000 description 1
- 231100000862 numbness Toxicity 0.000 description 1
- 235000021231 nutrient uptake Nutrition 0.000 description 1
- 208000015380 nutritional deficiency disease Diseases 0.000 description 1
- 206010029864 nystagmus Diseases 0.000 description 1
- 235000020824 obesity Nutrition 0.000 description 1
- 101150110245 ompC gene Proteins 0.000 description 1
- 101150093139 ompT gene Proteins 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 101150008884 osmY gene Proteins 0.000 description 1
- 239000007800 oxidant agent Substances 0.000 description 1
- 230000004792 oxidative damage Effects 0.000 description 1
- 101150114893 oxyR gene Proteins 0.000 description 1
- 208000014965 pancolitis Diseases 0.000 description 1
- 210000000496 pancreas Anatomy 0.000 description 1
- 244000045947 parasite Species 0.000 description 1
- 230000008506 pathogenesis Effects 0.000 description 1
- 238000010647 peptide synthesis reaction Methods 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 239000010452 phosphate Substances 0.000 description 1
- 238000003566 phosphorylation assay Methods 0.000 description 1
- 230000004962 physiological condition Effects 0.000 description 1
- 230000004260 plant-type cell wall biogenesis Effects 0.000 description 1
- 230000008488 polyadenylation Effects 0.000 description 1
- 206010036067 polydipsia Diseases 0.000 description 1
- 229920001223 polyethylene glycol Polymers 0.000 description 1
- 229930001118 polyketide hybrid Natural products 0.000 description 1
- 125000003308 polyketide hybrid group Chemical group 0.000 description 1
- 229920000642 polymer Polymers 0.000 description 1
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 1
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 1
- 208000022530 polyphagia Diseases 0.000 description 1
- 229940068977 polysorbate 20 Drugs 0.000 description 1
- 239000011148 porous material Substances 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 238000012545 processing Methods 0.000 description 1
- 206010036784 proctocolitis Diseases 0.000 description 1
- 208000017048 proctosigmoiditis Diseases 0.000 description 1
- 229940002612 prodrug Drugs 0.000 description 1
- 239000000651 prodrug Substances 0.000 description 1
- 230000000770 proinflammatory effect Effects 0.000 description 1
- 235000013930 proline Nutrition 0.000 description 1
- 230000001737 promoting effect Effects 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 230000004850 protein–protein interaction Effects 0.000 description 1
- 230000017854 proteolysis Effects 0.000 description 1
- 230000002797 proteolythic effect Effects 0.000 description 1
- 230000006337 proteolytic cleavage Effects 0.000 description 1
- 230000008141 pubertal development Effects 0.000 description 1
- 238000000746 purification Methods 0.000 description 1
- 230000009257 reactivity Effects 0.000 description 1
- 238000003753 real-time PCR Methods 0.000 description 1
- 230000008707 rearrangement Effects 0.000 description 1
- 102000005962 receptors Human genes 0.000 description 1
- 108020003175 receptors Proteins 0.000 description 1
- 230000006798 recombination Effects 0.000 description 1
- 238000005215 recombination Methods 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000009711 regulatory function Effects 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 230000011506 response to oxidative stress Effects 0.000 description 1
- 230000003938 response to stress Effects 0.000 description 1
- 229920006395 saturated elastomer Polymers 0.000 description 1
- 230000007017 scission Effects 0.000 description 1
- 230000009962 secretion pathway Effects 0.000 description 1
- 230000001953 sensory effect Effects 0.000 description 1
- 238000012163 sequencing technique Methods 0.000 description 1
- 235000004400 serine Nutrition 0.000 description 1
- 208000026775 severe diarrhea Diseases 0.000 description 1
- 230000035939 shock Effects 0.000 description 1
- 150000004666 short chain fatty acids Chemical class 0.000 description 1
- 210000001599 sigmoid colon Anatomy 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 239000002356 single layer Substances 0.000 description 1
- 239000008107 starch Substances 0.000 description 1
- 235000019698 starch Nutrition 0.000 description 1
- 229940032147 starch Drugs 0.000 description 1
- 230000036262 stenosis Effects 0.000 description 1
- 208000037804 stenosis Diseases 0.000 description 1
- 238000003756 stirring Methods 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- 101150118796 sufS gene Proteins 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 101150072314 thyA gene Proteins 0.000 description 1
- 229940113082 thymine Drugs 0.000 description 1
- 210000001578 tight junction Anatomy 0.000 description 1
- 231100000331 toxic Toxicity 0.000 description 1
- 230000002588 toxic effect Effects 0.000 description 1
- 108091008023 transcriptional regulators Proteins 0.000 description 1
- 239000012581 transferrin Substances 0.000 description 1
- 230000009466 transformation Effects 0.000 description 1
- 230000009261 transgenic effect Effects 0.000 description 1
- 238000011277 treatment modality Methods 0.000 description 1
- 101150118060 trxA gene Proteins 0.000 description 1
- 101150112435 trxC gene Proteins 0.000 description 1
- 238000010396 two-hybrid screening Methods 0.000 description 1
- 230000003827 upregulation Effects 0.000 description 1
- 230000036325 urinary excretion Effects 0.000 description 1
- 239000013598 vector Substances 0.000 description 1
- 235000015112 vegetable and seed oil Nutrition 0.000 description 1
- 239000008158 vegetable oil Substances 0.000 description 1
- 239000000304 virulence factor Substances 0.000 description 1
- 230000007923 virulence factor Effects 0.000 description 1
- 239000002699 waste material Substances 0.000 description 1
- 230000004584 weight gain Effects 0.000 description 1
- 235000019786 weight gain Nutrition 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 101150024223 yaaA gene Proteins 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K35/00—Medicinal preparations containing materials or reaction products thereof with undetermined constitution
- A61K35/66—Microorganisms or materials therefrom
- A61K35/74—Bacteria
- A61K35/741—Probiotics
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K14/00—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- C07K14/435—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- C07K14/475—Growth factors; Growth regulators
- C07K14/485—Epidermal growth factor [EGF], i.e. urogastrone
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07K—PEPTIDES
- C07K2319/00—Fusion polypeptide
- C07K2319/01—Fusion polypeptide containing a localisation/targetting motif
- C07K2319/02—Fusion polypeptide containing a localisation/targetting motif containing a signal sequence
Definitions
- probiotic bacteria are beneficial in the treatment or prevention of various diseases or disorders associated with the gut, including, for example, gastrointestinal disorders such as Crohn’s disease and inflammatory bowel syndrome.
- gastrointestinal disorders such as Crohn’s disease and inflammatory bowel syndrome.
- recombinant bacteria have emerged as a potential new therapeutic treatment modality for gastrointestinal diseases and have also opened the field of bacterial therapies to a large number of other indications, including metabolic diseases, and inflammatory diseases.
- One benefit of recombinant bacteria is the ability to specifically target one or more disease mechanisms.
- bacteria can be engineered to contain genes for the expression of anti-inflammatory agents or agents that aid in the healing of a disrupted gut-barrier, such as the short chain fatty acid butyrate, e.g., as described in International Patent Publication W02016141108.
- bacterial therapies have the additional advantage that the size of the bacterial chromosome(s) allows for the insertion of gene(s) for the production and secretion of multiple effectors.
- Potential secreted polypeptides include signaling molecules, such as cytokines and growth factors, their receptors, and single chain antibodies directed against cell surface molecules, many of which have been proposed as are promising candidates for therapeutic interference in a wide range of indications.
- problems include incomplete translocation across the inner membrane, insufficient capacity of the export machinery, and proteolytic degradation (Mergulhao et al., Biotechnology Advances 23 (2005) 177-202).
- a polypeptide to be secreted from a Gram-negative bacterium such as E. coli
- biochemical properties thereof such as formation of correct disulfide bonds, size of protein or levels of expression.
- the instant disclosure relates to compositions of recombinant bacteria and methods for secreting therapeutically active epidermal growth factor (EGF) from recombinant bacteria for treatment of diseases or disorders.
- EGF epidermal growth factor
- the recombinant bacteria disclosed herein are capable of high yield production of functionally active EGF molecules, which are secreted as therapeutically active EGF polypeptides.
- the recombinant bacteria are functionally silent until they reach an inducing environment, e.g., a mammalian gut, wherein expression of EGF is induced.
- the recombinant bacteria are naturally non-pathogenic and may be introduced into the gut in order to reduce gut inflammation and/or enhance gut barrier function and may thereby further ameliorate or prevent an autoimmune disorder.
- the secreted EGF molecule is stably produced by the recombinant bacteria, and/or the recombinant bacteria are stably maintained in vivo and/or in vitro.
- the disclosure also provides pharmaceutical compositions comprising the recombinant bacteria. Methods of treating diseases are also provided.
- the recombinant bacteria produce EGF under the control of one or more promoters induced by an environmental condition, e.g., an environmental condition found in the mammalian gut, such as an inflammatory condition or a low oxygen condition.
- an environmental condition e.g., an environmental condition found in the mammalian gut, such as an inflammatory condition or a low oxygen condition.
- the recombinant bacteria produce EGF under the control of an oxygen level- dependent promoter, a reactive oxygen species (ROS)-dependent promoter, a reactive nitrogen species (RNS) -dependent promoter, or a temperature sensitive promoter, and a corresponding transcription factor.
- ROS reactive oxygen species
- RNS reactive nitrogen species
- the recombinant bacterium comprises one or more one gene(s) encoding one or more EGF polypeptides for secretion of an active polypeptide in vivo, wherein the one or more gene sequence(s) for producing the EGF polypeptide is operably linked to a directly or indirectly inducible promoter that is not associated with the gene(s) in nature.
- the secretion tags are N terminally or C terminally fused to the EGF polypeptides.
- the secretion tag may be covalently linked to the N terminus of the polypeptide through a peptide bond or polypeptide linker.
- the secretion tag may be covalently linked to the C terminus of the polypeptide through a peptide bond or polypeptide linker.
- Non-limiting examples of contemplated secretion tags include PhoA, OmpF, ompA, cvaC, TorA, fdnG, dmsA, PelB, tolB, torT, dsbA, Gltl, GspD, HdeB, MalE, mglB, OppA, PpiA, lamb, ECOLIN_05715, ECOLIN_16495, ECOLIN_19410, and ECOLIN_19880 secretion signals.
- the secretion tag is cleaved after secretion into the extracellular environment.
- the secretion tag is PhoA.
- the secretion tag is ECOLIN 19410 secretion tag. In some embodiments, the secretion tag is GspD secretion tag. In some embodiments, the secretion tag is HdeB secretion tag. In some embodiments, the secretion tag is torT secretion tag. [0014] In some embodiments, the recombinant bacteria further have one or more mutations or deletions in an outer membrane protein selected from Ipp, nlP, tolA, and pal. In some embodiments, the fully or partially deleted or mutated outer membrane protein is pal. In some embodiments, the recombinant bacteria further encode a stabilizing polypeptide. In some embodiments, the EGF polypeptide is covalently fused to the stabilizing polypeptide through a peptide linker or a peptide bond.
- the C terminus of the EGF polypeptide is covalently fused to the N terminus of the stabilizing polypeptide through the peptide linker or peptide bond.
- the N terminus of the EGF polypeptide is covalently fused to the C terminus of the stabilizing polypeptide through the peptide linker or peptide bond.
- the stabilizing polypeptide comprises an immunoglobulin Fc polypeptide.
- the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin heavy chain CH2 constant region.
- the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin heavy chain CH3 constant region.
- the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin heavy chain CHI constant region. In some embodiments, the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin variable hinge region. In some embodiments, the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin variable hinge region, immunoglobulin heavy chain CH2 constant region and an immunoglobulin heavy chain CH3 constant region. In some embodiments, the immunoglobulin Fc polypeptide is a human IgA or human IgG Fc polypeptide. In some embodiments, the immunoglobulin Fc polypeptide is a human IgG Fc polypeptide.
- the immunoglobulin Fc polypeptide is a human IgA polypeptide.
- the linker comprises a glycine rich peptide.
- the glycine rich peptide comprises the sequence [GlyGlyGlyGlySer]n where n is 1, 2, 3, 4, 5 or 6 (SEQ ID NO: 344).
- the glycine rich peptide comprises the sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 212).
- the linker comprises GGGGSGGGS (SEQ ID NO: 345).
- the stabilizing polypeptide has the ability to perform an effector function.
- the stabilizing polypeptide is able to perform an anti-inflammatory effector function. In some embodiments, the stabilizing polypeptide is able to perform a pro-inflammatory effector function. In some embodiments, the stabilizing polypeptide is a cytokine.
- the stabilizing polypeptide is a multimer. In some embodiments, the stabilizing polypeptide is a dimer. In some embodiments, the gene sequences encoding the stabilizing polypeptide comprise a monomer and a second monomer, wherein the first and second monomer are covalently linked to each other through a peptide bond or a peptide linker.
- the gene sequences are located on a chromosome in the bacterium. In some embodiments, the gene sequences are located on a plasmid in the bacterium. In some embodiments, the bacterium is a probiotic bacterium. In some embodiments, the bacterium is selected from the group consisting of Bacteroides, Bifidobacterium, Clostridium, Escherichia, Lactobacillus, and Lactococcus. In some embodiments, the bacterium is selected from Clostridium novyi NT, and Clostridium butyricum, and Bifidobacterium longum. In some embodiments, the bacterium is Escherichia coli strain Nissle.
- the bacterium is an auxotroph in a gene that is complemented when the bacterium is present in a mammalian gut, e.g., an auxotroph in diaminopimelic acid or an enzyme in the thymine biosynthetic pathway.
- Pharmaceutically acceptable compositions comprising the bacteria and methods of treating or preventing disorders are also provided.
- a method treating a disease or disorder in a human subject comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal healing is induced in the gut of the subject after administration of the pharmaceutical composition, thereby treating the disease or disorder in the human subject.
- EGF epidermal growth factor
- a pharmaceutical composition for use in the treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal healing is induced in the gut of the human subject after administration of the pharmaceutical composition.
- EGF epidermal growth factor
- a pharmaceutical composition in the manufacture of a medicament for treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal healing is induced in the gut of the human subject after administration of the pharmaceutical composition.
- EGF epidermal growth factor
- mucosal healing comprises improvement or alleviation of one or more symptoms of the disease or disorder after the administration of the pharmaceutical composition as compared to the one or more symptoms prior to the administration of the pharmaceutical composition, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
- a method of inducing mucosal healing in the gut of a human subject in need thereof comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, thereby inducing mucosal healing.
- EGF epidermal growth factor
- a pharmaceutical composition for use in inducing mucosal healing in the gut of a human subject comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter.
- EGF epidermal growth factor
- a pharmaceutical composition in the manufacture of a medicament for inducing mucosal healing in the gut of a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter.
- EGF epidermal growth factor
- mucosal healing comprises improvement or alleviation of one or more symptoms exhibited by the subject after administration of the pharmaceutical composition as compared to the one or more symptoms exhibited by the subject prior to the administration of the pharmaceutical composition, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
- a method of treating a disease or disorder in a human subject comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal cell proliferation is induced in the gut mucosa of the subject after administration of the pharmaceutical composition, thereby treating the disease or disorder in the human subject.
- EGF epidermal growth factor
- a pharmaceutical composition for use in the treatment a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal cell proliferation is induced in the gut mucosa of the human subject after administration of the pharmaceutical composition.
- EGF epidermal growth factor
- a pharmaceutical composition in the manufacture of a medicament for treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal cell proliferation is induced in the gut mucosa of the human subject after administration of the pharmaceutical composition.
- EGF epidermal growth factor
- an expression level of one or more of the markers, Ki67, PCNA, and/or Edu are increased in the gut mucosa of the subject after administration of the pharmaceutical composition.
- the expression level of one or more of the markers, Ki67, PCNA, and/or Edu are increased in epithelial cells and/or lamina intestinal in the gut mucosa.
- a method of treating a disease or disorder in a human subject comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein an expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in the gut mucosa of the subject after administration of the pharmaceutical composition, thereby treating the disease or disorder in the human subject.
- EGF epidermal growth factor
- a pharmaceutical composition for use in the treatment a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein an expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in the gut mucosa of the subject after administration of the pharmaceutical composition as compared to before administration of the pharmaceutical composition.
- EGF epidermal growth factor
- a pharmaceutical composition in the manufacture of a medicament for treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein an expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in the gut mucosa of the subject after administration of the pharmaceutical composition as compared to before administration of the pharmaceutical composition.
- EGF epidermal growth factor
- the one or more markers is Ki67.
- the expression level of Ki67 is increased by at least 1.2 fold, at least 1.4 fold, at least 1.6 fold, at least 1.8 fold, at least 2.0 fold, at least 2.2 fold, at least 2.4 fold, at least 2.6 fold, at least 2.8 fold, at least 3.0 fold, at least 3.2 fold, at least 3.4 fold, at least 3.6 fold, at least 3.8 fold, at least 4.0 fold, at least 4.2 fold, at least 4.4 fold, at least 4.6 fold, at least 4.8 fold, or at least 5.0 fold in the gut of the subject as compared an expression level of expression of Ki67 in the gut of the subject prior receiving the pharmaceutical composition.
- the one or more markers is PCNA.
- the expression level of PCNA is increased at least 1.2 fold, at least 1.4 fold, at least 1.6 fold, at least 1.8 fold, at least 2.0 fold, at least 2.2 fold, at least 2.4 fold, at least 2.6 fold, at least 2.8 fold, at least 3.0 fold, or at least 3.2 fold as compared to an expression level of PCNA in the gut of the subject prior receiving the pharmaceutical composition.
- the one or more markers is Edu.
- the expression level of Edu is increased by at least 1.2 fold, at least 1.4 fold, at least 1.6 fold, at least 1.8 fold, at least 2.0 fold, at least 2.2 fold, at least 2.4 fold, at least 2.6 fold, at least 2.8 fold, at least 3.0 fold, or at least 3.2 fold as compared to an expression level of Edu in the gut of the subject prior receiving the pharmaceutical composition.
- the pharmaceutical composition is administered to the subject two times a day or three times a day.
- the method further comprises selecting a subject. In one embodiment, the method further comprises selecting a subject who would benefit from an increased expression level of one or more of the markers: Ki67, PCNA, and/or Edu. In one embodiment, the method further comprises selecting a subject who has a disease or a disorder. In one embodiment, the disease or disorder is an autoimmune disorder, a metabolic disease, a disease relating to inborn errors of metabolism, or a neurological or neurodegenerative disease.
- the method further comprising administering a carbon source to the subject.
- the carbon source is lactulose.
- a method of treating a disease or disorder in a human subject comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, administering a carbon source to the subject, thereby treating the disease or disorder in the human subject.
- the carbon source is lactulose.
- a pharmaceutical composition for use in the treatment a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, and administering a carbon source to the subject.
- EGF epidermal growth factor
- a pharmaceutical composition in the manufacture of a medicament for treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, and administering a carbon source to the subject.
- EGF epidermal growth factor
- the carbon source is administered at the same time as the pharmaceutical composition, in the same pharmaceutical composition, or at a different time as the pharmaceutical composition.
- the carbon source is lactulose.
- secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject is increased after administration of the carbon source as compared to a level of secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject prior to administration of the carbon source.
- secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject is increased at least 10-fold or at least 100-fold after administration of the carbon source compared to the level of secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject prior to administration of the carbon source.
- the pharmaceutical composition is administered to the subject with food. In some embodiments, the pharmaceutical composition is administered to the subject at least about 2 hr, at least 1.5 hr, at least 1 hr, at least 30 minutes, at least 10 minutes, or at least 5 minutes before food.
- the pharmaceutical composition is administered to the subject concurrently with food. In some embodiments, the pharmaceutical composition is administered to the subject at least about 2 hr, at least 1.5 hr, at least 1 hr, at least 30 minutes, at least 10 minutes, or at least 5 minutes after food.
- the pharmaceutical composition is administered to the subject between about 2 hr to about 5 minutes, about 2 hr to about 10 minutes, about 2 hour to about 30 minutes, about 2 hr to about 1 hr, about 2 hr to about 1.5 hr, about 1.5 hr to about 5 minutes, about 1.5 hr to about 10 minutes, about 1.5 hour to about 30 minutes, about 1.5 hr to about 1 hr, about 1 hr to about 5 minutes, about 1 hr to about 10 minutes, about 1 hour to about 30 minutes, about 30 minutes to about 5 minutes, about 30 minutes to about 10 minutes, about 30 minutes to about 5 minutes before food.
- the pharmaceutical composition is administered to the subject between about 2 hr to about 5 minutes, about 2 hr to about 10 minutes, about 2 hour to about 30 minutes, about 2 hr to about 1 hr, about 2 hr to about 1.5 hr, about 1.5 hr to about 5 minutes, about 1.5 hr to about 10 minutes, about 1.5 hour to about 30 minutes, about 1.5 hr to about 1 hr, about 1 hr to about 5 minutes, about 1 hr to about 10 minutes, about 1 hour to about 30 minutes, about 30 minutes to about 5 minutes, about 30 minutes to about 10 minutes, about 30 minutes to about 5 minutes after food.
- the pharmaceutical composition is administered to the subject once per day or twice per day.
- mucosal healing is induced in the gut of the subject after administration of the pharmaceutical composition.
- the pharmaceutical composition is administered orally.
- the carbon source is administered orally.
- the mucosal healing comprises improvement or alleviation of one or more symptoms exhibited by the subject after administration as compared to the one or more symptoms exhibited by the subject prior to administration, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
- the intestinal permeability is decreased in the gut of the subject after administration of the pharmaceutical composition as compared to the intestinal permeability in the gut of the subject prior to administration of the pharmaceutical composition.
- the intestinal permeability is decreased at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the intestinal permeability in the gut of the subject prior to administration of the pharmaceutical composition.
- the intestinal permeability is decreased between about 10% to about 100%, about 10% to about 95%, about 10% to about 90%, about 10% to about 85%, about 10% to about 80%, about 10% to about 75%, about 10% to about 70%, about 10% to about 65%, about 10% to about 60%, about 10% to about 55%, about 10% to about 50%, about 10% to about 45%, about 10% to about 40%, about 10% to about 35%, about 10% to about 30%, about 10% to about 25%, about 10% to about 20%, about 10% to about 15%, about 15% to about 100%, about 15% to about 95%, about 15% to about 90%, about 15% to about 85%, about 15% to about 80%, about 15% to about 75%, about 15% to about 70%, about 15% to about 65%, about 15% to about 60%, about 15% to about 55%, about 15% to about 50%, about 15% to about 45%, about 15% to about 40%, about 15% to about 35%, about 15% to about 30%, about 15% to about 25%, about 15% to about 20%, about 20% to about 100%, about 20% to about 15% to about 95%, about 15% to about
- the intestinal permeability is measured by a L:M test to determine the lactulose:mannitol ratio (LMR) in the subject’s urine after ingestion of solute comprising lactulose and mannitol.
- LMR lactulose:mannitol ratio
- inflammation is decreased in the gut of the subject after administration of the pharmaceutical composition as compared to the inflammation in the gut of the subject prior to administration of the pharmaceutical composition.
- inflammation is decreased by at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the inflammation in the gut of the subject prior to administration of the pharmaceutical composition.
- inflammation is decreased by between about 10% to about 100%, about 10% to about 95%, about 10% to about 90%, about 10% to about 85%, about 10% to about 80%, about 10% to about 75%, about 10% to about 70%, about 10% to about 65%, about 10% to about 60%, about 10% to about 55%, about 10% to about 50%, about 10% to about 45%, about 10% to about 40%, about 10% to about 35%, about 10% to about 30%, about 10% to about 25%, about 10% to about 20%, about 10% to about 15%, about 15% to about 100%, about 15% to about 95%, about 15% to about 90%, about 15% to about 85%, about 15% to about 80%, about 15% to about 75%, about 15% to about 70%, about 15% to about 65%, about 15% to about 60%, about 15% to about 55%, about 15% to about 50%, about 15% to about 45%, about 15% to about 40%, about 15% to about 35%, about 15% to about 30%, about 15% to about 25%, about 15% to about 20%, about 20% to about 100%, about 20% to about 95%, about 20%, about 10% to about 15%, about
- levels of inflammation is measured by determining degree of immune cell infiltration of the gut mucosa.
- inflammation in the gut of a subject is measured by endoscopy or from a biopsy of the colon.
- inflammation in the gut of a subject is determined by measuring levels of one or more biomarkers in a biological sample from the subject.
- the biological sample is blood, urine, or stool.
- the one or more biomarkers are C- reactive protein (CRP) and/or calprotectin.
- inflammation is measured by determining the level of infiltration of immune cells in the intestinal lining of mid-distal and/or distal colon sections of the subject.
- tissue damage is decreased in the gut of the subject after administration of the pharmaceutical composition as compared to the tissue damage in the gut of the subject prior to administration of the pharmaceutical composition.
- tissue damage in the gut of the subject is decreased at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the tissue damage in the gut of the subject prior to administration of the pharmaceutical composition.
- tissue damage in the gut of the subject is decreased between about 10% to about 100%, about 10% to about 95%, about 10% to about 90%, about 10% to about 85%, about 10% to about 80%, about 10% to about 75%, about 10% to about 70%, about 10% to about 65%, about 10% to about 60%, about 10% to about 55%, about 10% to about 50%, about 10% to about 45%, about 10% to about 40%, about 10% to about 35%, about 10% to about 30%, about 10% to about 25%, about 10% to about 20%, about 10% to about 15%, about 15% to about 100%, about 15% to about 95%, about 15% to about 90%, about 15% to about 85%, about 15% to about 80%, about 15% to about 75%, about 15% to about 70%, about 15% to about 65%, about 15% to about 60%, about 15% to about 55%, about 15% to about 50%, about 15% to about 45%, about 15% to about 40%, about 15% to about 35%, about 15% to about 30%, about 15% to about 25%, about 15% to about 20%, about 20% to about 100%, about 20% to about 10% to about 15%, about 15%
- tissue damage in the gut of a subject is measured from a biopsy of the colon.
- mucosal ulceration and/or ulcerative lesions are decreased in the gut of the subject after administration of the pharmaceutical composition as compared to mucosal ulceration and/or ulcerative lesions in the gut of the subject prior to administration of the pharmaceutical composition.
- mucosal ulceration and/or ulcerative lesions is determined by endoscopy or biopsy from the distal colon, rectum, and/or mid-distal colon sections. [0072] In some embodiments, the mucosal ulceration and/or ulcerative lesions is decreased at least 1%, at least 5%, at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the mucosal ulceration and/or ulcerative lesions in the gut of the subject prior to administration of the pharmaceutical composition.
- the mucosal ulceration decreases between about 10% to about 100%, about 10% to about 95%, about 10% to about 90%, about 10% to about 85%, about 10% to about 80%, about 10% to about 75%, about 10% to about 70%, about 10% to about 65%, about 10% to about 60%, about 10% to about 55%, about 10% to about 50%, about 10% to about 45%, about 10% to about 40%, about 10% to about 35%, about 10% to about 30%, about 10% to about 25%, about 10% to about 20%, about 10% to about 15%, about 15% to about 100%, about 15% to about 95%, about 15% to about 90%, about 15% to about 85%, about 15% to about 80%, about 15% to about 75%, about 15% to about 70%, about 15% to about 65%, about 15% to about 60%, about 15% to about 55%, about 15% to about 50%, about 15% to about 45%, about 15% to about 40%, about 15% to about 35%, about 15% to about 30%, about 15% to about 25%, about 15% to about 20%, about 20% to about 100%, about 20% to about 10% to about 15%, about 15% to
- the EGF polypeptide comprises SEQ ID NO: 505 or a fragment thereof.
- the secretion tag is PhoA, PelB, OmpA, LARD3, or HylA.
- the secretion tag has a sequence comprising: a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 136; or b. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 161; or c. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 168; or d. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 361; or e. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 362.
- the secretion tag has a sequence comprising: a. SEQ ID NO: 136; b. SEQ ID NO: 161; c. SEQ ID NO: 168; d. SEQ ID NO: 361; or e. SEQ ID NO: 362.
- the inducible promoter is an low oxygen-inducible promoter, a temperature-sensitive promoter, or an isopropyl beta-D-1 -thiogalactopyranoside (IPTG) inducible promoter.
- IPTG isopropyl beta-D-1 -thiogalactopyranoside
- the inducible promoter is a low oxygen-inducible promoter, and wherein the low oxygen-inducible promoter has a sequence comprising a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of SEQ ID NOs: 1-11, 336 and 337; or b. any one of SEQ ID NOs: 1-11, 336 and 337.
- the inducible promoter is a temperature-sensitive promoter, and wherein the temperature-sensitive promoter is a pR promoter further comprising a CI857 repressor (CI857 repressor -pR promoter).
- the CI857 repressor-pR promoter has a sequence comprising a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of SEQ ID NOs: 19-21; or b. any one of SEQ ID NOs: 19-21.
- the polynucleotide sequence encoding the epidermal growth factor (EGF) polypeptide linked to the secretion tag has a sequence comprising a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of sequences SEQ ID NO: 500, SEQ ID NO: 502, SEQ ID NO: 501, SEQ ID NO: 503, SEQ ID NO: 504, SEQ ID NO: 506, SEQ ID NO: 508, SEQ ID NO: 507, SEQ ID NO: 509, SEQ ID NO: 510, SEQ ID NO: 519, SEQ ID NO: 520, SEQ ID NO: 521, SEQ ID NO: 522, SEQ ID NO: 523, SEQ ID NO: 524, SEQ ID NO: 525, or SEQ ID NO: 526; or b.
- the recombinant bacterium further comprises a polynucleotide sequence encoding a peptide bond, a polypeptide linker, and/or a stabilizing polypeptide.
- the secretion tag is linked to the N terminus of the EGF polypeptide by a peptide bond or a polypeptide linker, or wherein the secretion tag is linked to the C terminus of the EGF polypeptide by a peptide bond or a polypeptide linker.
- the secretion tag is cleaved from the EGF polypeptide after secretion from the recombinant bacterium.
- the bacterium is selected from the group consisting of Bacteroides, Bifidobacterium, Clostridium, Escherichia, Lactobacillus, and Lactococcus.
- the bacterium is selected from the group consisting of Clostridium novyi NT, Clostridium butyricum, and Bifidobacterium longum. In some embodiments, the bacterium is Escherichia coli strain Nissle.
- the bacterium further comprises a mutated gene encoding a periplasmic protein pal.
- the bacterium further expresses a Type 1 secretion system capable of secreting the EGF polypeptide linked to the secretion tag.
- the recombinant bacterium further comprises a deletion in a pks island.
- the disease or disorder is selected from a group consisting of autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, and neurological or neurodegenerative diseases.
- the disease or disorder is a disease disorder, or condition associated with gut inflammation and/or compromised gut barrier function.
- the disease or disorder is an inflammatory bowel disease, diarrheal diseases, or a related disease.
- the inflammatory bowel disease is Crohn’s disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, diversion colitis, Bechet’ s disease, indeterminate colitis, short bowel syndrome, and radiation induced GI toxicity.
- the autoimmune disorder is selected from the group consisting of acute disseminated encephalomyelitis (ADEM), acute necrotizing hemorrhagic leukoencephalitis, Addison’ s disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti- GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune angioedema, autoimmune aplastic anemia, autoimmune dysautonomia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear disease (AIED), autoimmune myocarditis, autoimmune oophoritis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura (ATP), autoimmune thyroid disease, autoimmune urticarial, Axonal & neuronal neuropathies, Balo
- ADAM acute disse
- the metabolic disorder or condition is selected from the group consisting of: type 1 diabetes; type 2 diabetes; metabolic syndrome; Bardet-Biedel syndrome; Prader- Willi syndrome; non-alcoholic fatty liver disease; tuberous sclerosis; Albright hereditary osteodystrophy; brain-derived neurotrophic factor (BDNF) deficiency; Single-minded 1 (SIM1) deficiency; leptin deficiency; leptin receptor deficiency; pro-opiomelanocortin (POMC) defects; proprotein convertase subtilisin/kexin type 1 (PCSK1) deficiency; Src homology 2B1 (SH2B1) deficiency; pro-hormone convertase 1/3 deficiency; melanocortin-4-receptor (MC4R) deficiency; aniridia, genitourinary anomalies, and mental retardation (WAGR) syndrome; pseudohypoparathyroidism type 1A; Fragile
- the method further comprises selecting a human subject who would benefit from an improvement or alleviation of one or more symptoms, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
- FIG. 1 depicts a schematic representation of an exemplary bacterium that secretes EGF linked to a signal peptide and under control of an FNR-inducible promoter (left) or a heat-inducible promoter that also expresses a T1S secretion pore (right).
- FIGs. 2A and FIG. 2B depict schematics of the gene organization of exemplary circuits of the disclosure for the expression of therapeutic polypeptides, which are secreted via a diffusible outer membrane (DOM) system.
- the therapeutic polypeptide of interest is fused to a prototypical N- terminal Sec-dependent secretion signal or Tat-dependent secretion signal, which is cleaved upon secretion into the periplasmic space.
- Exemplary secretion tags include sec-dependent PhoA, PelB, OmpF, OmpA, cvaC, and Tat-dependent tags (TorA, FdnG, DmsA).
- the recombinant bacteria comprise deletions in one or more of Ipp, pal, tolA, and/or nlpl.
- periplasmic proteases are also deleted, including, but not limited to, degP and ompT, e.g., to increase stability of the polypeptide in the periplasm.
- a FRT-KanR-FRT cassette is used for downstream integration. Expression is driven by a tet promoter (FIG. 2A) or an inducible promoter, such as oxygen level-dependent promoters (e.g., FNR-inducible promoter, FIG.
- promoters induced by inflammation or an inflammatory response RNS, ROS promoters
- promoters induced by a metabolite that may or may not be naturally present e.g., can be exogenously added in the gut, e.g., arabinose.
- FIGs. 3A-3B show an ELISA of EGF secretion across three different EGF fusion proteins in two different bacterial backgrounds grown in either LB (FIG. 3A) or grown in 2YT (FIG. 3B).
- FIG. 4 shows an ELISA of bioreactivity for secreted hEGF on pERK and pEGFR in HT-29 cells.
- FIG. 5 shows a western blot of phosphorylated downstream targets of EGF after treatment with either EGF, different supernatants, or the presence of AG1478, an EGFR inhibitor.
- FIGs. 6A-6B show an ELISA of pEGFR with secreted EGF.
- FIGs. 7A-7B show an ELISA of pERK with secreted EGF.
- FIG. 8 shows an in vitro activity assay for hEGF production (WT or Apal/DOM grown in either LB or 2YT medium before induction (30°C) and 4 hours after induction (37°C)).
- FIG. 9 shows the production of hEGF (pg/ml) in WT or Apal/DOM grown 2YT media at timepoints of 0 hours, 4 hours after induction and overnight induction.
- FIG. 10 shows the production of hEGF (ng/ml) in WT-CLOmpA-EGF or Apal/DOM-CL OmpA-EGF at timepoints of before induction, 4 hours after induction and overnight induction.
- FIGs. 11A and 11B depict a schematic (FIG. 11 A) and a bar graph showing EGF production (FIG. 11B).
- FIG. 11A shows a schematic describing four EGF secreting prototype strains.
- FIG. 11B shows a graph demonstrating EGF production represented as pg EGF produced per 5xl0 A l 1 cells in 8 hr (mean ⁇ SEM). Numbers 1-3 indicate three separate experiments.
- FIG. 12 depicts a schematic showing EGF production and secretion by prototype strains over time.
- FIGs. 13A and 13B depicts graphs showing prototype strain bioactivity.
- FIG. 13A depicts a graph showing representative pEGFR signal in the FRET assay in HT-29 cells after 5 mins stimulation across a range of EGF concentrations using rEGF standards or supernatants collected in one of three independent experiments.
- FIG. 13B depicts a graph showing EC50 (nM EGF) of pEGFR stimulation in HT-29 cells determined using rEGF standards or supernatants collected in three separate experiments. EC50 values are presented as mean ⁇ 95% CL Dashed lines indicate ⁇ 0.5 log fold-change from the mean of rEGF standards across all three experiments.
- FIG. 14 depicts a chart showing EGF detected in colon effluent of naive mice treated with the prototype strains (le10 CFU) as indicated at a six-hour time point.
- FIGs. 15A-15E depict schematics and graphs relating to an in vivo study.
- FIG. 15A is a schematic outlining the study protocol. Mice received a single oral bolus of EcN WT (SYN094), A- Temp (SYN8062), A-FNR (SYN8063) at 1 x 10 ⁇ 10 CFU. Strain abundance in tissue effluents (small intestine (FIG. 15B), cecum (FIG. 15C), colon (FIG. 15D) and feces (FIG. 15E) were collected and counted at indicated times. For each time point, data represent the average CFU per gram of sample determined from 5 mice samples ⁇ standard error of the mean.
- FIGs. 16A-16E depict graphs relating to an in vivo study in which mice were gavaged at 1 x 10 ⁇ 10 CFU with prototype strains showing EGF secretion in the gastrointestinal contents of naive mice (stomach effluent (FIG. 16A), small intestine effluent (FIG. 16B), cecum effluent (FIG. 16C), colon effluent (FIG. 16D) and feces (FIG. 16E).
- FIGs. 17A-17C depict graphs relating to an in vivo study in DSS treated mice.
- Mice received a single oral bolus of SYN8066 (Chassis B, FNR) and SYN8248 (Chassis B) at le10 CFU.
- Strain abundance in tissue small intestine effluents (FIG. 17A), cecum effluents (FIG. 17B), and colon contents (FIG. 17C) were collected and counted at indicated times. For each time point, data represent the average CFU per gram of sample determined from 5 mice samples.
- FIGs. 18A-18C depict graphs relating to an in vivo study in which DSS treated mice were gavaged at le10 CFU with prototype strains showing EGF secretion in the gastrointestinal contents of DSS mice (small intestine effluent (FIG. 18A), cecum effluent (FIG. 18B), and colon contents (FIG.
- FIG. 19 depicts a bar graph showing in vitro EGF production activity of strains SYN8371, SYN8408, and SYN8510 having 1, 2, or 3 integrated copies, respectively of FNR-ompA-EGF, as compared to the plasmid strain SYN8066 having the same construct.
- FIG. 20A is a schematic showing BID (two times a day) or TID (three times a day) dosing and feces collection schedule in a DSS model. Mice were sacrificed on D6 and colon effluents collected.
- FIG. 20B depicts a graph showing abundance of bacteria in feces (CFU/g feces) collected on D3 and D4 according to the schedule shown in FIG. 20A.
- FIG. 20C depicts a graph showing EGF levels present in feces collected at D3 and D4 according to the schedule shown in FIG. 20A.
- FIG. 20D is a schematic showing BID or TID dosing and mice were sacrificed on D6 at Ih or 3h post last dose. Flushed colon contents were collected.
- FIG. 20E depicts a graph showing the amount of EGF present in colon content on D6.
- FIGs. 20F and 20G depict graphs showing body weight observed during time course of DSS administration as shown in FIG. 20D.
- FIG. 21A depicts a schematic showing transverse sections. Segment 3 (distal colon) was stained by immunohistochemistry (Ki67, PCNA) or immunofluorescence staining, images were quantitated by computational image analysis for proliferation markers.
- FIGs. 21B, 21C and 21D depict graphs showing levels of Ki67 (FIG. 21B), PCNA (FIG.
- FIG. 21E depicts a graph showing RT-PCR analysis performed on colon tissue of mice at day 6, treated according to the schedule shown in FIG. 20A.
- FIG. 22A depicts a schematic showing administration of le10 EcN or EcN-EGF preceded by lactulose administration in a DSS model combined with streptomycin administration.
- FIG. 22B depicts a graph showing the amount of EGF present in colon content on D6.
- FIG. 23A depicts the formula of the disaccharide lactulose.
- FIG. 23B depicts proliferation of EcN-EGF (SYN8066) in M9 media, with no carbon source, xylulose or lactulose added.
- FIG. 24A is a schematic showing a dosing schedule in which mice are given lactulose 30 minutes prior to gavage with le9 Ecn-EGF (SYN8066).
- FIGs. 24B and 24C depicts graphs showing cecal (FIG. 24B) and colonic ( FIG. 24C) levels of EGF in mice dosed according to the schedule shown in FIG. 24A.
- FIG. 25 A is a schematic showing a dosing schedule in which mice are given lactulose either 1 or 2 hours prior to gavage with le9 Ecn-EGF (SYN8066) in a DSS model.
- FIG. 25B depicts a graph showing colonic EGF levels in mice at 2 and 3 hours post-dose according to the schedule shown in FIG. 25A.
- FIG. 26A is a schematic showing a dosing schedule in which mice are given streptomycin in drinking water from day -7 to day 6; lactulose BID orally and DSS in drinking water from day 0 to day 6; and le10 Ecn (SYN094) or Ecn-EGF (SYN8854) on day -6, -3, -1, 1, 4 in a DSS model. Mice were sacrificed on day 6.
- FIG. 26B depicts a graph showing abundance of bacteria in feces (CFU/g feces) collected on D-6, D-2 and D2 according to the schedule shown in FIG. 26A.
- FIG. 26C depicts a graph showing EGF levels in stool collected on D-2 and D2 according to the schedule shown in FIG. 26A.
- FIG. 27 is a graph showing EGF production over time for three different biomass batches.
- FIG. 28A and FIG. 28B are graphs showing EGF production in EnN-hEGF dosed mice over time in normal light cycle (NLC) rooms (FIG. 28A) and in reverse light cycle (RLC) rooms (FIG. 28B), as measured in fecal matter. Each line represents one experiment which encompasses 4-5 mice.
- FIG. 29A and FIG. 29B are graphs showing EGF production in EcN-hEGF (SYN8510) dosed mice over time in normal light cycle (NLC) rooms (FIG. 29 A) and in reverse light cycle rooms (FIG. 29B) at two different doses, 1E9 and 3.5E9 CFUs, as measured in fecal matter. Each line represents one experiment which encompasses 4-5 mice.
- FIG. 30A and FIG. 30B are graphs showing EGF production over time in mice housed in reverse light cycle room, which were dosed with 5e9 CFU of EcN-hEGF (SYN8510) at T0 and T5.
- FIG. 30A and FIG. 30B are repeat studies of the same experimental setup. Each line is the average of 4-5 mice per experiment on a single day. Hatched box: Colon content EGF levels at 8 hours post first dose.
- FIG. 31 is a graph showing Ki67 positive cells in DSS treated mice in various study groups. Each dot on the graph corresponds to a mouse colon. Naive: no DSS; DSS vehicle: vehicle control; EcN-EGF: SYN8510. T0/3: treatment at T0 and T3; T0/5: treatment at T0 and T5.
- FIG. 32A is a schematic outlining an in vivo study protocol. DSS drinking water was given for 5 days.
- FIG. 32B is a graph of the body weight as measured over the course of the study described in FIG. 32A.
- FIG. 32C is a graph of CFU/g of colon content as collected according to the protocol described in FIG. 32A.
- FIG. 32D is a graph of CFU/g of mesenteric lymph node as collected according to the protocol described in FIG. 32A.
- FIG. 32E is a graph of CFU/g of liver as collected according to the protocol described in FIG. 32A.
- FIG. 32F is a graph of CFU/g of spleen as collected according to the protocol described in FIG. 32A.
- FIG. 32G is a graph of CFU/g of blood as collected according to the protocol described in FIG. 32A.
- FIG. 3 A and FIG. 33B are bar graphs showing serum levels of EcN-EGF at day 6 (FIG. 33A) or day 9 (FIG. 33B) of a study essentially the same as shown in FIG. 32A.
- L.O.D is Limit of Detection for the EGF assay.
- FIG. 34A and FIG. 34B are graphs showing the number of Ki67 -positive cells per crypt in a mid-distal colon section (FIG. 34A) and in a distal colon section (FIG. 34B), from two studies in which DSS treated mice were administered EcN-EGF biomass prepared on in two separate batches (Biomass 1 (BM1; Study 1) and Biomass 2 (BM2; Study 2)). Naive: no DSS; vehicle: vehicle control; EcN-EGF BM1: EcN-EGF Biomass 1 (Study 1); EcN-EGF BM2: EcN-EGF Biomass 2 (Study 2). [0150] FIG. 34C, FIG. 34D, and FIG.
- FIGs. 35A, 35B, and 35C are graphs showing blood concentration of IR dye in 3 identical studies assessing intestinal permeability (Study 1: FIG. 35A, Study 2: FIG. 35B; Study 3: FIG. 35C).
- FIGs. 36A, 36B, and 36C show tissue damage scored in Study 2 from mid-distal colon sections (FIG. 36A), distal colon sections (FIG. 36B) and the average of the tissue damage score from both mid-distal and distal colon sections (FIG. 36C).
- FIGs. 37A, 37B, and 37C show ulceration scored in Study 2 from mid-distal colon sections (FIG. 37 A), distal colon sections (FIG. 37B) and the average of the ulceration score from both mid- distal and distal colon sections (FIG. 37 C).
- FIGs. 38A, 38B, and 38C show immune cell infiltration scored from mid-distal colon sections (FIG. 38A), distal colon sections (FIG. 38B) and the average of the immune cell infiltration score from both mid-distal and distal colon sections (FIG. 38C).
- FIGs. 39A, 39B, and 39C show tissue damage scored in Study 3 from mid-distal colon sections (FIG. 39 A), distal colon sections (FIG. 39B) and the average of the tissue damage score from both mid-distal and distal colon sections (FIG. 39C).
- FIGs. 40A, 40B, and 40C show ulceration scored in Study 3 from mid-distal colon sections (FIG. 40A), distal colon sections (FIG. 40B) and the average of the ulceration score from both mid- distal and distal colon sections (FIG. 40C).
- FIGs. 41A, 41B, and 41C show immune cell infiltration scored in Study 3 from mid-distal colon sections (FIG. 41A), distal colon sections (FIG. 41B) and the average of the immune cell infiltration score from both mid-distal and distal colon sections (FIG. 41C).
- FIGs. 42A, 42B, and 42C show the effects of DSS (i.e., vehicle control only) in the DSS model employed in Studies 1-3, comparing permeability (FIG. 42A), tissue myeloperoxidase (MPO, a measure for immune system activity) (FIG. 42B), and total histological score (FIG. 42C), showing differing disease severity between studies using this DSS model.
- DSS i.e., vehicle control only
- FIG. 43 shows total histopathological score of vehicle control in the DSS model employed in Studies 1-3, showing differing disease severity between Studies 1-3, and greater disease severity in the distal colon than the mid-distal colon in this DSS model.
- the present disclosure relates to compositions of recombinant bacteria and methods for secreting EGF from recombinant bacteria for treatment of diseases or disorders.
- the recombinant bacteria disclosed herein are capable of high yield production of functionally active EGF, which is secreted as therapeutically active polypeptide.
- EGF is used to encompass human, murine, and other species and sources of EGF polypeptides and polynucleotides, including naturally occurring EGF (e.g., naturally occurring EGF isoforms) and non-naturally occurring EGF (e.g., synthetic or engineered variants of EGF). Exemplary EGF sequences are known in the art.
- a human EGF polypeptide comprises SEQ ID NO: 505 (below), a functional fragment and/or variant thereof, or a polypeptide having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 505 or a functional fragment and/or variant thereof, e.g., as assessed by an alignment algorithm such as NCBI BLAST.
- a human EGF polynucleotide encodes a human EGF polypeptide.
- a non-limiting example of a human EGF polynucleotide comprises SEQ ID NO: 511.
- NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR SEQ ID NO: 505
- the term “recombinant microorganism” refers to a microorganism, e.g., bacterial, yeast, or viral cell, or bacteria, yeast, or virus, that has been genetically modified from its native state.
- a “recombinant bacterial cell” or “recombinant bacteria” refers to a bacterial cell or bacteria that have been genetically modified from their native state.
- a recombinant bacterial cell may have nucleotide insertions, nucleotide deletions, nucleotide rearrangements, and nucleotide modifications introduced into their DNA. These genetic modifications may be present in the chromosome of the bacteria or bacterial cell, or on a plasmid in the bacteria or bacterial cell.
- Recombinant bacterial cells disclosed herein may comprise exogenous nucleotide sequences on plasmids.
- recombinant bacterial cells may comprise exogenous nucleotide sequences stably incorporated into their chromosome.
- a “programmed or engineered microorganism” refers to a microorganism, e.g., bacterial or viral cell, or bacteria or virus, that has been genetically modified from its native state to perform a specific function.
- a “programmed or engineered bacterial cell” or “programmed or engineered bacteria” refers to a bacterial cell or bacteria that has been genetically modified from its native state to perform a specific function.
- the programmed or engineered bacterial cell has been modified to express one or more proteins, for example, one or more EGF proteins that have a therapeutic activity or serve a therapeutic purpose.
- the programmed or engineered bacterial cell may additionally have the ability to stop growing or to destroy itself once EGF has been expressed.
- the term “gene” refers to a nucleic acid fragment that encodes a protein or fragment thereof, optionally including regulatory sequences preceding (5’ non-coding sequences) and following (3’ non-coding sequences) the coding sequence. In one embodiment, a “gene” does not include regulatory sequences preceding and following the coding sequence.
- a “native gene” refers to a gene as found in nature, optionally with its own regulatory sequences preceding and following the coding sequence.
- a “chimeric gene” refers to any gene that is not a native gene, optionally comprising regulatory sequences preceding and following the coding sequence, wherein the coding sequences and/or the regulatory sequences, in whole or in part, are not found together in nature. Thus, a chimeric gene may comprise regulatory sequences and coding sequences that are derived from different sources, or regulatory and coding sequences that are derived from the same source, but arranged differently than is found in nature.
- the term “gene sequence” is meant to refer to a genetic sequence, e.g., a nucleic acid sequence.
- the gene sequence or genetic sequence is meant to include a complete gene sequence or a partial gene sequence.
- the gene sequence or genetic sequence is meant to include sequence that encodes a protein or polypeptide and is also meant to include genetic sequence that does not encode a protein or polypeptide, e.g., a regulatory sequence, leader sequence, signal sequence, or other non-protein coding sequence.
- EGF EGF effector polypeptide described herein.
- the nucleic acid sequence may comprise the entire gene sequence or a partial gene sequence encoding a functional molecule.
- the nucleic acid sequence may be a natural sequence or a synthetic sequence.
- the nucleic acid sequence may comprise a native or wild-type sequence or may comprise a modified sequence having one or more insertions, deletions, substitutions, or other modifications, for example, the nucleic acid sequence may be codon-optimized.
- heterologous gene or heterologous sequence refers to a nucleotide sequence that is not normally found in a given cell in nature.
- a heterologous sequence encompasses a nucleic acid sequence that is exogenously introduced into a given cell and can be a native sequence (naturally found or expressed in the cell) or non-native sequence (not naturally found or expressed in the cell) and can be a natural or wild-type sequence or a variant, non-natural, or synthetic sequence.
- “Heterologous gene” includes a native gene, or fragment thereof, that has been introduced into the host cell in a form that is different from the corresponding native gene.
- a heterologous gene may include a native coding sequence that is a portion of a chimeric gene to include non-native regulatory regions that is reintroduced into the host cell.
- a heterologous gene may also include a native gene, or fragment thereof, introduced into a non-native host cell.
- a heterologous gene may be foreign or native to the recipient cell; a nucleic acid sequence that is naturally found in a given cell but expresses an unnatural amount of the nucleic acid and/or the polypeptide which it encodes; and/or two or more nucleic acid sequences that are not found in the same relationship to each other in nature.
- the term “endogenous gene” refers to a native gene in its natural location in the genome of an organism.
- the term “transgene” refers to a gene that has been introduced into the host organism, e.g., host bacterial cell, genome.
- a “non-native” nucleic acid sequence refers to a nucleic acid sequence not normally present in a microorganism, e.g., an extra copy of an endogenous sequence, or a heterologous sequence such as a sequence from a different species, strain, or substrain of bacteria or virus, or a sequence that is modified and/or mutated as compared to the unmodified sequence from bacteria or virus of the same subtype.
- the non-native nucleic acid sequence is a synthetic, non-naturally occurring sequence (see, e.g., Purcell et al., 2013).
- the non-native nucleic acid sequence may be a regulatory region, a promoter, a gene, and/or one or more genes in gene cassette.
- “non-native” refers to two or more nucleic acid sequences that are not found in the same relationship to each other in nature.
- the non-native nucleic acid sequence may be present on a plasmid or chromosome.
- the genetically engineered microorganism of the disclosure comprises a gene that is operably linked to a promoter that is not associated with said gene in nature.
- the recombinant bacteria disclosed herein comprise a gene that is operably linked to a directly or indirectly inducible promoter that is not associated with said gene in nature, e.g., an FNR responsive promoter (or other promoter disclosed herein) operably linked to EGF.
- a directly or indirectly inducible promoter that is not associated with said gene in nature, e.g., an FNR responsive promoter (or other promoter disclosed herein) operably linked to EGF.
- coding region refers to a nucleotide sequence that codes for a specific amino acid sequence.
- regulatory sequence refers to a nucleotide sequence located upstream (5’ non-coding sequences), within, or downstream (3’ non-coding sequences) of a coding sequence, and which influences the transcription, RNA processing, RNA stability, or translation of the associated coding sequence. Examples of regulatory sequences include, but are not limited to, promoters, translation leader sequences, effector binding sites, signal sequences, and stem-loop structures. In one embodiment, the regulatory sequence comprises a promoter, e.g., an FNR responsive promoter or other promoter disclosed herein.
- a “gene cassette” or “operon” encoding a biosynthetic pathway refers to the two or more genes for the production of an effector molecule such as EGF.
- the gene cassette or operon may also comprise additional transcription and translation elements, e.g., a ribosome binding site.
- a regulatory region “operably linked” refers to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is affected by the other.
- a regulatory element is operably linked with a coding sequence when it is capable of affecting the expression of the gene coding sequence, regardless of the distance between the regulatory element and the coding sequence. More specifically, operably linked refers to a nucleic acid sequence, e.g., a gene encoding EGF, that is joined to a regulatory sequence in a manner which allows expression of the nucleic acid sequence, e.g., the gene encoding the EGF molecule described herein. In other words, the regulatory sequence acts in cis.
- a gene may be “directly linked” to a regulatory sequence in a manner which allows expression of the gene.
- a gene may be “indirectly linked” to a regulatory sequence in a manner which allows expression of the gene.
- two or more genes may be directly or indirectly linked to a regulatory sequence in a manner which allows expression of the two or more genes.
- a regulatory region or sequence is a nucleic acid that can direct transcription of an EGF gene and may comprise promoter sequences, enhancer sequences, response elements, protein recognition sites, inducible elements, promoter control elements, protein binding sequences, 5’ and 3’ untranslated regions, transcriptional start sites, termination sequences, polyadenylation sequences and introns.
- a “promoter” as used herein refers to a nucleotide sequence that is capable of controlling the expression of a coding sequence or gene. Promoters are generally located 5’ of the sequence that they regulate. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from promoters found in nature, and/or comprise synthetic nucleotide segments. Those skilled in the art will readily ascertain that different promoters may regulate expression of a coding sequence or gene in response to a particular stimulus, e.g., in a cell- or tissue-specific manner, in response to different environmental or physiological conditions, or in response to specific compounds. Prokaryotic promoters are typically classified into two classes: inducible and constitutive. A “constitutive promoter” refers to a promoter that allows for continual transcription of the coding sequence or gene under its control.
- Constant promoter refers to a promoter that is capable of facilitating continuous transcription of a coding sequence or gene under its control and/or to which it is operably linked.
- Constitutive promoters and variants are well known in the art and include, but are not limited to, Ptac promoter, BBa_J23100, a constitutive Escherichia coli aS promoter (e.g., an osmY promoter (International Genetically Engineered Machine (iGEM) Registry of Standard Biological Parts Name BBa_J45992; BBa_J45993)), a constitutive Escherichia coli a32 promoter (e.g., htpG heat shock promoter (BBa_J45504)), a constitutive Escherichia coli a70 promoter (e.g., lacq promoter (BBa_J54200; BBa_J56015), E.
- coli CreABCD phosphate sensing operon promoter (BBa_J64951), GlnRS promoter (BBa_K088007), lacZ promoter (BBa_Kl 19000; BBa_Kl 19001); M13K07 gene I promoter (BBa_M13101); M13K07 gene II promoter (BBa_M13102), M13K07 gene III promoter (BBa_M13103), M13K07 gene IV promoter (BBa_M13104), M13K07 gene V promoter (BBa_M13105), M13K07 gene VI promoter (BBa_M13106), M13K07 gene VIII promoter (BBa_M13108), M13110 (BBa_M13110)), a constitutive Bacillus subtilis oA promoter (e.g., promoter veg (BBa_K143013), promoter 43 (BBa_K143013), PliaG (BBa_K823000), PlepA (BBa_K823002),
- an “inducible promoter” refers to a regulatory region that is operably linked to one or more genes, wherein expression of the gene(s) is increased in the presence of an inducer of said regulatory region.
- An “inducible promoter” refers to a promoter that initiates increased levels of transcription of the coding sequence or gene under its control in response to a stimulus or an exogenous environmental condition.
- a “directly inducible promoter” refers to a regulatory region, wherein the regulatory region is operably linked to a gene encoding a protein or polypeptide, where, in the presence of an inducer of said regulatory region, the protein or polypeptide is expressed.
- an “indirectly inducible promoter” refers to a regulatory system comprising two or more regulatory regions, for example, a first regulatory region that is operably linked to a first gene encoding a first protein, polypeptide, or factor, e.g., a transcriptional regulator, which is capable of regulating a second regulatory region that is operably linked to a second gene, the second regulatory region may be activated or repressed, thereby activating or repressing expression of the second gene.
- stable bacterium is used to refer to a bacterial host cell carrying non-native genetic material, e.g., a gene encoding one or more EGF molecule(s), which is incorporated into the host genome or propagated on a self-replicating extra-chromosomal plasmid, such that the non-native genetic material is retained, expressed, and propagated.
- the stable bacterium is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
- the stable bacterium may be a recombinant bacterium comprising a gene encoding a encoding a payload, e.g., one or more EGF molecule(s), in which the plasmid or chromosome carrying the gene is stably maintained in the bacterium, such that the payload can be expressed in the bacterium, and the bacterium is capable of survival and/or growth in vitro and/or in vivo.
- copy number affects the stability of expression of the non-native genetic material.
- copy number affects the level of expression of the non-native genetic material.
- expression refers to the transcription and stable accumulation of sense (mRNA) or anti-sense RNA derived from a nucleic acid, and/or to translation of an mRNA into a polypeptide.
- Plasmid refers to an extrachromosomal nucleic acid, e.g., DNA, construct that is not integrated into a bacterial cell’s genome. Plasmids are usually circular and capable of autonomous replication. Plasmids may be low-copy, medium-copy, or high-copy, as is well known in the art. Plasmids may optionally comprise a selectable marker, such as an antibiotic resistance gene, which helps select for bacterial cells containing the plasmid and which ensures that the plasmid is retained in the bacterial cell.
- a plasmid disclosed herein may comprise a nucleic acid sequence encoding a heterologous gene, e.g., a gene encoding EGF molecule.
- transform refers to the transfer of a nucleic acid fragment into a host bacterial cell, resulting in genetically-stable inheritance.
- Host bacterial cells comprising the transformed nucleic acid fragment are referred to as “recombinant” or “transgenic” or “transformed” organisms.
- genetic modification refers to any genetic change.
- Exemplary genetic modifications include those that increase, decrease, or abolish the expression of a gene, including, for example, modifications of native chromosomal or extrachromosomal genetic material.
- Exemplary genetic modifications also include the introduction of at least one plasmid, modification, mutation, base deletion, base addition, base substitution, and/or codon modification of chromosomal or extrachromosomal genetic sequence(s), gene over-expression, gene amplification, gene suppression, promoter modification or substitution, gene addition (either single or multi-copy), antisense expression or suppression, or any other change to the genetic elements of a host cell, whether the change produces a change in phenotype or not.
- Genetic modification can include the introduction of a plasmid, e.g., a plasmid comprising EGF operably linked to a promoter, into a bacterial cell. Genetic modification can also involve a targeted replacement in the chromosome, e.g., to replace a native gene promoter with an inducible promoter, regulated promoter, strong promoter, or constitutive promoter. Genetic modification can also involve gene amplification, e.g., introduction of at least one additional copy of a native gene into the chromosome of the cell. Alternatively, chromosomal genetic modification can involve a genetic mutation.
- the term “genetic mutation” refers to a change or changes in a nucleotide sequence of a gene or related regulatory region that alters the nucleotide sequence as compared to its native or wild-type sequence. Mutations include, for example, substitutions, additions, and deletions, in whole or in part, within the wild-type sequence. Such substitutions, additions, or deletions can be single nucleotide changes (e.g., one or more point mutations), or can be two or more nucleotide changes, which may result in substantial changes to the sequence. Mutations can occur within the coding region of the gene as well as within the non-coding and regulatory sequence of the gene.
- genetic mutation is intended to include silent and conservative mutations within a coding region as well as changes which alter the amino acid sequence of the polypeptide encoded by the gene.
- a genetic mutation in a gene coding sequence may, for example, increase, decrease, or otherwise alter the activity (e.g., enzymatic activity) of the gene’s polypeptide product.
- a genetic mutation in a regulatory sequence may increase, decrease, or otherwise alter the expression of sequences operably linked to the altered regulatory sequence.
- the term “transporter” is meant to refer to a mechanism, e.g., protein, proteins, or protein complex, for importing a molecule, e.g., amino acid, peptide (di-peptide, tri- peptide, polypeptide, etc.), toxin, metabolite, substrate, as well as other biomolecules into the microorganism from the extracellular milieu.
- a mechanism e.g., protein, proteins, or protein complex
- a molecule e.g., amino acid, peptide (di-peptide, tri- peptide, polypeptide, etc.), toxin, metabolite, substrate, as well as other biomolecules into the microorganism from the extracellular milieu.
- exogenous environmental condition or “exogenous environment signal” refers to settings, circumstances, stimuli, or biological molecules under which a promoter described herein is directly or indirectly induced.
- exogenous environmental conditions is meant to refer to the environmental conditions external to the engineered microorganism, but endogenous or native to the host subject environment.
- exogenous and endogenous may be used interchangeably to refer to environmental conditions in which the environmental conditions are endogenous to a mammalian body, but external or exogenous to an intact microorganism cell.
- the exogenous environmental conditions are specific to the gut of a mammal.
- the exogenous environmental conditions are specific to the upper gastrointestinal tract of a mammal. In some embodiments, the exogenous environmental conditions are specific to the lower gastrointestinal tract of a mammal. In some embodiments, the exogenous environmental conditions are specific to the small intestine of a mammal. In some embodiments, the exogenous environmental conditions are low-oxygen, microaerobic, or anaerobic conditions, such as the environment of the mammalian gut. In some embodiments, exogenous environmental conditions are molecules or metabolites that are specific to the mammalian gut, e.g., propionate. In some embodiments, the exogenous environmental condition is a tissue-specific or disease-specific metabolite or molecule(s).
- the exogenous environmental condition is specific to an inflammatory disease. In some embodiments, the exogenous environmental condition is a low- pH environment. In some embodiments, the genetically engineered microorganism of the disclosure comprises a pH-dependent promoter. In some embodiments, the genetically engineered microorganism of the disclosure comprises an oxygen level-dependent promoter. In some aspects, bacteria have evolved transcription factors that are capable of sensing oxygen levels. Different signaling pathways may be triggered by different oxygen levels and occur with different kinetics.
- oxygen level-dependent promoter or “oxygen level-dependent regulatory region” refers to a nucleic acid sequence to which one or more oxygen level-sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression.
- oxygen level-dependent transcription factors include, but are not limited to, FNR (fumarate and nitrate reductase), ANR (anaerobic nitrate respiration), and DNR (dissimilatory nitrate respiration regulator).
- FNR fluarate and nitrate reductase
- ANR anaerobic nitrate respiration
- DNR dissimilatory nitrate respiration regulator
- Corresponding FNR -responsive promoters, ANR-responsive promoters, and DNR-responsive promoters are known in the art (see, e.g., Castiglione et al., 2009; Eiglmeier et al., 1989; Galimand et al., 1991; Hasegawa et al., 1998; Hoeren et al., 1993; Salmon et al., 2003), and non-limiting examples are shown in Table 1.
- a promoter was derived from the E. coll Nissle fumarate and nitrate reductase gene S (fnrS) that is known to be highly expressed under conditions of low or no environmental oxygen (Durand and Storz, 2010; Boysen et al, 2010).
- the PfnrS promoter is activated under anaerobic conditions by the global transcriptional regulator FNR that is naturally found in Nissle. Under anaerobic conditions, FNR forms a dimer and binds to specific sequences in the promoters of specific genes under its control, thereby activating their expression.
- PfnrS inducible promoter is adopted to modulate the expression of proteins or RNA.
- PfnrS is used interchangeably in this application as FNRS, fnrs, FNR, P-FNRS promoter and other such related designations to indicate the promoter PfnrS.
- a “tunable regulatory region” refers to a nucleic acid sequence under direct or indirect control of a transcription factor and which is capable of activating, repressing, derepressing, or otherwise controlling gene expression relative to levels of an inducer.
- the tunable regulatory region comprises a promoter sequence.
- the inducer may be RNS, or other inducer described herein, and the tunable regulatory region may be a RNS-responsive regulatory region or other responsive regulatory region described herein.
- the tunable regulatory region may be operatively linked to a gene sequence(s) or gene cassette for the production of one or more payloads, e.g., EGF gene cassette or gene sequence(s).
- the tunable regulatory region is a RNS-derepressible regulatory region, and when RNS is present, a RNS-sensing transcription factor no longer binds to and/or represses the regulatory region, thereby permitting expression of the operatively linked gene or gene cassette.
- the tunable regulatory region derepresses gene or gene cassette expression relative to RNS levels.
- Each gene or gene cassette may be operatively linked to a tunable regulatory region that is directly or indirectly controlled by a transcription factor that is capable of sensing at least one RNS.
- the exogenous environmental conditions are the presence or absence of reactive oxygen species (ROS). In other embodiments, the exogenous environmental conditions are the presence or absence of reactive nitrogen species (RNS).
- exogenous environmental conditions are biological molecules that are involved in the inflammatory response, for example, molecules present in an inflammatory disorder of the gut.
- the exogenous environmental conditions or signals exist naturally or are naturally absent in the environment in which the recombinant bacterial cell resides. In some embodiments, the exogenous environmental conditions or signals are artificially created, for example, by the creation or removal of biological conditions and/or the administration or removal of biological molecules.
- the exogenous environmental condition(s) and/or signal(s) stimulates the activity of an inducible promoter.
- the exogenous environmental condition(s) and/or signal(s) that serves to activate the inducible promoter is not naturally present within the gut or any other organ of a mammal.
- the inducible promoter is stimulated by a molecule or metabolite that is administered in combination with the pharmaceutical composition of the disclosure, for example, tetracycline, arabinose, or any biological molecule that serves to activate an inducible promoter.
- the exogenous environmental condition(s) and/or signal(s) is added to culture media comprising a recombinant bacterial cell of the disclosure.
- the exogenous environmental condition that serves to activate the inducible promoter is naturally present within the gut of a mammal (for example, low oxygen or anaerobic conditions, or biological molecules involved in an inflammatory response).
- the loss of exposure to an exogenous environmental condition inhibits the activity of an inducible promoter, as the exogenous environmental condition is not present to induce the promoter (for example, an aerobic environment outside the gut).
- “Gut” refers to the organs, glands, tracts, and systems that are responsible for the transfer and digestion of food, absorption of nutrients, and excretion of waste.
- the gut comprises the gastrointestinal (GI) tract, which starts at the mouth and ends at the anus, and additionally comprises the esophagus, stomach, small intestine, and large intestine.
- the gut also comprises accessory organs and glands, such as the spleen, liver, gallbladder, and pancreas.
- the upper gastrointestinal tract comprises the esophagus, stomach, and duodenum of the small intestine.
- the lower gastrointestinal tract comprises the remainder of the small intestine, i.e., the jejunum and ileum, and all of the large intestine, i.e., the cecum, colon, rectum, and anal canal.
- Bacteria can be found throughout the gut, e.g., in the gastrointestinal tract, and particularly in the intestines.
- the term “low oxygen” is meant to refer to a level, amount, or concentration of oxygen (Oj) that is lower than the level, amount, or concentration of oxygen that is present in the atmosphere (e.g., ⁇ 21% Oj ; ⁇ 160 torr Oj)).
- the term “low oxygen condition or conditions” or “low oxygen environment” refers to conditions or environments containing lower levels of oxygen than are present in the atmosphere.
- the term “low oxygen” is meant to refer to the level, amount, or concentration of oxygen (O2) found in a mammalian gut, e.g., lumen, stomach, small intestine, duodenum, jejunum, ileum, large intestine, cecum, colon, distal sigmoid colon, rectum, and anal canal.
- O2 oxygen
- the term “low oxygen” is meant to refer to a level, amount, or concentration of O2 that is 0-60 mmHg O2 (0-60 torr O2) (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45,46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, and 60 mmHg O2), including any and all incremental fraction(s) thereof (e.g., 0.2 mmHg, 0.5 mmHg O2, 0.75 mmHg O2,
- low oxygen refers to about 60 mmHg O2 or less (e.g., 0 to about 60 mmHg O2).
- the term “low oxygen” may also refer to a range of O2 levels, amounts, or concentrations between 0-60 mmHg O2 (inclusive), e.g., 0-5 mmHg O2, ⁇ 1.5 mmHg O2, 6-10 mmHg, ⁇ 8 mmHg, 47-60 mmHg, etc.
- low oxygen is meant to refer to the level, amount, or concentration of oxygen (O2) present in partially aerobic, semi aerobic, microaerobic, nanoaerobic, microoxicanoxic, and/or anaerobic conditions.
- O2 oxygen
- Table 2 summarizes the amount of oxygen present in various organs and tissues.
- DO dissolved oxygen
- the term “low oxygen” is meant to refer to a level, amount, or concentration of oxygen (O2) that is about 6.0 mg/L DO or less, e.g., 6.0 mg/L, 5.0 mg/L, 4.0 mg/L, 3.0 mg/L, 2.0 mg/L, 1.0 mg/L, or 0 mg/L, and any fraction therein, e.g., 3.25 mg/L, 2.5 mg/L, 1.75 mg/L, 1.5 mg/L, 1.25 mg/L, 0.9 mg/L, 0.8 mg/L, 0.7 mg/L, 0.6 mg/L, 0.5 mg/L, 0.4 mg/L, 0.3 mg/L, 0.2 mg/L and 0.1 mg/L DO, which exemplary fractions are listed here for illustrative purposes and not meant to be limiting in any way.
- the level of oxygen in a liquid or solution may also be reported as a percentage of air saturation or as a percentage of oxygen saturation (the ratio of the concentration of dissolved oxygen (O2) in the solution to the maximum amount of oxygen that will dissolve in the solution at a certain temperature, pressure, and salinity under stable equilibrium).
- Well- aerated solutions e.g., solutions subjected to mixing and/or stirring
- oxygen producers or consumers are 100% air saturated.
- the term “low oxygen” is meant to refer to 40% air saturation or less, e.g., 40%, 39%, 38%, 37%, 36%, 35%, 34%, 33%, 32%, 31%, 30%, 29%, 28%, 27%, 26%, 25%, 24%, 23%, 22%, 21%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, and 0% air saturation, including any and all incremental fraction(s) thereof (e.g., 30.25%, 22.70%, 15.5%, 7.7%, 5.0%, 2.8%, 2.0%, 1.65%, 1.0%, 0.9%, 0.8%, 0.75%, 0.68%, 0.5%.
- any and all incremental fraction(s) thereof e.g., 30.25%, 22.70%, 15.5%, 7.7%, 5.0%, 2.8%, 2.0%, 1.65%, 1.0%, 0.9%,
- any range of air saturation levels between 0-40%, inclusive e.g., 0- 5%, 0.05 - 0.1%, 0.1-0.2%, 0.1-0.5%, 0.5 - 2.0%, 0-10%, 5-10%, 10-15%, 15-20%, 20-25%, 25- 30%, etc.
- the exemplary fractions and ranges listed here are for illustrative purposes and not meant to be limiting in any way.
- the term “low oxygen” is meant to refer to 9% O2 saturation or less, e.g., 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0%, O2 saturation, including any and all incremental fraction(s) thereof (e.g., 6.5%, 5.0%, 2.2%, 1.7%, 1.4%, 0.9%, 0.8%, 0.75%, 0.68%, 0.5%. 0.44%, 0.3%, 0.25%, 0.2%, 0.1%, 0.08%, 0.075%, 0.058%, 0.04%.
- any range of O2 saturation levels between 0-9%, inclusive e.g., 0-5%, 0.05 - 0.1%, 0.1- 0.2%, 0.1-0.5%, 0.5 - 2.0%, 0-8%, 5-7%, 0.3-4.2% O2, etc.
- the exemplary fractions and ranges listed here are for illustrative purposes and not meant to be limiting in any way.
- Microorganism refers to an organism or microbe of microscopic, submicroscopic, or ultramicroscopic size that typically consists of a single cell.
- microorganisms include bacteria, viruses, parasites, fungi, certain algae, yeast, e.g., Saccharomyces, and protozoa.
- the microorganism is engineered (“engineered microorganism”) to produce one or more therapeutic molecules, e.g., an anti-inflammatory or barrier enhancer molecule.
- the engineered microorganism is an engineered bacterium.
- Non-pathogenic bacteria refer to bacteria that are not capable of causing disease or harmful responses in a host.
- non-pathogenic bacteria are Gram-negative bacteria.
- non-pathogenic bacteria are Gram-positive bacteria.
- non- pathogenic bacteria do not contain lipopolysaccharides (LPS).
- LPS lipopolysaccharides
- non-pathogenic bacteria are commensal bacteria.
- non-pathogenic bacteria examples include, but are not limited to certain strains belonging to the genus Bacillus, Bacteroides, Bifidobacterium, Brevibacteria, Clostridium, Enterococcus, Escherichia coli, Lactobacillus, Lactococcus, Saccharomyces, and Staphylococcus, e.g., Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium butyricum, Enterococcus faecium, Escherichia coli, Escherichia coli Nissle, Lactobacillus acidophilus, Lactobacillus bulgaricus, Lactobacillus casei, Lactobac
- Non-pathogenic bacteria also include commensal bacteria, which are present in the indigenous microbiota of the gut.
- the disclosure further includes non-pathogenic Saccharomyces, such as Saccharomyces boulardii.
- Naturally pathogenic bacteria may be genetically engineered to reduce or eliminate pathogenicity.
- Probiotic is used to refer to live, non-pathogenic microorganisms, e.g., bacteria, which can confer health benefits to a host organism that contains an appropriate amount of the microorganism.
- the host organism is a mammal.
- the host organism is a human.
- the probiotic bacteria are Gram-negative bacteria.
- the probiotic bacteria are Gram-positive bacteria. Some species, strains, and/or subtypes of non-pathogenic bacteria are currently recognized as probiotic bacteria.
- probiotic bacteria examples include, but are not limited to, certain strains belonging to the genus Bifidobacteria, Escherichia Coli, Lactobacillus, and Saccharomyces e.g., Bifidobacterium bifidum, Enterococcus faecium, Escherichia coli strain Nissle, Lactobacillus acidophilus, Lactobacillus bulgaricus, Lactobacillus paracasei, and Lactobacillus plantarum, and Saccharomyces boulardii (Dinleyici et al., 2014; U.S. Patent No. 5,589,168; U.S. Patent No. 6,203,797; U.S.
- the probiotic may be a variant or a mutant strain of bacterium (Arthur et al., 2012; Cuevas-Ramos et al., 2010; Olier et al., 2012; Nougayrede et al., 2006).
- Non-pathogenic bacteria may be genetically engineered to enhance or improve desired biological properties, e.g., survivability.
- Non-pathogenic bacteria may be genetically engineered to provide probiotic properties.
- Probiotic bacteria may be genetically engineered to enhance or improve probiotic properties.
- auxotroph refers to an organism that requires a specific factor, e.g., an amino acid, a sugar, or other nutrient) to support its growth.
- An “auxotrophic modification” is a genetic modification that causes the organism to die in the absence of an exogenously added nutrient essential for survival or growth because it is unable to produce said nutrient.
- essential gene refers to a gene which is necessary to for cell growth and/or survival.
- Essential genes include, but are not limited to, DNA synthesis genes (such as thyA), cell wall synthesis genes (such as dapA), and amino acid genes (such as serA and metA).
- module and its cognates means to alter, regulate, or adjust positively or negatively a molecular or physiological readout, outcome, or process, to effect a change in said readout, outcome, or process as compared to a normal, average, wild-type, or baseline measurement.
- “modulate” or “modulation” includes up-regulation and down- regulation.
- a non-limiting example of modulating a readout, outcome, or process is effecting a change or alteration in the normal or baseline functioning, activity, expression, or secretion of a biomolecule (e.g., a protein, enzyme, cytokine, growth factor, hormone, metabolite, short chain fatty acid, or other compound).
- a biomolecule e.g., a protein, enzyme, cytokine, growth factor, hormone, metabolite, short chain fatty acid, or other compound.
- Another non-limiting example of modulating a readout, outcome, or process is effecting a change in the amount or level of a biomolecule of interest, e.g., in the serum and/or the gut lumen.
- modulating a readout, outcome, or process relates to a phenotypic change or alteration in one or more disease symptoms.
- module is used to refer to an increase, decrease, masking, altering, overriding or restoring the normal functioning, activity, or levels of a readout, outcome or process (e.g, biomolecule of interest, and/or molecular or physiological process, and/or a phenotypic change in one or more disease symptoms).
- a readout, outcome or process e.g, biomolecule of interest, and/or molecular or physiological process, and/or a phenotypic change in one or more disease symptoms.
- module and “treat” a disease and their cognates refer to an amelioration of a disease, disorder, and/or condition, or at least one discernible symptom thereof.
- modulate and “treat” refer to an amelioration of at least one measurable physical parameter, not necessarily discernible by the patient.
- modulate and “treat” refer to inhibiting the progression of a disease, disorder, and/or condition, either physically (e.g., stabilization of a discernible symptom), physiologically (e.g., stabilization of a physical parameter), or both.
- module and “treat” refer to slowing the progression or reversing the progression of a disease, disorder, and/or condition.
- prevent and its cognates refer to delaying the onset or reducing the risk of acquiring a given disease, disorder and/or condition or a symptom associated with such disease, disorder, and/or condition.
- Those in need of treatment may include individuals already having a particular medical disorder, as well as those at risk of having, or who may ultimately acquire the disorder.
- the need for treatment is assessed, for example, by the presence of one or more risk factors associated with the development of a disorder, the presence or progression of a disorder, or likely receptiveness to treatment of a subject having the disorder.
- Treating autoimmune disorders and/or diseases and conditions associated with gut inflammation and/or compromised gut barrier function may encompass reducing or eliminating excess inflammation and/or associated symptoms, and does not necessarily encompass the elimination of the underlying disease. Treating the diseases described herein may encompass increasing levels EGF and does not necessarily encompass the elimination of the underlying disease.
- “diseases and conditions associated with gut inflammation and/or compromised gut barrier function” include, but are not limited to, inflammatory bowel diseases, diarrheal diseases, and related diseases.
- “Inflammatory bowel diseases” and “IBD” are used interchangeably herein to refer to a group of diseases associated with gut inflammation, which include, but are not limited to, Crohn’ s disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, diversion colitis, Bechet’ s disease, indeterminate colitis, short bowel syndrome, and radiation induced GI toxicity.
- diarrheal diseases include, but are not limited to, acute watery diarrhea, e.g., cholera; acute bloody diarrhea, e.g.. dysentery; and persistent diarrhea.
- related diseases include, but are not limited to, short bowel syndrome, ulcerative proctitis, proctosigmoiditis, left-sided colitis, pancolitis, and fulminant colitis.
- Symptoms associated with the aforementioned diseases and conditions include, but are not limited to, one or more of diarrhea, bloody stool, mouth sores, perianal disease, abdominal pain, abdominal cramping, fever, fatigue, weight loss, iron deficiency, anemia, appetite loss, weight loss, anorexia, delayed growth, delayed pubertal development, inflammation of the skin, inflammation of the eyes, inflammation of the joints, inflammation of the liver, and inflammation of the bile ducts.
- Different parts of the intestine may be affected in different inflammatory bowel diseases.
- ulcerative colitis is a chronic type of IBD in which abnormal reactions of the immune system cause inflammation and ulcers on the inner lining of the large intestine, i.e., the colon, and rectum.
- Crohn's disease CD is another type of IBD, which causes intestinal inflammation, leading to abdominal pain, severe diarrhea, fatigue, weight loss and malnutrition. In Crohn's disease, any part of the small or large intestine may be affected. CD may be present in multiple segments, or it may be continuous, but it most commonly affects the last part of the small intestine (ileum) and parts of the colon.
- Mucosal healing is a main treatment target in UC and CD and it is primarily defined through endoscopic and histologic hallmarks.
- the term “mucosal healing” refers to a process in which the integrity of damaged epithelial barrier and homeostatic function is improved or restored after an injury, e.g., mucosal tissue damage (e.g., epithelial or in the lamina basement) or ulceration, which may occur as a result of a disease or disorder described herein, such as CD or UC.
- mucosal healing has three phases, (1) epithelial restitution (where epithelial cells first migrate into the injured area), followed by (2) mucosal cell (e.g., epithelial cell) proliferation, and (3) differentiation and maturation (where intestinal stem cells differentiate and mature into all mature intestinal cell types).
- epithelial restitution where epithelial cells first migrate into the injured area
- mucosal cell e.g., epithelial cell
- differentiation and maturation where intestinal stem cells differentiate and mature into all mature intestinal cell types.
- mucosal healing manifests itself in reduction or alleviation of tissue damage, reduced or alleviated inflammation at the mucosal lining, alleviation or improvement of ulceration, and ultimately, an improvement in intestinal permeability.
- the phrases “enhancing mucosal healing” or “enhance mucosal healing” or “promote mucosal healing” “induced mucosal healing” or similar include both mucosal improvement, i.e., grades of mucosal healing (grades of improvement in tissue damage, of reduction in inflammation, of improved ulceration, and of improved intestinal permeability), as well as complete absence of indicia of a damaged epithelial barrier (absence of inflammatory and ulcerative lesions in the gut, absence of inflammation, absence of tissue damage, absence of abnormal increase in intestinal permeability).
- endoscopy is a standard test for assessing extent of mucosal pathology, activity and healing in clinical practice. Extent of mucosal healing may also be assessed through combinations of endoscopy and biopsies.
- Computed tomography enterography (CTE) and magnetic resonance enterography (MRE) as well as capsule endoscopy are newer modalities for diagnosing and assessing disease activity and mucosal healing in IBD patients.
- biomarkers such as fecal calprotectin, fecal lactoferrin, serum C-reactive protein, serum lipocalin-2, and fecal S100A12 may be used as surrogate markers for mucosal pathology and healing.
- the level of damage or injury and the extent of mucosal healing is measured by assessing various parameters, including, but not limited to, the amount of epithelial tissue damage, the amount of inflammation (i.e., immune cell infiltration, such as neutrophils), and the occurrence of ulcerations. These observations or measurements are combined to come up with a disease activity score as a measurement of disease. There are endoscopic and histological scoring systems exist, which can be used alone or in combination.
- Endoscopic disease activity scores which assess the condition of the intestinal lining, and are indicative of levels of damage and the extent of mucosal healing, are known in the art, e.g., different scoring systems exist for CD and ulcerative colitis.
- Examples of endoscopic disease activity scores for UC include but are not limited to: Truelove and Witts score (mucosal assessment (granularity, hyperemia)); Baron score (bleeding, vascular pattern); Powell-Tuck score (bleeding); Sutherland score (bleeding, friability); Mayo endoscopic subscore (vascular pattern, erythema, friability, erosions and ulcerations, bleeding); Rachmilewitz score (granulation, tissue damage (mucosal damage), vascular pattern, bleeding); Modified Baron score (vascular pattern, friability, ulcerations, bleeding).
- Scores for CD include Crohn's disease endoscopic index of severity (superficial and deep ulceration, ulcerated and nonulcerated stenosis, surface area of ulcerated and diseased segments); Simple endoscopic score for Crohn's disease (ulcer size, ulcerated surface, affected surface, presence of narrowings); Rutgeerts score (ulcerations, inflammation, ulcers, nodules, narrowing). Reviewed in, e.g., Gastroenterol Hepatol (N Y). 2012 Jan; 8(1): 29-38.
- biopsies When biopsies are used to characterize disease state and healing on the histopathological level, these are taken from several different areas of the intestinal tract to determine how each area is affected. Similar to endoscopic scoring, several different histopathological scoring methods can be used to look at disease severity and therapeutic efficacy (see e.g., Villanacci, et al., Inflammatory Bowel Diseases: Does One Histological Score Fit All? Diagnostics 2023, 13, 2112).
- Non-limiting examples of scoring systems include the Simplified Geboes score which inter alia scores inflammatory activity, the presence of certain immune cells in epithelium and lamina basement (basal plasma cells, eosinophils and neutrophils in lamina basement), and epithelial injury (tissue damage)); the Nancy score, which inter alia scores the inflammatory infiltrate, ulceration, tissue damage and mucin depletion; the Robarts score, which inter alia scores the chronic inflammatory infiltrate and erosion/ulceration; SHMHS score, which inter alia scores infiltrates, tissue damage, and erosions/ulcerations.
- gut lining or “mucosa” are used interchangeably, and as used herein refer to the inner wall of the gut comprising layers: a single layer of epithelial cells, lamina basement, and muscular mucosae.
- inflammation includes a finding infiltration of inflammatory immune cells, e.g., chronic inflammatory infiltrate, into the gut lining.
- inflammatory immune cells e.g., chronic inflammatory infiltrate
- Non-limiting examples include lymphocytes and plasmacytes; e.g., increases in basal plasma cells, and/or eosinophils and/or neutrophils in the lamina intestinal, neutrophils in the epithelium, inflammation may be measured in a biopsy as noted above as part of the mucosal healing scoring systems.
- levels of blood C-reactive protein (CRP) and fecal calprotectin which is released by neutrophils when inflammation is present in the gastrointestinal tract
- CRP blood C-reactive protein
- fecal calprotectin which is released by neutrophils when inflammation is present in the gastrointestinal tract
- Lipocalin-2 is produced by epithelial cells and also can be used as a measurement of inflammation and epithelial health.
- one or more biomarkers are measured to determine inflammation of the gut in a subject.
- the one or more biomarkers are measured from a biological sample from the subject, such as, but not limited to, blood, urine, and/or stool.
- ulceration refers to an endoscopic or histological finding. Extent and quality of ulceration is scored as one element of the UC and Crohn’s disease endoscopic and histological disease scoring methods listed above.
- a finding of ulceration includes a complete loss of epithelial cell lining, which may be observed in a localized area, ulcers or granulation tissue, and erosion, as well as fibrin and regeneration.
- tissue damage refers to an endoscopic or histological finding. Tissue damage includes damage to the epithelium, in crypt(s) and/or surface epithelium, e.g., crypts that are lost, distorted, or with altered architecture which can include including crypt hyperplasia and/or fission.
- Measurements of intestinal permeability are another way by which damage to the intestinal lining and extent of mucosal healing is assessed.
- intestinal permeability refers to the ability of the gut lining to permit material passing from inside the gut through the cells in the gut lining into the blood.
- the gut lining functions as a barrier to uptake of toxic metabolites, including bacterial metabolites, although some permeability exists in the healthy gut to allow nutrient uptake into the blood.
- disease state such as the disorders described herein, e.g., CD and UC, there is abnormally increased intestinal permeability, which may play a role in disease symptoms and presence of harmful metabolites in the blood and other organs.
- Intestinal permeability can be measured according to a number of methods known in the art. For example, urinary excretion of two orally-administered non-metabolizable sugars, lactulose and mannitol, can be used as a marker for evaluating levels of intestinal permeability. More recently, fluorescent dye base techniques have been developed to measure variations in intestinal permeability. For example, a fluorescent solution containing a clinically approved contrast agent (fluorescein) may be administered orally and the dye permeation from the gut into the bloodstream is measured non- invasively, via fluorescence signal measurement on the fingertip (10.1117/12.2649030). Alternatively, dyes may be administered, and presence of the dyes may be measured in the urine.
- a clinically approved contrast agent fluorescein
- the level of instestinal permability is measured in the subject before and after treatment with the pharmaceutical composition as disclosed herein.
- metabolic diseases include, but are not limited to, type 1 diabetes; type 2 diabetes; metabolic syndrome; Bardet- Biedel syndrome; Prader-Willi syndrome; non-alcoholic fatty liver disease; tuberous sclerosis;
- Albright hereditary osteodystrophy brain-derived neurotrophic factor (BDNF) deficiency; Single- minded 1 (SIM1) deficiency; leptin deficiency; leptin receptor deficiency; pro-opiomelanocortin (POMC) defects; proprotein convertase subtilisin/kexin type 1 (PCSK1) deficiency; Src homology 2B1 (SH2B1) deficiency; pro-hormone convertase 1/3 deficiency; melanocortin-4-receptor (MC4R) deficiency; aniridia, genitourinary anomalies, and mental retardation (WAGR) syndrome; pseudohypoparathyroidism type 1A; Fragile X syndrome; Borjeson-Forsmann-Lehmann syndrome; Alstrom syndrome; Cohen syndrome; and ulnar-mammary syndrome.
- BDNF brain-derived neurotrophic factor
- SIM1 Single- minded 1
- POMC pro-opi
- Symptoms associated with the aforementioned diseases and conditions include, but are not limited to, one or more of weight gain, obesity, fatigue, hyperlipidemia, hyperphagia, hyperdipsia, polyphagia, polydipsia, polyuria, pain of the extremities, numbness of the extremities, blurry vision, nystagmus, hearing loss, cardiomyopathy, insulin resistance, light sensitivity, pulmonary disease, liver disease, liver cirrhosis, liver failure, kidney disease, kidney failure, seizures, hypogonadism, and infertility.
- a "pharmaceutical composition” refers to a preparation of genetically engineered microorganism of the disclosure, e.g., recombinant bacteria, with other components such as a physiologically suitable carrier and/or excipient.
- physiologically acceptable carrier and “pharmaceutically acceptable carrier” which may be used interchangeably refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered bacterial or viral compound.
- An adjuvant is included under these phrases.
- excipient refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient.
- examples include, but are not limited to, calcium bicarbonate, sodium bicarbonate calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20.
- terapéuticaally effective dose and “therapeutically effective amount” are used to refer to an amount of a compound that results in prevention, delay of onset of symptoms, or amelioration of symptoms of a condition, e.g., inflammation, diarrhea, an autoimmune disorder.
- a therapeutically effective amount may, for example, be sufficient to treat, prevent, reduce the severity, delay the onset, and/or reduce the risk of occurrence of one or more symptoms of an autoimmune a disorder and/or a disease or condition as described herein.
- a therapeutically effective amount, as well as a therapeutically effective frequency of administration can be determined by methods known in the art and discussed below.
- bacteriostatic or “cytostatic” refers to a molecule or protein which is capable of arresting, retarding, or inhibiting the growth, division, multiplication or replication of recombinant bacterial cell of the disclosure.
- bactericidal refers to a molecule or protein which is capable of killing the recombinant bacterial cell of the disclosure.
- the term “toxin” refers to a protein, enzyme, or polypeptide fragment thereof, or other molecule which is capable of arresting, retarding, or inhibiting the growth, division, multiplication or replication of the recombinant bacterial cell of the disclosure, or which is capable of killing the recombinant bacterial cell of the disclosure.
- the term “toxin” is intended to include bacteriostatic proteins and bactericidal proteins.
- the term “toxin” is intended to include, but not limited to, lytic proteins, bacteriocins (e.g., microcins and colicins), gyrase inhibitors, polymerase inhibitors, transcription inhibitors, translation inhibitors, DNases, and RNases.
- anti-toxin refers to a protein or enzyme which is capable of inhibiting the activity of a toxin.
- anti-toxin is intended to include, but not limited to, immunity modulators, and inhibitors of toxin expression. Examples of toxins and antitoxins are known in the art and described in more detail infra.
- payload refers to one or more molecules of interest to be produced by a genetically engineered microorganism, such as a bacteria or a virus.
- the payload is a therapeutic EGF payload.
- the payload is a regulatory molecule, e.g., a transcriptional regulator such as FNR.
- the payload comprises a regulatory element, such as a promoter or a repressor.
- the payload comprises an inducible promoter, such as from FNRS or a cI857 repressor-pR promoter.
- the payload comprises a repressor element, such as a kill switch.
- the payload comprises an antibiotic resistance gene or genes.
- the payload is encoded by a gene, multiple genes, gene cassette, or an operon.
- the payload is produced by a biosynthetic or biochemical pathway, wherein the biosynthetic or biochemical pathway may optionally be endogenous to the microorganism.
- the payload is produced by a biosynthetic or biochemical pathway, wherein the biosynthetic or biochemical pathway is not endogenous to the microorganism.
- the genetically engineered microorganism comprises two or more payloads.
- preventional treatment refers to treatment or therapy that is currently accepted, considered current standard of care, and/or used by most healthcare professionals for treating a disease or disorder, e.g., autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, neurological or neurodegenerative diseases, or diseases associated with inflammation and/or reduced gut barrier function. It is different from alternative or complementary therapies, which are not as widely used.
- polypeptide includes “polypeptide” as well as “polypeptides,” and refers to a molecule composed of amino acid monomers linearly linked by amide bonds (i.e., peptide bonds).
- polypeptide refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product.
- polypeptides include peptides, “dipeptides,” “tripeptides, “oligopeptides,” “protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids, are included within the definition of “polypeptide,” and the term “polypeptide” may be used instead of, or interchangeably with any of these terms.
- polypeptide is also intended to refer to the products of post-expression modifications of the polypeptide, including but not limited to glycosylation, acetylation, phosphorylation, amidation, derivatization, proteolytic cleavage, or modification by non-naturally occurring amino acids.
- a polypeptide may be derived from a natural biological source or produced by recombinant technology.
- polypeptide is produced by the recombinant bacteria of the current disclosure.
- a polypeptide may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids.
- Polypeptides may have a defined three-dimensional structure, although they do not necessarily have such structure. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides, which do not possess a defined three-dimensional structure, but rather can adopt a large number of different conformations, are referred to as unfolded.
- peptide or “polypeptide” may refer to an amino acid sequence that corresponds to a protein or a portion of a protein or may refer to an amino acid sequence that corresponds with non-protein sequence, e.g., a sequence selected from a regulatory peptide sequence, leader peptide sequence, signal peptide sequence, linker peptide sequence, and other peptide sequence.
- an “isolated” polypeptide or a fragment, variant, or derivative thereof refers to a polypeptide that is not in its natural milieu. No particular level of purification is required.
- Recombinantly produced polypeptides and proteins expressed in host cells including but not limited to bacterial or mammalian cells, are considered isolated for purposed of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any suitable technique.
- Recombinant peptides, polypeptides or proteins refer to peptides, polypeptides or proteins produced by recombinant DNA techniques, i.e..
- fragments include polypeptides having an amino acid sequence sufficiently similar to the amino acid sequence of the original peptide and include any polypeptides, which retain at least one or more properties of the corresponding original polypeptide. Fragments of polypeptides include proteolytic fragments, as well as deletion fragments.
- Fragments also include specific antibody or bioactive fragments or immunologically active fragments derived from any polypeptides described herein. Variants may occur naturally or be non-naturally occurring. Non-naturally occurring variants may be produced using mutagenesis methods known in the art. Variant polypeptides may comprise conservative or non- conservative amino acid substitutions, deletions or additions.
- Polypeptides also include fusion proteins.
- the term “variant” includes a fusion protein, which comprises a sequence of the original peptide or sufficiently similar to the original peptide.
- the term “fusion protein” refers to a chimeric protein comprising amino acid sequences of two or more different proteins. Typically, fusion proteins result from well known in vitro recombination techniques. Fusion proteins may have a similar structural function (but not necessarily to the same extent), and/or similar regulatory function (but not necessarily to the same extent), and/or similar biochemical function (but not necessarily to the same extent) and/or immunological activity (but not necessarily to the same extent) as the individual original proteins which are the components of the fusion proteins.
- “Derivatives” include but are not limited to peptides, which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids. “Similarity” between two peptides is determined by comparing the amino acid sequence of one peptide to the sequence of a second peptide. An amino acid of one peptide is similar to the corresponding amino acid of a second peptide if it is identical or a conservative amino acid substitution. Conservative substitutions include those described in Dayhoff, M. O., ed., The Atlas of Protein Sequence and Structure 5, National Biomedical Research Foundation, Washington, D.C. (1978), and in Argos, EMBO J. 8 (1989), 779-785.
- amino acids belonging to one of the following groups represent conservative changes or substitutions: -Ala, Pro, Gly, Gin, Asn, Ser, Thr; - Cys, Ser, Tyr, Thr; -Vai, He, Leu, Met, Ala, Phe; -Lys, Arg, His; -Phe, Tyr, Trp, His; and -Asp, Glu.
- the recombinant bacteria comprise one or more gene sequence(s) encoding one or more fusion proteins.
- the recombinant bacteria express a fusion protein, in which a secretion tag polypeptide is fused to an EGF polypeptide, i.e., the secretion tag is linked to the polypeptide through a peptide bond or a linker.
- the recombinant bacteria express an EGF polypeptide which is fused to a stabilizing polypeptide.
- stabilizing polypeptide extends the half-life of the EGF polypeptide to which it is fused.
- Non-limiting examples of fusion proteins containing such stabilizing polypeptides include Fc fusion proteins, transferrin fusion proteins, and albumin fusion proteins (Strohl, BioDrugs.
- the EGF polypeptide is fused to an inert polypeptide to extend the half- life.
- an inert polypeptide is XTEN (Schellenberger V, et al. Nat Biotechnol. 2009;27 : 1186-1190).
- CTP a half-life extending polypeptide. CTP naturally extends protein’s half-life in human serum, likely because the negatively charged, heavily sialylated CTP impairs renal clearance.
- ELPs which are repeating peptide units containing sequences commonly found in elastin (repeats of V-P-G-x-G, where x is any amino acid except proline (SEQ ID NO: 348 (Strohl et al. .
- PAS polymer using three repeating amino acids, proline, alanine and serine
- HAP glycine-rich HAP
- the term “sufficiently similar” means a first amino acid sequence that contains a sufficient or minimum number of identical or equivalent amino acid residues relative to a second amino acid sequence such that the first and second amino acid sequences have a common structural domain and/or common functional activity.
- amino acid sequences that comprise a common structural domain that is at least about 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical are defined herein as sufficiently similar.
- variants will be sufficiently similar to the amino acid sequence of the peptides of the disclosure.
- V ariants include peptides that differ in amino acid sequence from the native and wt peptide, respectively, by way of one or more amino acid deletion(s), addition(s), and/or substitution(s). These may be naturally occurring variants as well as artificially designed ones.
- linker refers to synthetic or non-native or non-naturally-occurring amino acid sequences that connect or link two polypeptide sequences, e.g., that link two polypeptide domains.
- synthetic refers to amino acid sequences that are not naturally occurring. Exemplary linkers are described herein. Additional exemplary linkers are provided in US 20140079701 and in Chen et al., Adv Drug Deliv Rev. 2013; 65(10): 1357-1369, the contents of which are herein incorporated by reference in its entirety. Table 3 depicts non-limiting examples of linkers known in the art.
- codon-optimized refers to the modification of codons in the gene or coding regions of a nucleic acid molecule to reflect the typical codon usage of the host organism without altering the polypeptide encoded by the nucleic acid molecule. Such optimization includes replacing at least one, or more than one, or a significant number, of codons with one or more codons that are more frequently used in the genes of the host organism.
- a “codon-optimized sequence” refers to a sequence, which was modified from an existing coding sequence, or designed, for example, to improve translation in an expression host cell or organism of a transcript RNA molecule transcribed from the coding sequence, or to improve transcription of a coding sequence.
- Codon optimization includes, but is not limited to, processes including selecting codons for the coding sequence to suit the codon preference of the expression host organism. Many organisms display a bias or preference for use of particular codons to code for insertion of a particular amino acid in a growing polypeptide chain. Codon preference or codon bias, differences in codon usage between organisms, is allowed by the degeneracy of the genetic code, and is well documented among many organisms. Codon bias often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, inter alia, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization.
- mRNA messenger RNA
- tRNA transfer RNA
- secretion system or “secretion protein” refers to a native or non- native secretion mechanism capable of secreting or exporting a biomolecule, e.g., polypeptide from the microbial, e.g., bacterial cytoplasm.
- the secretion system may comprise a single protein or may comprise two or more proteins assembled in a complex e.g., HlyBD.
- Non-limiting examples of secretion systems for gram negative bacteria include the type I (e.g., hemolysin secretion system), type II, type III, type III flagellar, type IV, type V, type VI, type VII, type VIII secretion systems and modifications thereof, e.g., modified type III, modified type III flagellar, resistance-nodulation- division (RND) multi-drug efflux pumps, and various single membrane secretion systems.
- Non-liming examples of secretion systems for gram positive bacteria include Sec and TAT secretion systems.
- the polypeptide to be secreted include a “secretion tag” of either RNA or peptide origin to direct the polypeptide to specific secretion systems.
- the secretion system is able to remove this tag before secreting the polypeptide from the engineered bacteria.
- the N-terminal peptide secretion tag is removed upon translocation of the “passenger” peptide from the cytoplasm into the periplasmic compartment by the native Sec system.
- the C-terminal secretion tag can be removed by either an autocatalytic or protease- catalyzed e.g., OmpT cleavage thereby releasing the anti-inflammatory or barrier enhancer molecule(s) into the extracellular milieu.
- the secretion system involves the generation of a “leaky” or de-stabilized outer membrane, which may be accomplished by deleting or mutagenizing genes responsible for tethering the outer membrane to the rigid peptidoglycan skeleton, including for example, Ipp, ompC, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl.
- Lpp functions as the primary ‘staple’ of the bacterial cell wall to the peptidoglycan.
- TolA-pal and OmpA complexes function similarly to Lpp and are other deletion targets to generate a leaky phenotype.
- the engineered bacteria have one or more deleted or mutated membrane genes, e.g., selected from lpp, ompA, ompA, ompF, tolA, tolB, and pal genes.
- the engineered bacteria have one or more deleted or mutated periplasmic protease genes, e.g., selected from degS, degP, and nlpl.
- the engineered bacteria have one or more deleted or mutated gene(s), selected from lpp, ompA, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl genes.
- phage and “bacteriophage” are used interchangeably herein. Both terms refer to a virus that infects and replicates within a bacterium. As used herein “phage” or bacteriophage” collectively refers to prophage, lysogenic, dormant, temperate, intact, defective, cryptic, and satellite phage, phage tail bacteriocins, tailiocins, and gene transfer agents.
- prophage refers to the genomic material of a bacteriophage, which is integrated into a replicon of the host cell and replicates along with the host.
- the prophage may be able to produce phages if specifically activated. In some cases, the prophage is not able to produce phages or has never done so (i.e.. defective or cryptic prophages). In some cases, prophage also refers to satellite phages.
- prophage and “endogenous phage” are used interchangeably herein. “Endogenous phage” or “endogenous prophage” also refers to a phage that is present in the natural state of a bacterium (and its parental strain).
- phage knockout or “inactivated phage” refers to a phage which has been modified so that it can either no longer produce and/or package phage particles or it produces fewer phage particles than the wild type phage sequence.
- the inactivated phage or phage knockout refers to the inactivation of a temperate phage in its lysogenic state, i.e., to a prophage.
- Such a modification refers to a mutation in the phage; such mutations include insertions, deletions (partial or complete deletion of phage genome), substitutions, inversions, at one or more positions within the phage genome, e.g., within one or more genes within the phage genome.
- phage-free”, phage free and phageless are used interchangeably to characterize a bacterium or strain which contains one or more prophages, one or more of which have been modified. The modification can result in a loss of the ability of the prophage to be induced or release phage particles.
- the modification can result in less efficient or less frequent induction or less efficient or less frequent phage release as compared to the isogenic strain without the modification.
- Ability to induce and release phage can be measured using a plaque assay as described herein.
- phage induction refers to the part of the life cycle of a lysogenic prophage, in which the lytic phage genes are activated, phage particles are produced and lysis occurs.
- the phrase “and/or,” when used between elements in a list, is intended to mean either (1) that only a single listed element is present, or (2) that more than one element of the list is present.
- “A, B, and/or C” indicates that the selection may be A alone; B alone; C alone; A and B; A and C; B and C; or A, B, and C.
- the phrase “and/or” may be used interchangeably with “at least one of’ or “one or more of’ the elements in a list.
- Ranges provided herein are understood to be shorthand for all of the values within the range.
- a range of 1 to 50 is understood to include any number, combination of numbers, or sub- range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48,
- the genetically engineered microorganisms, or programmed microorganisms, such as recombinant bacteria of the disclosure are capable of producing EGF.
- the recombinant bacteria are obligate anaerobic bacteria.
- the recombinant bacteria are facultative anaerobic bacteria.
- the recombinant bacteria are aerobic bacteria.
- the recombinant bacteria are Gram-positive bacteria.
- the recombinant bacteria are Gram-positive bacteria and lack LPS.
- the recombinant bacteria are Gram-negative bacteria.
- the recombinant bacteria are Gram-positive and obligate anaerobic bacteria.
- the recombinant bacteria are Gram-positive and facultative anaerobic bacteria. In some embodiments, the recombinant bacteria are non-pathogenic bacteria. In some embodiments, the recombinant bacteria are commensal bacteria. In some embodiments, the recombinant bacteria are probiotic bacteria. In some embodiments, the recombinant bacteria are naturally pathogenic bacteria that are modified or mutated to reduce or eliminate pathogenicity.
- Exemplary bacteria include, but are not limited to, Bacillus, Bacteroides, Bifidobacterium, Brevibacteria, Caulobacter, Clostridium, Enterococcus, Escherichia coli, Lactobacillus, Lactococcus, Listeria, Mycobacterium, Saccharomyces, Salmonella, Staphylococcus, Streptococcus, Vibrio, Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium adolescentis, Bifidobacterium bifidum, Bifidobacterium breve UCC2003, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium acetobutylicum, Clostridium butyricum, Clostridium butyricum M-55,
- the recombinant bacteria are selected from the group consisting of Enterococcus faecium, Lactobacillus acidophilus, Lactobacillus bulgaricus, Lactobacillus casei, Lactobacillus johnsonii, Lactobacillus paracasei, Lactobacillus plantarum, Lactobacillus reuteri, Lactobacillus rhamnosus, Lactococcus lactis, and Saccharomyces boulardii, Clostridium clusters IV and XlVa of Firmicutes (including species of Eubacterium), Roseburia, Faecalibacterium, Enterobacter, Faecalibacterium prausnitzii, Clostridium difficile, Subdoligranulum, Clostridium sporogenes, Campylobacter jejuni, Clostridium saccharolyticum, Klebsiella, Citrobacter, Pseudobutyrivibrio, and Ruminococcus
- the recombinant bacteria are selected from Bacteroides fragilis, Bacteroides thetaiotaomicron, Bacteroides subtilis, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Clostridium butyricum, Escherichia coli, Escherichia coli Nissle, Lactobacillus acidophilus, Lactobacillus plantarum, Lactobacillus reuteri, and Lactococcus lactis [0242]
- the recombinant bacterium is a Gram-positive bacterium, e.g., Clostridium, that is naturally capable of producing high levels of butyrate.
- the recombinant bacterium is selected from the group consisting of C. butyricum ZJUCB, C. butyricum S21, C. thermobutyricum ATCC 49875, C. beijerinckii, C. populeti ATCC 35295, C. tyrobutyricum JM1, C. tyrobutyricum CIP 1-776, C. tyrobutyricum ATCC 25755, C. tyrobutyricum CNRZ 596, and C. tyrobutyricum ZJU 8235.
- the recombinant bacterium is C.
- butyricum CBM588 a probiotic bacterium that is highly amenable to protein secretion and has demonstrated efficacy in treating IBD (Kanai et al., 2015).
- the recombinant bacterium is Bacillus, a probiotic bacterium that is highly genetically tractable and has been a popular chassis for industrial protein production; in some embodiments, the bacterium has highly active secretion and/or no toxic byproducts (Cutting, 2011).
- the bacterial cell is a Bacteroides fragilis bacterial cell. In one embodiment, the bacterial cell is a Bacteroides thetaiotaomicron bacterial cell. In one embodiment, the bacterial cell is a Bacteroides subtilis bacterial cell. In one embodiment, the bacterial cell is a Bifidobacterium bifidum bacterial cell. In one embodiment, the bacterial cell is a Bifidobacterium infantis bacterial cell. In one embodiment, the bacterial cell is a Bifidobacterium lactis bacterial cell. In one embodiment, the bacterial cell is a Clostridium butyricum bacterial cell.
- the bacterial cell is an Escherichia coli bacterial cell. In one embodiment, the bacterial cell is a Lactobacillus acidophilus bacterial cell. In one embodiment, the bacterial cell is a Lactobacillus plantarum bacterial cell. In one embodiment, the bacterial cell is a Lactobacillus reuteri bacterial cell. In one embodiment, the bacterial cell is a Lactococcus lactis bacterial cell.
- the recombinant bacteria are Escherichia coli strain Nissle 1917 (E. coli Nissle), a Gram-negative bacterium of the Enterobacteriaceae family that has evolved into one of the best characterized probiotics (Ukena et al., 2007).
- the strain is characterized by its complete harmlessness (Schultz, 2008), and has GRAS (generally recognized as safe) status (Reister et al., 2014, emphasis added).
- Genomic sequencing confirmed that E. coli Nissle lacks prominent virulence factors (e.g., E. coli a-hemolysin, P-fimbrial adhesins) (Schultz, 2008).
- E. coli Nissle does not carry pathogenic adhesion factors, does not produce any enterotoxins or cytotoxins, is not invasive, and not uropathogenic (Sonnenborn et al., 2009). As early as in 1917, E. coli Nissle was packaged into medicinal capsules, called Mutaflor, for therapeutic use. E.
- the recombinant bacteria are E. coli Nissle and are naturally capable of promoting tight junctions and gut barrier function. In some embodiments, the recombinant bacteria are E. coli and are highly amenable to recombinant protein technologies.
- the recombinant bacterial cell does not colonize the subject having the disorder.
- Unmodified E. coli Nissle and the recombinant bacteria may be destroyed, e.g., by defense factors in the gut or blood serum (Sonnenborn et al., 2009) or by activation of a kill switch, several hours or days after administration.
- the recombinant bacteria may require continued administration.
- Residence time in vivo may be calculated for the recombinant bacteria. In some embodiments, the residence time is calculated for a human subject. In some embodiments, residence time in vivo is calculated for the recombinant bacteria of the disclosure, e.g., as described herein.
- the bacterial cell is a recombinant bacterial cell.
- the disclosure comprises a colony of bacterial cells disclosed herein.
- the disclosure provides a recombinant bacterial culture which comprises bacterial cells disclosed herein.
- the recombinant bacteria comprising a gene sequence encoding EGF further comprise a kill-switch circuit, such as any of the kill-switch circuits provided herein.
- the recombinant bacteria further comprise one or more genes encoding one or more recombinase(s) under the control of an inducible promoter, and an inverted toxin sequence.
- the recombinant bacteria further comprise one or more genes encoding an antitoxin.
- the engineered bacteria further comprise one or more genes encoding one or more recombinase(s) under the control of an inducible promoter and one or more inverted excision genes, wherein the excision gene(s) encode an enzyme that deletes an essential gene.
- the recombinant bacteria further comprise one or more genes encoding an antitoxin.
- the engineered bacteria further comprise one or more genes encoding a toxin under the control of a promoter having a TetR repressor binding site and a gene encoding the TetR under the control of an inducible promoter that is induced by arabinose, such as ParaBAD.
- the recombinant bacteria further comprise one or more genes encoding an antitoxin.
- the recombinant bacteria is an auxotroph comprising a gene sequence encoding EGF and further comprises a kill-switch circuit, such as any of the kill-switch circuits described herein.
- the gene sequence encoding EGF is present on a plasmid in the bacterium.
- the gene sequence encoding EGF is present in the bacterial chromosome.
- a gene sequence encoding a secretion protein or protein complex, such as any of the secretion systems disclosed herein, for secreting EGF is present on a plasmid in the bacterium.
- the gene sequence encoding a secretion protein or protein complex for secreting a biomolecule, such as any of the secretion systems disclosed herein, is present in the bacterial chromosome.
- the gene sequence(s) encoding an antibiotic resistance gene is present on a plasmid in the bacterium. In some embodiments, the gene sequence(s) encoding an antibiotic resistance gene is present in the bacterial chromosome.
- the genetically engineered bacteria comprise one or more E. coli Nissle bacteriophage sequence(s), and at least one of the bacteriophage sequence(s) is mutated or modified, e.g., to delete the bacteriophage sequence, e.g.. an endogenous prophage sequence, in part or whole.
- the deletion prevents the bacteria from being able to express infectious bacteriophage particles.
- Non-limiting examples of such mutations or modifications are described in PCT/US2018/038840, the contents of which are incorporated by reference in their entirety.
- the genetically engineered bacteria comprise one or modifications or mutations in one or more of Phage 1, 2 or 3 as described in PCT/US2018/038840. In some embodiments, the genetically engineered bacteria comprise a modification or mutation in Phage 3. In some embodiments, the mutations include deletions, insertions, substitutions and inversions and are located in or encompass one or more Phage 3 genes. In some embodiments, the one or more insertions comprise an antibiotic cassette. In some embodiments, the mutation is a deletion.
- the genetically engineered bacteria comprise one or more deletions, which are located in or comprise one or more genes selected from ECOLIN_09965, ECOLIN_09970, ECOLIN_09975, ECOLIN_09980, ECOLIN_09985, ECOLIN_09990, ECOLIN_09995, ECOLIN_WOOO, ECOLIN_10005, ECOLIN_10010, ECOLIN_10015, ECOLIN_10020, ECOLIN_10025, ECOLIN_10030, ECOLIN_10035, ECOLIN_10040, ECOLIN_10045, ECOLIN_10050, ECOLIN_10055, ECOLIN_10065, ECOLIN_10070, ECOLIN_10075, ECOLIN_10080, ECOLIN_10085, ECOLIN_10090, ECOLIN_10095, ECOLIN_10100, ECOLIN_10105, ECOLIN_10110, ECOLIN_10115, ECOLIN_10120, ECOLIN_10125,
- the genetically engineered bacteria comprise a complete or partial deletion of one or more of ECOLIN_10110, ECOLIN_10115, ECOLIN_10120, ECOLIN_10125, ECOLIN_10130, ECOLIN_10135, ECOLIN_10140, ECOLIN_10145, ECOLIN_10150, ECOLIN_10160, ECOLIN_10165, ECOLIN_10170, and ECOLIN_10175.
- the deletion is a complete deletion of ECOLIN_10110, ECOLIN_10115, ECOLIN_10120, ECOLIN_10125, ECOLIN_10130, ECOLIN_10135, ECOLIN_10140, ECOLIN_10145, ECOLIN_10150, ECOLIN_10160, ECOLIN_10165, and ECOLIN_10170, and a partial deletion of ECOLIN_10175.
- the sequence of SEQ ID NO: 130 of PCT/US2018/038840 (herein SEQ ID NO: 292) is deleted from the Phage 3 genome.
- a sequence comprising SEQ ID NO: 130 of PCT/US2018/038840 (herein SEQ ID NO: 292) is deleted from the Phage 3 genome.
- the engineered bacterium further comprises a modified pks island (colibactin island).
- a modified pks island colibactin island
- Colibactin is a cyclomodulin that is synthetized by enzymes encoded by the pks genomic island. See Fais 2018. The pks genomic island is “highly conserved” in Enterobacteriaceae. Id.
- a 54-kilobase pks genomic island contains 19 genes, clbA to clbS, and encodes various enzymes that have been described as an “assembly line responsible for colibactin synthesis.” Id.
- the pks genomic island assembly line for colibactin synthesis includes three polyketide synthases (ClbC, Clbl, ClbO), three non-ribosomal peptide synthases (ClbH, ClbJ, ClbN), two hybrid non-ribosomal peptide/polyketide synthases (ClbB, ClbK), and nine accessory, tailoring, and editing proteins.
- polyketide synthases non-ribosomal peptide synthases, and hybrid enzymes “are usually organized in mega-complexes as an assembly line, in which the synthesized compound is transferred from one enzymatic module to the following one.”
- Colibactin undergoes a prodrug activation mechanism that incorporates an N-terminal structural motif, which is removed during the final stage of biosynthesis.
- the bacterium comprises a partial or full deletion in one or more of clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbl, clbJ, clbK, clbL, clbM, clbN, clbO, clbP, clbQ, clbR, and clbS or operably linked promoter(s) thereof, e.g.. as compared to the microorganism’s native clb gene(s) and operably linked promoter(s).
- the bacteria produce less colibactin as compared a control microorganism comprising the native or unmodified pks island and/or is less genotoxic compared a control microorganism comprising the native or unmodified pks island.
- the bacterium comprises a modified clb sequence selected from one or more of the clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbl, clbJ, clbK, clbL, clbM, clbN, clbO, clbP, clbQ, clbR, and clbS gene sequences, as compared to a suitable control, e.g., the native pks island in an unmodified bacterium of the same strain and/or subtype.
- a suitable control e.g., the native pks island in an unmodified bacterium of the same strain and/or subtype.
- the modified clb sequence is an insertion, a substitution, and/or a deletion as compared to the control.
- the modified clb sequence is a deletion of the clb island, e.g.. clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbl, clbJ, clbK, clbL, clbM, clbN, clbO, clbP, clbQ, clbR, and clbS.
- the colibactin deletion is the whole island except for the clbS gene, e.g., a deletion of clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbl, clbJ, clbK, clbL, clbM, clbN, clbO, clbP, clbQ, and clbR.
- the clbS gene e.g., a deletion of clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbl, clbJ, clbK, clbL, clbM, clbN, clbO, clbP
- the modified endogenous colibactin island comprises one or more modified clb sequences selected from clbA (SEQ ID NO: 294), clbB (SEQ ID NO: 295), clbC (SEQ ID NO: 296), clbD (SEQ ID NO: 297), clbE (SEQ ID NO: 298), clbF (SEQ ID NO: 299), clbG (SEQ ID NO: 300), clbH (SEQ ID NO: 301), clbl (SEQ ID NO: 302), clbJ (SEQ ID NO: 303), clbK (SEQ ID NO: 304), clbL (SEQ ID NO: 305), clbM (SEQ ID NO: 306), clbN (SEQ ID NO: 307), clbO (SEQ ID NO: 308), clbP (SEQ ID NO: 309)
- the modified endogenous colibactin island comprises a deletion of clbA (SEQ ID NO: 294), clbB (SEQ ID NO: 295), clbC (SEQ ID NO: 296), clbD (SEQ ID NO: 297), clbE (SEQ ID NO: 298), clbF (SEQ ID NO: 299), clbG (SEQ ID NO: 300), clbH (SEQ ID NO: 301), clbl (SEQ ID NO: 302), clbJ (SEQ ID NO: 303), clbK (SEQ ID NO: 304), clbL (SEQ ID NO: 305), clbM (SEQ ID NO: 306), clbN (SEQ ID NO: 307), clbO (SEQ ID NO: 308), clbP (SEQ ID NO: 309), clbQ (SEQ ID NO:
- the recombinant bacteria are capable of producing EGF, particularly human EGF.
- EGF mediates signaling pathways by binding Epidermal Growth Factor Receptor (EGFR). The binding of EGF to EGFR promotes phosphorylation of EGFR and subsequent phosphorylation of AKT and ERK. Once cleaved and secreted, EGF functions as a cytokine to ameliorate inflammatory signals. For example, EGF can enhance goblet cell-associated mucosal integrity, while diminished EGF can be associated with inflammatory disorders. EGF plays a role in inflammatory bowel disease, with murine and human studies suggesting a protective and restorative role in disease pathogenesis and activity.
- EGFR Epidermal Growth Factor Receptor
- the recombinant bacteria comprise a nucleic acid sequence encoding a polypeptide of SEQ ID NO: 505 or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a nucleic acid sequence that is at least about 80%, 85%, 90%, 95%, or 99% homologous to a nucleic acid sequence encoding a polypeptide of SEQ ID NO: 505 or a functional fragment thereof.
- the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 161 (below) or a functional fragment thereof.
- recombinant bacteria comprise a gene sequence encoding a fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 161 or a functional fragment thereof.
- the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 161.
- the polypeptide tag comprises SEQ ID NO: 161.
- the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 136 (below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 136 or a functional fragment thereof.
- the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 136.
- the polypeptide tag comprises SEQ ID NO: 136.
- the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 168 (below) or a functional fragment thereof.
- recombinant bacteria comprise a gene sequence encoding a fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 168 or a functional fragment thereof.
- the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 168.
- the polypeptide tag comprises SEQ ID NO: 168.
- the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 361 (below) or a functional fragment thereof.
- recombinant bacteria comprise a gene sequence encoding a fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 361 or a functional fragment thereof.
- the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 361.
- the polypeptide tag comprises SEQ ID NO: 361.
- LARD3 [0269] IEGRGSDGNDLIQGGKGADFIEGGKGNDTIRDNSGHNTFLFSGHFGQDRIIGYQPTDR LVFQGADGSTDLRDHAKAVGADTVLSFGADSVTLVGVGLGGLWSEGVLIS (SEQ ID NO: 361)
- the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 362 (below) or a functional fragment thereof.
- recombinant bacteria comprise a gene sequence encoding a fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 362 or a functional fragment thereof.
- the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 362.
- the polypeptide tag comprises SEQ ID NO: 362.
- the recombinant bacteria comprise a nucleic acid sequence encoding an PelB-EGF fusion protein of (SEQ ID NO: 500 below) or a functional fragment thereof.
- recombinant bacteria comprise a gene sequence encoding a PelB-EGF fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to PelB-EGF fusion protein comprising SEQ ID NO: 500 or a functional fragment thereof.
- the PelB-EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 500. In some specific embodiments, the PelB-EGF fusion protein comprises SEQ ID NO: 500.
- the recombinant bacteria comprise nucleic acid sequence encoding an PhoA-EGF fusion protein of (SEQ ID NO: 502 below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a PhoA-EGF fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to PhoA-EGF fusion protein comprising SEQ ID NO: 502 or a functional fragment thereof.
- the PhoA-EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 502. In some specific embodiments, the PhoA-EGF fusion protein comprises SEQ ID NO: 502.
- the recombinant bacteria comprise nucleic acid sequence encoding an OmpA-EGF fusion protein of (SEQ ID NO: 501 below) or a functional fragment thereof.
- recombinant bacteria comprise a gene sequence encoding a OmpA-EGF fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to OmpA-EGF fusion protein comprising SEQ ID NO: 501 or a functional fragment thereof.
- the OmpA-EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 501.
- the OmpA-EGF fusion protein comprises SEQ ID NO: 501.
- the recombinant bacteria comprise nucleic acid sequence encoding an EGF-LARD3 fusion protein of (SEQ ID NO: 503 below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding an EGF-LARD3 fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to EGF-LARD3 fusion protein comprising SEQ ID NO: 503 or a functional fragment thereof.
- the EGF- LARD3 fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 503. In some specific embodiments, the EGF-LARD3 fusion protein comprises SEQ ID NO: 503.
- EGF-LARD3 [0283] EGF-LARD3:
- the recombinant bacteria comprise nucleic acid sequence encoding an OmpA-EGF fusion protein of (SEQ ID NO: 504 below) or a functional fragment thereof.
- recombinant bacteria comprise a gene sequence encoding a OmpA-EGF fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to OmpA-EGF fusion protein comprising SEQ ID NO: 504 or a functional fragment thereof.
- the OmpA-EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 504. In some specific embodiments, the OmpA-EGF fusion protein comprises SEQ ID NO: 504.
- EGF-HylA [0286] EGF-HylA:
- the recombinant bacteria comprise a nucleic acid sequence encoding a polypeptide set forth in Table 4 or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a nucleic acid sequence that is at least about 80%, 85%, 90%, 95%, or 99% homologous to a nucleic acid sequence encoding a polypeptide set forth in Table 4 or a functional fragment thereof.
- the recombinant bacteria comprise a nucleic acid sequence set forth in Table 5 or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a nucleic acid sequence that is at least about 80%, 85%, 90%, 95%, or 99% homologous to a nucleic acid sequence set forth in Table 5 or a functional fragment thereof.
- the recombinant bacteria are capable of producing EGF under inducing conditions, e.g., under a condition(s) associated with inflammation. In some embodiments, the recombinant bacteria are capable of producing EGF in low-oxygen conditions.
- the recombinant bacteria comprise one or more gene sequence(s) selected from PhoA-EGF, OmpF-EGF, and TorA-EGF.
- the recombinant bacteria comprise gene(s) encoding an ATP binding cassette transporter or a portion thereof, e.g., one, two, three, or more subunits of an ATP binding cassette transporter as described herein.
- ATP binding cassette transporters are known in the art and described herein.
- the recombinant bacteria comprise nucleic acid sequence encoding an ATP binding cassette transporter of SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514 below or a functional fragment thereof.
- recombinant bacteria comprise a gene sequence encoding a ATP binding cassette transporter that is at least about 80%, 85%, 90%, 95%, or 99% identity to ATP binding cassette transporter comprising SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514 or a functional fragment thereof.
- the ATP binding cassette transporter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514.
- the ATP binding cassette transporter protein comprises SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514.
- the recombinant bacteria comprise a gene sequence encoding a linker fusion protein which comprises SEQ ID NO: 335 or a functional fragment thereof.
- recombinant bacteria comprise a gene sequence encoding a linker polypeptide that has at least about 80%, 85%, 90%, 95%, or 99% identity to linker polypeptide comprising SEQ ID NO: 335 or a functional fragment thereof.
- the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 335.
- the linker polypeptide comprises SEQ ID NO: 335.
- the gene sequence encoding ECOLIN 19410 secretion tag further comprises SEQ ID NO: 335.
- the recombinant bacteria comprise gene sequence encoding a linker fusion protein.
- the linker fusion protein gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 342.
- the linker gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 342.
- the linker gene sequence comprises SEQ ID NO: 342.
- the recombinant bacteria may further comprise gene sequences encoding a secretion tag.
- secretion tags include PhoA, OmpF, cvaC, TorA, fdnG, dmsA, PelB, the ECOLIN_05715 secretion signal, ECOLIN_16495 secretion signal, ECOLIN_19410 secretion signal, and the ECOLIN_19880 secretion signal.
- the secretion tag is PhoA.
- the PhoA secretion tag comprises SEQ ID NO: 136.
- the PhoA secretion tag comprises SEQ ID NO: 136.
- the recombinant bacteria produce 0% to 2%, 2% to 4%, 4% to 6%, 6% to 8%, 8% to 10%, 10% to 12%, 12% to 14%, 14% to 16%, 16% to 18%, 18% to 20%, 20% to 25%, 25% to 30%, 30% to 35%, 35% to 40%, 40% to 45%, 45% to 50%, 50% to 55%, 55% to 60%, 60% to 65%, 65% to 70%, 70% to 80%, 80% to 90%, or 90% to 100% more EGF than unmodified bacteria of the same bacterial subtype under the same conditions.
- the recombinant bacteria produce 1.0-1.2-fold, 1.2-1.4-fold, 1.4-1.6-fold, 1.6-1.8-fold, 1.8-2-fold, or two- fold more EGF than unmodified bacteria of the same bacterial subtype under the same conditions.
- the recombinant bacteria produce three-fold, four-fold, five-fold, six-fold, seven-fold, eight-fold, nine-fold, ten-fold, fifteen-fold, twenty-fold, thirty-fold, forty-fold, or fifty- fold, more EGF, than unmodified bacteria of the same bacterial subtype under the same conditions.
- the EGF constructs described herein may further comprise a secretion tag.
- secretion tags are described herein. The secretion tag is at the N-terminus or at the C-terminus.
- the recombinant bacteria may further comprise gene sequences encoding a secretion tag.
- secretion tags are described herein and include PhoA, OmpF, cvaC, TorA, fdnG, dmsA, PelB, the ECOLIN_05715 secretion signal, ECOLIN_16495 secretion signal, ECOLIN_19410 secretion signal, and the ECOLIN_19880 secretion signal.
- the secretion tag is PhoA.
- the secretion tag is ECOLIN 19410.
- the recombinant bacteria may further comprise one or more mutations to outer membrane proteins, i.e., to generate a diffusible outer membrane phenotype (DOM).
- outer membrane proteins i.e., to generate a diffusible outer membrane phenotype (DOM).
- DOM diffusible outer membrane phenotype
- outer membrane proteins include Ipp, nlP, tolA, and pal.
- the recombinant bacteria comprise a deletion or mutation in pal.
- the recombinant bacterium e.g., Gram-negative bacterium, e.g., E.
- coli Nissle may be engineered by deleting the gene encoding the periplasmic protein pal to create a diffusible outer membrane (DOM) phenotype, e.g., to result in a “leaky membrane” bacterium and increase the rate of diffusion of periplasmic proteins to the external environment without compromising cell growth properties.
- DOM diffusible outer membrane
- the genetically engineered are capable of producing and secreting EGF.
- the EGF gene is functionally replaced, modified, and/or mutated in order to enhance stability and/or increase EGF production or secretion.
- the recombinant bacteria are capable of expressing and secreting EGF in low-oxygen conditions, in the presence of certain molecules or metabolites, in the presence of molecules or metabolites associated with inflammation or an inflammatory response, or in the presence of some other metabolite that may or may not be present in the gut, such as arabinose. Exemplary chemical inducers are described herein.
- the EGF gene is directly operably linked to a first promoter. In another embodiment, the EGF gene is indirectly operably linked to a first promoter. In one embodiment, the promoter is not operably linked with the EGF gene in nature.
- the EGF gene is expressed under the control of a constitutive promoter. In another embodiment, the EGF gene is expressed under the control of an inducible promoter. In some embodiments, the EGF gene is expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions. In one embodiment, the EGF gene is expressed under the control of a promoter that is directly or indirectly induced by low-oxygen or anaerobic conditions, wherein expression of the EGF gene is activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut.
- the EGF gene is expressed under the control of a temperature-sensitive promoter, e.g., a promoter that is directly or indirectly induced by a temperature between 37°C and 42°C.
- a temperature-sensitive promoter e.g., a promoter that is directly or indirectly induced by a temperature between 37°C and 42°C.
- Inducible promoters are described in more detail herein.
- the EGF gene may be present on a plasmid or chromosome in the bacterial cell.
- the EGF gene is located on a plasmid in the bacterial cell.
- the EGF gene is located in the chromosome of the bacterial cell.
- a native copy of the EGF gene is located in the chromosome of the bacterial cell.
- the EGF gene may be expressed on a low-copy plasmid or a high-copy plasmid. The high-copy plasmid may be useful for increasing expression of EGF.
- the bacterium comprises a gene sequence encoding EGF operably linked to a thermoregulated promoter, e.g., cI857; a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the gene sequence encoding EGF; a modification, e.g., knockout, in the Phage 3 genome; a modification, e.g., knockout, in the colibactin pks island; a thymidine auxotrophy, as disclosed herein.
- a thermoregulated promoter e.g., cI857
- a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the gene sequence encoding EGF
- a modification e.g., knockout
- a modification e.g., knockout, in the Phage 3 genome
- a modification e.g., knockout, in the colibactin pks island
- a thymidine auxotrophy
- the bacterium comprises a gene sequence encoding EGF operably linked to a thermoregulated promoter, e.g., cI857; a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence; a modification, e.g., knockout, in the Phage 3 genome; a modification, e.g., knockout, in the colibactin pks island; a thymidine auxotrophy; and Apal (diffusible outer membrane), as disclosed herein.
- the bacterium comprises a gene sequence encoding EGF operably linked to an oxygen level-dependent promoter, e.g., FNR-responsive promoter; a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence; a modification, e.g., knockout, in the Phage 3 genome; a modification, e.g., knockout, in the colibactin pks island; a thymidine auxotrophy, as disclosed herein.
- an oxygen level-dependent promoter e.g., FNR-responsive promoter
- a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence
- a modification e.g., knockout
- a modification e.g., knockout, in the Phage 3 genome
- a modification e.g., knockout, in the colibactin pks island
- a thymidine auxotrophy as disclosed
- the bacterium comprises a gene sequence encoding EGF operably linked to an oxygen level-dependent promoter, e.g., FNR-responsive promoter; a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence; a modification, e.g., knockout, in the Phage 3 genome; a modification, e.g., knockout, in the colibactin pks island; a thymidine auxotrophy; and Apal (diffusible outer membrane), as disclosed herein.
- an oxygen level-dependent promoter e.g., FNR-responsive promoter
- a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence
- a modification e.g., knockout, in the Phage 3 genome
- a modification e.g., knockout, in the colibactin pks island
- a thymidine auxotrophy e.g
- the gene sequences encoding the EGF constructs comprising gene sequences encoding EGF operably linked to an inducible promoter, e.g., an oxygen level-dependent or temperature sensitive promoter, and the gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence may be integrated into the bacterial chromosome.
- the bacterium comprises a single integrated copy of such an EGF gene sequence (i.e., OmpA-EGF).
- the genetically engineered bacterium comprises multiple integrated copies of the EGF gene sequence. The multiple copies may be present at the same genomic integration site, e.g., arranged in tandem.
- each copy of the EGF gene sequence may be operably linked to the same copy of the same promoter. In some embodiments, each copy of the EGF gene sequence may be operably linked to a different copy of the same promoter or different promoters. Alternatively, multiple copies of EGF gene sequences may be integrated at multiple distinct genomic integration sites, wherein each copy of EGF gene sequence is operably linked to a distinct instance of the promoter. In some embodiments, the promoters are multiple instances of the same promoter. In some embodiments, the promoters are multiple instances of different promoters. In some embodiments, the promoters are inducible promoters, such as a low oxygen inducible FNR promoter, a temperature sensitive promoter, or an IPTG inducible promoter.
- the bacterium comprises two copies of EGF gene sequences, wherein the two copies of the gene sequences are integrated at two distinct integration sites, and wherein each copy of the EGF gene sequence is operably linked to a separate instance of the same promoter.
- the bacterium comprises three copies of the EGF gene sequences, wherein the three copies of the gene sequences each are integrated at three distinct integration sites, and wherein each copy of the EGF gene is operatively linked to a separate instance of the same promoter.
- the promoter is an inducible promoter, e.g., a low oxygen inducible promoter (e.g., FNR promoter), a temperature sensitive promoter, or an IPTG inducible promoter.
- the EGF gene sequences may be operably linked to a gene sequence encoding an N-terminal OmpA secretion tag.
- the bacterium may further comprise one or more of (1) a knockout in the Phage 3 genome; (2) a modification, e.g., knockout, in the colibactin pks island; (3) a thymidine auxotrophy; and (4) Apal (diffusible outer membrane), as disclosed herein.
- the recombinant bacteria are capable of secreting about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, or 1.0 ng EGF/5el l cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 ug EGF/5el l cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, or 120 ug EGF/5el 1 cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 pg EGF/5el 1 cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 pg EGF/5el 1 cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 350, 400, 450, 500, 550, 600, 650, 700, 750, or 800 pg EGF/5el 1 cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, or 1.0 ug EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 ug EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, or 120 ug/mL EGF/5el 1 cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 40, 50, 60, 70, 80, 90, or 100 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 310, 320, 330, 340, 350, 360, 370, 380, 390, or 400 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 410, 420, 430, 440, 450, 460, 470, 480, 490, or 500 pg EGF/5el 1 cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 510, 520, 530, 540, 550, 560, 570, 580, 590, or 600 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 610, 620, 630, 640, 650, 660, 670, 680, 690, or 700 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 710, 720, 730, 740, 750, 760, 770, 780, 790, or 800 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least about 350, 400, 450, 500, 550, 600, 650, 700, 750, or 800 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, or 1.0 ug EGF/5el l cells over 5 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 ug EGF/5el l cells over 5 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, or 120 ug EGF/5el 1 cells over 5 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- the recombinant bacteria are capable of secreting at least 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 pg EGF/5el 1 cells over 5 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
- inducing conditions may be low oxygen or anaerobic inducing conditions or, alternatively, inducing conditions may be a temperature between about 37°C and 42°C. In some embodiments, inducing conditions may be the presence of an inducer, such as IPTG. In some specific embodiments, the inducing conditions are low oxygen or anaerobic inducing conditions. In some specific embodiments, the inducing conditions are a temperature between about 37°C and about 42°C. Inducible regulatory regions
- the terms “payload” “polypeptide of interest” or “polypeptides of interest”, “protein of interest”, “proteins of interest”, “payloads” “effector molecule”, “effector” refers to one or more effector molecules described herein and/or one or more enzyme(s) or polypeptide(s) that function as enzymes for the production and secretion of such effector molecules, e.g., EGF.
- the bacterial cell comprises a stably maintained plasmid or chromosome carrying the gene(s) encoding payload (s), such that the payload(s) can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
- bacterial cell comprises two or more distinct payloads or operons, e.g., two or more payload genes.
- bacterial cell comprises three or more distinct transporters or operons, e.g., three or more payload genes.
- bacterial cell comprises 4, 5, 6, 7, 8, 9, 10, or more distinct payloads or operons, e.g., 4, 5, 6, 7, 8, 9, 10, or more payload genes.
- the recombinant bacteria comprise multiple copies of the same payload gene(s).
- the gene encoding the payload is present on a plasmid and operably linked to a directly or indirectly inducible promoter.
- the gene encoding the payload is present on a plasmid and operably linked to a constitutive promoter.
- the gene encoding the payload is present on a plasmid and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions.
- the gene encoding the payload is present on a plasmid and operably linked to a temperature sensitive promoter.
- the gene encoding the payload is present on plasmid and operably linked to a promoter that is induced by exposure to tetracycline or arabinose, or another chemical or nutritional inducer described herein.
- the gene encoding the payload is present on a chromosome and operably linked to a directly or indirectly inducible promoter. In some embodiments, the gene encoding the payload is present on a chromosome and operably linked to a constitutive promoter. In some embodiments, the gene encoding the payload is present in the chromosome and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions. In some embodiments, the gene encoding the payload is present in the chromosome and operably linked to a temperature sensitive promoter. In some embodiments, the gene encoding the payload is present on chromosome and operably linked to a promoter that is induced by exposure to tetracycline or arabinose, or another chemical or nutritional inducer described herein.
- the recombinant bacteria comprise two or more payloads, all of which are present on the chromosome. In some embodiments, the recombinant bacteria comprise two or more payloads, all of which are present on one or more same or different plasmids. In some embodiments, the recombinant bacteria comprise two or more payloads, some of which are present on the chromosome and some of which are present on one or more same or different plasmids.
- an EGF payload is operably linked to one or more directly or indirectly inducible promoter(s).
- the one or more payload(s) are operably linked to a directly or indirectly inducible promoter that is induced under exogenous environmental conditions, e.g., conditions found in the gut, e.g., induced by metabolites found in the gut, or other specific conditions.
- the one or more payload(s) are operably linked to a directly or indirectly inducible promoter that is temperature sensitive or induced under low-oxygen or anaerobic conditions, or induced under inflammatory conditions (e.g., RNS, ROS), as described herein.
- the two or more gene sequence(s) are linked to a directly or indirectly inducible promoter that is induced by exposure a chemical or nutritional inducer, which may or may not be present under in vivo conditions and which may be present during in vitro conditions (such as strain culture, expansion, manufacture), such as tetracycline or arabinose, or others described herein.
- a chemical or nutritional inducer which may or may not be present under in vivo conditions and which may be present during in vitro conditions (such as strain culture, expansion, manufacture), such as tetracycline or arabinose, or others described herein.
- the two or more payloads are all linked to a constitutive promoter, as described herein.
- the promoter is induced under in vivo conditions, e.g., the gut, as described herein. In some embodiments, the promoter is induced under in vitro conditions, e.g., various cell culture and/or cell manufacturing conditions, as described herein.
- the promoter that is operably linked to the gene encoding the payload is directly induced by exogenous environmental conditions (e.g., in vivo and/or in vitro and/or production/manufacturing conditions).
- the promoter is directly or indirectly induced by exogenous environmental conditions specific to the gut of a mammal, e.g., to the small intestine of a mammal. In some embodiments, the promoter is directly or indirectly induced by low-oxygen or anaerobic conditions such as the environment of the mammalian gut. In some embodiments, the promoter is a temperature sensitive promoter. In some embodiments, the promoter is directly or indirectly induced by molecules or metabolites that are specific to the tumor, a particular tissue or the gut of a mammal. In some embodiments, the promoter is directly or indirectly induced by a molecule that is co- administered with the bacterial cell.
- the recombinant bacteria comprise a gene or gene cassette for producing EGF, wherein the gene or gene cassette is operably linked to a directly or indirectly inducible promoter that is controlled by exogenous environmental condition(s).
- the inducible promoter is an oxygen level-dependent promoter and EGF is expressed in low-oxygen, microaerobic, or anaerobic conditions.
- the oxygen level-dependent promoter is activated by a corresponding oxygen level-sensing transcription factor, thereby driving production of EGF.
- Bacteria have evolved transcription factors that are capable of sensing oxygen levels. Different signaling pathways may be triggered by different oxygen levels and occur with different kinetics.
- An oxygen level-dependent promoter is a nucleic acid sequence to which one or more oxygen level-sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression.
- the recombinant bacteria comprise a gene or gene cassette for producing a payload under the control of an oxygen level-dependent promoter.
- the recombinant bacteria comprise a gene or gene cassette for producing a payload under the control of an oxygen level-dependent promoter that is activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut.
- the bacterial cell comprises a gene encoding a pay load expressed under the control of a fumarate and nitrate reductase regulator (FNR) responsive promoter.
- FNR fumarate and nitrate reductase regulator
- E. coli FNR is a major transcriptional activator that controls the switch from aerobic to anaerobic metabolism (Unden et al., 1997). In the anaerobic state, FNR dimerizes into an active DNA binding protein that activates hundreds of genes responsible for adapting to anaerobic growth. In the aerobic state, FNR is prevented from dimerizing by oxygen and is inactive.
- Exemplary FNR responsive promoters include, but are not limited to, SEQ ID NO: 1-11, 336 and 337. FNR promoter sequences are known in the art, and any suitable FNR promoter sequence(s) may be used in the recombinant bacteria.
- the recombinant bacteria comprise one or more of: SEQ ID NOS: 1- 7, nirBl promoter (SEQ ID NO: 1), nirB2 promoter (SEQ ID NO: 8), nirB3 promoter (SEQ ID NO: 9), ydfZ promoter (SEQ ID NO: 2), nirB promoter fused to a strong ribosome binding site (SEQ ID NO: 336), ydfZ promoter fused to a strong ribosome binding site (SEQ ID NO: 4), fnrS, an anaerobically induced small RNA gene (fnrSl promoter SEQ ID NO: 5 or fnrS2 promoter SEQ ID NO: 10), nirB promoter fused to a crp binding site (SEQ ID NO: 11), and fnrS fused to a crp binding site (SEQ ID NO: 337).
- the FNR-responsive promoter is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- multiple distinct FNR nucleic acid sequences are inserted in the recombinant bacteria.
- the recombinant bacteria comprise a gene encoding a payload expressed under the control of an alternate oxygen level-dependent promoter, e.g., DNR (Trunk et al., 2010) or ANR (Ray et al., 1997).
- expression of the payload gene is particularly activated in a low-oxygen or anaerobic environment, such as in the gut, e.g., a mammalian gut, e.g., a human gut.
- gene expression is further optimized by methods known in the art, e.g., by optimizing ribosomal binding sites and/or increasing mRNA stability.
- the recombinant bacteria comprise a gene sequence encoding EGF, expressed under the control of anaerobic regulation of arginine deiminiase and nitrate reduction transcriptional regulator (ANR).
- ANR arginine deiminiase and nitrate reduction transcriptional regulator
- P. aeruginosa ANR is “required for the expression of physiological functions which are inducible under oxygen-limiting or anaerobic conditions” (Winteler et al., 1996; Sawers 1991).
- P. aeruginosa ANR is homologous with E. coli FNR, and “the consensus FNR site (TTGAT — ATCAA) was recognized efficiently by ANR and FNR” (Winteler et al., 1996).
- ANR activates numerous genes responsible for adapting to anaerobic growth.
- ANR In the aerobic state, ANR is inactive. Pseudomonas fluorescens, Pseudomonas putida, Pseudomonas syringae, and Pseudomonas mendocina all have functional analogs of ANR (Zimmermann et al., 1991). Promoters that are regulated by ANR are known in the art, e.g., the promoter of the arcDABC operon (see, e.g., Hasegawa et al., 1998).
- the one or more gene sequence(s) for producing a payload are expressed under the control of an oxygen level-dependent promoter fused to a binding site for a transcriptional activator, e.g., CRP.
- CRP cyclic AMP receptor protein or catabolite activator protein or CAP
- CRP plays a major regulatory role in bacteria by repressing genes responsible for the uptake, metabolism, and assimilation of less favorable carbon sources when rapidly metabolizable carbohydrates, such as glucose, are present (Wu et al., 2015). This preference for glucose has been termed glucose repression, as well as carbon catabolite repression (Deutscher, 2008; Gbrke and Stiilke, 2008).
- the gene or gene cassette for producing EGF is controlled by an oxygen level-dependent promoter fused to a CRP binding site.
- the one or more gene sequence(s) for a payload are controlled by a FNR promoter fused to a CRP binding site.
- cyclic AMP binds to CRP when no glucose is present in the environment. This binding causes a conformational change in CRP, and allows CRP to bind tightly to its binding site. CRP binding then activates transcription of the gene or gene cassette by recruiting RNA polymerase to the FNR promoter via direct protein-protein interactions. In the presence of glucose, cyclic AMP does not bind to CRP and transcription of the gene or gene cassette for producing an payload is repressed.
- an oxygen level-dependent promoter e.g., an FNR promoter fused to a binding site for a transcriptional activator is used to ensure that the gene or gene cassette for producing a payload is not expressed under anaerobic conditions when sufficient amounts of glucose are present, e.g., by adding glucose to growth media in vitro.
- the recombinant bacteria comprise an oxygen level-dependent promoter from a different species, strain, or substrain of bacteria.
- the recombinant bacteria comprise an oxygen level-sensing transcription factor, e.g., FNR, ANR or DNR, from a different species, strain, or substrain of bacteria.
- the recombinant bacteria comprise an oxygen level-sensing transcription factor and corresponding promoter from a different species, strain, or substrain of bacteria.
- the heterologous oxygen-level dependent transcriptional regulator and/or promoter increases the transcription of genes operably linked to said promoter, e.g., one or more gene sequence(s) for producing the payload(s) in a low-oxygen or anaerobic environment, as compared to the native gene(s) and promoter in the bacteria under the same conditions.
- the non-native oxygen-level dependent transcriptional regulator is an FNR protein from N. gonorrhoeae (see, e.g., Isabella et al., 2011).
- the corresponding wild-type transcriptional regulator is left intact and retains wild-type activity.
- the corresponding wild-type transcriptional regulator is deleted or mutated to reduce or eliminate wild-type activity.
- the recombinant bacteria comprise a wild-type oxygen-level dependent transcriptional regulator, e.g., FNR, ANR, or DNR, and corresponding promoter that is mutated relative to the wild-type promoter from bacteria of the same subtype.
- the mutated promoter enhances binding to the wild-type transcriptional regulator and increases the transcription of genes operably linked to said promoter, e.g., the gene encoding the payload, in a low-oxygen or anaerobic environment, as compared to the wild-type promoter under the same conditions.
- the recombinant bacteria comprise a wild-type oxygen-level dependent promoter, e.g., FNR, ANR, or DNR promoter, and corresponding transcriptional regulator that is mutated relative to the wild-type transcriptional regulator from bacteria of the same subtype.
- the mutated transcriptional regulator enhances binding to the wild-type promoter and increases the transcription of genes operably linked to said promoter, e.g., the gene encoding the payload, in a low-oxygen or anaerobic environment, as compared to the wild-type transcriptional regulator under the same conditions.
- the mutant oxygen-level dependent transcriptional regulator is an FNR protein comprising amino acid substitutions that enhance dimerization and FNR activity (see, e.g., Moore et al., (2006).
- both the oxygen level-sensing transcriptional regulator and corresponding promoter are mutated relative to the wild-type sequences from bacteria of the same subtype in order to increase expression of the payload in low-oxygen conditions.
- the bacterial cells comprise multiple copies of the endogenous gene encoding the oxygen level-sensing transcriptional regulator, e.g., the FNR gene.
- the gene encoding the oxygen level-sensing transcriptional regulator is present on a plasmid.
- the gene encoding the oxygen level- sensing transcriptional regulator and the gene encoding the payload are present on different plasmids.
- the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding the payload are present on the same plasmid.
- the gene encoding the oxygen level-sensing transcriptional regulator is present on a chromosome. In some embodiments, the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding the payload are present on different chromosomes. In some embodiments, the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding the payload are present on the same chromosome. In some instances, it may be advantageous to express the oxygen level-sensing transcriptional regulator under the control of an inducible promoter in order to enhance expression stability. In some embodiments, expression of the transcriptional regulator is controlled by a different promoter than the promoter that controls expression of the gene encoding the payload. In some embodiments, expression of the transcriptional regulator is controlled by the same promoter that controls expression of the payload. In some embodiments, the transcriptional regulator and the payload are divergently transcribed from a promoter region.
- the recombinant bacteria comprise a gene encoding a payload that is expressed under the control of an inducible promoter.
- the recombinant bacterium that expresses a payload under the control of a promoter that is activated by inflammatory conditions.
- the gene for producing the payload is expressed under the control of an inflammatory-dependent promoter that is activated in inflammatory environments, e.g., a reactive nitrogen species or RNS promoter.
- RNS reactive nitrogen species
- RNS can cause deleterious cellular effects such as nitrosative stress.
- RNS includes, but is not limited to, nitric oxide (NO*), peroxynitrite or peroxynitrite anion (ONOO-), nitrogen dioxide (*NO2), dinitrogen trioxide (N2O3), peroxynitrous acid (ONOOH), and nitroperoxycarbonate (ONOOCO2-) (unpaired electrons denoted by •).
- NO* nitric oxide
- ONOO- nitrogen dioxide
- N2O3 dinitrogen trioxide
- ONOOH peroxynitrous acid
- ONOOCO2- nitroperoxycarbonate
- Bacteria have evolved transcription factors that are capable of sensing RNS levels. Different RNS signaling pathways are triggered by different RNS levels and occur with different kinetics.
- RNS-inducible regulatory region refers to a nucleic acid sequence to which one or more RNS-sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression; in the presence of RNS, the transcription factor binds to and/or activates the regulatory region.
- the RNS-inducible regulatory region comprises a promoter sequence.
- the transcription factor senses RNS and subsequently binds to the RNS-inducible regulatory region, thereby activating downstream gene expression.
- the transcription factor is bound to the RNS-inducible regulatory region in the absence of RNS; in the presence of RNS, the transcription factor undergoes a conformational change, thereby activating downstream gene expression.
- the RNS-inducible regulatory region may be operatively linked to a gene or genes, e.g., a payload gene sequence(s), e.g., any of the payloads described herein.
- a transcription factor senses RNS and activates a corresponding RNS-inducible regulatory region, thereby driving expression of an operatively linked gene sequence.
- RNS induces expression of the gene or gene sequences.
- Each regulatory region is capable of binding at least one corresponding RNS-sensing transcription factor.
- transcription factors that sense RNS and their corresponding RNS- responsive genes, promoters, and/or regulatory regions include, but are not limited to, those shown in Table 6.
- the recombinant bacteria comprise a tunable regulatory region that is directly or indirectly controlled by a transcription factor that is capable of sensing at least one reactive nitrogen species.
- the tunable regulatory region is operatively linked to a gene or genes capable of directly or indirectly driving the expression of a payload, thus controlling expression of the payload relative to RNS levels.
- the tunable regulatory region is a RNS-inducible regulatory region, and the payload is a payload, such as any of the payloads provided herein; when RNS is present, e.g., in an inflamed tissue, a RNS-sensing transcription factor binds to and/or activates the regulatory region and drives expression of the payload gene or genes. Subsequently, when inflammation is ameliorated, RNS levels are reduced, and production of the payload is decreased or eliminated.
- the tunable regulatory region is a RNS-inducible regulatory region; in the presence of RNS, a transcription factor senses RNS and activates the RNS-inducible regulatory region, thereby driving expression of an operatively linked gene or genes.
- the transcription factor senses RNS and subsequently binds to the RNS-inducible regulatory region, thereby activating downstream gene expression.
- the transcription factor is bound to the RNS-inducible regulatory region in the absence of RNS; when the transcription factor senses RNS, it undergoes a conformational change, thereby inducing downstream gene expression.
- the tunable regulatory region is a RNS-inducible regulatory region
- the transcription factor that senses RNS is NorR.
- NorR is an NO-responsive transcriptional activator that regulates expression of the norVW genes encoding flavorubredoxin and an associated flavoprotein, which reduce NO to nitrous oxide” (Spiro 2006).
- the recombinant bacteria may comprise any suitable RNS-responsive regulatory region from a gene that is activated by NorR.
- the recombinant bacteria comprise a RNS- inducible regulatory region from nor VW that is operatively linked to a gene or genes, e.g., one or more payload gene sequence(s).
- a NorR transcription factor senses RNS and activates to the norVW regulatory region, thereby driving expression of the operatively linked gene(s) and producing the payload(s).
- the tunable regulatory region is a RNS-inducible regulatory region
- the transcription factor that senses RNS is DNR.
- DNR dissimilatory nitrate respiration regulator
- the recombinant bacteria may comprise any suitable RNS-responsive regulatory region from a gene that is activated by DNR. Genes that are capable of being activated by DNR are known in the art (see, e.g., Castiglione et al., 2009; Giardina et al., 2008).
- the recombinant bacteria comprise a RNS-inducible regulatory region from norCB that is operatively linked to a gene or gene cassette, e.g., a butyrogenic gene cassette.
- a DNR transcription factor senses RNS and activates to the norCB regulatory region, thereby driving expression of the operatively linked gene or genes and producing one or more payloads.
- the DNR is Pseudomonas aeruginosa DNR. Any suitable transcriptional regulator that is controlled by exogenous environmental conditions and corresponding regulatory region may be used. Non-limiting examples include ArcA/B, ResD/E, NreA/B/C, and AirSR, and others are known in the art.
- the tunable regulatory region is a RNS-derepressible regulatory region, and binding of a corresponding transcription factor represses downstream gene expression; in the presence of RNS, the transcription factor no longer binds to the regulatory region, thereby derepressing the operatively linked gene or gene cassette.
- the tunable regulatory region is a RNS-derepressible regulatory region
- the transcription factor that senses RNS is NsrR.
- NsrR is “an Rrf2-type transcriptional repressor [that] can sense NO and control the expression of genes responsible for NO metabolism” (Isabella et al., 2009).
- the recombinant bacteria may comprise any suitable RNS-responsive regulatory region from a gene that is repressed by NsrR.
- the NsrR is Neisseria gonorrhoeae NsrR.
- the recombinant bacteria comprise a RNS- derepressible regulatory region from norB that is operatively linked to a gene or genes, e.g., a payload gene or genes.
- a RNS- derepressible regulatory region from norB that is operatively linked to a gene or genes, e.g., a payload gene or genes.
- an NsrR transcription factor senses RNS and no longer binds to the norB regulatory region, thereby derepressing the operatively linked a payload gene or genes and producing the encoding a payload(s).
- the recombinant bacteria it is advantageous for the recombinant bacteria to express a RNS- sensing transcription factor that does not regulate the expression of a significant number of native genes in the bacteria.
- the recombinant bacterium expresses a RNS-sensing transcription factor from a different species, strain, or substrain of bacteria, wherein the transcription factor does not bind to regulatory sequences in the recombinant bacterium.
- the recombinant bacterium is Escherichia coli
- the RNS-sensing transcription factor is NsrR, e.g., from is Neisseria gonorrhoeae, wherein the Escherichia coli does not comprise binding sites for said NsrR.
- the heterologous transcription factor minimizes or eliminates off-target effects on endogenous regulatory regions and genes in the recombinant bacteria.
- the recombinant bacteria may comprise a two-repressor activation regulatory circuit, which is used to express a payload.
- the two-repressor activation regulatory circuit comprises a first RNS-sensing repressor and a second repressor, which is operatively linked to a gene or gene cassette, e.g., encoding a payload.
- the RNS-sensing repressor inhibits transcription of the second repressor, which inhibits the transcription of the gene or gene cassette.
- second repressors include, but are not limited to, TetR, Cl, and LexA.
- a RNS-responsive transcription factor may induce, derepress, or repress gene expression depending upon the regulatory region sequence used in the recombinant bacteria.
- One or more types of RNS-sensing transcription factors and corresponding regulatory region sequences may be present in recombinant bacteria.
- the recombinant bacteria comprise one type of RNS- sensing transcription factor, e.g., NsrR, and one corresponding regulatory region sequence, e.g., from norB. In some embodiments, the recombinant bacteria comprise one type of RNS-sensing transcription factor, e.g., NsrR, and two or more different corresponding regulatory region sequences, e.g., from norB and aniA. In some embodiments, the recombinant bacteria comprise two or more types of RNS-sensing transcription factors, e.g., NsrR and NorR, and two or more corresponding regulatory region sequences, e.g., from norB and norR, respectively.
- One RNS-responsive regulatory region may be capable of binding more than one transcription factor.
- the recombinant bacteria comprise two or more types of RNS-sensing transcription factors and one corresponding regulatory region sequence. Nucleic acid sequences of several RNS-regulated regulatory regions are known in the art (see, e.g., Spiro 2006; Isabella et al., 2009; Dunn et al., 2010; Vine et al., 2011; Karlinsey et al., 2012).
- the recombinant bacteria comprise a gene encoding a RNS-sensing transcription factor, e.g., the nsrR gene, that is controlled by its native promoter, an inducible promoter, a promoter that is stronger than the native promoter, e.g., the GlnRS promoter or the P(Bla) promoter, or a constitutive promoter.
- a RNS-sensing transcription factor e.g., the nsrR gene
- expression of the RNS-sensing transcription factor is controlled by a different promoter than the promoter that controls expression of EGF.
- expression of the RNS-sensing transcription factor is controlled by the same promoter that controls expression of EGF.
- the RNS-sensing transcription factor and EGF are divergently transcribed from a promoter region.
- the recombinant bacteria comprise a gene for a RNS-sensing transcription factor from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise a RNS-responsive regulatory region from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise a RNS- sensing transcription factor and corresponding RNS-responsive regulatory region from a different species, strain, or substrain of bacteria. The heterologous RNS-sensing transcription factor and regulatory region may increase the transcription of genes operatively linked to said regulatory region in the presence of RNS, as compared to the native transcription factor and regulatory region from bacteria of the same subtype under the same conditions.
- the recombinant bacteria comprise a RNS-sensing transcription factor, NsrR, and corresponding regulatory region, nsrR, from Neisseria gonorrhoeae.
- NsrR RNS-sensing transcription factor
- nsrR regulatory region from Neisseria gonorrhoeae.
- the native RNS-sensing transcription factor e.g., NsrR
- the native RNS-sensing transcription factor e.g., NsrR
- the recombinant bacteria comprise multiple copies of the endogenous gene encoding the RNS-sensing transcription factor, e.g., the nsrR gene.
- the gene encoding the RNS-sensing transcription factor is present on a plasmid.
- the gene encoding the RNS-sensing transcription factor and the gene or gene cassette for producing EGF are present on different plasmids.
- the gene encoding the RNS-sensing transcription factor and the gene or gene cassette for producing EGF are present on the same plasmid.
- the gene encoding the RNS-sensing transcription factor is present on a chromosome. In some embodiments, the gene encoding the RNS-sensing transcription factor and the gene or gene cassette for producing EGF are present on different chromosomes. In some embodiments, the gene encoding the RNS-sensing transcription factor and the gene or gene cassette for producing EGF are present on the same chromosome.
- the recombinant bacteria comprise a wild-type gene encoding a RNS- sensing transcription factor, e.g., the NsrR gene, and a corresponding regulatory region, e.g., a norB regulatory region, that is mutated relative to the wild-type regulatory region from bacteria of the same subtype.
- the mutated regulatory region increases the expression of the payload in the presence of RNS, as compared to the wild-type regulatory region under the same conditions.
- the recombinant bacteria comprise a wild-type RNS-responsive regulatory region, e.g., the norB regulatory region, and a corresponding transcription factor, e.g., NsrR, that is mutated relative to the wild-type transcription factor from bacteria of the same subtype.
- the mutant transcription factor increases the expression of the payload in the presence of RNS, as compared to the wild-type transcription factor under the same conditions.
- both the RNS- sensing transcription factor and corresponding regulatory region are mutated relative to the wild-type sequences from bacteria of the same subtype in order to increase expression of the payload in the presence of RNS.
- the gene or gene cassette for producing the e molecule(s) is present on a plasmid and operably linked to a promoter that is induced by RNS.
- expression is further optimized by methods known in the art, e.g., by optimizing ribosomal binding sites, manipulating transcriptional regulators, and/or increasing mRNA stability.
- any of the gene(s) of the present disclosure may be integrated into the bacterial chromosome at one or more integration sites.
- one or more copies of one or more encoding a pay load gene(s) may be integrated into the bacterial chromosome. Having multiple copies of the gene or gen(s) integrated into the chromosome allows for greater production of the payload(s) and also permits fine-tuning of the level of expression.
- different circuits described herein, such as any of the secretion or exporter circuits, in addition to the EGF gene(s) or gene cassette(s) could be integrated into the bacterial chromosome at one or more different integration sites to perform multiple different functions.
- the recombinant bacteria produce at least one payload in the presence of RNS to reduce local gut inflammation by at least about 1.5 -fold, at least about 2-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1,000-fold, or at least about 1,500-fold as compared to unmodified bacteria of the same subtype under the same conditions.
- Inflammation may be measured by methods known in the art, e.g., counting disease lesions using endoscopy; detecting T regulatory cell differentiation in peripheral blood, e.g., by fluorescence activated sorting; measuring T regulatory cell levels; measuring cytokine levels; measuring areas of mucosal damage; assaying inflammatory biomarkers, e.g., by qPCR; PCR arrays; transcription factor phosphorylation assays; immunoassays; and/or cytokine assay kits (Mesoscale, Cayman Chemical, Qiagen).
- the recombinant bacteria produce at least about 1.5-fold, at least about 2-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1,000-fold, or at least about 1,500-fold more of payload in the presence of RNS than unmodified bacteria of the same subtype under the same conditions. Certain unmodified bacteria will not have detectable levels of the payload. In embodiments using genetically modified forms of these bacteria, payload will be detectable in the presence of RNS. ROS-dependent regulation
- the recombinant bacteria comprise a gene for producing a payload that is expressed under the control of an inducible promoter.
- the recombinant bacterium that expresses a payload under the control of a promoter that is activated by conditions of cellular damage.
- the gene for producing the payload is expressed under the control of a cellular damaged-dependent promoter that is activated in environments in which there is cellular or tissue damage, e.g., a reactive oxygen species or ROS promoter.
- ROS reactive oxygen species
- ROS reactive oxygen species
- ROS can be produced as byproducts of aerobic respiration or metal -catalyzed oxidation and may cause deleterious cellular effects such as oxidative damage.
- ROS includes, but is not limited to, hydrogen peroxide (H2O2), organic peroxide (ROOH), hydroxyl ion (OH-), hydroxyl radical (*OH), superoxide or superoxide anion (*O2-), singlet oxygen (102), ozone (03), carbonate radical, peroxide or peroxyl radical (*O2- 2), hypochlorous acid (HOC1), hypochlorite ion (OC1-), sodium hypochlorite (NaOCl), nitric oxide (NO*), and peroxynitrite or peroxynitrite anion (ONOO-) (unpaired electrons denoted by •).
- Bacteria have evolved transcription factors that are capable of sensing ROS levels. Different ROS signaling pathways are triggered by different ROS levels and occur with different kinetics (Marinho et al., 2014).
- ROS-inducible regulatory region refers to a nucleic acid sequence to which one or more ROS-sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression; in the presence of ROS, the transcription factor binds to and/or activates the regulatory region.
- the ROS-inducible regulatory region comprises a promoter sequence.
- the transcription factor senses ROS and subsequently binds to the ROS-inducible regulatory region, thereby activating downstream gene expression.
- the transcription factor is bound to the ROS-inducible regulatory region in the absence of ROS; in the presence of ROS, the transcription factor undergoes a conformational change, thereby activating downstream gene expression.
- the ROS-inducible regulatory region may be operatively linked to a gene sequence or gene sequence, e.g., a sequence or sequences encoding one or more payload(s).
- a transcription factor e.g., OxyR
- ROS induces expression of the gene or genes.
- a transcription factor e.g., PerR
- PerR senses ROS and binds to a corresponding ROS-repressible regulatory region, thereby blocking expression of an operatively linked gene sequence or gene sequences.
- ROS represses expression of the gene or genes.
- Each regulatory region is capable of binding at least one corresponding ROS-sensing transcription factor.
- transcription factors that sense ROS and their corresponding ROS- responsive genes, promoters, and/or regulatory regions include, but are not limited to, those shown in
- the recombinant bacteria comprise a tunable regulatory region that is directly or indirectly controlled by a transcription factor that is capable of sensing at least one reactive oxygen species.
- the tunable regulatory region is operatively linked to a gene or gene cassette capable of directly or indirectly driving the expression of a payload, thus controlling expression of the payload relative to ROS levels.
- the tunable regulatory region is a ROS-inducible regulatory region, and the molecule is a payload; when ROS is present, e.g.. in an inflamed tissue, a ROS- sensing transcription factor binds to and/or activates the regulatory region and drives expression of the gene sequence for the payload, thereby producing the payload. Subsequently, when inflammation is ameliorated, ROS levels are reduced, and production of the payload is decreased or eliminated.
- the tunable regulatory region is a ROS-inducible regulatory region; in the presence of ROS, a transcription factor senses ROS and activates the ROS-inducible regulatory region, thereby driving expression of an operatively linked gene or gene cassette.
- the transcription factor senses ROS and subsequently binds to the ROS-inducible regulatory region, thereby activating downstream gene expression.
- the transcription factor is bound to the ROS-inducible regulatory region in the absence of ROS; when the transcription factor senses ROS, it undergoes a conformational change, thereby inducing downstream gene expression.
- the tunable regulatory region is a ROS-inducible regulatory region
- the transcription factor that senses ROS is OxyR.
- OxyR “functions primarily as a global regulator of the peroxide stress response” and is capable of regulating dozens of genes, e.g., “genes involved in H2O2 detoxification (katE, ahpCF), heme biosynthesis (hemH), reductant supply (grxA, gor, trxC), thiol-disulfide isomerization (dsbG), Fe-S center repair (sufA-E, sufS), iron binding (yaaA), repression of iron import systems (fur)” and “OxyS, a small regulatory RNA” (Dubbs et al., 2012).
- the recombinant bacteria may comprise any suitable ROS -responsive regulatory region from a gene that is activated by OxyR. Genes that are capable of being activated by OxyR are known in the art (see, e.g., Zheng et al., 2001; Dubbs et al., 2012).
- the recombinant bacteria comprise a ROS-inducible regulatory region from oxyS that is operatively linked to a gene, e.g., a payload gene.
- ROS e.g., H2O2
- an OxyR transcription factor senses ROS and activates to the oxyS regulatory region, thereby driving expression of the operatively linked payload gene and producing the payload.
- OxyR is encoded by an E. coll oxyR gene.
- the oxyS regulatory region is an E. coll oxyS regulatory region.
- the ROS-inducible regulatory region is selected from the regulatory region of katG, dps, and ahpC.
- the tunable regulatory region is a ROS-inducible regulatory region, and the corresponding transcription factor that senses ROS is SoxR.
- SoxR When SoxR is “activated by oxidation of its [2Fe-2S] cluster, it increases the synthesis of SoxS, which then activates its target gene expression” (Koo et al., 2003).
- SoxR is known to respond primarily to superoxide and nitric oxide” (Koo et al., 2003), and is also capable of responding to H2O2.
- the recombinant bacteria may comprise any suitable ROS-responsive regulatory region from a gene that is activated by SoxR.
- the recombinant bacteria comprise a ROS-inducible regulatory region from soxS that is operatively linked to a gene, e.g., a payload.
- a gene e.g., a payload.
- the SoxR transcription factor senses ROS and activates the soxS regulatory region, thereby driving expression of the operatively linked a payload gene and producing the payload.
- the tunable regulatory region is a ROS-derepressible regulatory region, and binding of a corresponding transcription factor represses downstream gene expression; in the presence of ROS, the transcription factor no longer binds to the regulatory region, thereby derepressing the operatively linked gene or gene cassette.
- the tunable regulatory region is a ROS-derepressible regulatory region
- the transcription factor that senses ROS is OhrR.
- OhrR “binds to a pair of inverted repeat DNA sequences overlapping the ohrA promoter site and thereby represses the transcription event,” but oxidized OhrR is “unable to bind its DNA target” (Duarte et al., 2010).
- OhrR is a “transcriptional repressor [that] . . .
- the recombinant bacteria may comprise any suitable ROS-responsive regulatory region from a gene that is repressed by OhrR. Genes that are capable of being repressed by OhrR are known in the art (see, e.g., Dubbs et al., 2012).
- the recombinant bacteria comprise a ROS- derepressible regulatory region from ohrA that is operatively linked to a gene or gene cassette, e.g., a payload gene.
- ROS e.g., NaOCl
- an OhrR transcription factor senses ROS and no longer binds to the ohrA regulatory region, thereby derepressing the operatively linked payload gene and producing the payload.
- OhrR is a member of the MarR family of ROS -responsive regulators. “Most members of the MarR family are transcriptional repressors and often bind to the -10 or -35 region in the promoter causing a steric inhibition of RNA polymerase binding” (Bussmann et al., 2010). Other members of this family are known in the art and include, but are not limited to, OspR, MgrA, RosR, and SarZ.
- the transcription factor that senses ROS is OspR, MgRA, RosR, and/or SarZ
- the recombinant bacteria comprises one or more corresponding regulatory region sequences from a gene that is repressed by OspR, MgRA, RosR, and/or SarZ.
- Genes that are capable of being repressed by OspR, MgRA, RosR, and/or SarZ are known in the art (see, e.g., Dubbs et al., 2012).
- the tunable regulatory region is a ROS-derepressible regulatory region
- the corresponding transcription factor that senses ROS is RosR.
- RosR is “a MarR-type transcriptional regulator” that binds to an “18-bp inverted repeat with the consensus sequence TTGTTGAYRYRTCAACWA (SEQ ID NO: 359)” and is “reversibly inhibited by the oxidant H2O2” (Bussmann et al., 2010).
- RosR is capable of repressing numerous genes and putative genes, including but not limited to “a putative polyisoprenoid-binding protein (cgl322, gene upstream of and divergent from rosR), a sensory histidine kinase (cgtS9), a putative transcriptional regulator of the Crp/FNR family (cg3291), a protein of the glutathione S-transferase family (cgl426), two putative FMN reductases (cgl l50 and cgl850), and four putative monooxygenases (cg0823, cgl848, cg2329, and cg3084)” (Bussmann et al., 2010).
- a putative polyisoprenoid-binding protein cgl322
- gene upstream of and divergent from rosR a sensory histidine kinase
- cgtS9 a putative transcriptional regulator of the Crp/F
- the recombinant bacteria may comprise any suitable ROS- responsive regulatory region from a gene that is repressed by RosR. Genes that are capable of being repressed by RosR are known in the art (see, e.g., Bussmann et al., 2010).
- the recombinant bacteria comprise a ROS-derepressible regulatory region from cgtS9 that is operatively linked to a gene or gene cassette, e.g., a payload.
- ROS e.g., H2O2
- a RosR transcription factor senses ROS and no longer binds to the cgtS9 regulatory region, thereby derepressing the operatively linked payload gene and producing the payload.
- the recombinant bacteria expresses a ROS-sensing transcription factor that does not regulate the expression of a significant number of native genes in the bacteria.
- the recombinant bacterium expresses a ROS-sensing transcription factor from a different species, strain, or substrain of bacteria, wherein the transcription factor does not bind to regulatory sequences in the recombinant bacterium.
- the recombinant bacterium is Escherichia coli
- the ROS-sensing transcription factor is RosR, e.g., from Corynebacterium glutamicum, wherein the Escherichia coli does not comprise binding sites for said RosR.
- the heterologous transcription factor minimizes or eliminates off- target effects on endogenous regulatory regions and genes in the recombinant bacteria.
- the tunable regulatory region is a ROS-repressible regulatory region
- the transcription factor that senses ROS is PerR.
- PerR “when bound to DNA, represses the genes coding for proteins involved in the oxidative stress response (katA, ahpC, and mrgA), metal homeostasis (hemAXCDBL, fur, and zoaA) and its own synthesis (perR)” (Marinho et al., 2014).
- PerR is a “global regulator that responds primarily to H2O2” (Dubbs et al., 2012) and “interacts with DNA at the per box, a specific palindromic consensus sequence (TTATAATNATTATAA (SEQ ID NO: 360)) residing within and near the promoter sequences of PerR-controlled genes” (Marinho et al., 2014).
- PerR is capable of binding a regulatory region that “overlaps part of the promoter or is immediately downstream from it” (Dubbs et al., 2012).
- the recombinant bacteria may comprise any suitable ROS-responsive regulatory region from a gene that is repressed by PerR. Genes that are capable of being repressed by PerR are known in the art (see, e.g., Dubbs et al., 2012).
- the recombinant bacteria may comprise a two-repressor activation regulatory circuit, which is used to express a payload.
- the two-repressor activation regulatory circuit comprises a first ROS-sensing repressor, e.g., PerR, and a second repressor, e.g., TetR, which is operatively linked to a gene or gene cassette, e.g., a payload.
- the ROS-sensing repressor inhibits transcription of the second repressor, which inhibits the transcription of the gene or gene cassette.
- second repressors useful in these embodiments include, but are not limited to, TetR, Cl, and LexA.
- the ROS-sensing repressor is PerR.
- the second repressor is TetR.
- a PerR-repressible regulatory region drives expression of TetR
- a TetR-repressible regulatory region drives expression of the gene or gene cassette, e.g., a payload.
- tetR is transcribed
- TetR represses expression of the gene or gene cassette e.g., a payload.
- tetR expression is repressed, and the gene or gene cassette, e.g., a payload, is expressed.
- a ROS-responsive transcription factor may induce, derepress, or repress gene expression depending upon the regulatory region sequence used in the recombinant bacteria.
- OxyR is primarily thought of as a transcriptional activator under oxidizing conditions. OxyR can function as either a repressor or activator under both oxidizing and reducing conditions” (Dubbs et al., 2012), and OxyR “has been shown to be a repressor of its own expression as well as that of fhuF (encoding a ferric ion reductase) and flu (encoding the antigen 43 outer membrane protein)” (Zheng et al., 2001).
- the recombinant bacteria may comprise any suitable ROS-responsive regulatory region from a gene that is repressed by OxyR.
- OxyR is used in a two-repressor activation regulatory circuit, as described above. Genes that are capable of being repressed by OxyR are known in the art (see, e.g., Zheng et al., 2001). Or, for example, although RosR is capable of repressing a number of genes, it is also capable of activating certain genes, e.g., the narKGHJI operon.
- the recombinant bacteria comprise any suitable ROS- responsive regulatory region from a gene that is activated by RosR.
- the recombinant bacteria comprise any suitable ROS -responsive regulatory region from a gene that is activated by PerR.
- ROS-sensing transcription factors and corresponding regulatory region sequences may be present in recombinant bacteria.
- “OhrR is found in both Gram- positive and Gram-negative bacteria and can coreside with either OxyR or PerR or both” (Dubbs et al., 2012).
- the recombinant bacteria comprise one type of ROS-sensing transcription factor, e.g., OxyR, and one corresponding regulatory region sequence, e.g., from oxyS.
- the recombinant bacteria comprise one type of ROS-sensing transcription factor, e.g., OxyR, and two or more different corresponding regulatory region sequences, e.g., from oxyS and katG.
- the recombinant bacteria comprise two or more types of ROS- sensing transcription factors, e.g., OxyR and PerR, and two or more corresponding regulatory region sequences, e.g., from oxyS and katA, respectively.
- One ROS-responsive regulatory region may be capable of binding more than one transcription factor.
- the recombinant bacteria comprise two or more types of ROS-sensing transcription factors and one corresponding regulatory region sequence.
- recombinant bacteria comprise nucleic acid sequences comprising OxyR binding sites.
- recombinant bacteria comprise a nucleic acid sequence that is at least about 80%, 85%, 90%, 95%, or 99% homologous to the DNA sequence of SEQ ID NO: 370, SEQ ID NO: 371, or SEQ ID NO: 372, or SEQ ID NO: 373, or a functional fragment thereof.
- the regulatory region sequence is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of SEQ ID NO: 370, SEQ ID NO: 371, SEQ ID NO: 372, and/or SEQ ID NO: 373.
- the recombinant bacteria comprise a gene encoding a ROS-sensing transcription factor, e.g., the oxyR gene, that is controlled by its native promoter, an inducible promoter, a promoter that is stronger than the native promoter, e.g., the GlnRS promoter or the P(Bla) promoter, or a constitutive promoter.
- a ROS-sensing transcription factor e.g., the oxyR gene
- expression of the ROS-sensing transcription factor is controlled by a different promoter than the promoter that controls expression of EGF.
- expression of the ROS-sensing transcription factor is controlled by the same promoter that controls expression of EGF.
- the ROS-sensing transcription factor and EGF are divergently transcribed from a promoter region.
- the recombinant bacteria comprise a gene for a ROS-sensing transcription factor from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise a ROS-responsive regulatory region from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise a ROS- sensing transcription factor and corresponding ROS -responsive regulatory region from a different species, strain, or substrain of bacteria.
- the heterologous ROS-sensing transcription factor and regulatory region may increase the transcription of genes operatively linked to said regulatory region in the presence of ROS, as compared to the native transcription factor and regulatory region from bacteria of the same subtype under the same conditions.
- the recombinant bacteria comprise a ROS-sensing transcription factor, OxyR, and corresponding regulatory region, oxyS, from Escherichia coli.
- the native ROS-sensing transcription factor e.g., OxyR
- the native ROS-sensing transcription factor is left intact and retains wild-type activity.
- the native ROS-sensing transcription factor e.g., OxyR
- the recombinant bacteria comprise multiple copies of the endogenous gene encoding the ROS-sensing transcription factor, e.g., the oxyR gene.
- the gene encoding the ROS-sensing transcription factor is present on a plasmid.
- the gene encoding the ROS-sensing transcription factor and the gene or gene cassette for producing EGF are present on different plasmids.
- the gene encoding the ROS-sensing transcription factor and the gene or gene cassette for producing EGF are present on the same plasmid.
- the gene encoding the ROS-sensing transcription factor is present on a chromosome.
- the gene encoding the ROS-sensing transcription factor and the gene or gene cassette for producing EGF are present on different chromosomes. In some embodiments, the gene encoding the ROS-sensing transcription factor and the gene or gene cassette for producing EGF are present on the same chromosome.
- the recombinant bacteria comprise a wild-type gene encoding a ROS- sensing transcription factor, e.g., the soxR gene, and a corresponding regulatory region, e.g., a soxS regulatory region, that is mutated relative to the wild-type regulatory region from bacteria of the same subtype.
- the mutated regulatory region increases the expression of the payload in the presence of ROS, as compared to the wild-type regulatory region under the same conditions.
- the recombinant bacteria comprise a wild-type ROS -responsive regulatory region, e.g., the oxyS regulatory region, and a corresponding transcription factor, e.g., OxyR, that is mutated relative to the wild-type transcription factor from bacteria of the same subtype.
- the mutant transcription factor increases the expression of the payload in the presence of ROS, as compared to the wild-type transcription factor under the same conditions.
- both the ROS- sensing transcription factor and corresponding regulatory region are mutated relative to the wild-type sequences from bacteria of the same subtype in order to increase expression of the payload in the presence of ROS.
- the gene or gene cassette for producing the payload is present on a plasmid and operably linked to a promoter that is induced by ROS. In some embodiments, the gene or gene cassette for producing the payload is present in the chromosome and operably linked to a promoter that is induced by ROS. In some embodiments, the gene or gene cassette for producing the payload is present on a chromosome and operably linked to a promoter that is induced by exposure to tetracycline. In some embodiments, the gene or gene cassette for producing the payload is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline.
- expression is further optimized by methods known in the art, e.g., by optimizing ribosomal binding sites, manipulating transcriptional regulators, and/or increasing mRNA stability.
- the recombinant bacteria may comprise multiple copies of the gene(s) capable of producing a payload(s).
- the gene(s) capable of producing a payload(s) is present on a plasmid and operatively linked to a ROS -responsive regulatory region.
- the gene(s) capable of producing a payload is present in a chromosome and operatively linked to a ROS -responsive regulatory region.
- the recombinant bacteria produce one or more payloads under the control of an oxygen level-dependent promoter, a reactive oxygen species (ROS)-dependent promoter, or a reactive nitrogen species (RNS)-dependent promoter, and a corresponding transcription factor.
- an oxygen level-dependent promoter a reactive oxygen species (ROS)-dependent promoter, or a reactive nitrogen species (RNS)-dependent promoter, and a corresponding transcription factor.
- ROS reactive oxygen species
- RNS reactive nitrogen species
- the recombinant bacteria comprise a stably maintained plasmid or chromosome carrying a gene for producing a payload, such that the payload can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo.
- a bacterium may comprise multiple copies of the gene encoding the payload.
- the gene encoding the payload is expressed on a low-copy plasmid.
- the low-copy plasmid may be useful for increasing stability of expression.
- the low-copy plasmid may be useful for decreasing leaky expression under non- inducing conditions.
- the gene encoding the payload is expressed on a high- copy plasmid.
- the high-copy plasmid may be useful for increasing expression of the payload.
- the gene encoding the payload is expressed on a chromosome. Propionate and other promoters
- the recombinant bacteria comprise the gene or gene cassette for producing EGF polypeptides, expressed under the control of an inducible promoter that is responsive to specific molecules or metabolites in the environment, e.g., r the mammalian gut.
- an inducible promoter that is responsive to specific molecules or metabolites in the environment, e.g., r the mammalian gut.
- the short-chain fatty acid propionate is a major microbial fermentation metabolite localized to the gut (Hosseini et al., 2011).
- the gene or gene cassette for producing EGF is under the control of a propionate-inducible promoter.
- the gene or gene cassette for producing EGF is under the control of a propionate-inducible promoter that is activated by the presence of propionate in the mammalian gut. Any molecule or metabolite found in the mammalian gut, in a healthy and/or disease state, may be used to induce payload expression.
- Non-limiting examples of inducers include propionate, bilirubin, aspartate aminotransferase, alanine aminotransferase, blood coagulation factors II, VII, IX, and X, alkaline phosphatase, gamma glutamyl transferase, hepatitis antigens and antibodies, alpha fetoprotein, anti-mitochondrial, smooth muscle, and anti-nuclear antibodies, iron, transferrin, ferritin, copper, ceruloplasmin, ammonia, and manganese.
- the gene or gene cassette for producing EGF is under the control of a pBAD promoter, which is activated in the presence of the sugar arabinose.
- the gene or gene cassette for producing the EGF is present on a plasmid and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions. In some embodiments, the gene or gene cassette for producing the EGF is present on a plasmid and operably linked to a temperature sensitive promoter. In some embodiments, the gene or gene cassette for producing EGF is present in the chromosome and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions. In some embodiments, the gene or gene cassette for producing the EGF is present in the chromosome and operably linked to a temperature sensitive promoter.
- the gene or gene cassette for producing EGF is present on a plasmid and operably linked to a promoter that is induced by molecules or metabolites that are specific to the mammalian gut. In some embodiments, the gene or gene cassette for producing EGF is present on a chromosome and operably linked to a promoter that is induced by molecules or metabolites that are specific to the mammalian gut. In some embodiments, the gene or gene cassette for producing EGF is present on a chromosome and operably linked to a promoter that is induced by exposure to tetracycline.
- the gene or gene cassette for producing EGF is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline.
- expression is further optimized by methods known in the art, e.g., by optimizing ribosomal binding sites, manipulating transcriptional regulators, and/or increasing mRNA stability.
- the recombinant bacteria comprise a stably maintained plasmid or chromosome carrying the gene or gene cassette for producing EGF, such that the gene or gene cassette can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
- a bacterium may comprise multiple copies of the gene or gene cassette for producing EGF.
- gene or gene cassette for producing the payload is expressed on a low-copy plasmid. In some embodiments, the low-copy plasmid may be useful for increasing stability of expression.
- the low-copy plasmid may be useful for decreasing leaky expression under non- inducing conditions.
- gene or gene cassette for producing EGF is expressed on a high-copy plasmid.
- the high-copy plasmid may be useful for increasing gene or gene cassette expression.
- gene or gene cassette for producing EGF is expressed on a chromosome.
- the recombinant bacteria comprise a regulatory region comprising a propionate promoter, which is induced in the mammalian gut.
- the propionate promoter sequence is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of SEQ ID NO: 374.
- the gene encoding EGF is present on a plasmid and operably linked to a promoter that is induced by one or more nutritional and/or chemical inducer(s) and/or metabolite(s). In some embodiments, the gene encoding EGF is present in the chromosome and operably linked to a promoter that is induced by one or more nutritional and/or chemical inducer(s) and/or metabolite(s).
- the bacterial cell comprises a stably maintained plasmid or chromosome carrying the one or more gene sequences(s), inducible by one or more nutritional and/or chemical inducer(s) and/or metabolite(s), encoding EGF, such that EGF can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut.
- bacterial cell comprises two or more distinct copies of the one or more gene sequences(s) encoding EGF, which is controlled by a promoter inducible one or more nutritional and/or chemical inducer(s) and/or metabolite(s).
- the recombinant bacteria comprise multiple copies of the same one or more gene sequences(s) encoding EGF, which is controlled by a promoter inducible one or more nutritional and/or chemical inducer(s) and/or metabolite(s).
- the one or more gene sequences(s) encoding EGF is present on a plasmid and operably linked to a directly or indirectly inducible promoter inducible by one or more nutritional and/or chemical inducer(s) and/or metabolite(s). In some embodiments, the one or more gene sequences(s) encoding EGF, is present on a chromosome and operably linked to a directly or indirectly inducible by one or more nutritional and/or chemical inducer(s) and/or metabolite(s).
- expression of EGF is driven directly or indirectly by one or more promoter(s) induced by a chemical and/or nutritional inducer and/or metabolite during in vitro growth, preparation, or manufacturing of the strain prior to in vivo administration.
- the promoter(s) induced by a chemical and/or nutritional inducer and/or metabolite are induced in culture, e.g., grown in a flask, fermenter or other appropriate culture vessel, e.g., used during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture.
- the promoter is directly or indirectly induced by a molecule that is added to in the bacterial culture to induce expression and pre-load the bacterium with EGF prior to administration.
- the cultures, which are induced by a chemical and/or nutritional inducer and/or metabolite are grown aerobically. In some embodiments, the cultures, which are induced by a chemical and/or nutritional inducer and/or metabolite, are grown anaerobically.
- expression of one or more EGF molecules is driven directly or indirectly by one or more arabinose inducible promoter(s) in vivo.
- the promoter is directly or indirectly induced by a chemical and/or nutritional inducer and/or metabolite which is co-administered with the recombinant bacteria, e.g., arabinose.
- the genes of arabinose metabolism are organized in one operon, AraBAD, which is controlled by the PAraBAD promoter.
- the PAraBAD (or Para) promoter suitably fulfills the criteria of inducible expression systems.
- PAraBAD displays tighter control of payload gene expression than many other systems, likely due to the dual regulatory role of AraC, which functions both as an inducer and as a repressor. Additionally, the level of ParaBAD-based expression can be modulated over a wide range of L-arabinose concentrations to fine-tune levels of expression of the payload.
- the cell population exposed to sub-saturating L-arabinose concentrations is divided into two subpopulations of induced and uninduced cells, which is determined by the differences between individual cells in the availability of L-arabinose transporter (Zhang et al., Development and Application of an Arabinose-Inducible Expression System by Facilitating Inducer Uptake in Corynebacterium glutamicum; Appl. Environ. Microbiol. August 2012 vol. 78 no. 16 5831-5838).
- inducible expression from the ParaBad can be controlled or fine-tuned through the optimization of the ribosome binding site (RBS), as described herein.
- the arabinose inducible promoter drives the expression of a construct comprising EGF, jointly with a second promoter, e.g., a second constitutive or inducible promoter.
- a second promoter e.g., a second constitutive or inducible promoter.
- two promoters are positioned proximally to the construct and drive its expression, wherein the arabinose inducible promoter drives expression under a first set of exogenous conditions, and the second promoter drives the expression under a second set of exogenous conditions.
- the first and second conditions may be two sequential culture conditions (i.e., during preparation of the culture in a flask, fermenter or other appropriate culture vessel, e.g., arabinose and IPTG).
- the first inducing conditions may be culture conditions, e.g., including arabinose presence
- the second inducing conditions may be in vivo conditions.
- in vivo conditions include low-oxygen, microaerobic, or anaerobic conditions, presence of gut metabolites, and/or metabolites administered in combination with the bacterial strain.
- the one or more arabinose promoters drive expression of EGF, in combination with the FNR promoter driving the expression of the same gene sequence(s).
- EGF is knocked into the arabinose operon and are driven by the native arabinose inducible promoter.
- the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 376.
- the arabinose inducible construct further comprises a gene encoding AraC, which is divergently transcribed from the same promoter as EGF.
- the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 376.
- the recombinant bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 377.
- the recombinant bacteria comprise one or more gene sequence(s) which are inducible through a rhamnose inducible system. The genes rhaB AD are organized in one operon which is controlled by the rhaP BAD promoter.
- the rhaP BAD promoter is regulated by two activators, RhaS and RhaR, and the corresponding genes belong to one transcription unit which divergently transcribed in the opposite direction of rhaB AD.
- RhaR binds to the rhaP RS promoter and activates the production of RhaR and RhaS.
- RhaS together with L- rhamnose then bind to the rhaP BAD and the rhaP T promoter and activate the transcription of the structural genes.
- expression of EGF is driven directly or indirectly by one or more rhamnose inducible promoter(s). In one embodiment, expression of the payload is driven directly or indirectly by a rhamnose inducible promoter.
- the rhamnose inducible promoter is useful for or induced during in vivo expression of EGF.
- expression of EGF is driven directly or indirectly by one or more rhamnose inducible promoter(s) in vivo.
- the promoter is directly or indirectly induced by a molecule that is co-administered with the recombinant bacteria, e.g.. rhamnose.
- the rhamnose inducible promoter drives the expression of a construct comprising EGF jointly with a second promoter, e.g., a second constitutive or inducible promoter.
- a second promoter e.g., a second constitutive or inducible promoter.
- two promoters are positioned proximally to the construct and drive its expression, wherein the rhamnose inducible promoter drives expression under a first set of exogenous conditions, and the second promoter drives the expression under a second set of exogenous conditions.
- the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 378.
- the recombinant bacteria comprise one or more gene sequence(s) which are inducible through an Isopropyl -D-1 -thiogalactopyranoside (IPTG) inducible system or other compound which induced transcription from the Lac Promoter.
- IPTG is a molecular mimic of allolactose, a lactose metabolite that activates transcription of the lac operon.
- the sulfur atom in IPTG creates a non-hydrolyzable chemical blond, which prevents the degradation of IPTG, allowing the concentration to remain constant.
- IPTG binds to the lac repressor and releases the tetrameric repressor (lacl) from the lac operator in an allosteric manner, thereby allowing the transcription of genes in the lac operon. Since IPTG is not metabolized by E. coli, its concentration stays constant and the rate of expression of Lac promoter-controlled is tightly controlled, both in vivo and in vitro. IPTG intake is independent on the action of lactose permease, since other transport pathways are also involved. Inducible expression from the PLac can be controlled or fine-tuned through the optimization of the ribosome binding site (RBS), as described herein. Other compounds which inactivate Lacl, can be used instead of IPTG in a similar manner.
- RBS ribosome binding site
- expression of EGF is driven directly or indirectly by one or more IPTG inducible promoter(s).
- the IPTG inducible promoter is useful for or induced during in vivo expression of EGF.
- expression of EGF is driven directly or indirectly by one or more IPTG inducible promoter(s) in vivo.
- the promoter is directly or indirectly induced by a molecule that is co -administered with the recombinant bacteria, e.g., IPTG.
- the IPTG inducible promoter drives the expression of a construct comprising EGF jointly with a second promoter, e.g., a second constitutive or inducible promoter.
- a second promoter e.g., a second constitutive or inducible promoter.
- two promoters are positioned proximally to the construct and drive its expression, wherein the IPTG inducible promoter drives expression under a first set of exogenous conditions, and the second promoter drives the expression under a second set of exogenous conditions.
- the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 350.
- the IPTG inducible construct further comprises a gene encoding lacl, which is divergently transcribed from the same promoter EGF.
- the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 350.
- the recombinant bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 16.
- the recombinant bacteria comprise one or more gene sequence(s) which are inducible through a tetracycline inducible system.
- the initial system Gossen and Bujard (Tight control of gene expression in mammalian cells by tetracycline-responsive promoters. Gossen M & Bujard H. PNAS, 1992 Jun 15;89(12):5547-51) developed is known as tetracycline off: in the presence of tetracycline, expression from a tet-inducible promoter is reduced.
- Tetracycline-controlled transactivator was created by fusing tetR with the C-terminal domain of VP16 (virion protein 16) from herpes simplex virus. In the absence of tetracycline, the tetR portion of tTA will bind tetO sequences in the tet promoter, and the activation domain promotes expression. In the presence of tetracycline, tetracycline binds to tetR, precluding tTA from binding to the tetO sequences. Next, a reverse Tet repressor (rTetR), was developed which created a reliance on the presence of tetracycline for induction, rather than repression. The new transactivator rtTA (reverse tetracycline-controlled transactivator) was created by fusing rTetR with VP16. The tetracycline on system is also known as the rtTA-dependent system.
- expression of EGF is driven directly or indirectly by one or more tetracycline inducible promoter(s).
- the tetracycline inducible promoter is useful for or induced during in vivo expression of EGF.
- expression of EGF and/or transcriptional regulator(s), e.g., FNRS24Y, is driven directly or indirectly by one or more tetracycline inducible promoter(s) in vivo.
- the promoter is directly or indirectly induced by a molecule that is co-administered with the recombinant bacteria, e.g., tetracycline [0433]
- the recombinant bacteria comprise one or more gene sequence(s) whose expression is controlled by a temperature sensitive mechanism.
- Thermoregulators are advantageous because of strong transcriptional control without the use of external chemicals or specialized media (see, e.g. , Nemani et al., Magnetic nanoparticle hyperthermia induced cytosine deaminase expression in microencapsulated E. coli for enzyme-prodrug therapy; J Biotechnol. 2015 Jun 10; 203: 32-40, and references therein).
- Thermoregulated protein expression using the mutant cI857 repressor and the pL and/or pR phage X promoters have been used to engineer recombinant bacterial strains.
- the EGF gene cloned downstream of the X promoters can then be efficiently regulated by the mutant thermolabile cI857 repressor of bacteriophage X.
- cI857 binds to the oL or regions of the pR promoter and blocks transcription by RNA polymerase.
- the functional cI857 dimer is destabilized, binding to the oL or oR DNA sequences is abrogated, and mRNA transcription is initiated.
- An exemplary construct is depicted in in the figures and examples. Inducible expression from the temperature sensitive promoter can be controlled or further fine-tuned through the optimization of the ribosome binding site (RBS), as described herein.
- RBS ribosome binding site
- thermoregulated promoter is useful for or induced during in vivo expression of EGF. In some embodiments, expression of EGF is driven directly or indirectly by one or more thermoregulated promoter(s) in vitro.
- thermoregulated promoter(s) are driven directly or indirectly by one or more thermoregulated promoter(s) during in vitro growth, preparation, or manufacturing of the strain prior to in vivo administration. In some embodiments, it may be advantageous to shut off production of EGF. This can be done in a thermoregulated system by growing the strain at lower temperatures, e.g., 30°C. Expression can then be induced by elevating the temperature to 37°C and/or 42°C. In some embodiments, thermoregulated promoter(s) are induced in culture, e.g., grown in a flask, fermenter or other appropriate culture vessel, e.g., used during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture.
- the cultures, which are induced by temperatures between 37°C and 42°C are grown aerobically. In some embodiments, the cultures, which are induced by induced by temperatures between 37°C and 42°C, are grown anaerobically.
- the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 19.
- thermoregulated construct further comprises a gene encoding mutant cI857 repressor, which is divergently transcribed from the same promoter as EGF.
- the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 20.
- the recombinant bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 369.
- thermoregulators may be advantageous because of strong transcriptional control without the use of external chemicals or specialized media.
- Thermoregulated protein expression using the mutant cI857 repressor and the pL and/or pR phage ⁇ promoters have been used to engineer recombinant bacterial strains.
- a gene of interest cloned downstream of the ⁇ promoters can be efficiently regulated by the mutant thermolabile cI857 repressor of bacteriophage ⁇ .
- cI857 binds to the oL or oR regions of the pR promoter and inhibits transcription by RNA polymerase.
- the functional cI857 dimer is destabilized, binding to the oL or oR DNA sequences is abrogated, and mRNA transcription is initiated.
- thermoregulated system it may be advantageous to reduce, diminish, or shut off production of one or more protein(s) of interest. This can be done in a thermoregulated system by growing a bacterial strain at temperatures at which the temperature regulated system is not optimally active. Temperature regulated expression can then be induced as desired by changing the temperature to a temperature where the system is more active or optimally active.
- thermoregulated promoter may be induced in culture, e.g.. grown in a flask, fermenter or other appropriate culture vessel, e.g., used during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture.
- Bacteria comprising gene sequences or gene cassettes either indirectly or directly operably linked to a temperature sensitive system or promoter may, for example, could be induced by temperatures between 37°C and 42°C.
- the cultures may be grown aerobically. Alternatively, the cultures are grown anaerobically.
- the bacteria described herein comprise one or more gene sequence(s) or gene cassette(s) which are directly or indirectly operably linked to a temperature regulated promoter.
- the gene sequence(s) or gene cassette(s) are induced in vitro during growth, preparation, or manufacturing of the strain prior to in vivo administration.
- the gene sequence(s) are induced upon or during in vivo administration.
- the gene sequence(s) are induced during in vitro growth, preparation, or manufacturing of the strain prior to in vivo administration and upon or during in vivo administration.
- the genetically engineered bacteria further comprise gene sequence (s) encoding a transcription factor which is capable of binding to the temperature sensitive promoter.
- the transcription factor is a repressor of transcription.
- thermoregulated promoter drives the expression of one or more protein(s) of interest from a low-copy plasmid or a high copy plasmid. In some embodiments, the thermoregulated promoter drives the expression of one or more protein(s) of interest from a construct which is integrated into the bacterial chromosome. Exemplary insertion sites are described herein.
- the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 19.
- the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 22.
- the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 25.
- the thermoregulated construct further comprises a gene encoding mutant cI857 repressor, which is divergently transcribed from the same promoter as the one or more one or more protein(s) of interest.
- the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 20.
- the genetically engineered bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 21.
- the thermoregulated construct further comprises a gene encoding mutant cI38 repressor, which is divergently transcribed from the same promoter as the one or more one or more protein(s) of interest.
- the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 23.
- the genetically engineered bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 24. [0443] SEQ ID NOs: 19-25 and 367 are shown in Table 9.
- thermosensitive promoter-ompA- EGF and mutant cI857 repressor driven by temperature sensitive promoter in reverse orientation: disclosed herein comprises a sequence that is 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 515 or a fragment thereof.
- the bacterium disclosed herein comprises a sequence that is 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 22 or a fragment thereof.
- the recombinant bacteria comprise one or more gene sequence(s) which are indirectly inducible through a system driven by the PssB promoter.
- the Pssb promoter is active under aerobic conditions, and shuts off under anaerobic conditions.
- This promoter can be used to express an EGF gene under aerobic conditions.
- This promoter can also be used to tightly control the expression of a gene product such that it is only expressed under anaerobic conditions.
- the oxygen induced PssB promoter induces the expression of a repressor, which represses the expression of an EGF gene.
- the EGF gene is only expressed in the absence of the repressor, i.e., under anaerobic conditions.
- This strategy has the advantage of an additional level of control for improved fine-tuning and tighter control.
- expression of EGF is indirectly regulated by a repressor expressed under the control of one or more PssB promoter(s).
- induction of the RssB promoter(s) indirectly drives the in vivo expression of EGF.
- induction of the RssB promoter(s) indirectly drives the expression of EGF during in vitro growth, preparation, or manufacturing of the strain prior to in vivo administration.
- Bacteria comprising one or more sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences disclosed herein are also contemplated.
- the bacterium comprises one or more sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with a promoter disclosed herein, e.g., a thermoregulated promoter or a promoter induced under low-oxygen or anaerobic conditions.
- a promoter disclosed herein e.g., a thermoregulated promoter or a promoter induced under low-oxygen or anaerobic conditions.
- the bacterium comprises one or more sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with a secretion molecule disclosed herein, e.g., nucleotide or amino acid sequence, e.g., ompA.
- the bacterium comprises one or more sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with an EGF disclosed herein, e.g., nucleotide or amino acid sequence.
- this strategy can be used to control expression of thyA and/or dapA, e.g., to make a conditional auxotroph. The chromosomal copy of dapA or ThyA is knocked out.
- dapA or thyA -as the case may be- are expressed, and the strain can grow in the absence of dap or thymidine.
- dapA or thyA expression is shut off, and the strain cannot grow in the absence of dap or thymidine.
- Such a strategy can, for example be employed to allow survival of bacteria under anaerobic conditions, e.g., the gut, but prevent survival under aerobic conditions (biosafety switch).
- the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 387.
- the inducible promoters as described above, drive the expression of EGF from a low -copy plasmid or a high copy plasmid or a biosafety system plasmid described herein.
- the inducible promoters drive the expression of EGF from a construct which is integrated into the bacterial chromosome.
- the gene encoding the payload is present on a plasmid and operably linked to a constitutive promoter. In some embodiments, the gene encoding the payload is present on a chromosome and operably linked to a constitutive promoter.
- the constitutive promoter is active under in vivo conditions, e.g., the gut, as described herein.
- the promoters is active under in vitro conditions, e.g., various cell culture and/or cell manufacturing conditions, as described herein.
- the constitutive promoter is active under in vivo conditions, e.g., the gut, as described herein, and under in vitro conditions, e.g., various cell culture and/or cell production and/or manufacturing conditions, as described herein.
- the constitutive promoter that is operably linked to the gene encoding the payload is active in various exogenous environmental conditions (e.g., in vivo and/or in vitro and/or production/manufacturing conditions).
- the constitutive promoter is active in exogenous environmental conditions specific to the gut of a mammal. In some embodiments, the constitutive promoter is active in exogenous environmental conditions specific to the small intestine of a mammal. In some embodiments, the constitutive promoter is active in low-oxygen or anaerobic conditions such as the environment of the mammalian gut. In some embodiments, the constitutive promoter is active in the presence of molecules or metabolites that are specific to the gut of a mammal. In some embodiments, the constitutive promoter is directly or indirectly induced by a molecule that is co-administered with the bacterial cell.
- the constitutive promoter is active in the presence of molecules or metabolites or other conditions, that are present during in vitro culture, cell production and/or manufacturing conditions.
- Bacterial constitutive promoters are known in the art. Exemplary constitutive promoters include E. coli a70, such as BBa I14034 (SEQ ID NO: 39), BBa I732021 (SEQ ID NO: 40), constitutive promoters further include constitutive B.
- subtilis oA promoters e.g., BBa_K780003 (SEQ ID NO: 98), BBa_K823000 (SEQ ID NO: 99), BBa_K823002 (SEQ ID NO: 100), and BBa_K823003 (SEQ ID NO: 101), BBa_K143012 (SEQ ID NO: 96), BBa_K143010 (SEQ ID NO: 102), BBa_K143013 (SEQ ID NO: 97).
- Exemplary constitutive promoters further include constitutive B.
- subtilis oB promoters e.g., BBa_K143010 (SEQ ID NO: 102), BBa_K143011 (SEQ ID NO: 103), BBa_K143013 (SEQ ID NO: 97).
- Exemplary constitutive promoters further include BBa_Kl 12706 (SEQ ID NO: 104) and BBa_Kl 12707 (SEQ ID NO: 105) promoters.
- Exemplary promoters from Bacteriophage T7 or SP6 or various prokaryotes include BBa_K143010 (SEQ ID NO: 102), BBa_K143011 (SEQ ID NO: 103), BBa_K143013 (SEQ ID NO: 97), BBa_I712074 (SEQ ID NO: 106), BBa_I719005 (SEQ ID NO: 107), BBa_J34814 (SEQ ID NO: 108), BBa_J64997 (SEQ ID NO: 109), BBa_Kl 13010 (SEQ ID NO: 110), BBa_Kl 13011 (SEQ ID NO: 111), BBa_Kl 13012 (SEQ ID NO: 112), BBa_K1614000 (SEQ ID NO: 113), BBa_R0085 (SEQ ID NO: 107), BBa_R0180 (SEQ ID NO: 114), BBa_R0181 (SEQ ID NO:
- Exemplary promoters from yeast and various eukaryotes include BBa_I766557 (SEQ ID NO: 124), BBa_J63005 (SEQ ID NO: 125), BBa_K105027 (SEQ ID NO: 126), BBa_K105028 (SEQ ID NO: 126), BBa_K105029 (SEQ ID NO: 126), BBa_K105030 (SEQ ID NO: 126), BBa_K105031 (SEQ ID NO: 126), BBa_K122000), SEQ ID NO: 127), BBa_K124000 (SEQ ID NO: 122), BBa_K124002 (SEQ ID NO: 128), BBa_K319005 (SEQ ID NO: 123), BBa_M31201 (SEQ ID NO: 129), BBa_I766555 (SEQ ID NO: 122), BBa_I766556 (SEQ ID NO: 123), BBa_
- Bacterial constitutive promoters are known in the art.
- the constitutive promoter is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NOs: 37-135.
- ribosome binding sites are added, switched out or replaced. By testing a few ribosome binding sites, expression levels can be fine-tuned to the desired level.
- Various RBS are suitable for prokaryotic expression and can be used to achieve the desired expression levels (See, e.g., Registry of standard biological parts).
- Exemplary ribosome binding sites include those derived from Master sequence SEQ ID NO: 241.
- Non limiting examples of such ribosome binding sites include BBa_J61100, BBa_J61101, BBa_J61102, BBa_J61103, BBa_J61104, BBa_J61105, BBa_J61106, BBa_J61107, BBa_J61108, BBa_J61109, BBa_J61110, BBa_J61111, BBa_J61112, BBa_J61113, BBa_J61114, BBa_J61115, BBa_J61116, BBa_J61117, BBa_J61118, BBa_J61119, BBa_J61120, BBa_J61121, BBa_J61122, BBa_J61123, BBa_J61124, BBa_J61125, BBa_J61126, BBa_J61127, BBa_J61128, BBa_J6112,
- the disclosure provides novel nucleic acids for producing and secreting EGF.
- the nucleic acid encodes one or more EGF or EGF fusion protein polypeptides.
- the nucleic acid comprises gene sequence(s) encoding one or more EGF or EGF fusion protein polypeptides.
- the one or more EGF or EGF fusion protein polypeptide(s) comprises a polypeptide sequence selected from any of Sequences SEQ ID NO: 505, SEQ ID NO: 161, SEQ ID NO: 136, SEQ ID NO: 168, SEQ ID NO: 361, SEQ ID NO: 362, SEQ ID NO: 500, SEQ ID NO: 502, SEQ ID NO: 501, SEQ ID NO: 503, or SEQ ID NO: 504 a functional fragment and/or variant thereof, or a polypeptide having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereof, e.g., as assessed by an alignment algorithm such as NCBI BLAST.
- the nucleic acid comprises one or more EGF or EGF fusion protein cassettes.
- the EGF fusion nucleic acid comprises a polynucleotide selected from Sequences SEQ ID NO: 511, SEQ ID NO: 506, SEQ ID NO: 508, SEQ ID NO: 507, SEQ ID NO: 509, SEQ ID NO: 510, SEQ ID NO: 162, SEQ ID NO: 364, SEQ ID NO: 363, SEQ ID NO: 365, or SEQ ID NO: 366 (see below), a functional fragment and/or variant thereof, or a polynucleotide having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereof, e.g., as assessed by an alignment algorithm such as NCBI BLAST.
- the nucleic acid comprises gene sequence encoding a human EGF polypeptide linked to an FNR-responsive promoter.
- the human EGF polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 505 (EGF).
- the FNR -responsive promoter is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the human EGF polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 505.
- the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the human EGF polypeptide comprises SEQ ID NO: 505.
- the human EGF polypeptide consists of SEQ ID NO: 505.
- the nucleic acid comprises a gene sequence linked to an FNR- responsive element.
- the nucleic acid comprises gene sequence encoding a human EGF polypeptide linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor.
- the human EGF polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 505 (EGF).
- the temperature sensitive promoter construct comprises a gene encoding mutant cI857 repressor that is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21.
- the human EGF polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 505.
- the temperature sensitive promoter construct comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
- the human EGF polypeptide comprises SEQ ID NO: 505.
- the human EGF polypeptide consists of SEQ ID NO: 505.
- the nucleic acid comprises a gene sequence linked to a temperature sensitive element.
- the nucleic acid comprising the human EGF gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 511 (EGF) linked to an FNR- responsive element. In some embodiments, the nucleic acid comprising the human EGF gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 511.
- the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the nucleic acid comprising the human EGF gene sequence comprises SEQ ID NO: 511 with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336 and 337.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 511 with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336 and 337.
- the nucleic acid comprising the human EGF gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 511 (EGF) linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor.
- the nucleic acid comprising the human EGF gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 511.
- the temperature sensitive promoter construct further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
- the nucleic acid comprising the human EGF gene sequence comprises SEQ ID NO: 511 with a temperature sensitive element of any one of SEQ ID NO: 19-21.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 511 with a temperature sensitive element of any one of SEQ ID NO: 19-21.
- the nucleic acid comprises a gene sequence encoding a PelB polypeptide.
- the PelB polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 161 (PelB).
- the PelB polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 161.
- the PelB polypeptide comprises SEQ ID NO: 161.
- the PelB polypeptide consists of SEQ ID NO: 161.
- the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the PelB gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 162 (see below). In some embodiments, the nucleic acid comprising the PelB gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 162. In some specific embodiments, the nucleic acid comprising the PelB gene sequence comprises SEQ ID NO: 162. In other specific embodiments the nucleic acid comprising the PelB gene sequence consists of SEQ ID NO: 162.
- the nucleic acid comprises a gene sequence encoding a PhoA polypeptide.
- the PhoA polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 136 (PhoA).
- the PhoA polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 136.
- the PhoA polypeptide comprises SEQ ID NO: 136.
- the PhoA polypeptide consists of SEQ ID NO: 136.
- the nucleic acid comprises a gene sequence.
- the nucleic acid comprising the PhoA gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 364 (see below).
- the nucleic acid comprising the PhoA gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 364.
- the nucleic acid comprising the PhoA gene sequence comprises SEQ ID NO: 364.
- the nucleic acid comprising the PhoA gene sequence consists of SEQ ID NO: 364.
- the nucleic acid comprises a gene sequence encoding a OmpA polypeptide.
- the OmpA polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 168 (OmpA).
- the OmpA polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 168.
- the OmpA polypeptide comprises SEQ ID NO: 168.
- the OmpA polypeptide consists of SEQ ID NO: 168.
- the nucleic acid comprises a gene sequence.
- the nucleic acid comprising the OmpA gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 363 (See below).
- the nucleic acid comprising the OmpA gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 363.
- the nucleic acid comprising the OmpA gene sequence comprises SEQ ID NO: 363.
- the nucleic acid comprising the OmpA gene sequence consists of SEQ ID NO: 363.
- the nucleic acid comprises a gene sequence encoding a LARD3 polypeptide.
- the LARD3 polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 361 (LARD3).
- the LARD3 polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 361.
- the LARD3 polypeptide comprises SEQ ID NO: 361.
- the LARD3 polypeptide consists of SEQ ID NO: 361.
- the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the LARD3 gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 365 (See below). In some embodiments, the nucleic acid comprising the LARD3 gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 365. In some specific embodiments, the nucleic acid comprising the LARD3 gene sequence comprises SEQ ID NO: 365. In other specific embodiments the nucleic acid comprising the LARD3 gene sequence consists of SEQ ID NO: 365.
- the nucleic acid comprises a gene sequence encoding a HylA polypeptide.
- the HylA polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 362 (HylA).
- the HylA polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 362.
- the HylA polypeptide comprises SEQ ID NO: 362.
- the HylA polypeptide consists of SEQ ID NO: 362.
- the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the HylA gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 366 (See below). In some embodiments, the nucleic acid comprising the HylA gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 366. In some specific embodiments, the nucleic acid comprising the HylA gene sequence comprises SEQ ID NO: 366. In other specific embodiments the nucleic acid comprising the HylA gene sequence consists of SEQ ID NO: 366.
- the nucleic acid comprises a gene sequence encoding an ATP-binding cassette transporter polypeptide.
- the ATP-binding cassette transporter polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514.
- the ATP-binding cassette transporter polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514.
- the HylA polypeptide comprises SEQ ID NO: 362.
- the HylA polypeptide consists of SEQ ID NO: 362.
- the nucleic acid comprises a gene sequence.
- the nucleic acid comprising the ATP- binding cassette transporter gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 516, SEQ ID NO: 517, and/ or SEQ ID NO: 518 (See below). In some embodiments, the nucleic acid comprising the ATP-binding cassette transporter gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 516, SEQ ID NO: 517, and/ or SEQ ID NO: 518.
- the nucleic acid comprising the ATP-binding cassette transporter gene sequence comprises SEQ ID NO: 516, SEQ ID NO: 517, and/ or SEQ ID NO: 518. In other specific embodiments the nucleic acid comprising the ATP-binding cassette transporter gene sequence consists of SEQ ID NO: 516, SEQ ID NO: 517, and/ or SEQ ID NO: 518.
- the nucleic acid comprises gene encoding a human EGF polypeptide fused to a PelB secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 500 (PelB-EGF).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 500.
- the human EGF fusion protein comprises SEQ ID NO: 500.
- the gene encoding the fusion is operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the nucleic acid comprises gene encoding a human EGF polypeptide fused to a PelB secretion tag, optionally wherein the gene is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 500 (PelB-EGF).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 500.
- the human EGF fusion protein comprises SEQ ID NO: 500.
- the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21.
- the temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
- the nucleic acid comprises gene encoding a human EGF polypeptide fused to a PhoA secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 502 (PhoA-EGF).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 502.
- the human EGF fusion protein comprises SEQ ID NO: 502.
- the gene encoding the fusion is operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the nucleic acid comprises gene encoding a human EGF polypeptide fused to a PhoA secretion tag, optionally wherein the gene is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 502 (PhoA-EGF).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 502.
- the human EGF fusion protein comprises SEQ ID NO: 502.
- the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21.
- the Temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
- the nucleic acid comprises gene encoding a human EGF polypeptide fused to a OmpA secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 501 (OmpA-EGF).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 501.
- the human EGF fusion protein comprises SEQ ID NO: 501.
- the gene encoding the fusion is operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the nucleic acid comprises a gene encoding a human EGF polypeptide fused to a OmpA secretion tag, optionally wherein the gene is operably linked to an temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 501 (OmpA-EGF).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 501.
- the human EGF fusion protein comprises SEQ ID NO: 501.
- the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21.
- the temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
- the nucleic acid comprises gene encoding a human EGF polypeptide fused to a LARD3 secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 503 (EGF-LARD3).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 503.
- the human EGF fusion protein comprises SEQ ID NO: 503.
- the gene encoding the fusion is operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the nucleic acid comprises a gene encoding a human EGF polypeptide fused to a LARD3 secretion tag, optionally wherein the gene is operably linked to an temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 503 (EGF-LARD3).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 503.
- the human EGF fusion protein comprises SEQ ID NO: 503.
- the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21.
- the temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
- the nucleic acid comprises gene encoding a human EGF polypeptide fused to a HylA secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 504 (EGF-HylA).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 504.
- the human EGF fusion protein comprises SEQ ID NO: 504.
- the gene encoding the fusion is operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
- the nucleic acid comprises a gene encoding a human EGF polypeptide fused to a HylA secretion tag, optionally wherein the gene is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor.
- the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 504 (EGF-HylA).
- the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 504.
- the human EGF fusion protein comprises SEQ ID NO: 504.
- the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21.
- the temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
- the nucleic acid comprises gene sequence encoding a Fc (IgA) polypeptide.
- the Fc (IgA) polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 415.
- the Fc (IgA) polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 415.
- the Fc (IgA) polypeptide comprises SEQ ID NO: 415.
- the Fc (IgA) polypeptide consists of SEQ ID NO: 415.
- the nucleic acid comprises a gene sequence.
- the nucleic acid comprising the Fc (IgA) gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 416.
- the nucleic acid comprising the Fc (IgA) gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 416.
- the nucleic acid comprising the Fc (IgA) gene sequence comprises SEQ ID NO: 416. In other specific embodiments the nucleic acid comprising the Fc (IgA) gene sequence consists of SEQ ID NO: 416.
- the nucleic acid comprises a gene sequence.
- the nucleic acid comprising the Fc (IgA) gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 417.
- the nucleic acid comprising the Fc (IgA) gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 417.
- the nucleic acid comprising the Fc (IgA) gene sequence comprises SEQ ID NO: 417.
- the nucleic acid comprising the Fc (IgA) gene sequence consists of SEQ ID NO: 417.
- the nucleic acid comprises gene sequence encoding a Linker polypeptide.
- the Linker polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 212.
- the Linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 212.
- the Linker polypeptide comprises SEQ ID NO: 212.
- the Linker polypeptide consists of SEQ ID NO: 212.
- the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the LINKER gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 418. In some embodiments, the nucleic acid comprising the Linker gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 418. In some specific embodiments, the nucleic acid comprising the Linker gene sequence comprises SEQ ID NO: 418. In other specific embodiments the nucleic acid comprising the linker gene sequence consists of SEQ ID NO: 418.
- the nucleic acid comprises gene sequence encoding a EGF-linker Fc (IgA) polypeptide.
- the nucleic acid comprises gene sequence encoding a PhoA-EGF-Fc (hlgA) polypeptide.
- the nucleic acid comprises gene sequence encoding a PelB-EGF-Fc (hlgA) polypeptide.
- the nucleic acid comprises gene sequence encoding a OmpA-EGF-Fc (hlgA) polypeptide.
- the nucleic acid comprises gene sequence encoding a ECOLIN 19410- EGF polypeptide.
- the nucleic acid comprises gene sequence encoding a ECOLIN 19410- EGF- Fc (hlgA) polypeptide.
- the nucleic acid comprises gene sequence encoding an EGF-LARD3- Fc (hlgA) polypeptide.
- the nucleic acid comprises gene sequence encoding an EGF-HylA-Fc (hlgA) polypeptide. In some embodiments, the nucleic acid comprises gene sequence encoding a mutated EGF polypeptide. In certain embodiments, the mutated EGF polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 505. In some embodiments, the mutated EGF polypeptide has at least about 85%, SEQ ID NO: 505. In some specific embodiments, the mutated EGF polypeptide comprises SEQ ID NO: 505. In other specific embodiments, the mutated EGF polypeptide consists of SEQ ID NO: 505.
- the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the mutated EGF gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 511. In some embodiments, the nucleic acid comprising the mutated EGF gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 511. In some specific embodiments, the nucleic acid comprising the mutated EGF gene sequence comprises SEQ ID NO: 511. In other specific embodiments the nucleic acid comprising the mutated EGF gene sequence consists of SEQ ID NO: 511.
- the nucleic acid comprises gene sequence encoding a mutated EGF- linker Fc (IgA) polypeptide.
- the nucleic acid comprises gene sequence encoding a Pho A- mutated EGF polypeptide.
- the nucleic acid comprises gene sequence encoding a PhoA-mutated EGF-Fc (hlgA) polypeptide.
- the nucleic acid comprises gene sequence encoding a PelB- mutated EGF polypeptide.
- the nucleic acid comprises gene sequence encoding a PelB-mutated EGF-Fc (hlgA) polypeptide.
- the nucleic acid comprises gene sequence encoding a OmpA- mutated EGF polypeptide.
- the nucleic acid comprises gene sequence encoding a OmpA-mutated EGF-Fc (hlgA) polypeptide.
- the nucleic acid comprises gene sequence encoding a the ECOLIN 19410-mutated EGF polypeptide. [0527] In some embodiments, the nucleic acid comprises gene sequence encoding an EGF-LARD3- mutated polypeptide.
- the nucleic acid comprises gene sequence encoding an EGF-LARD3- mutated-Fc (hlgA) polypeptide.
- the nucleic acid comprises gene sequence encoding an EGF-HylA- mutated polypeptide.
- the nucleic acid comprises gene sequence encoding an EGF-HylA- mutated-Fc (hlgA) polypeptide.
- the nucleic acid may further comprise one or more of the following sequences: (1) promoter, (2) enhancer, (3) regulatory sequence, (4) ribosome binding site - nonlimiting examples of RBS are provided herein and include SEQ ID NO: 241-289, (5) secretion tag, non-limiting examples of secretion tags are provided herein and include SEQ ID NO: 136-145 (6) leader sequence, (7) auxotrophy, (8) antibiotic resistance.
- the nucleic acid may be functionally replaced, modified, and/or mutated in order to enhance stability and/or increase polypeptide production or secretion.
- the nucleic acid is expressed and secreted in low-oxygen conditions, in the presence of certain molecules or metabolites, in the presence of molecules or metabolites associated with inflammation or an inflammatory response, or in the presence of some other metabolite that may or may not be present in the gut, such as arabinose.
- Exemplary chemical inducers are described herein.
- the nucleic acid is directly operably linked to a first promoter.
- the nucleic acid is indirectly operably linked to a first promoter.
- the promoter is not operably linked with the nucleic acid in nature.
- nucleic acid is expressed under the control of a constitutive promoter.
- constitutive promoters are provided herein and include SEQ ID NO: 39-56 and 58-75.
- the nucleic acid is expressed under the control of an inducible promoter.
- the nucleic acid is expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions.
- the nucleic acid is expressed under the control of a promoter that is directly or indirectly induced by low- oxygen or anaerobic conditions, wherein expression of the nucleic acid is activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut.
- Inducible promoters are described in more detail infra. Non-limiting examples of low oxygen inducible promoters are provided herein and include SEQ ID NO: 1-11, 336 and 337.
- Non-limiting examples of OxyR inducible promoters are provided herein and include SEQ ID NO: 370-373.
- Non-limiting examples of promoters regulated by chemical inducers are provided herein and include SEQ ID NO: 15, 16, 19-21, 350, 369, 375-378, and 386-387.
- the nucleic acid sequence comprises an FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide.
- the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 519.
- the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 519.
- the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 519 (PelB-EGF) with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 519 with an FNR-responsive element of any one of SEQ ID NO: 1- 11, 336, and 337.
- the nucleic acid sequence comprises an FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide.
- the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 520.
- the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 520.
- the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 502 (PhoA-EGF) with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 502 with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337.
- the nucleic acid sequence comprises an FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide.
- the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 521.
- the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 521.
- the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 501 (OmpA-EGF) with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 501 with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337.
- the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 522.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 522.
- the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 500 (PelB-EGF) with a temperature sensitive element of any one of SEQ ID NO: 19-21.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 500 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
- the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 523.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 523.
- the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 502 (PhoA-EGF) with a temperature sensitive element of any one of SEQ ID NO: 19-21.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 502 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
- the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 524.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 524.
- the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 501 (OmpA-EGF) with a temperature sensitive element of any one of SEQ ID NO: 19-21.
- nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 501 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
- CI857-pR-OmpA-EGF CI857-pR-OmpA-EGF:
- the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 525.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 525.
- the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 503 (EGF-LARD3) with a temperature sensitive element of any one of SEQ ID NO: 19-21.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 503 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
- the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 526.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 526.
- the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 504 (EGF-HylA) with a temperature sensitive element of any one of SEQ ID NO: 19-21.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 504 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
- the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an ATP-binding cassette transporter polypeptide.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an ATP-binding cassette transporter polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 527.
- the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an ATP-binding cassette transporter polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 527.
- the nucleic acid comprising the gene sequence encoding an ATP-binding cassette transporter polypeptide comprises SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514 (ATP-binding cassette transporter) with a temperature sensitive element of any one of SEQ ID NO: 19-21.
- the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19-21.
- the nucleic acid may be present on a plasmid or chromosome in the bacterial cell. In one embodiment, the nucleic acid is located on a plasmid in the bacterial cell. In another embodiment, the nucleic acid is located in the chromosome of the bacterial cell. In yet another embodiment, a native copy of the nucleic acid is located in the chromosome of the bacterial cell.
- the bacteria are genetically engineered to include multiple mechanisms of action (MO As), e.g., circuits producing multiple copies of the same product (e.g., to enhance copy number) or circuits performing multiple different functions.
- MO As mechanisms of action
- insertion sites include, but are not limited to, malE/K, insB/I, araC/BAD, lacZ, dapA, cea.
- the recombinant bacteria may include four copies of EGF inserted at four different insertion sites, e.g., malE/K, insB/I, araC/BAD, and lacZ.
- the recombinant bacteria may include three copies of EGF inserted at three different insertion sites, e.g., malE/K, insB/I, and lacZ.
- the bacteria are genetically engineered to include multiple mechanisms of action (MO As), e.g., circuits producing multiple copies of the same product (e.g., to enhance copy number) or circuits performing multiple different functions.
- MO As mechanisms of action
- the recombinant bacteria may include four copies of the gene, gene(s), or gene cassettes for producing the payload(s) inserted at four different insertion sites.
- the recombinant bacteria may include three copies of the gene, gene(s), or gene cassettes for producing the payload(s) inserted at three different insertion sites and three copies of the gene, gene(s), or gene cassettes for producing the payload(s) inserted at three different insertion sites.
- the recombinant bacteria of the disclosure produce at least about 1.5-fold, at least about 2-fold, at least about 10-fold, at least about 15-fold, at least about 20- fold, at least about 30-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1,000-fold, or at least about 1,500-fold more of the payload(s) as compared to unmodified bacteria of the same subtype under the same conditions.
- the recombinant bacteria produce at least about 1.5-fold, at least about 2-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1,000-fold, or at least about 1,500-fold more of a payload under inducing conditions than unmodified bacteria of the same subtype under the same conditions. Certain unmodified bacteria will not have detectable levels of the payload. In embodiments using genetically modified forms of these bacteria, the payload will be detectable under inducing conditions.
- qPCR quantitative PCR
- Primers may be designed and used to detect mRNA in a sample according to methods known in the art.
- a fluorophore is added to a sample reaction mixture that may contain payload RNA, and a thermal cycler is used to illuminate the sample reaction mixture with a specific wavelength of light and detect the subsequent emission by the fluorophore.
- the reaction mixture is heated and cooled to predetermined temperatures for predetermined time periods. In certain embodiments, the heating and cooling is repeated for a predetermined number of cycles.
- the reaction mixture is heated and cooled to 90-100°C, 60-70°C, and 30-50°C for a predetermined number of cycles. In a certain embodiment, the reaction mixture is heated and cooled to 93-97°C, 55-65°C, and 35-45°C for a predetermined number of cycles.
- the accumulating amplicon is quantified after each cycle of the qPCR. The number of cycles at which fluorescence exceeds the threshold is the threshold cycle (CT). At least one CT result for each sample is generated, and the CT result(s) may be used to determine mRNA expression levels of the payload(s).
- CT threshold cycle
- the gene sequence(s) encoding EGF peptides for secretion may be expressed under the control of a constitutive promoter or an inducible promoter.
- the gene sequence(s) encoding the one or more EGF peptides for secretion are expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions, e.g., low-oxygen or anaerobic conditions, wherein expression of the gene sequence(s) encoding the one or more EGF peptides for secretion are activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut.
- the gene sequence(s) encoding the one or more EGF peptides for secretion are expressed under the control of a temperature-sensitive promoter.
- the gene sequence(s) encoding the one or more EGF peptides for secretion are expressed under the control of a promoter that is directly or indirectly induced by inflammatory conditions.
- Exemplary inducible promoters described herein include oxygen level-dependent promoters (e.g., FNR-inducible promoter), promoters induced by inflammation or an inflammatory response (RNS, ROS promoters), and promoters induced by a metabolite that may or may not be naturally present (e.g., can be exogenously added) in the gut, e.g., arabinose and tetracycline.
- inducible promoters include, but are not limited to, an FNR responsive promoter, a P ara c promoter, a P ara BAD promoter, and a PTBIR promoter, each of which are described in more detail herein. Inducible promoters are described in more detail infra.
- the at least one gene encoding EGF for secretion may be present on a plasmid or chromosome in the bacterial cell.
- a native copy of the gene sequence(s) encoding EGF for secretion are located in the chromosome of the bacterial cell, and at least one gene encoding EGF for secretion from a different species of bacteria are located on a plasmid in the bacterial cell.
- a native copy of the gene sequence(s) encoding EGF for secretion are located on a plasmid in the bacterial cell, and at least one gene encoding EGF for secretion from a different species of bacteria are located on a plasmid in the bacterial cell.
- a native copy of the gene sequence(s) encoding EGF for secretion are located in the chromosome of the bacterial cell, and at least one gene encoding EGF for secretion from a different species of bacteria are located in the chromosome of the bacterial cell.
- the gene sequence(s) encoding the one or more EGF peptides for secretion are expressed on a low-copy plasmid. In some embodiments, the gene sequence(s) encoding the one or more EGF peptides for secretion are expressed on a high-copy plasmid. In some embodiments, the high-copy plasmid may be useful for increasing expression of EGF for secretion.
- a recombinant bacterial cell comprising at least one gene encoding EGF for secretion are expressed on a high-copy plasmid do not increase tryptophan catabolism as compared to a recombinant bacterial cell comprising the same gene expressed on a low-copy plasmid in the absence of a heterologous importer of tryptophan and/or its metabolites and additional copies of a native importer of tryptophan and/or its metabolites.
- the importer of tryptophan and/or its metabolites is used in conjunction with a high-copy plasmid.
- the recombinant bacteria described above further comprise one or more of the modifications, mutations, and/or deletions in endogenous genes described herein.
- the genetically engineered microorganism further comprises a mutation and/or deletion in IdhA.
- the genetically engineered microorganism further comprises a mutation and/or deletion in frdA.
- the genetically engineered microorganism further comprises a mutation and/or deletion in adhE.
- the genetically engineered microorganism further comprises a mutation and/or deletion in one or more of IdhA, frdA, and adhE.
- surface display could be used to display EGF on the surface of the genetically modified bacterium.
- the recombinant bacteria and/or microorganisms encode one or more gene(s) and/or gene cassette(s) encoding EGF, which is anchored or displayed on the surface of the bacteria and/or microorganisms.
- Such payload or EGF may be an effector intended for secretion or may be an enzyme which catalyzes a metabolic reaction to produce an effector.
- the protein of interest is an enzyme which catabolizes a harmful metabolite.
- the strains are pre-loaded with active payload or EGF.
- the recombinant bacteria express EGF, under conditions provided in bacterial culture during cell growth, expansion, purification, fermentation, and/or manufacture prior to administration in vivo. Such culture conditions can be provided in a flask, fermenter or other appropriate culture vessel, e.g..
- bacterial culture or bacterial cell culture or “culture” refers to bacterial cells or microorganisms, which are maintained or grown in vitro during several production processes, including cell growth, cell expansion, recovery, purification, fermentation, and/or manufacture.
- fermentation refers to the growth, expansion, and maintenance of bacteria under defined conditions. Fermentation may occur under a number of cell culture conditions, including anaerobic or low oxygen or oxygenated conditions, in the presence of inducers, nutrients, at defined temperatures, and the like.
- Culture conditions are selected to achieve optimal activity and viability of the cells, while maintaining a high cell density (high biomass) yield.
- a number of cell culture conditions and operating parameters are monitored and adjusted to achieve optimal activity, high yield and high viability, including oxygen levels (e.g., low oxygen, microaerobic, aerobic), temperature of the medium, and nutrients and/or different growth media, chemical and/or nutritional inducers and other components provided in the medium.
- pre-induction may boost in vivo activity. This is particularly important in proximal regions of the gut which are reached first by the bacteria, e.g., the small intestine. If the bacterial residence time in this compartment is relatively short, the bacteria may pass through the small intestine without reaching full in vivo induction capacity. In contrast, if a strain is pre-induced and preloaded, the strains are already fully active, allowing for greater activity more quickly as the bacteria reach the intestine. Ergo, no transit time is “wasted”, in which the strain is not optimally active. As the bacteria continue to move through the intestine, in vivo induction occurs under environmental conditions of the gut (e.g., low oxygen, or in the presence of gut metabolites).
- expression of one or more payload(s), is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture.
- expression EGF is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture.
- expression of one or more payload(s) is driven from the same promoter as a multicistronic message.
- expression of one or more payload(s) is driven from the same promoter as two or more separate messages.
- expression of one or more payload(s) is driven from the one or more different promoters.
- the strains are administered without any pre-induction protocols during strain growth prior to in vivo administration.
- cells are induced under anaerobic or low oxygen conditions in culture.
- cells are grown (e.g., for 1.5 to 3 hours) until they have reached a certain OD, e.g., ODs within the range of 0.1 to 10, indicating a certain density e.g., ranging from 1X10 ⁇ 8 to 1X10 ⁇ 11, and exponential growth and are then switched to anaerobic or low oxygen conditions for approximately 3 to 5 hours.
- strains are induced under anaerobic or low oxygen conditions, e.g., to induce FNR promoter activity and drive expression of one or more payload(s) under the control of one or more FNR promoters.
- expression of one or more payload(s) is under the control of one or more anaerobic or low oxygen inducible promoter(s), e.g., FNR promoter(s), and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under anaerobic or low oxygen conditions.
- expression of EGF is under the control of one or more anaerobic or low oxygen inducible promoter(s), e.g., FNR promoter(s) and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under anaerobic or low oxygen conditions.
- expression of two or more payload(s) is under the control of one or more anaerobic or low oxygen inducible promoter(s), e.g., FNR promoter(s), and is driven from the same promoter in the form of a multicistronic message under anaerobic or low oxygen conditions.
- expression of one or more payload(s) is under the control of one or more anaerobic or low oxygen inducible promoter(s), e.g., FNR promoter(s), and is driven from the same promoter as two or more separate messages under anaerobic or low oxygen conditions.
- anaerobic or low oxygen inducible promoter(s) e.g., FNR promoter(s)
- strains that comprise one or more payload(s) under the control of an FNR promoter may allow expression of payload(s) from these promoters in vitro, under anaerobic or low oxygen culture conditions, and in vivo, under the low oxygen conditions found in the gut.
- promoters inducible by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers can be induced under anaerobic or low oxygen conditions in the presence of the chemical and/or nutritional inducer.
- strains may comprise a combination of gene sequence(s), some of which are under control of FNR promoters and others which are under control of promoters induced by chemical and/or nutritional inducers.
- strains may comprise one or more payload gene sequence(s) under the control of one or more FNR promoter(s) and one or more payload gene sequence(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art.
- strains may comprise one or more payload gene sequence(s) and/or under the control of one or more FNR promoter(s), and one or more payload gene sequence(s) under the control of a one or more constitutive promoter(s) described herein.
- strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more thermoregulated promoter(s) described herein.
- expression of one or more payload gene sequence(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under anaerobic and/or low oxygen conditions.
- the chemical and/or nutritional inducer is arabinose and the promoter is inducible by arabinose.
- the chemical and/or nutritional inducer is IPTG and the promoter is inducible by IPTG.
- the chemical and/or nutritional inducer is rhamnose and the promoter is inducible by rhamnose.
- the chemical and/or nutritional inducer is tetracycline and the promoter is inducible by tetracycline.
- expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter in the form of a multicistronic message under anaerobic and/or low oxygen conditions.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter as two or more separate messages under anaerobic and/or low oxygen conditions.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the one or more different promoters under anaerobic and/or low oxygen conditions.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers, under anaerobic or low oxygen conditions.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers.
- the strains comprise gene sequence(s) under the control of a third inducible promoter, e.g., an anaerobic/low oxygen promoter, e.g., FNR promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced promoter or a low oxygen promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a FNR promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. Additionally the strains may comprise a construct which is under thermoregulatory control. In some embodiments, the bacteria strains further comprise payload sequence(s) under the control of one or more constitutive promoter(s) active under low oxygen conditions.
- cells are grown (e.g., for 1.5 to 3 hours) until they have reached a certain OD, e.g., ODs within the range of 0.1 to 10, indicating a certain density e.g., ranging from 1X10 ⁇ 8 to 1X10 ⁇ 11, and exponential growth and are then induced through the addition of the inducer or through other means, such as shift to a permissive temperature, for approximately 3 to 5 hours.
- a certain OD e.g., ODs within the range of 0.1 to 10
- a certain density e.g., ranging from 1X10 ⁇ 8 to 1X10 ⁇ 11
- promoters inducible by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art can be induced under aerobic conditions in the presence of the chemical and/or nutritional inducer during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under aerobic conditions.
- expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter in the form of a multicistronic message under aerobic conditions.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter as two or more separate messages under aerobic conditions.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the one or more different promoters under aerobic conditions.
- the chemical and/or nutritional inducer is arabinose and the promoter is inducible by arabinose.
- the chemical and/or nutritional inducer is IPTG and the promoter is inducible by IPTG.
- the chemical and/or nutritional inducer is rhamnose and the promoter is inducible by rhamnose.
- the chemical and/or nutritional inducer is tetracycline and the promoter is inducible by tetracycline.
- promoters regulated by temperature are induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture.
- expression of one or more payload(s) is driven directly or indirectly by one or more thermoregulated promoter(s) and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under aerobic conditions.
- expression of one or more payload(s) is driven directly or indirectly by one or more thermoregulated promoter(s) and is driven from the same promoter in the form of a multicistronic message under aerobic conditions.
- expression of one or more payload(s) is driven directly or indirectly by one or more thermoregulated promo ter(s) and is driven from the same promoter as two or more separate messages under aerobic conditions.
- expression of one or more payload(s) is driven directly or indirectly by one or more thermoregulated promoter(s) and is driven from the one or more different promoters under aerobic conditions.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced under aerobic conditions. In some embodiments, a strain comprises three or more different promoters which are induced under aerobic culture conditions. [0594] In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically inducible promoter, and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter under aerobic culture conditions.
- a first inducible promoter e.g., a chemically inducible promoter
- a second inducible promoter e.g., a temperature sensitive promoter under aerobic culture conditions.
- two or more chemically induced promoter gene sequence(s) are combined with a thermoregulated construct described herein.
- the chemical and/or nutritional inducer is arabinose and the promoter is inducible by arabinose.
- the chemical and/or nutritional inducer is IPTG and the promoter is inducible by IPTG.
- the chemical and/or nutritional inducer is rhamnose and the promoter is inducible by rhamnose. In one embodiment, the chemical and/or nutritional inducer is tetracycline and the promoter is inducible by tetracycline.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a FNR promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. Additionally the strains may comprise a construct which is under thermoregulatory control. In some embodiments, the bacteria strains further comprise payload sequences under the control of one or more constitutive promoter(s) active under aerobic conditions.
- genetically engineered strains comprise gene sequence(s) which are induced under aerobic culture conditions. In some embodiments, these strains further comprise FNR inducible gene sequence(s) for in vivo activation in the gut. In some embodiments, these strains do not further comprise FNR inducible gene sequence(s) for in vivo activation in the gut.
- genetically engineered strains comprise gene sequence(s), which are arabinose inducible under aerobic culture conditions. In some embodiments, these strains do not further comprise FNR inducible gene sequence(s) for in vivo activation in the gut.
- genetically engineered strains comprise gene sequence(s), which are IPTG inducible under aerobic culture conditions. In some embodiments, these strains further comprise FNR inducible gene sequence(s) for in vivo activation in the gut. In some embodiments, these strains do not further comprise FNR inducible gene sequence(s) for in vivo activation in the gut.
- genetically engineered strains comprise gene sequence(s) which are arabinose inducible under aerobic culture conditions. In some embodiments, such a strain further comprises sequence(s) which are IPTG inducible under aerobic culture conditions. In some embodiments, these strains further comprise FNR inducible gene payload sequence(s) for in vivo activation in the gut. In some embodiments, these strains do not further comprise FNR inducible gene sequence(s) for in vivo activation in the gut.
- genetically engineered strains comprise inducible gene sequence(s) which can be induced numerous combinations.
- rhamnose or tetracycline can be used as an inducer with the appropriate promoters in addition or in lieu of arabinose and/or IPTG or with thermoregulation.
- such bacterial strains can also be induced with the chemical and/or nutritional inducers under anaerobic conditions.
- viability, growth, and activity are optimized by pre-inducing the bacterial strain under microaerobic conditions.
- microaerobic conditions are best suited to “strike a balance” between optimal growth, activity and viability conditions and optimal conditions for induction; in particular, if the expression of the one or more payload(s) are driven by an anaerobic and/or low oxygen promoter, e.g., a FNR promoter.
- cells are grown (e.g., for 1.5 to 3 hours) until they have reached a certain OD, e.g., ODs within the range of 0.1 to 10, indicating a certain density e.g., ranging from 1X10 ⁇ 8 to 1X10 ⁇ 11, and exponential growth and are then induced through the addition of the inducer or through other means, such as shift to at a permissive temperature, for approximately 3 to 5 hours.
- a certain OD e.g., ODs within the range of 0.1 to 10
- a certain density e.g., ranging from 1X10 ⁇ 8 to 1X10 ⁇ 11
- expression of one or more payload(s) is under the control of one or more FNR promoter(s) and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under microaerobic conditions.
- expression of one or more payload(s), is under the control of one or more FNR promoter(s) and is driven from the same promoter in the form of a multicistronic message under microaerobic conditions.
- expression of one or more payload(s) is under the control of one or more FNR promoter(s) and is driven from the same promoter as two or more separate messages under microaerobic conditions.
- expression of one or more payload(s) is under the control of one or more FNR promoter(s) and is driven from the one or more different promoters under microaerobic conditions.
- strains that comprise one or more payload(s) under the control of an FNR promoter may allow expression of payload(s) from these promoters in vitro, under microaerobic culture conditions, and in vivo, under the low oxygen conditions found in the gut.
- promoters inducible by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers can be induced under microaerobic conditions in the presence of the chemical and/or nutritional inducer.
- strains may comprise a combination of gene sequence(s), some of which are under control of FNR promoters and others which are under control of promoters induced by chemical and/or nutritional inducers.
- strains may comprise one or more payload gene sequence(s) sequence(s) under the control of one or more FNR promoter(s) and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art.
- strains may comprise one or more payload gene sequence(s) under the control of one or more FNR promoter(s), and one or more payload gene sequence(s) under the control of a one or more constitutive promoter(s) described herein. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more thermoregulated promoter(s) described herein.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under microaerobic conditions.
- expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter in the form of a multicistronic message under microaerobic conditions.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter as two or more separate messages under microaerobic conditions.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the one or more different promoters under microaerobic conditions.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers, under microaerobic conditions.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers.
- the strains comprise gene sequence(s) under the control of a third inducible promoter, e.g., an anaerobic/low oxygen promoter or microaerobic promoter, e.g., FNR promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced promoter or a low oxygen or microaerobic promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a FNR promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. Additionally the strains may comprise a construct which is under thermoregulatory control. In some embodiments, the bacteria strains further comprise payload under the control of one or more constitutive promoter(s) active under low oxygen conditions.
- cycling, phasing, or pulsing techniques are employed during cell growth, expansion, recovery, purification, fermentation, and/or manufacture to efficiently induce and grow the strains prior to in vivo administration.
- This method is used to “strike a balance” between optimal growth, activity, cell health, and viability conditions and optimal conditions for induction; in particular, if growth, cell health or viability are negatively affected under inducing conditions.
- cells are grown (e.g., for 1.5 to 3 hours) in a first phase or cycle until they have reached a certain OD, e.g., ODs within the range of 0.1 to 10, indicating a certain density e.g., ranging from 1X10 ⁇ 8 to 1X10 ⁇ 11, and are then induced through the addition of the inducer or through other means, such as shift to a permissive temperature (if a promoter is thermoregulated), or change in oxygen levels (e.g., reduction of oxygen level in the case of induction of an FNR promoter driven construct) for approximately 3 to 5 hours.
- a second phase or cycle conditions are brought back to the original conditions which support optimal growth, cell health and viability.
- the culture can be spiked with a second dose of the inducer in the second phase or cycle.
- two cycles of optimal conditions and inducing conditions are employed (i.e, growth, induction, recovery and growth, induction). In some embodiments, three cycles of optimal conditions and inducing conditions are employed. In some embodiments, four or more cycles of optimal conditions and inducing conditions are employed. In a non-liming example, such cycling and/or phasing is used for induction under anaerobic and/or low oxygen conditions (e.g., induction of FNR promoters). In one embodiment, cells are grown to the optimal density and then induced under anaerobic and/or low oxygen conditions.
- growing cultures are spiked once with the chemical and/or nutritional inducer. In some embodiments, growing cultures are spiked twice with the chemical and/or nutritional inducer. In some embodiments, growing cultures are spiked three or more times with the chemical and/or nutritional inducer.
- cells are first grown under optimal growth conditions up to a certain density, e.g., for 1.5 to 3 hour, to reach an OD of 0.1 to 10, until the cells are at a density ranging from 1X10 ⁇ 8 to 1X10 ⁇ 11.
- the chemical inducer e.g., arabinose or IPTG
- an additional dose of the inducer is added to re-initiate the induction. Spiking can be repeated as needed.
- phasing or cycling changes in temperature in the culture.
- adjustment of temperature may be used to improve the activity of a payload. For example, lowering the temperature during culture may improve the proper folding of the payload.
- cells are first grown at a temperature optimal for growth (e.g., 37 C).
- the cells are then induced, e.g., by a chemical inducer, to express the payload.
- the temperature in the media is lowered, e.g., between 25 and 35 C, to allow improved folding of the expressed payload.
- payload(s) are under the control of different inducible promoters, for example two different chemical inducers.
- the payload is induced under low oxygen conditions or microaerobic conditions and a second payload is induced by a chemical inducer.
- expression of one or more payload(s) is under the control of one or more FNR promoter(s) and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture by using phasing or cycling or pulsing or spiking techniques.
- expression of one or more payload(s), is under the control of one or more FNR promoter(s) and is driven from the same promoter in the form of a multicistronic message through the employment of phasing or cycling or pulsing or spiking techniques.
- expression of one or more payload(s) is under the control of one or more FNR promoter(s) and is driven from the same promoter as two or more separate messages through the employment of phasing or cycling or pulsing or spiking techniques.
- expression of one or more payload(s), is under the control of one or more FNR promoter(s) and is driven from the one or more different promoters through the employment of phasing or cycling or pulsing or spiking techniques.
- promoters inducible by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers can be induced through the employment of phasing or cycling or pulsing or spiking techniques in the presence of the chemical and/or nutritional inducer.
- strains may comprise a combination of gene sequence(s), some of which are under control of FNR promoters and others which are under control of promoters induced by chemical and/or nutritional inducers.
- strains may comprise one or more payload gene sequence(s) under the control of one or more FNR promoter(s) and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art.
- strains may comprise one or more payload gene sequence(s) under the control of one or more FNR promoter(s), and one or more payload gene sequence(s) under the control of a one or more constitutive promoter(s) described herein and are induced through the employment of phasing or cycling or pulsing or spiking techniques.
- strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more thermoregulated promoter(s) described herein, and are induced through the employment of phasing or cycling or pulsing or spiking techniques.
- any of the strains described herein can be grown through the employment of phasing or cycling or pulsing or spiking techniques.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under anaerobic and/or low oxygen conditions.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter in the form of a multicistronic message and which are induced through the employment of phasing or cycling or pulsing or spiking techniques.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter as two or more separate messages and is grown through the employment of phasing or cycling or pulsing or spiking techniques.
- expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the one or more different promoters, all of which are induced through the employment of phasing or cycling or pulsing or spiking techniques.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers, through the employment of phasing or cycling or pulsing or spiking techniques.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers through the employment of phasing or cycling or pulsing or spiking techniques.
- the strains comprise gene sequence(s) under the control of a third inducible promoter, e.g., an anaerobic/low oxygen promoter, e.g., FNR promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced promoter or a low oxygen promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a FNR promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter.
- strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. Additionally the strains may comprise a construct which is under thermoregulatory control. In some embodiments, the bacteria strains further comprise payload sequence(s) under the control of one or more constitutive promoter(s) active under low oxygen conditions. Any of the strains described in these embodiments may be induced through the employment of phasing or cycling or pulsing or spiking techniques. Aerobic induction of the FNR promoter
- FNRS24Y is a mutated form of FNR which is more resistant to inactivation by oxygen, and therefore can activate FNR promoters under aerobic conditions (see e.g., Jervis AJ
- the 02 sensitivity of the transcription factor FNR is controlled by Ser24 modulating the kinetics of [4Fe-4S] to [2Fe-2S] conversion, Proc Natl Acad Sci U S A. 2009 Mar 24;106(12):4659-64, the contents of which is herein incorporated by reference in its entirety).
- an oxygen bypass system shown and described in figures and examples is used.
- FNRS24Y is induced by addition of arabinose and then drives the expression of EGF by binding and activating the FNR promoter under aerobic conditions.
- strains can be grown, produced or manufactured efficiently under aerobic conditions, while being effectively pre-induced and pre-loaded, as the system takes advantage of the strong FNR promoter resulting in of high levels of expression of EGF.
- This system does not interfere with or compromise in vivo activation, since the mutated FNRS24Y is no longer expressed in the absence of arabinose, and wild type FNR then binds to the FNR promoter and drives expression of EGF.
- FNRS24Y is expressed during aerobic culture growth and induces EGF.
- a second payload expression can also be induced aerobically, e.g., by arabinose.
- EGF and FNRS24Y can in some embodiments be induced simultaneously, e.g., from an arabinose inducible promoter.
- FNRS24Y and EGF are transcribed as a bicistronic message whose expression is driven by an arabinose promoter.
- FNRS24Y is knocked into the arabinose operon, allowing expression to be driven from the endogenous Para promoter.
- a LacI promoter and IPTG induction are used in this system (in lieu of Para and arabinose induction).
- a rhamnose inducible promoter is used in this system.
- a temperature sensitive promoter is used to drive expression of FNRS24Y.
- the engineered microorganism may comprise a secretion mechanism and corresponding gene sequence(s) encoding the secretion system.
- the recombinant bacteria further comprise a native secretion mechanism or non-native secretion mechanism that is capable of secreting the EGF molecule from the bacterial cytoplasm in the extracellular environment.
- Many bacteria have evolved sophisticated secretion systems to transport substrates across the bacterial cell envelope. Substrates, such as small molecules, proteins, and DNA, may be released into the extracellular space or periplasm (such as the gut lumen or other space), injected into a target cell, or associated with the bacterial membrane.
- secretion machineries may span one or both of the inner and outer membranes.
- the recombinant bacteria further comprise a non-native double membrane-spanning secretion system.
- Double membrane- spanning secretion systems include, but are not limited to, the type I secretion system (T1SS), the type II secretion system (T2SS), the type III secretion system (T3SS), the type IV secretion system (T4SS), the type VI secretion system (T6SS), and the resistance-nodulation-division (RND) family of multi-drug efflux pumps (Pugsley 1993; Gerlach et al., 2007; Collinson et al., 2015; Costa et al., 2015; Reeves et al., 2015;
- RTD resistance-nodulation-division
- WO2014138324A1 incorporated herein by reference.
- Examples of such secretion systems are shown in figures and examples.
- Mycobacteria which have a Gram-negative-like cell envelope, may also encode a type VII secretion system (T7SS) (Stanley et al., 2003).
- T7SS type VII secretion system
- double membrane-spanning secretions generally transport substrates from the bacterial cytoplasm directly into the extracellular space or into the target cell.
- the T2SS and secretion systems that span only the outer membrane may use a two-step mechanism, wherein substrates are first translocated to the periplasm by inner membrane-spanning transporters, and then transferred to the outer membrane or secreted into the extracellular space.
- Outer membrane-spanning secretion systems include, but are not limited to, the type V secretion or autotransporter system or autosecreter system (T5SS), the curli secretion system, and the chaperone-usher pathway for pili assembly (Saier, 2006; Costa et al., 2015).
- the engineered microorganism comprises gene sequence(s) that includes a secretion tag.
- the EGF protein includes a “secretion tag” of either RNA or peptide origin to direct the EGF protein to specific secretion systems.
- a secretion tag for the Type I Hemolysin secretion system is encoded in the C-terminal 53 amino acids of the alpha hemolysin protein (HlyA).
- HlyA alpha hemolysin protein
- a Hemolysin-based Secretion System is used to secrete EGF.
- Type I Secretion systems offer the advantage of translocating their passenger peptide directly from the cytoplasm to the extracellular space, obviating the two-step process of other secretion types.
- the alpha-hemolysin (HlyA) of uropathogenic Escherichia coli uses HlyB, an ATP-binding cassette transporter; HlyD, a membrane fusion protein; and TolC, an outer membrane protein.
- HlyB inserts into inner membrane to form a pore
- HlyD aligns HlyB with TolC (outer membrane pore) thereby forming a channel through inner and outer membrane.
- this channel is used to secrete HlyA, however, to secrete EGF, the secretion signal-containing C-terminal portion of HlyA is fused to the C-terminal portion of an EGF peptide (star) to mediate secretion of this peptide.
- the C-terminal secretion tag can be removed by either an autocatalytic or protease-catalyzed e.g., OmpT cleavage thereby releasing the EGF protein into the extracellular milieu.
- one or more EGF proteins contain expressed as fusion protein with the 53 amino acids of the C termini of alpha-hemolysin (hlyA) of E. coli CFT073 (C terminal secretion tag).
- a Type V Autotransporter Secretion System is used to secrete EGF.
- the Type V Auto-secretion System utilizes an N-terminal Sec-dependent peptide tag (inner membrane) and C-terminal tag (outer-membrane). This system uses the Sec-system to get from the cytoplasm to the periplasm. The C-terminal tag then inserts into the outer membrane forming a pore through which the “passenger protein” threads through. Due to the simplicity of the machinery and capacity to handle relatively large protein fluxes, the Type V secretion system is attractive for the extracellular production of recombinant proteins.
- EGF can be fused to an N-terminal secretion signal, a linker, and the beta-domain of an autotransporter.
- the N-terminal, Sec-dependent signal sequence directs the protein to the SecA-YEG machinery which moves the protein across the inner membrane into the periplasm, followed by subsequent cleavage of the signal sequence.
- the Beta- domain is recruited to the Bam complex (‘Beta-barrel assembly machinery’) where the beta-domain is folded and inserted into the outer membrane as a beta-barrel structure.
- EGF is threaded through the hollow pore of the beta-barrel structure ahead of the linker sequence.
- the passenger is released from the membrane-embedded C-terminal tag by either an autocatalytic, intein-like mechanism (left side of Bam complex) or via a membrane-bound protease (black scissors; right side of Bam complex) (i.e., OmpT).
- a membrane-associated peptidase to a complimentary protease cut site in the linker i.e., a membrane-associated peptidase to a complimentary protease cut site in the linker.
- the secreted molecule such as a heterologous protein or peptide comprises an N-terminal secretion signal, a linker, and beta-domain of an autotransporter so as to allow the molecule to be secreted from the bacteria.
- the N-terminal tag is removed by the Sec system.
- the secretion system is able to remove this tag before secreting EGF from the engineered bacteria.
- the N-terminal peptide secretion tag is removed upon translocation of the “passenger” peptide from the cytoplasm into the periplasmic compartment by the native Sec system.
- the C-terminal secretion tag can be removed by either an autocatalytic or protease-catalyzed e.g., OmpT cleavage thereby releasing the molecule(s) into the extracellular milieu.
- the recombinant bacteria comprise a type III or a type Ill-like secretion system (T3SS) from Shigella, Salmonella, E. coll, Bivrio, Burkholderia, Yersinia, Chlamydia, or Pseudomonas.
- T3SS type III or a type Ill-like secretion system
- the traditional T3SS is capable of transporting a protein from the bacterial cytoplasm to the host cytoplasm through a needle complex.
- the basal body closely resembles the flagella, however, instead of a “tail"/whip, the traditional T3SS has a syringe to inject the passenger proteins into host cells.
- the secretion tag is encoded by an N-terminal peptide (lengths vary and there are several different tags, see PCT/US14/020972). The N-terminal tag is not removed from the polypeptides in this secretion system.
- the T3SS may be modified to secrete the molecule from the bacterial cytoplasm, but not inject the molecule into the host cytoplasm. Thus, the molecule is secreted into the gut lumen.
- the recombinant bacteria comprise said modified T3SS and are capable of secreting the EGF from the bacterial cytoplasm.
- the secreted molecule such as a heterologous protein or peptide comprises a type III secretion sequence that EGF to be secreted from the bacteria.
- the tag is encoded in 5’ untranslated region of the mRNA and thus there is no peptide tag to cleave/remove.
- This modified system does not contain the “syringe” portion and instead uses the basal body of the flagella structure as the pore to translocate across both membranes and out through the forming flagella. If the fliC/fliD genes (encoding the flagella “tail’Vwhip) are disrupted the flagella cannot fully form and this promotes overall secretion. In some embodiments, the tail portion can be removed entirely.
- a flagellar type III secretion pathway is used to EGF.
- an incomplete flagellum is used to secrete EGF by recombinantly fusing the peptide to an N-terminal flagellar secretion signal of a native flagellar component. In this manner, the intracellularly expressed chimeric peptide can be mobilized across the inner and outer membranes into the surrounding host environment.
- a modified flagellar type III secretion apparatus in which untranslated DNA fragment upstream of the gene lliC (encoding flagellin), e.g., a 173-bp region, is fused to the gene encoding the heterologous protein or peptide can be used to secrete polypeptides of interest (See, e.g., Majander et al., Extracellular secretion of polypeptides using a modified Escherichia coli flagellar secretion apparatus. Nat Biotechnol. 2005 Apr;23(4):475-81).
- the untranslated region from the fliC loci may not be sufficient to mediate translocation of the passenger peptide through the flagella.
- N-terminal signal into the amino acid coding sequence of FliC, for example, by using the 173 bp of untranslated region along with the first 20 amino acids of FliC (see, e.g., Duan et al., Secretion of Insulinotropic Proteins by Commensal Bacteria: Rewiring the Gut To Treat Diabetes, Appl. Environ. Microbiol. December 2008 vol. 74 no. 23 7437-7438).
- the recombinant bacteria further comprise a non-native single membrane-spanning secretion system.
- Single membrane- spanning transporters may act as a component of a secretion system, or may export substrates independently.
- Such transporters include, but are not limited to, ATP-binding cassette translocases, flagellum/virulence-related translocases, conjugation-related translocases, the general secretory system (e.g., the SecYEG complex in E.
- the accessory secretory system in mycobacteria and several types of Gram-positive bacteria e.g., Bacillus anthracis, Lactobacillus johnsonii, Corynebacterium glutamicum, Streptococcus gordonii, Staphylococcus aureus
- TAT twin-arginine translocation
- the TAT system may offer particular advantages, however, in that it is able to transport folded substrates, thus eliminating the potential for premature or incorrect folding.
- the recombinant bacteria comprise a TAT or a TAT-like system and are capable of secreting EGF from the bacterial cytoplasm.
- the secretion systems disclosed herein may be modified to act in different species, strains, and subtypes of bacteria, and/or adapted to deliver different payloads.
- EGF EGF
- the polypeptide In order to translocate EGF to the extracellular space, the polypeptide must first be translated intracellularly, mobilized across the inner membrane and finally mobilized across the outer membrane. EGF contains disulphide bonds to stabilize the tertiary and quaternary structures. While these bonds are capable of correctly forming in the oxidizing periplasmic compartment with the help of periplasmic chaperones, in order to translocate the polypeptide across the outer membrane the disulphide bonds must be reduced and the protein unfolded again.
- Destabilizing the bacterial outer membrane to induce leakiness can be accomplished by deleting or mutagenizing genes responsible for tethering the outer membrane to the rigid peptidoglycan skeleton, including for example, Ipp, ompC, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl.
- Lpp is the most abundant polypeptide in the bacterial cell existing at -500,000 copies per cell and functions as the primary ‘staple’ of the bacterial cell wall to the peptidoglycan. Silhavy, T. J., Kahne, D. & Walker, S. The bacterial cell envelope. Cold Spring Harb Perspect Biol 2, a000414 (2010).
- TolA-pal and OmpA complexes function similarly to Lpp and are other deletion targets to generate a leaky phenotype. Additionally, leaky phenotypes have been observed when periplasmic proteases are inactivated. The periplasm is very densely packed with protein and therefore encode several periplasmic proteins to facilitate protein turnover. Removal of periplasmic proteases such as degS, degP or nlpl can induce leaky phenotypes by promoting an excessive build-up of periplasmic protein. Mutation of the proteases can also preserve the EGF polypeptide by preventing targeted degradation by these proteases.
- the engineered bacteria have one or more deleted or mutated membrane genes.
- the engineered bacteria have a deleted or mutated lpp gene.
- the engineered bacteria have one or more deleted or mutated gene(s), selected from ompA, ompA, and ompF genes.
- the engineered bacteria have one or more deleted or mutated gene(s), selected from tolA, tolB, and pal genes, in some embodiments, the engineered bacteria have one or more deleted or mutated periplasmic protease genes.
- the engineered bacteria have one or more deleted or mutated periplasmic protease genes selected from degS, degP, and nlpl. In some embodiments, the engineered bacteria have one or more deleted or mutated gene(s), selected from lpp, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl genes.
- the leaky phenotype can be made inducible by placing one or more membrane or periplasmic protease genes, e.g.. selected from lpp, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl, under the control of an inducible promoter.
- membrane or periplasmic protease genes e.g.. selected from lpp, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl
- expression of lpp or other cell wall stability protein or periplasmic protease can be repressed in conditions where EGF needs to be delivered (secreted).
- a transcriptional repressor protein or a designed antisense RNA can be expressed which reduces transcription or translation of a target membrane or periplasmic protease gene.
- over expression of certain peptides can result in a destabilized phenotype, e.g., overexpression of colicins or the third topological domain of TolA, wherein peptide overexpression can be induced in conditions in which EGF needs to be delivered (secreted).
- These sorts of strategies would decouple the fragile, leaky phenotypes from biomass production.
- the engineered bacteria have one or more membrane and/or periplasmic protease genes under the control of an inducible promoter.
- Table 11 and Table 12 below lists secretion systems for Gram-positive bacteria and Gram- negative bacteria.
- the recombinant bacterial comprise a native or non-native secretion system described herein for the secretion of a molecule, e.g.. a cytokine, antibody (e.g.. scFv), metabolic enzyme, e.g., kynureninase, an others described herein.
- a molecule e.g.. a cytokine, antibody (e.g.. scFv), metabolic enzyme, e.g., kynureninase, an others described herein.
- Polypeptide Sequences of exemplary secretion tags include PhoA (SEQ ID NO: 136), PhoA (SEQ ID NO: 137), OmpF (SEQ ID NO: 138), cvaC (SEQ ID NO: 139), TorA (SEQ ID NO: 140), fdnG (SEQ ID NO: 141), dmsA (SEQ ID NO: 142), PelB (SEQ ID NO: 143), HlyA secretion signal (SEQ ID NOs: 144 and 145), and PelB (SEQ ID NO: 161).
- secretion tags of endogenous secreted proteins from E. coll can be used to secrete EGF.
- Exemplary secretion tags from secreted E coll Nissle include ECOLIN_05715 Secretion signal (SEQ ID NO: 146), ECOLIN_16495 Secretion signal (SEQ ID NO: 147), ECOLIN_19410 Secretion signal (SEQ ID NO: 148), and ECOLIN_19880 Secretion signal (SEQ ID NO: 149).
- Additional secretion tags include adhesion (SEQ ID NOS: 149 and 150), DsbA (SEQ ID NOS: 151 and 152), GltI (SEQ ID NOS: 153 and 154), GspD (SEQ ID NOS: 147 and 155), HdeB (SEQ ID NOS: 148 and 156), MalE (SEQ ID NOS: 157 and 158), OppA (SEQ ID NOS: 159 and 160), PelB (SEQ ID NOS: 161 and 162), PhoA (SEQ ID NOS: 136 and 163) and PpiA (SEQ ID NOS: 164 and 165).
- recombinant bacteria comprise a nucleic acid sequence that encodes a polypeptide which is at least about 80%, 85%, 90%, 95%, or 99% homologous to one or more of the sequences of SEQ ID NOS: 136-165, or a nucleic acid sequence which is at least about 80%, 85%, 90%, 95%, or 99% homologous to one or more of the sequences of SEQ ID NOS: 136-165.
- Any secretion tag or secretion system can be combined with any cytokine described herein, and can be used to generate a construct (plasmid based or integrated) which is driven by a directly or indirectly inducible or constitutive promoter described herein.
- the secretion system is used in combination with one or more genomic mutations, which leads to the leaky or diffusible outer membrane phenotype (DOM), including but not limited to, Ipp, nlP, tolA, pal.
- DOM leaky or diffusible outer membrane phenotype
- the secretion system is selected from the type I (e.g., hemolysin secretion system), type II, type III, type III flagellar, type IV, type V, type VI, type VII, type VIII secretion systems and modifications thereof, e.g., modified type III, modified type III flagellar secretion systems, resistance-nodulation-division (RND) multi-drug efflux pumps, a single membrane secretion system, Sec and, TAT secretion systems.
- type I e.g., hemolysin secretion system
- type II e.g., hemolysin secretion system
- type II e.g., type III flagellar
- type IV e.g., type IV, type V, type VI, type VII, type VIII secretion systems
- modifications thereof e.g., modified type III, modified type III flagellar secretion systems, resistance-nodulation-division (RND) multi-drug efflux pumps, a single membrane secreti
- EGF secreted by the recombinant bacteria is modified to increase resistance to proteases, e.g., intestinal proteases.
- the genetically engineered microorganisms are capable of expressing any one or more of the described circuits in low-oxygen conditions, and/or in the gut, or tissue specific molecules or metabolites, and/or in the presence of molecules or metabolites associated with inflammation or immune suppression, and/or in the presence of metabolites that may be present in the gut, and/or in the presence of metabolites that may or may not be present in vivo, and may be present in vitro during strain culture, expansion, production and/or manufacture, such as arabinose and others described herein.
- the gene sequences(s) are controlled by a promoter inducible by such conditions and/or inducers.
- the gene sequences(s) are controlled by a constitutive promoter, as described herein. In some embodiments, the gene sequences(s) are controlled by a constitutive promoter, and are expressed in in vivo conditions and/or in vitro conditions, e.g., during expansion, production and/or manufacture, as described herein.
- any one or more of the described circuits are present on one or more plasmids (e.g., high copy or low copy) or are integrated into one or more sites in the microorganism’s chromosome.
- the genetically engineered microorganisms are further capable of expressing any one or more of the described circuits and further comprise one or more of the following: (1) one or more auxotrophies, such as any auxotrophies known in the art and provided herein, e.g., thyA auxotrophy, (2) one or more kill switch circuits, such as any of the kill-switches described herein or otherwise known in the art, (3) one or more antibiotic resistance circuits, (4) one or more transporters for importing biological molecules or substrates, such any of the transporters described herein or otherwise known in the art, (5) one or more secretion circuits, such as any of the secretion circuits described herein and otherwise known in the art, (6) one or more surface display circuits, such
- EGF secreted using components of the flagellar type III secretion system is secreted via Type I Hemolysin Secretion, is assembled behind a fliC-5’UTR (e.g., 173-bp untranslated region from the fliC loci), and is driven by the native promoter.
- the expression of EGF secreted using components of the flagellar type III secretion system is driven by a tet-inducible promoter.
- an inducible promoter such as oxygen level-dependent promoters (e.g., FNR-inducible promoter), promoters induced by IBD specific molecules or promoters induced by inflammation or an inflammatory response (RNS, ROS promoters), and promoters induced by a metabolite that may or may not be naturally present (e.g., can be exogenously added) in the gut, e.g., arabinose is used.
- EGF is expressed from a plasmid (e.g., a medium copy plasmid).
- EGF is expressed from a construct which is integrated into fliC locus (thereby deleting fliC) , where it is driven by the native FliC promoter.
- an N terminal part of FliC e.g., the first 20 amino acids of FliC is included in the construct, to further increase secretion efficiency.
- EGF is secreted via Type I Hemolysin Secretion, are secreted using via a diffusible outer membrane (DOM) system.
- EGF is fused to a N-terminal Sec-dependent secretion signal.
- Non-limiting examples of such N-terminal Sec-dependent secretion signals include Pho A, OmpF, OmpA, and cvaC.
- EGF is fused to a Tat- dependent secretion signal.
- Exemplary Tat-dependent tags include TorA, FdnG, and DmsA.
- the recombinant bacteria comprise deletions or mutations in one or more of the outer membrane and/or periplasmic proteins.
- Non-limiting examples of such proteins, one or more of which may be deleted or mutated include Ipp, pal, tolA, and/or nlpl.
- Ipp is deleted or mutated.
- pal is deleted or mutated.
- tolA is deleted or mutated.
- nlpl is deleted or mutated.
- certain periplasmic proteases are deleted or mutated, e.g., to increase stability of the polypeptide in the periplasm.
- Non-limiting examples of such proteases include degP and ompT.
- degP is deleted or mutated.
- ompT is deleted or mutated.
- degP and ompT are deleted or mutated.
- EGF is secreted via Type I Hemolysin Secretion, are secreted via a Type V Auto-secreter (pic Protein) Secretion.
- EGF is expressed as a fusion protein with the native Nissle auto-secreter E. coli_01635 (where the original passenger protein is replaced by EGF.
- EGF is secreted via Type I Hemolysin Secretion, are secreted via Type I Hemolysin Secretion.
- EGF is expressed as fusion protein with the 53 amino acids of the C terminus of alpha-hemolysin (hlyA) of E. coll CFT073.
- essential gene refers to a gene which is necessary to for cell growth and/or survival.
- Bacterial essential genes are well known to one of ordinary skill in the art, and can be identified by directed deletion of genes and/or random mutagenesis and screening (see, e.g., Zhang, 2009, Nucl. Acids Res., 37:D455-D458 and Gerdes et al., Curr. Opin. Biotechnol., 17(5):448-456, the entire contents of each reference are incorporated herein by reference).
- An “essential gene” may be dependent on the circumstances and environment in which an organism lives. For example, a mutation of, modification of, or excision of an essential gene may result in the recombinant bacteria of the disclosure becoming an auxotroph.
- An auxotrophic modification is intended to cause bacteria to die in the absence of an exogenously added nutrient essential for survival or growth because they lack the gene(s) necessary to produce that essential nutrient.
- an auxotrophic modification is intended to cause bacteria to die in the absence of an exogenously added nutrient essential for survival or growth because they lack the gene(s) necessary to produce that essential nutrient.
- any of the recombinant bacteria described herein also comprise a deletion or mutation in a gene required for cell survival and/or growth.
- the essential gene is a DNA synthesis gene, for example, thyA.
- the essential gene is a cell wall synthesis gene, for example, dapA.
- the essential gene is an amino acid gene, for example, serA or MetA.
- Any gene required for cell survival and/or growth may be targeted, including but not limited to, cysE, gin A, ilvD, leuB, lysA, serA, metA, glyA, hisB, ilvA, pheA, proA, thrC, trpC, tyrA, thyA, uraA, dapA, dapB, dapD, dapE, dapF, flhD, metB, metC, pro AB, and thil, as long as the corresponding wild-type gene product is not produced in the bacteria.
- Table 14 lists exemplary bacterial genes which may be disrupted or deleted to produce an auxotrophic strain. These include, but are not limited to, genes required for oligonucleotide synthesis, amino acid synthesis, and cell wall synthesis. Table 14. Non-limiting Examples of Bacterial Genes Useful for Generation of an Auxotroph
- Table 15 shows the survival of various amino acid auxotrophs in the mouse gut, as detected 24 hrs and 48 hrs post-gavage. These auxotrophs were generated using BW25113, a non-Nissle strain of E. coli.
- thymine is a nucleic acid that is required for bacterial cell growth; in its absence, bacteria undergo cell death.
- the thyA gene encodes thimidylate synthetase, an enzyme that catalyzes the first step in thymine synthesis by converting dUMP to dTMP (Sat et al., 2003).
- the bacterial cell of the disclosure is a thyA auxotroph in which the thyA gene is deleted and/or replaced with an unrelated gene.
- a thyA auxotroph can grow only when sufficient amounts of thymine are present, e.g., by adding thymine to growth media in vitro, or in the presence of high thymine levels found naturally in the human gut in vivo.
- the bacterial cell of the disclosure is auxotrophic in a gene that is complemented when the bacterium is present in the mammalian gut. Without sufficient amounts of thymine, the thyA auxotroph dies.
- the auxotrophic modification is used to ensure that the bacterial cell does not survive in the absence of the auxotrophic gene product (e.g., outside of the gut).
- Diaminopimelic acid is an amino acid synthetized within the lysine biosynthetic pathway and is required for bacterial cell wall growth (Meadow et al., 1959; Clarkson et al., 1971).
- any of the recombinant bacteria described herein is a dapD auxotroph in which dapD is deleted and/or replaced with an unrelated gene.
- a dapD auxotroph can grow only when sufficient amounts of DAP are present, e.g., by adding DAP to growth media in vitro. Without sufficient amounts of DAP, the dapD auxotroph dies.
- the auxotrophic modification is used to ensure that the bacterial cell does not survive in the absence of the auxotrophic gene product (e.g., outside of the gut).
- the recombinant bacterium of the present disclosure is a uraA auxotroph in which uraA is deleted and/or replaced with an unrelated gene.
- the uraA gene codes for UraA, a membrane-bound transporter that facilitates the uptake and subsequent metabolism of the pyrimidine uracil (Andersen et al., 1995).
- a uraA auxotroph can grow only when sufficient amounts of uracil are present, e.g., by adding uracil to growth media in vitro. Without sufficient amounts of uracil, the uraA auxotroph dies.
- auxotrophic modifications are used to ensure that the bacteria do not survive in the absence of the auxotrophic gene product (e.g., outside of the gut).
- an auxotrophic bacterial strain may receive DNA from a non- auxotrophic strain, which repairs the genomic deletion and permanently rescues the auxotroph. Therefore, engineering a bacterial strain with more than one auxotroph may greatly decrease the probability that DNA transfer will occur enough times to rescue the auxotrophy.
- the recombinant bacteria comprise a deletion or mutation in two or more genes required for cell survival and/or growth.
- essential genes include, but are not limited to yhbV, yagG, hemB, secD, secF, ribD, ribE, thiL, dxs, ispA, dnaX, adk, hemH, IpxH, cysS, fold, rplT, infC, thrS, nadE, gapA, yeaZ, aspS, argS, pgsA, yefM, metG, folE, yejM, gyrA, nrdA, nrdB, folC, accD, fabB, gltX, ligA, zipA, dapE, dapA, der, hisS, ispG, suhB, tadA, acpS, era, rnc, ftsB, eno, pyrG, chpR, Ig
- the recombinant bacterium of the present disclosure is a synthetic ligand-dependent essential gene (SLiDE) bacterial cell.
- SLiDE bacterial cells are synthetic auxotrophs with a mutation in one or more essential genes that only grow in the presence of a particular ligand (see Lopez and Anderson, ACS Synthetic Biology (2015), the entire contents of which are expressly incorporated herein by reference).
- the SLiDE bacterial cell comprises a mutation in an essential gene.
- the essential gene is selected from the group consisting of pheS, dnaN, tyrS, metG, and adk.
- the essential gene is dnaN comprising one or more of the following mutations: H191N, R240C, I317S, F319V, L340T, V347I, and S345C.
- the essential gene is dnaN comprising the mutations H191N, R240C, I317S, F319V, L340T, V347I, and S345C.
- the essential gene is pheS comprising one or more of the following mutations: F125G, P183T, P184A, R186A, and I188L. In some embodiments, the essential gene is pheS comprising the mutations F125G, P183T, P184A, R186A, and I188L. In some embodiments, the essential gene is tyrS comprising one or more of the following mutations: L36V, C38A and F40G. In some embodiments, the essential gene is tyrS comprising the mutations L36V, C38A and F40G. In some embodiments, the essential gene is metG comprising one or more of the following mutations: E45Q, N47R, I49G, and A51C.
- the essential gene is metG comprising the mutations E45Q, N47R, I49G, and A51C. In some embodiments, the essential gene is adk comprising one or more of the following mutations: I4L, L5I and L6G. In some embodiments, the essential gene is adk comprising the mutations I4L, L5I and L6G.
- the recombinant bacterium is complemented by a ligand.
- the ligand is selected from the group consisting of benzothiazole, indole, 2- aminobenzothiazole, indole-3 -butyric acid, indole-3-acetic acid, and L-histidine methyl ester.
- bacterial cells comprising mutations in metG are complemented by benzothiazole, indole, 2-aminobenzothiazole, indole-3 -butyric acid, indole-3 -acetic acid or L-histidine methyl ester.
- Bacterial cells comprising mutations in dnaN are complemented by benzothiazole, indole or 2- aminobenzothiazole.
- Bacterial cells comprising mutations in pheS are complemented by benzothiazole or 2-aminobenzothiazole.
- Bacterial cells comprising mutations in tyrS are complemented by benzothiazole or 2- aminobenzothiazole.
- Bacterial cells comprising mutations in adk I4L, L5I and L6G are complemented by benzothiazole or indole.
- the recombinant bacterium comprises more than one mutant essential gene that renders it auxotrophic to a ligand.
- the bacterial cell comprises mutations in two essential genes.
- the bacterial cell comprises mutations in tyrS (L36V, C38A, and F40G) and metG (E45Q, N47R, I49G, and A51C).
- the bacterial cell comprises mutations in three essential genes.
- the bacterial cell comprises mutations in tyrS (L36V, C38A, and F40G), metG (E45Q, N47R, I49G, and A51C), and pheS (F125G, P183T, P184A, R186A, and I188L).
- the recombinant bacterium is a conditional auxotroph, wherein the expression of a heterologous gene is activated by an exogenous environmental signal.
- the recombinant bacterium is a conditional auxotroph whose essential gene(s) is replaced using an arabinose system.
- the AraC transcription factor adopts a conformation that represses transcription of the essential gene under the control of the araBAD promoter and the bacterial cell cannot survive.
- the AraC transcription factor undergoes a conformational change that allows it to bind to and activate the araBAD promoter, which induces expression of the essential gene and maintains viability of the bacterial cell.
- the recombinant bacterium of the disclosure is an auxotroph and also comprises kill-switch circuitry, such as any of the kill-switch components and systems described herein.
- the recombinant bacteria may comprise a deletion or mutation in an essential gene required for cell survival and/or growth, for example, in a DNA synthesis gene, for example, thy A, cell wall synthesis gene, for example, dapA and/or an amino acid gene, for example, serA or MetA and may also comprise a toxin gene that is regulated by one or more transcriptional activators that are expressed in response to an environmental condition(s) and/or signal(s) (such as the described arabinose system) or regulated by one or more recombinases that are expressed upon sensing an exogenous environmental condition(s) and/or signal(s) (such as the recombinase systems described herein).
- the recombinant bacterium of the disclosure is an auxotroph and also comprises kill-switch circuitry, such as any of the kill-switch components and systems described herein, as well as another biosecurity system, such a conditional origin of replication (Wright et al., 2015).
- auxotrophic modifications may also be used to screen for mutant bacteria that produce the EGF molecule.
- the recombinant bacteria comprise one or more genes providing resistance to antibiotics.
- Antibiotics are substances that kill bacteria (bactericidal), or inhibit bacterial growth (bacteriostatic). Antibiotics may be natural products, many common antibiotics used in labs today are semi-synthetic or fully synthetic compounds.
- An antibiotic resistance gene can be added to a bacterium of interest, either on a plasmid or integrated into the chromosome in conjunction with the EGF gene, allowing the simple detection of bacteria containing the EGF gene by growing the bacteria on selective media containing the antibiotic.
- the recombinant bacteria comprise one or more genes providing resistance to aminoglycosides. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to a beta-lactam. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to glycopeptides. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to macrolides. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to polypeptide antibiotics. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to a tetracycline.
- the recombinant bacteria comprise one or more genes providing resistance to Kanamycin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Spectinomycin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Streptomycin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Ampicillin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Carbenicillin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Bleomycin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Erythromycin.
- the recombinant bacteria comprise one or more genes providing resistance to Polymyxin B. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Tetracycline. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Chloramphenicol.
- the inducible promoter is operably linked to a detectable product, e.g., GFP, and can be used to screen for mutants.
- the inducible promoter is mutagenized, and mutants are selected based upon the level of detectable (L.O.D.) product, e.g., by flow cytometry, fluorescence-activated cell sorting (FACS) when the detectable product fluoresces.
- detectable L.O.D.
- FACS fluorescence-activated cell sorting
- one or more transcription factor binding sites is mutagenized to increase or decrease binding.
- the wild-type binding sites are left intact, and the remainder of the regulatory region is subjected to mutagenesis.
- the mutant promoter is inserted into the recombinant bacteria to increase expression of the EGF molecule under inducing conditions, as compared to unmutated bacteria of the same subtype under the same conditions.
- the inducible promoter and/or corresponding transcription factor is a synthetic, non-naturally occurring sequence.
- the gene encoding EGF is mutated to increase expression and/or stability of said molecule under inducing conditions, as compared to unmutated bacteria of the same subtype under the same conditions.
- one or more of the genes in a gene cassette for producing EGF is mutated to increase expression of said molecule under inducing conditions, as compared to unmutated bacteria of the same subtype under the same conditions.
- the efficacy or activity of any of the importers and exporters for metabolites of interest can be improved through mutations in any of these genes.
- Mutations increase uptake or export of such metabolites, including but not limited to, tryptophan, e.g., under inducing conditions, as compared to unmutated bacteria of the same subtype under the same conditions.
- Methods for directed mutation and screening are known in the art.
- compositions comprising one or more recombinant bacteria, alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers are provided.
- the pharmaceutical composition comprises one species, strain, or subtype of bacteria that are engineered to comprise the genetic modifications described herein, e.g., to produce EGF.
- the pharmaceutical composition comprises two or more species, strains, and/or subtypes of bacteria that are each engineered to comprise the genetic modifications described herein, e.g., to produce EGF.
- a combination of two or more different genetically engineered microorganisms can be administered at the same time.
- the method comprises administering a subject a combination of two or more genetically engineered microorganisms, a first microorganism which expresses a first payload, and at least a second microorganism which expresses a second payload.
- the method comprises compositions comprising a combination of two or more genetically engineered microorganisms, a first microorganisms which expresses a first payload, and at least a second microorganism which expresses a second payload.
- compositions described herein may be formulated in a conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into compositions for pharmaceutical use.
- physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into compositions for pharmaceutical use.
- Methods of formulating pharmaceutical compositions are known in the art (see, e.g., "Remington's Pharmaceutical Sciences,” Mack Publishing Co., Easton, PA).
- the pharmaceutical compositions are subjected to tabletting, lyophilizing, direct compression, conventional mixing, dissolving, granulating, levigating, emulsifying, encapsulating, entrapping, or spray drying to form tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated. Appropriate formulation depends on the route of administration.
- the genetically engineered microorganisms may be formulated into pharmaceutical compositions in any suitable dosage form (e.g., liquids, capsules, sachet, hard capsules, soft capsules, tablets, enteric coated tablets, suspension powders, granules, or matrix sustained release formations for oral administration) and for any suitable type of administration (e.g., oral, topical, injectable, intravenous, sub-cutaneous, immediate-release, pulsatile-release, delayed-release, or sustained release).
- suitable dosage form e.g., liquids, capsules, sachet, hard capsules, soft capsules, tablets, enteric coated tablets, suspension powders, granules, or matrix sustained release formations for oral administration
- suitable type of administration e.g., oral, topical, injectable, intravenous, sub-cutaneous, immediate-release, pulsatile-release, delayed-release, or sustained release.
- Suitable dosage amounts for the recombinant bacteria may range from about 10e5 to 10el2 bacteria, e.g., approximately 10e5 bacteria, approximately 10e6 bacteria, approximately 10e7 bacteria, approximately 10e8 bacteria, approximately 10e9 bacteria, approximately 10e10 bacteria, approximately Well bacteria, or approximately 10el2 bacteria.
- the composition may be administered once or more daily, weekly, or monthly.
- the composition may be administered before, during, or following a meal.
- the pharmaceutical composition is administered before the subject eats a meal.
- the pharmaceutical composition is administered concurrently with a meal.
- the pharmaceutical composition is administered after the subject eats a meal.
- the recombinant bacteria may be formulated into pharmaceutical compositions comprising one or more pharmaceutically acceptable carriers, thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, liposomes, penetration enhancers, carrier compounds, and other pharmaceutically acceptable carriers or agents.
- the pharmaceutical composition may include, but is not limited to, the addition of calcium bicarbonate, sodium bicarbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20.
- the recombinant bacteria may be formulated in a solution of sodium bicarbonate, e.g., 1 molar solution of sodium bicarbonate (to buffer an acidic cellular environment, such as the stomach, for example).
- the recombinant bacteria may be administered and formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
- the genetically engineered microorganisms may be administered intravenously, e.g., by infusion or injection.
- the genetically engineered microorganisms of the disclosure may be administered intrathecally.
- the genetically engineered microorganisms may be administered orally.
- the genetically engineered microorganisms disclosed herein may be administered topically and formulated in the form of an ointment, cream, transdermal patch, lotion, gel, shampoo, spray, aerosol, solution, emulsion, or other form well known to one of skill in the art. See, e.g., "Remington's Pharmaceutical Sciences," Mack Publishing Co., Easton, PA.
- viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity greater than water are employed.
- suitable formulations include, but are not limited to, solutions, suspensions, emulsions, creams, ointments, powders, liniments, salves, etc., which may be sterilized or mixed with auxiliary agents (e.g., preservatives, stabilizers, wetting agents, buffers, or salts) for influencing various properties, e.g., osmotic pressure.
- suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g., a gaseous propellant, such as freon) or in a squeeze bottle.
- a pressurized volatile e.g., a gaseous propellant, such as freon
- Moisturizers or humectants can also be added to pharmaceutical compositions and dosage forms. Examples of such additional ingredients are well known in the art.
- the pharmaceutical composition comprising the recombinant bacteria may be formulated as a hygiene product.
- the hygiene product may be an antibacterial formulation, or a fermentation product such as a fermentation broth.
- Hygiene products may be, for example, shampoos, conditioners, creams, pastes, lotions, and lip balms.
- the genetically engineered microorganisms disclosed herein may be administered orally and formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, etc.
- Pharmacological compositions for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores.
- Suitable excipients include, but are not limited to, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose compositions such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carbomethylcellulose; and/or physiologically acceptable polymers such as polyvinylpyrrolidone (PVP) or polyethylene glycol (PEG). Disintegrating agents may also be added, such as cross-linked polyvinylpyrrolidone, agar, alginic acid or a salt thereof such as sodium alginate.
- fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol
- cellulose compositions such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carbo
- Tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinised maize starch, polyvinylpyrrolidone, hydroxypropyl methylcellulose, carboxymethylcellulose, polyethylene glycol, sucrose, glucose, sorbitol, starch, gum, kaolin, and tragacanth); fillers (e.g., lactose, microcrystalline cellulose, or calcium hydrogen phosphate); lubricants (e.g., calcium, aluminum, zinc, stearic acid, polyethylene glycol, sodium lauryl sulfate, starch, sodium benzoate, L-leucine, magnesium stearate, talc, or silica); disintegrants (e.g., starch, potato starch, sodium starch glycolate, sugars, cellulose derivatives, silica powders); or wetting agents (e.g., sodium lauryl sulphate).
- binding agents e.g., pregelatinised
- the tablets may be coated by methods well known in the art.
- a coating shell may be present, and common membranes include, but are not limited to, polylactide, polyglycolic acid, polyanhydride, other biodegradable polymers, alginate - polylysine-alginate (APA), alginate-polymethylene-co-guanidine-alginate (A-PMCG-A), hydroymethylacrylate-methyl methacrylate (HEMA-MMA), multilayered HEMA-MMA-MAA, polyacrylonitrilevinylchloride (PAN-PVC), acrylonitrile/sodium methallylsulfonate (AN-69), polyethylene glycol/poly pentamethylcyclopentasiloxane/polydimethylsiloxane (PEG/PD5/PDMS), poly N,N- dimethyl acrylamide (PDMAAm), siliceous encapsulates, cellulose sulphate/sodium alginate/polymethylene-co
- the genetically engineered microorganisms are enterically coated for release into the gut or a particular region of the gut, for example, the large intestine.
- the typical pH profile from the stomach to the colon is about 1-4 (stomach), 5.5-6 (duodenum), 7.3-8.0 (ileum), and 5.5-6.5 (colon).
- the pH profile may be modified.
- the coating is degraded in specific pH environments in order to specify the site of release.
- at least two coatings are used.
- the outside coating and the inside coating are degraded at different pH levels.
- Liquid preparations for oral administration may take the form of solutions, syrups, suspensions, or a dry product for constitution with water or other suitable vehicle before use.
- Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable agents such as suspending agents (e.g., sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid).
- the preparations may also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate.
- Preparations for oral administration may be suitably formulated for slow release, controlled release, or sustained release of the genetically engineered microorganisms described herein.
- the genetically engineered microorganisms of the disclosure may be formulated in a composition suitable for administration to pediatric subjects.
- a composition suitable for administration to pediatric subjects may include easy-to-swallow or dissolvable dosage forms, or more palatable compositions, such as compositions with added flavors, sweeteners, or taste blockers.
- a composition suitable for administration to pediatric subjects may also be suitable for administration to adults.
- the composition suitable for administration to pediatric subjects may include a solution, syrup, suspension, elixir, powder for reconstitution as suspension or solution, dispersible/effervescent tablet, chewable tablet, gummy candy, lollipop, freezer pop, troche, chewing gum, oral thin strip, orally disintegrating tablet, sachet, soft gelatin capsule, sprinkle oral powder, or granules.
- the composition is a gummy candy, which is made from a gelatin base, giving the candy elasticity, desired chewy consistency, and longer shelf-life.
- the gummy candy may also comprise sweeteners or flavors.
- the composition suitable for administration to pediatric subjects may include a flavor.
- flavor is a substance (liquid or solid) that provides a distinct taste and aroma to the formulation. Flavors also help to improve the palatability of the formulation. Flavors include, but are not limited to, strawberry, vanilla, lemon, grape, bubble gum, and cherry.
- the genetically engineered microorganisms may be orally administered, for example, with an inert diluent or an assimilable edible carrier.
- the compound may also be enclosed in a hard- or soft-shell gelatin capsule, compressed into tablets, or incorporated directly into the subject’s diet.
- the compounds may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like.
- the pharmaceutical composition comprising the recombinant bacteria may be a comestible product, for example, a food product.
- the food product is milk, concentrated milk, fermented milk (yogurt, sour milk, frozen yogurt, lactic acid bacteria- fermented beverages), milk powder, ice cream, cream cheeses, dry cheeses, soybean milk, fermented soybean milk, vegetable-fruit juices, fruit juices, sports drinks, confectionery, candies, infant foods (such as infant cakes), nutritional food products, animal feeds, or dietary supplements.
- the food product is a fermented food, such as a fermented dairy product.
- the fermented dairy product is yogurt.
- the fermented dairy product is cheese, milk, cream, ice cream, milk shake, or kefir.
- the recombinant bacteria are combined in a preparation containing other live bacterial cells intended to serve as probiotics.
- the food product is a beverage.
- the beverage is a fruit juice-based beverage or a beverage containing plant or herbal extracts.
- the food product is a jelly or a pudding.
- Other food products suitable for administration of the recombinant bacteria are well known in the art. For example, see U.S. 2015/0359894 and US 2015/0238545, the entire contents of each of which are expressly incorporated herein by reference.
- the pharmaceutical composition is injected into, sprayed onto, or sprinkled onto a food product, such as bread, yogurt, or cheese.
- the composition is formulated for intraintestinal administration, intrajejunal administration, intraduodenal administration, intraileal administration, gastric shunt administration, or intracolic administration, via nanoparticles, nanocapsules, microcapsules, or microtablets, which are enterically coated or uncoated.
- the pharmaceutical compositions may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides.
- the compositions may be suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain suspending, stabilizing and/or dispersing agents.
- the genetically engineered microorganisms described herein may be administered intranasally, formulated in an aerosol form, spray, mist, or in the form of drops, and conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant (e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas).
- Pressurized aerosol dosage units may be determined by providing a valve to deliver a metered amount.
- Capsules and cartridges (e.g., of gelatin) for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
- the genetically engineered microorganisms may be administered and formulated as depot preparations. Such long acting formulations may be administered by implantation or by injection, including intravenous injection, subcutaneous injection, local injection, direct injection, or infusion.
- the compositions may be formulated with suitable polymeric or hydrophobic materials (e.g., as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives (e.g., as a sparingly soluble salt).
- Single dosage forms may be in a liquid or a solid form.
- Single dosage forms may be administered directly to a patient without modification or may be diluted or reconstituted prior to administration.
- a single dosage form may be administered in bolus form, e.g., single injection, single oral dose, including an oral dose that comprises multiple tablets, capsule, pills, etc.
- a single dosage form may be administered over a period of time, e.g., by infusion.
- Single dosage forms of the pharmaceutical composition may be prepared by portioning the pharmaceutical composition into smaller aliquots, single dose containers, single dose liquid forms, or single dose solid forms, such as tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated.
- a single dose in a solid form may be reconstituted by adding liquid, typically sterile water or saline solution, prior to administration to a patient.
- the composition can be delivered in a controlled release or sustained release system. In one embodiment, a pump may be used to achieve controlled or sustained release.
- polymeric materials can be used to achieve controlled or sustained release of therapies of the present disclosure (see e.g., U.S. Patent No. 5,989,463).
- examples of polymers used in sustained release formulations include, but are not limited to, poly(2-hydroxy ethyl methacrylate), poly(methyl methacrylate), poly(acrylic acid), poly(ethylene-co-vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N- vinyl pyrrolidone), poly(vinyl alcohol), polyacrylamide, poly(ethylene glycol), polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and poly orthoesters.
- the polymer used in a sustained release formulation may be inert, free of leachable impurities, stable on storage, sterile, and biodegradable.
- a controlled or sustained release system can be placed in proximity of the prophylactic or therapeutic target, thus requiring only a fraction of the systemic dose. Any suitable technique known to one of skill in the art may be used.
- Dosage regimens may be adjusted to provide a therapeutic response. Dosing can depend on several factors, including severity and responsiveness of the disease, route of administration, time course of treatment (days to months to years), and time to amelioration of the disease. For example, a single bolus may be administered at one time, several divided doses may be administered over a predetermined period of time, or the dose may be reduced or increased as indicated by therapeutic situation. The specification for the dosage is dictated by the unique characteristics of the active compound and the particular therapeutic effect to be achieved. Dosage values may vary with the type and severity of the condition to be alleviated. For any particular subject, specific dosage regimens may be adjusted over time according to the individual need and the professional judgment of the treating clinician.
- Toxicity and therapeutic efficacy of compounds provided herein can be determined by standard pharmaceutical procedures in cell culture or animal models. For example, LD50, ED50, EC50, and IC50 may be determined, and the dose ratio between toxic and therapeutic effects (LD50/ED50) may be calculated as therapeutic index. Compositions that exhibit toxic side effects may be used, with careful modifications to minimize potential damage to reduce side effects. Dosing may be estimated initially from cell culture assays and animal models. The data obtained from in vitro and in vivo assays and animal studies can be used in formulating a range of dosage for use in humans.
- the ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampoule or sachet indicating the quantity of active agent. If the mode of administration is by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
- the pharmaceutical compositions may be packaged in a hermetically sealed container such as an ampoule or sachet indicating the quantity of the agent.
- a hermetically sealed container such as an ampoule or sachet indicating the quantity of the agent.
- one or more of the pharmaceutical compositions is supplied as a dry sterilized lyophilized powder or water-free concentrate in a hermetically sealed container and can be reconstituted (e.g., with water or saline) to the appropriate concentration for administration to a subject.
- one or more of the prophylactic or therapeutic agents or pharmaceutical compositions is supplied as a dry sterile lyophilized powder in a hermetically sealed container stored between 2° C and 8° C and administered within 1 hour, within 3 hours, within 5 hours, within 6 hours, within 12 hours, within 24 hours, within 48 hours, within 72 hours, or within one week after being reconstituted.
- Cryoprotectants can be included for a lyophilized dosage form, principally 0-10% sucrose (optimally 0.5- 1.0%).
- Other suitable cryoprotectants include trehalose and lactose.
- Suitable bulking agents include glycine and arginine, either of which can be included at a concentration of 0-0.05%, and polysorbate-80 (optimally included at a concentration of 0.005-0.01%).
- Additional surfactants include but are not limited to polysorbate 20 and BRIJ surfactants.
- the pharmaceutical composition may be prepared as an injectable solution and can further comprise an agent useful as an adjuvant, such as those used to increase absorption or dispersion, e.g., hyaluronidase.
- Another aspect provides methods of treating autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, neurological or neurodegenerative diseases, diarrheal diseases, IBD, related diseases, and other diseases that benefit from reduced gut inflammation and/or enhanced gut barrier function.
- the invention provides for the use of at least one genetically engineered species, strain, or subtype of bacteria described herein for the manufacture of a medicament.
- the invention provides for the use of at least one genetically engineered species, strain, or subtype of bacteria described herein for the manufacture of a medicament for treating autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, neurological or neurodegenerative diseases, diarrheal diseases, IBD, related diseases, and other diseases that benefit from reduced gut inflammation and/or enhanced gut barrier function.
- the invention provides at least one genetically engineered species, strain, or subtype of bacteria described herein for use in treating autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, neurological or neurodegenerative diseases, diarrheal diseases, IBD, related diseases, and other diseases that benefit from reduced gut inflammation and/or enhanced gut barrier function.
- the diarrheal disease is selected from the group consisting of acute watery diarrhea, e.g., cholera, acute bloody diarrhea, e.g., dysentery, and persistent diarrhea.
- the IBD or related disease is selected from the group consisting of Crohn’s disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, diversion colitis, Behcet’ s disease, intermediate colitis, short bowel syndrome, ulcerative proctitis, proctosigmoiditis, left-sided colitis, pancolitis, gastric ulcers, duodenal ulcers, and fulminant colitis.
- the disease or condition is an autoimmune disorder selected from the group consisting of acute disseminated encephalomyelitis (ADEM), acute necrotizing hemorrhagic leukoencephalitis, Addison’ s disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune angioedema, autoimmune aplastic anemia, autoimmune dysautonomia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear disease (AIED), autoimmune myocarditis, autoimmune oophoritis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura (ATP), autoimmune thyroid disease, autoimmune urticarial, axonal & neuronal neuro
- ADAM acute disse
- the invention provides methods for reducing, ameliorating, or eliminating one or more symptom(s) associated with these diseases, including but not limited to diarrhea, bloody stool, mouth sores, perianal disease, abdominal pain, abdominal cramping, fever, fatigue, weight loss, iron deficiency, anemia, appetite loss, weight loss, anorexia, delayed growth, delayed pubertal development, and inflammation of the skin, eyes, joints, liver, and bile ducts.
- the invention provides methods for reducing gut inflammation and/or enhancing gut barrier function, thereby ameliorating or preventing a systemic autoimmune disorder, e.g., asthma (Arrieta et al., 2015).
- the method may comprise preparing a pharmaceutical composition with at least one genetically engineered species, strain, or subtype of bacteria described herein, and administering the pharmaceutical composition to a subject in a therapeutically effective amount.
- the pharmaceutical composition described herein is administered to reduce gut inflammation, enhance gut barrier function, and/or treat or prevent an autoimmune disorder in a subject.
- the methods of the present disclosure may reduce gut inflammation in a subject by at least about 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or more as compared to levels in an untreated or control subject.
- the methods of the present disclosure may enhance gut barrier function in a subject by at least about 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or more as compared to levels in an untreated or control subject.
- changes in inflammation and/or gut barrier function are measured by comparing a subject before and after administration of the pharmaceutical composition.
- the method of treating or ameliorating the autoimmune disorder and/or the disease or condition associated with gut inflammation and/or compromised gut barrier function allows one or more symptoms of the disease or condition to improve by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more.
- reduction is measured by comparing the levels of inflammation in a subject before and after administration of the pharmaceutical composition.
- the levels of inflammation is reduced in the gut of the subject.
- gut barrier function is enhanced in the gut of the subject.
- levels of inflammation is reduced in the blood of the subject.
- the levels of inflammation is reduced in the plasma of the subject.
- levels of inflammation is reduced in the brain of the subject.
- the pharmaceutical composition described herein is administered to reduce levels of inflammation in a subject to normal levels.
- the pharmaceutical composition described herein is administered to reduce levels of inflammation in a subject below normal.
- the method of treating the autoimmune disorder allows one or more symptoms of the condition or disorder to improve by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more. In some embodiments, the method of treating the disorder, allows one or more symptoms of the condition or disorder to improve by at least about two-fold, three-fold, four-fold, five-fold, six-fold, seven-fold, eight-fold, nine-fold, or ten-fold.
- gut inflammation and/or barrier function in the subject may be measured in a biological sample, such as blood, serum, plasma, urine, fecal matter, peritoneal fluid, intestinal mucosal scrapings, a sample collected from a tissue, and/or a sample collected from the contents of one or more of the following: the stomach, duodenum, jejunum, ileum, cecum, colon, rectum, and anal canal.
- the methods may include administration of the compositions to enhance gut barrier function and/or to reduce gut inflammation to baseline levels, e.g., levels comparable to those of a healthy control, in a subject.
- the methods may include administration of the compositions to reduce gut inflammation to undetectable levels in a subject, or to less than about 1%, 2%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, or 80% of the subject’s levels prior to treatment.
- the methods may include administration of the compositions to enhance gut barrier function in a subject by about 1%, 2%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 90%, 100% or more of the subject’s levels prior to treatment.
- the recombinant bacteria are E. coll Nissle.
- the recombinant bacteria may be destroyed, e.g., by defense factors in the gut or blood serum (Sonnenborn et al., 2009) or by activation of a kill switch, several hours or days after administration.
- the pharmaceutical composition comprising the recombinant bacteria may be re-administered at a therapeutically effective dose and frequency.
- the recombinant bacteria are not destroyed within hours or days after administration and may propagate and colonize the gut.
- the pharmaceutical composition may be administered alone or in combination with one or more additional therapeutic agents, e.g., corticosteroids, aminosalicylates, anti-inflammatory agents.
- the pharmaceutical composition is administered in conjunction with an anti- inflammatory drug (e.g., mesalazine, prednisolone, methylprednisolone, butesonide), an immunosuppressive drug (e.g., azathioprine, 6-mercaptopurine, methotrexate, cyclosporine, tacrolimus), an antibiotic (e.g., metronidazole, ornidazole, clarithromycin, rifaximin, ciprofloxacin, anti-TB), other probiotics, and/or biological agents (e.g., infliximab, adalimumab, certolizumab pegol) (Triantafillidis et al., 2011).
- an anti- inflammatory drug e.g., mesalazine
- the agent(s) should be compatible with the recombinant bacteria, e.g., the agent(s) must not kill the bacteria.
- the bacterial cells disclosed herein are administered to a subject once daily.
- the bacterial cells disclosed herein are administered to a subject twice daily.
- the bacterial cells disclosed herein are administered to a subject in combination with a meal, prior to a meal, or after a meal.
- the dosage of the pharmaceutical composition and the frequency of administration may be selected based on the severity of the symptoms and the progression of the disease. The appropriate therapeutically effective dose and/or frequency of administration can be selected by a treating clinician.
- the recombinant bacteria may be destroyed, e.g., by defense factors in tissues or blood serum (Sonnenborn et al., 2009), or by activation of a kill switch, several hours or days after administration.
- the pharmaceutical composition comprising the gene or gene cassette for producing the EGF molecule may be re-administered at a therapeutically effective dose and frequency.
- CpG DNA as a vaccine adjuvant.
- ODNs oligodeoxynucleotides
- CpG ODNs improve the function of professional antigen-presenting cells and boost the generation of humoral and cellular vaccine-specific immune responses.
- CpG can be administered in combination with the genetically engineered bacteria of the invention.
- the dosage of the pharmaceutical composition and the frequency of administration may be selected based on the severity of the symptoms and the progression of the disease or disorder.
- the appropriate therapeutically effective dose and the frequency of administration can be selected by a treating clinician.
- the human epidermal growth factor (hEGF) cDNA sequence was sourced from NCBI accession number: gq214314.1 and codon optimized for expression in E. coll. Sec secretion signal - hEGF fusion protein sequences were designed by adding the codon optimized hEGF sequence to the N-terminal sec secretion signal sequence of PhoA (21 amino acids), PelB (22 amino acids), or OmpA (21 amino acids).
- dsDNA encoding each fusion protein open reading frame was synthesized with the addition of a strong 5’ ribosome binding site (RBS) upstream of the start codon and 20 bp flanking homology to an expression vector containing apl5a origin of replication, kanamycin resistance cassette, and the PfnrS promoter from the fumarate and nitrate reductase gene S in E. coli Nissle.
- RBS ribosome binding site
- a second set of expression constructs was created by synthesizing each fusion protein downstream of the cI857 temperature responsive promoter and corresponding repressor protein derived from lambda phage, a 5’ RBS, and 20 bp flanking homology. Synthesized expression constructs were introduced into an expression vector containing a pl5a origin of replication and kanamycin resistance cassette using Gibson assembly methods to yield (pl5a_Kan_cI857_PhoA- EGF), (pl5a_Kan_cI857_PelB-EGF), and (pl5a_Kan_cI857_OmpA-EGF).
- prtD ATP-binding cassette
- prtE membrane fusion protein
- prtF outer membrane protein
- a diffusible outer membrane (DOM) phenotype in the E. coli Nissle background was engineered by deleting the gene encoding the periplasmic protein pal. This alteration results in an increased rate of diffusion of periplasmic proteins to the external environment without compromising cell growth properties.
- the resulting “leaky membrane” chassis strain is designated SYN1557.
- Each expression plasmid was introduced into either SYN094, a wild type E. coli Nissle strain, or SYN1557, E. coli Nissle containing a deletion of the pal gene (DOM), generating strains SYN7881-SYN7886, SYN7838- SYN7839, and SYN9001-SYN9004 (Table 16).
- Cultures were then poured in 50 ml flask and were left for 5 hours in anaerobic chamber to induce the PfnrS promoter. After induction, cultures were spun down for 8 minutes, 8000 RPM, supernatants were filtered with a 0.22 micron PES filter and used for ELISA analysis.
- EGF was measured in bacterial supernatants using a human EGF specific ELISA kit from R&D systems as per the manufacturer’s instructions (Cat. number DY236). Briefly, supernatants are diluted into the working range of the assay, added to wells coated with a monoclonal mouse anti- human EGF antibody specific for human EGF and incubated for one hour. Following a wash step, a polyclonal biotinylated goat anti-human EGF antibody is added and incubated for two hours. Following a second wash step, streptavidin-horseradish peroxidase is added and incubated for 20 minutes.
- HCT116 ATCC, cat. number CCL-247
- HT29 cells ATCC, cat. number HTB-38
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Chemical & Material Sciences (AREA)
- General Health & Medical Sciences (AREA)
- Microbiology (AREA)
- Mycology (AREA)
- Medicinal Chemistry (AREA)
- Organic Chemistry (AREA)
- Gastroenterology & Hepatology (AREA)
- Molecular Biology (AREA)
- Veterinary Medicine (AREA)
- Public Health (AREA)
- Animal Behavior & Ethology (AREA)
- Epidemiology (AREA)
- Toxicology (AREA)
- Zoology (AREA)
- Biochemistry (AREA)
- Biophysics (AREA)
- Genetics & Genomics (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Pharmacology & Pharmacy (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
Abstract
Recombinant bacteria capable of producing and secreting therapeutically active epidermal growth factor (EGF), pharmaceutical compositions thereof, and methods of treating disorders are disclosed.
Description
BACTERIA ENGINEERED TO PRODUCE ACTIVE EPIDERMAL GROWTH FACTOR (EGF) AND METHODS OF USE THEREOF
RELATED APPLICATIONS
[0001] The instant application claims priority to U.S. Provisional Application No. 63/415,338, filed on October 12, 2022, entire contents of which is expressly incorporated by reference herein.
SEQUENCE LISTING
[0002] The instant application contains a Sequence Listing which has been submitted electronically in XML format and is hereby incorporated by reference in its entirety. Said XML copy, created on October 12, 2023, is named 126046-07720_SL.xml and is 803,286 bytes in size.
BACKGROUND
[0003] A growing body of scientific evidence suggests that probiotic bacteria are beneficial in the treatment or prevention of various diseases or disorders associated with the gut, including, for example, gastrointestinal disorders such as Crohn’s disease and inflammatory bowel syndrome. More recently, recombinant bacteria have emerged as a potential new therapeutic treatment modality for gastrointestinal diseases and have also opened the field of bacterial therapies to a large number of other indications, including metabolic diseases, and inflammatory diseases. One benefit of recombinant bacteria is the ability to specifically target one or more disease mechanisms. For example, for gastrointestinal disorders, bacteria can be engineered to contain genes for the expression of anti-inflammatory agents or agents that aid in the healing of a disrupted gut-barrier, such as the short chain fatty acid butyrate, e.g., as described in International Patent Publication W02016141108. [0004] Additionally, bacterial therapies have the additional advantage that the size of the bacterial chromosome(s) allows for the insertion of gene(s) for the production and secretion of multiple effectors. Potential secreted polypeptides include signaling molecules, such as cytokines and growth factors, their receptors, and single chain antibodies directed against cell surface molecules, many of which have been proposed as are promising candidates for therapeutic interference in a wide range of indications.
[0005] A certain level of technical understanding of approaches to the secretion of heterologous proteins from bacteria can be gained from recombinant production strategies for therapeutic or other proteins. However, effective protocols for generation of recombinant bacteria which produce and secrete biologically active polypeptides in vivo have yet to be established.
[0006] Multiple conditions must be met for the successful secretion of effective amounts of biologically active polypeptides. In Gram-negative bacteria, secreted polypeptides have to cross the two membranes and a thin layer of peptidoglycan in the periplasmic space between the inner and outer lipid membranes. Type I, II, III, IV, and V secretion pathways are common among Gram-
negative bacteria, and all of these pathways have been exploited for the secretion of recombinant proteins. However, given that secretion of a polypeptide across the inner and outer membranes of a gram-negative bacterium is complex, involving the execution of several steps and the use of different biological factors, a number of complications can arise. For example, problems include incomplete translocation across the inner membrane, insufficient capacity of the export machinery, and proteolytic degradation (Mergulhao et al., Biotechnology Advances 23 (2005) 177-202). In addition, the ability of a polypeptide to be secreted from a Gram-negative bacterium, such as E. coli, depends on the specific polypeptide to be secreted and the biochemical properties thereof, such as formation of correct disulfide bonds, size of protein or levels of expression.
[0007] Given the number of factors involved in secreting polypeptides from Gram-negative bacteria, in combination with factors arising from the different biological properties and characteristics of individual polypeptides, e.g., size, dimer formation, secondary and tertiary protein folding, and polypeptide expression levels, secretion of polypeptides from Gram-negative bacteria remains challenging. Further, even if successful secretion is achieved, the polypeptide is not always secreted in a biologically active form.
[0008] In view of the difficulties outlined here as well as others, there remains a need for engineering and methods for the successful secretion of biologically active polypeptides.
SUMMARY
[0009] The instant disclosure relates to compositions of recombinant bacteria and methods for secreting therapeutically active epidermal growth factor (EGF) from recombinant bacteria for treatment of diseases or disorders. The recombinant bacteria disclosed herein are capable of high yield production of functionally active EGF molecules, which are secreted as therapeutically active EGF polypeptides.
[0010] In some embodiments, the recombinant bacteria are functionally silent until they reach an inducing environment, e.g., a mammalian gut, wherein expression of EGF is induced. In certain embodiments, the recombinant bacteria are naturally non-pathogenic and may be introduced into the gut in order to reduce gut inflammation and/or enhance gut barrier function and may thereby further ameliorate or prevent an autoimmune disorder. In certain embodiments, the secreted EGF molecule is stably produced by the recombinant bacteria, and/or the recombinant bacteria are stably maintained in vivo and/or in vitro. The disclosure also provides pharmaceutical compositions comprising the recombinant bacteria. Methods of treating diseases are also provided.
[0011] In some embodiments, the recombinant bacteria produce EGF under the control of one or more promoters induced by an environmental condition, e.g., an environmental condition found in the mammalian gut, such as an inflammatory condition or a low oxygen condition. In non-limiting exemplary embodiments, the recombinant bacteria produce EGF under the control of an oxygen level- dependent promoter, a reactive oxygen species (ROS)-dependent promoter, a reactive nitrogen species
(RNS) -dependent promoter, or a temperature sensitive promoter, and a corresponding transcription factor.
[0012] In some embodiments, the recombinant bacterium comprises one or more one gene(s) encoding one or more EGF polypeptides for secretion of an active polypeptide in vivo, wherein the one or more gene sequence(s) for producing the EGF polypeptide is operably linked to a directly or indirectly inducible promoter that is not associated with the gene(s) in nature. In some embodiments, the secretion tags are N terminally or C terminally fused to the EGF polypeptides. For example, the secretion tag may be covalently linked to the N terminus of the polypeptide through a peptide bond or polypeptide linker. Alternatively, the secretion tag may be covalently linked to the C terminus of the polypeptide through a peptide bond or polypeptide linker.
[0013] Non-limiting examples of contemplated secretion tags include PhoA, OmpF, ompA, cvaC, TorA, fdnG, dmsA, PelB, tolB, torT, dsbA, Gltl, GspD, HdeB, MalE, mglB, OppA, PpiA, lamb, ECOLIN_05715, ECOLIN_16495, ECOLIN_19410, and ECOLIN_19880 secretion signals. In some embodiments, the secretion tag is cleaved after secretion into the extracellular environment. In some embodiments, the secretion tag is PhoA. In some embodiments, the secretion tag is ECOLIN 19410 secretion tag. In some embodiments, the secretion tag is GspD secretion tag. In some embodiments, the secretion tag is HdeB secretion tag. In some embodiments, the secretion tag is torT secretion tag. [0014] In some embodiments, the recombinant bacteria further have one or more mutations or deletions in an outer membrane protein selected from Ipp, nlP, tolA, and pal. In some embodiments, the fully or partially deleted or mutated outer membrane protein is pal. In some embodiments, the recombinant bacteria further encode a stabilizing polypeptide. In some embodiments, the EGF polypeptide is covalently fused to the stabilizing polypeptide through a peptide linker or a peptide bond.
[0015] In some embodiments, the C terminus of the EGF polypeptide is covalently fused to the N terminus of the stabilizing polypeptide through the peptide linker or peptide bond. In some embodiments, the N terminus of the EGF polypeptide is covalently fused to the C terminus of the stabilizing polypeptide through the peptide linker or peptide bond. In some embodiments, the stabilizing polypeptide comprises an immunoglobulin Fc polypeptide. In some embodiments, the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin heavy chain CH2 constant region. In some embodiments, the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin heavy chain CH3 constant region. In some embodiments, the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin heavy chain CHI constant region. In some embodiments, the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin variable hinge region. In some embodiments, the immunoglobulin Fc polypeptide comprises at least a portion of an immunoglobulin variable hinge region, immunoglobulin heavy chain CH2 constant region and an immunoglobulin heavy chain CH3 constant region. In some embodiments, the immunoglobulin Fc polypeptide is a human IgA or human IgG Fc polypeptide. In
some embodiments, the immunoglobulin Fc polypeptide is a human IgG Fc polypeptide. In some embodiments, the immunoglobulin Fc polypeptide is a human IgA polypeptide. In some embodiments, the linker comprises a glycine rich peptide. In some embodiments, the glycine rich peptide comprises the sequence [GlyGlyGlyGlySer]n where n is 1, 2, 3, 4, 5 or 6 (SEQ ID NO: 344). In some embodiments, the glycine rich peptide comprises the sequence GGGGSGGGGSGGGGSGGGGS (SEQ ID NO: 212). In some embodiments, the linker comprises GGGGSGGGS (SEQ ID NO: 345). In some embodiments, the stabilizing polypeptide has the ability to perform an effector function. In some embodiments, the stabilizing polypeptide is able to perform an anti-inflammatory effector function. In some embodiments, the stabilizing polypeptide is able to perform a pro-inflammatory effector function. In some embodiments, the stabilizing polypeptide is a cytokine.
[0016] In some embodiments, the stabilizing polypeptide is a multimer. In some embodiments, the stabilizing polypeptide is a dimer. In some embodiments, the gene sequences encoding the stabilizing polypeptide comprise a monomer and a second monomer, wherein the first and second monomer are covalently linked to each other through a peptide bond or a peptide linker.
[0017] In some embodiments, the gene sequences are located on a chromosome in the bacterium. In some embodiments, the gene sequences are located on a plasmid in the bacterium. In some embodiments, the bacterium is a probiotic bacterium. In some embodiments, the bacterium is selected from the group consisting of Bacteroides, Bifidobacterium, Clostridium, Escherichia, Lactobacillus, and Lactococcus. In some embodiments, the bacterium is selected from Clostridium novyi NT, and Clostridium butyricum, and Bifidobacterium longum. In some embodiments, the bacterium is Escherichia coli strain Nissle. In some embodiments, the bacterium is an auxotroph in a gene that is complemented when the bacterium is present in a mammalian gut, e.g., an auxotroph in diaminopimelic acid or an enzyme in the thymine biosynthetic pathway. Pharmaceutically acceptable compositions comprising the bacteria and methods of treating or preventing disorders are also provided.
[0018] In one aspect, provided herein is a method treating a disease or disorder in a human subject, the method comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal healing is induced in the gut of the subject after administration of the pharmaceutical composition, thereby treating the disease or disorder in the human subject.
[0019] In one aspect, provided herein is a pharmaceutical composition for use in the treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked
to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal healing is induced in the gut of the human subject after administration of the pharmaceutical composition.
[0020] In one aspect, provided herein is use of a pharmaceutical composition in the manufacture of a medicament for treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal healing is induced in the gut of the human subject after administration of the pharmaceutical composition.
[0021] In some embodiments, mucosal healing comprises improvement or alleviation of one or more symptoms of the disease or disorder after the administration of the pharmaceutical composition as compared to the one or more symptoms prior to the administration of the pharmaceutical composition, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions. [0022] In one aspect, provided herein is a method of inducing mucosal healing in the gut of a human subject in need thereof, the method comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, thereby inducing mucosal healing.
[0023] In one aspect, provided herein is a pharmaceutical composition for use in inducing mucosal healing in the gut of a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter. [0024] In one aspect, provided herein is use of a pharmaceutical composition in the manufacture of a medicament for inducing mucosal healing in the gut of a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter.
[0025] In some embodiments, mucosal healing comprises improvement or alleviation of one or more symptoms exhibited by the subject after administration of the pharmaceutical composition as compared to the one or more symptoms exhibited by the subject prior to the administration of the pharmaceutical composition, wherein the one or more symptoms are selected from the group
consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
[0026] In one aspect, provided herein is a method of treating a disease or disorder in a human subject, the method comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal cell proliferation is induced in the gut mucosa of the subject after administration of the pharmaceutical composition, thereby treating the disease or disorder in the human subject.
[0027] In one aspect, provided herein is a pharmaceutical composition for use in the treatment a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal cell proliferation is induced in the gut mucosa of the human subject after administration of the pharmaceutical composition.
[0028] In one aspect, provided herein is use of a pharmaceutical composition in the manufacture of a medicament for treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal cell proliferation is induced in the gut mucosa of the human subject after administration of the pharmaceutical composition.
[0029] In some embodiments, an expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in the gut mucosa of the subject after administration of the pharmaceutical composition.
[0030] In some embodiments, the expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in epithelial cells and/or lamina propria in the gut mucosa.
[0031] In one aspect, provided herein is a method of treating a disease or disorder in a human subject, the method comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein an expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in the gut mucosa of the subject after administration of the pharmaceutical composition, thereby treating the disease or disorder in the human subject.
[0032] In one aspect, provided herein is a pharmaceutical composition for use in the treatment a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein an expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in the gut mucosa of the subject after administration of the pharmaceutical composition as compared to before administration of the pharmaceutical composition.
[0033] In one aspect, provided herein is use of a pharmaceutical composition in the manufacture of a medicament for treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein an expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in the gut mucosa of the subject after administration of the pharmaceutical composition as compared to before administration of the pharmaceutical composition.
[0034] In some embodiments, the one or more markers is Ki67. In some embodiments, the expression level of Ki67 is increased by at least 1.2 fold, at least 1.4 fold, at least 1.6 fold, at least 1.8 fold, at least 2.0 fold, at least 2.2 fold, at least 2.4 fold, at least 2.6 fold, at least 2.8 fold, at least 3.0 fold, at least 3.2 fold, at least 3.4 fold, at least 3.6 fold, at least 3.8 fold, at least 4.0 fold, at least 4.2 fold, at least 4.4 fold, at least 4.6 fold, at least 4.8 fold, or at least 5.0 fold in the gut of the subject as compared an expression level of expression of Ki67 in the gut of the subject prior receiving the pharmaceutical composition.
[0035] In some embodiments, the one or more markers is PCNA. In some embodiments, the expression level of PCNA is increased at least 1.2 fold, at least 1.4 fold, at least 1.6 fold, at least 1.8 fold, at least 2.0 fold, at least 2.2 fold, at least 2.4 fold, at least 2.6 fold, at least 2.8 fold, at least 3.0 fold, or at least 3.2 fold as compared to an expression level of PCNA in the gut of the subject prior receiving the pharmaceutical composition.
[0036] In some embodiments, the one or more markers is Edu.
[0037] In some embodiments, the expression level of Edu is increased by at least 1.2 fold, at least 1.4 fold, at least 1.6 fold, at least 1.8 fold, at least 2.0 fold, at least 2.2 fold, at least 2.4 fold, at least 2.6 fold, at least 2.8 fold, at least 3.0 fold, or at least 3.2 fold as compared to an expression level of Edu in the gut of the subject prior receiving the pharmaceutical composition.
[0038] In some embodiments, the pharmaceutical composition is administered to the subject two times a day or three times a day.
[0039] In one embodiment, the method further comprises selecting a subject. In one embodiment, the method further comprises selecting a subject who would benefit from an increased expression
level of one or more of the markers: Ki67, PCNA, and/or Edu. In one embodiment, the method further comprises selecting a subject who has a disease or a disorder. In one embodiment, the disease or disorder is an autoimmune disorder, a metabolic disease, a disease relating to inborn errors of metabolism, or a neurological or neurodegenerative disease.
[0040] In some embodiments, the method further comprising administering a carbon source to the subject. In some embodiments, the carbon source is lactulose.
[0041] In another aspect provided herein, is a method of treating a disease or disorder in a human subject, the method comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, administering a carbon source to the subject, thereby treating the disease or disorder in the human subject. In some embodiments, the carbon source is lactulose.
[0042] In one aspect, provided herein is a pharmaceutical composition for use in the treatment a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, and administering a carbon source to the subject.
[0043] In one aspect, provided herein is use of a pharmaceutical composition in the manufacture of a medicament for treatment of a disease or disorder in a human subject, wherein the pharmaceutical composition comprises a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, and administering a carbon source to the subject.
[0044] In some embodiments, the carbon source is administered at the same time as the pharmaceutical composition, in the same pharmaceutical composition, or at a different time as the pharmaceutical composition. In some embodiments, the carbon source is lactulose.
[0045] In some embodiments, secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject is increased after administration of the carbon source as compared to a level of secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject prior to administration of the carbon source.
[0046] In some embodiments, secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject is increased at least 10-fold or at least 100-fold after administration of the carbon source compared to the level of secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject prior to administration of the carbon source.
[0047] In some embodiments, the pharmaceutical composition is administered to the subject with food. In some embodiments, the pharmaceutical composition is administered to the subject at least about 2 hr, at least 1.5 hr, at least 1 hr, at least 30 minutes, at least 10 minutes, or at least 5 minutes before food. In some embodiments, the pharmaceutical composition is administered to the subject concurrently with food. In some embodiments, the pharmaceutical composition is administered to the subject at least about 2 hr, at least 1.5 hr, at least 1 hr, at least 30 minutes, at least 10 minutes, or at least 5 minutes after food.
[0048] In some embodiments, the pharmaceutical composition is administered to the subject between about 2 hr to about 5 minutes, about 2 hr to about 10 minutes, about 2 hour to about 30 minutes, about 2 hr to about 1 hr, about 2 hr to about 1.5 hr, about 1.5 hr to about 5 minutes, about 1.5 hr to about 10 minutes, about 1.5 hour to about 30 minutes, about 1.5 hr to about 1 hr, about 1 hr to about 5 minutes, about 1 hr to about 10 minutes, about 1 hour to about 30 minutes, about 30 minutes to about 5 minutes, about 30 minutes to about 10 minutes, about 30 minutes to about 5 minutes before food.
[0049] In some embodiments, the pharmaceutical composition is administered to the subject between about 2 hr to about 5 minutes, about 2 hr to about 10 minutes, about 2 hour to about 30 minutes, about 2 hr to about 1 hr, about 2 hr to about 1.5 hr, about 1.5 hr to about 5 minutes, about 1.5 hr to about 10 minutes, about 1.5 hour to about 30 minutes, about 1.5 hr to about 1 hr, about 1 hr to about 5 minutes, about 1 hr to about 10 minutes, about 1 hour to about 30 minutes, about 30 minutes to about 5 minutes, about 30 minutes to about 10 minutes, about 30 minutes to about 5 minutes after food.
[0050] In some embodiments, the pharmaceutical composition is administered to the subject once per day or twice per day.
[0051] In some embodiments, mucosal healing is induced in the gut of the subject after administration of the pharmaceutical composition.
[0052] In some embodiments, the pharmaceutical composition is administered orally.
[0053] In some embodiments, the carbon source is administered orally.
[0054] In some embodiments, the mucosal healing comprises improvement or alleviation of one or more symptoms exhibited by the subject after administration as compared to the one or more symptoms exhibited by the subject prior to administration, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
[0055] In some embodiments, the intestinal permeability is decreased in the gut of the subject after administration of the pharmaceutical composition as compared to the intestinal permeability in the gut of the subject prior to administration of the pharmaceutical composition.
[0056] In some embodiments, the intestinal permeability is decreased at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to
the intestinal permeability in the gut of the subject prior to administration of the pharmaceutical composition.
[0057] In some embodiments, the intestinal permeability is decreased between about 10% to about 100%, about 10% to about 95%, about 10% to about 90%, about 10% to about 85%, about 10% to about 80%, about 10% to about 75%, about 10% to about 70%, about 10% to about 65%, about 10% to about 60%, about 10% to about 55%, about 10% to about 50%, about 10% to about 45%, about 10% to about 40%, about 10% to about 35%, about 10% to about 30%, about 10% to about 25%, about 10% to about 20%, about 10% to about 15%, about 15% to about 100%, about 15% to about 95%, about 15% to about 90%, about 15% to about 85%, about 15% to about 80%, about 15% to about 75%, about 15% to about 70%, about 15% to about 65%, about 15% to about 60%, about 15% to about 55%, about 15% to about 50%, about 15% to about 45%, about 15% to about 40%, about 15% to about 35%, about 15% to about 30%, about 15% to about 25%, about 15% to about 20%, about 20% to about 100%, about 20% to about 95%, about 20% to about 90%, about 20% to about 85%, about 20% to about 80%, about 20% to about 75%, about 20% to about 70%, about 20% to about 65%, about 20% to about 60%, about 20% to about 55%, about 20% to about 50%, about 20% to about 45%, about 20% to about 40%, about 20% to about 35%, about 20% to about 30%, about 20% to about 25%, about 25% to about 100%, about 25% to about 95%, about 25% to about 90%, about 25% to about 85%, about 25% to about 80%, about 25% to about 75%, about 25% to about 70%, about 25% to about 65%, about 25% to about 60%, about 25% to about 55%, about 25% to about 50%, about 25% to about 45%, about 25% to about 40%, about 25% to about 35%, about 25% to about 30%, about 30% to about 100%, about 30% to about 95%, about 30% to about 90%, about 30% to about 85%, about 30% to about 80%, about 30% to about 75%, about 30% to about 70%, about 30% to about 65%, about 30% to about 60%, about 30% to about 55%, about 30% to about 50%, about 30% to about 45%, about 30% to about 40%, about 30% to about 35%, about 35% to about 100%, about 35% to about 95%, about 35% to about 90%, about 35% to about 85%, about 35% to about 80%, about 35% to about 75%, about 35% to about 70%, about 35% to about 65%, about 35% to about 60%, about 35% to about 55%, about 35% to about 50%, about 35% to about 45%, about 35% to about 40%, about 40% to about 100%, about 40% to about 95%, about 40% to about 90%, about 40% to about 85%, about 40% to about 80%, about 40% to about 75%, about 40% to about 70%, about 40% to about 65%, about 40% to about 60%, about 40% to about 55%, about 40% to about 50%, about 40% to about 45%, about 45% to about 100%, about 45% to about 95%, about 45% to about 90%, about 45% to about 85%, about 45% to about 80%, about 45% to about 75%, about 45% to about 70%, about 45% to about 65%, about 45% to about 60%, about 45% to about 55%, about 45% to about 50%, about 50% to about 100%, about 50% to about 95%, about 50% to about 90%, about 50% to about 85%, about 50% to about 80%, about 50% to about 75%, about 50% to about 70%, about 50% to about 65%, about 50% to about 60%, about 50% to about 55%, about 55% to about 100%, about 55% to about 95%, about 55% to about 90%, about 55% to about 85%,
about 55% to about 80%, about 55% to about 75%, about 55% to about 70%, about 55% to about 65%, about 55% to about 60%, about 60% to about 100%, about 60% to about 95%, about 60% to about 90%, about 60% to about 85%, about 60% to about 80%, about 60% to about 75%, about 60% to about 70%, about 60% to about 65%, about 65% to about 100%, about 65% to about 95%, about 65% to about 90%, about 65% to about 85%, about 65% to about 80%, about 65% to about 75%, about 65% to about 70%, about 70% to about 100%, about 70% to about 95%, about 70% to about 90%, about 70% to about 85%, about 70% to about 80%, about 70% to about 75%, about 75% to about 100%, about 75% to about 95%, about 75% to about 90%, about 75% to about 85%, about 75% to about 80%, about 80% to about 100%, about 80% to about 95%, about 80% to about 90%, about 80% to about 85%, about 85% to about 100%, about 85% to about 95%, about 85% to about 90%, about 90% to about 100%, about 90% to about 95%, or about 95% to about 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the intestinal permeability in the gut of the subject prior to administration of the pharmaceutical composition. [0058] In some embodiments, the intestinal permeability is measured by a L:M test to determine the lactulose:mannitol ratio (LMR) in the subject’s urine after ingestion of solute comprising lactulose and mannitol.
[0059] In some embodiments, inflammation is decreased in the gut of the subject after administration of the pharmaceutical composition as compared to the inflammation in the gut of the subject prior to administration of the pharmaceutical composition.
[0060] In some embodiments, inflammation is decreased by at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the inflammation in the gut of the subject prior to administration of the pharmaceutical composition.
[0061] In some embodiments, inflammation is decreased by between about 10% to about 100%, about 10% to about 95%, about 10% to about 90%, about 10% to about 85%, about 10% to about 80%, about 10% to about 75%, about 10% to about 70%, about 10% to about 65%, about 10% to about 60%, about 10% to about 55%, about 10% to about 50%, about 10% to about 45%, about 10% to about 40%, about 10% to about 35%, about 10% to about 30%, about 10% to about 25%, about 10% to about 20%, about 10% to about 15%, about 15% to about 100%, about 15% to about 95%, about 15% to about 90%, about 15% to about 85%, about 15% to about 80%, about 15% to about 75%, about 15% to about 70%, about 15% to about 65%, about 15% to about 60%, about 15% to about 55%, about 15% to about 50%, about 15% to about 45%, about 15% to about 40%, about 15% to about 35%, about 15% to about 30%, about 15% to about 25%, about 15% to about 20%, about 20% to about 100%, about 20% to about 95%, about 20% to about 90%, about 20% to about 85%, about 20% to about 80%, about 20% to about 75%, about 20% to about 70%, about 20% to about 65%, about 20% to about 60%, about 20% to about 55%, about 20% to about 50%, about 20% to
about 45%, about 20% to about 40%, about 20% to about 35%, about 20% to about 30%, about 20% to about 25%, about 25% to about 100%, about 25% to about 95%, about 25% to about 90%, about 25% to about 85%, about 25% to about 80%, about 25% to about 75%, about 25% to about 70%, about 25% to about 65%, about 25% to about 60%, about 25% to about 55%, about 25% to about 50%, about 25% to about 45%, about 25% to about 40%, about 25% to about 35%, about 25% to about 30%, about 30% to about 100%, about 30% to about 95%, about 30% to about 90%, about 30% to about 85%, about 30% to about 80%, about 30% to about 75%, about 30% to about 70%, about 30% to about 65%, about 30% to about 60%, about 30% to about 55%, about 30% to about 50%, about 30% to about 45%, about 30% to about 40%, about 30% to about 35%, about 35% to about 100%, about 35% to about 95%, about 35% to about 90%, about 35% to about 85%, about 35% to about 80%, about 35% to about 75%, about 35% to about 70%, about 35% to about 65%, about 35% to about 60%, about 35% to about 55%, about 35% to about 50%, about 35% to about 45%, about 35% to about 40%, about 40% to about 100%, about 40% to about 95%, about 40% to about 90%, about 40% to about 85%, about 40% to about 80%, about 40% to about 75%, about 40% to about 70%, about 40% to about 65%, about 40% to about 60%, about 40% to about 55%, about 40% to about 50%, about 40% to about 45%, about 45% to about 100%, about 45% to about 95%, about 45% to about 90%, about 45% to about 85%, about 45% to about 80%, about 45% to about 75%, about 45% to about 70%, about 45% to about 65%, about 45% to about 60%, about 45% to about 55%, about 45% to about 50%, about 50% to about 100%, about 50% to about 95%, about 50% to about 90%, about 50% to about 85%, about 50% to about 80%, about 50% to about 75%, about 50% to about 70%, about 50% to about 65%, about 50% to about 60%, about 50% to about 55%, about 55% to about 100%, about 55% to about 95%, about 55% to about 90%, about 55% to about 85%, about 55% to about 80%, about 55% to about 75%, about 55% to about 70%, about 55% to about 65%, about 55% to about 60%, about 60% to about 100%, about 60% to about 95%, about 60% to about 90%, about 60% to about 85%, about 60% to about 80%, about 60% to about 75%, about 60% to about 70%, about 60% to about 65%, about 65% to about 100%, about 65% to about 95%, about 65% to about 90%, about 65% to about 85%, about 65% to about 80%, about 65% to about 75%, about 65% to about 70%, about 70% to about 100%, about 70% to about 95%, about 70% to about 90%, about 70% to about 85%, about 70% to about 80%, about 70% to about 75%, about 75% to about 100%, about 75% to about 95%, about 75% to about 90%, about 75% to about 85%, about 75% to about 80%, about 80% to about 100%, about 80% to about 95%, about 80% to about 90%, about 80% to about 85%, about 85% to about 100%, about 85% to about 95%, about 85% to about 90%, about 90% to about 100%, about 90% to about 95%, or about 95% to about 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the inflammation in the gut of the subject prior to administration of the pharmaceutical composition.
[0062] In some embodiments, levels of inflammation is measured by determining degree of immune cell infiltration of the gut mucosa.
[0063] In some embodiments, inflammation in the gut of a subject is measured by endoscopy or from a biopsy of the colon.
[0064] In some embodiments, inflammation in the gut of a subject is determined by measuring levels of one or more biomarkers in a biological sample from the subject. In some embodiments, the biological sample is blood, urine, or stool. In some embodiments, the one or more biomarkers are C- reactive protein (CRP) and/or calprotectin.
[0065] In some embodiments, inflammation is measured by determining the level of infiltration of immune cells in the intestinal lining of mid-distal and/or distal colon sections of the subject.
[0066] In some embodiments, tissue damage is decreased in the gut of the subject after administration of the pharmaceutical composition as compared to the tissue damage in the gut of the subject prior to administration of the pharmaceutical composition.
[0067] In some embodiments, tissue damage in the gut of the subject is decreased at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the tissue damage in the gut of the subject prior to administration of the pharmaceutical composition.
[0068] In some embodiments, tissue damage in the gut of the subject is decreased between about 10% to about 100%, about 10% to about 95%, about 10% to about 90%, about 10% to about 85%, about 10% to about 80%, about 10% to about 75%, about 10% to about 70%, about 10% to about 65%, about 10% to about 60%, about 10% to about 55%, about 10% to about 50%, about 10% to about 45%, about 10% to about 40%, about 10% to about 35%, about 10% to about 30%, about 10% to about 25%, about 10% to about 20%, about 10% to about 15%, about 15% to about 100%, about 15% to about 95%, about 15% to about 90%, about 15% to about 85%, about 15% to about 80%, about 15% to about 75%, about 15% to about 70%, about 15% to about 65%, about 15% to about 60%, about 15% to about 55%, about 15% to about 50%, about 15% to about 45%, about 15% to about 40%, about 15% to about 35%, about 15% to about 30%, about 15% to about 25%, about 15% to about 20%, about 20% to about 100%, about 20% to about 95%, about 20% to about 90%, about 20% to about 85%, about 20% to about 80%, about 20% to about 75%, about 20% to about 70%, about 20% to about 65%, about 20% to about 60%, about 20% to about 55%, about 20% to about 50%, about 20% to about 45%, about 20% to about 40%, about 20% to about 35%, about 20% to about 30%, about 20% to about 25%, about 25% to about 100%, about 25% to about 95%, about 25% to about 90%, about 25% to about 85%, about 25% to about 80%, about 25% to about 75%, about 25% to about 70%, about 25% to about 65%, about 25% to about 60%, about 25% to about 55%, about 25% to about 50%, about 25% to about 45%, about 25% to about 40%, about 25% to about 35%, about 25% to about 30%, about 30% to about 100%, about 30% to about 95%, about 30% to about 90%, about 30% to about 85%, about 30% to about 80%, about 30% to about 75%, about 30%
to about 70%, about 30% to about 65%, about 30% to about 60%, about 30% to about 55%, about 30% to about 50%, about 30% to about 45%, about 30% to about 40%, about 30% to about 35%, about 35% to about 100%, about 35% to about 95%, about 35% to about 90%, about 35% to about 85%, about 35% to about 80%, about 35% to about 75%, about 35% to about 70%, about 35% to about 65%, about 35% to about 60%, about 35% to about 55%, about 35% to about 50%, about 35% to about 45%, about 35% to about 40%, about 40% to about 100%, about 40% to about 95%, about 40% to about 90%, about 40% to about 85%, about 40% to about 80%, about 40% to about 75%, about 40% to about 70%, about 40% to about 65%, about 40% to about 60%, about 40% to about 55%, about 40% to about 50%, about 40% to about 45%, about 45% to about 100%, about 45% to about 95%, about 45% to about 90%, about 45% to about 85%, about 45% to about 80%, about 45% to about 75%, about 45% to about 70%, about 45% to about 65%, about 45% to about 60%, about 45% to about 55%, about 45% to about 50%, about 50% to about 100%, about 50% to about 95%, about 50% to about 90%, about 50% to about 85%, about 50% to about 80%, about 50% to about 75%, about 50% to about 70%, about 50% to about 65%, about 50% to about 60%, about 50% to about 55%, about 55% to about 100%, about 55% to about 95%, about 55% to about 90%, about 55% to about 85%, about 55% to about 80%, about 55% to about 75%, about 55% to about 70%, about 55% to about 65%, about 55% to about 60%, about 60% to about 100%, about 60% to about 95%, about 60% to about 90%, about 60% to about 85%, about 60% to about 80%, about 60% to about 75%, about 60% to about 70%, about 60% to about 65%, about 65% to about 100%, about 65% to about 95%, about 65% to about 90%, about 65% to about 85%, about 65% to about 80%, about 65% to about 75%, about 65% to about 70%, about 70% to about 100%, about 70% to about 95%, about 70% to about 90%, about 70% to about 85%, about 70% to about 80%, about 70% to about 75%, about 75% to about 100%, about 75% to about 95%, about 75% to about 90%, about 75% to about 85%, about 75% to about 80%, about 80% to about 100%, about 80% to about 95%, about 80% to about 90%, about 80% to about 85%, about 85% to about 100%, about 85% to about 95%, about 85% to about 90%, about 90% to about 100%, about 90% to about 95%, or about 95% to about 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the tissue damage in the gut of the subject prior to administration of the pharmaceutical composition.
[0069] In some embodiments, tissue damage in the gut of a subject is measured from a biopsy of the colon.
[0070] In some embodiments, mucosal ulceration and/or ulcerative lesions are decreased in the gut of the subject after administration of the pharmaceutical composition as compared to mucosal ulceration and/or ulcerative lesions in the gut of the subject prior to administration of the pharmaceutical composition.
[0071] In some embodiments, mucosal ulceration and/or ulcerative lesions is determined by endoscopy or biopsy from the distal colon, rectum, and/or mid-distal colon sections.
[0072] In some embodiments, the mucosal ulceration and/or ulcerative lesions is decreased at least 1%, at least 5%, at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the mucosal ulceration and/or ulcerative lesions in the gut of the subject prior to administration of the pharmaceutical composition.
[0073] In some embodiments, the mucosal ulceration decreases between about 10% to about 100%, about 10% to about 95%, about 10% to about 90%, about 10% to about 85%, about 10% to about 80%, about 10% to about 75%, about 10% to about 70%, about 10% to about 65%, about 10% to about 60%, about 10% to about 55%, about 10% to about 50%, about 10% to about 45%, about 10% to about 40%, about 10% to about 35%, about 10% to about 30%, about 10% to about 25%, about 10% to about 20%, about 10% to about 15%, about 15% to about 100%, about 15% to about 95%, about 15% to about 90%, about 15% to about 85%, about 15% to about 80%, about 15% to about 75%, about 15% to about 70%, about 15% to about 65%, about 15% to about 60%, about 15% to about 55%, about 15% to about 50%, about 15% to about 45%, about 15% to about 40%, about 15% to about 35%, about 15% to about 30%, about 15% to about 25%, about 15% to about 20%, about 20% to about 100%, about 20% to about 95%, about 20% to about 90%, about 20% to about 85%, about 20% to about 80%, about 20% to about 75%, about 20% to about 70%, about 20% to about 65%, about 20% to about 60%, about 20% to about 55%, about 20% to about 50%, about 20% to about 45%, about 20% to about 40%, about 20% to about 35%, about 20% to about 30%, about 20% to about 25%, about 25% to about 100%, about 25% to about 95%, about 25% to about 90%, about 25% to about 85%, about 25% to about 80%, about 25% to about 75%, about 25% to about 70%, about 25% to about 65%, about 25% to about 60%, about 25% to about 55%, about 25% to about 50%, about 25% to about 45%, about 25% to about 40%, about 25% to about 35%, about 25% to about 30%, about 30% to about 100%, about 30% to about 95%, about 30% to about 90%, about 30% to about 85%, about 30% to about 80%, about 30% to about 75%, about 30% to about 70%, about 30% to about 65%, about 30% to about 60%, about 30% to about 55%, about 30% to about 50%, about 30% to about 45%, about 30% to about 40%, about 30% to about 35%, about 35% to about 100%, about 35% to about 95%, about 35% to about 90%, about 35% to about 85%, about 35% to about 80%, about 35% to about 75%, about 35% to about 70%, about 35% to about 65%, about 35% to about 60%, about 35% to about 55%, about 35% to about 50%, about 35% to about 45%, about 35% to about 40%, about 40% to about 100%, about 40% to about 95%, about 40% to about 90%, about 40% to about 85%, about 40% to about 80%, about 40% to about 75%, about 40% to about 70%, about 40% to about 65%, about 40% to about 60%, about 40% to about 55%, about 40% to about 50%, about 40% to about 45%, about 45% to about 100%, about 45% to about 95%, about 45% to about 90%, about 45% to about 85%, about 45% to about 80%, about 45% to about 75%, about 45% to about 70%, about 45% to about 65%, about 45% to about 60%, about 45% to about 55%,
about 45% to about 50%, about 50% to about 100%, about 50% to about 95%, about 50% to about 90%, about 50% to about 85%, about 50% to about 80%, about 50% to about 75%, about 50% to about 70%, about 50% to about 65%, about 50% to about 60%, about 50% to about 55%, about 55% to about 100%, about 55% to about 95%, about 55% to about 90%, about 55% to about 85%, about 55% to about 80%, about 55% to about 75%, about 55% to about 70%, about 55% to about 65%, about 55% to about 60%, about 60% to about 100%, about 60% to about 95%, about 60% to about 90%, about 60% to about 85%, about 60% to about 80%, about 60% to about 75%, about 60% to about 70%, about 60% to about 65%, about 65% to about 100%, about 65% to about 95%, about 65% to about 90%, about 65% to about 85%, about 65% to about 80%, about 65% to about 75%, about 65% to about 70%, about 70% to about 100%, about 70% to about 95%, about 70% to about 90%, about 70% to about 85%, about 70% to about 80%, about 70% to about 75%, about 75% to about 100%, about 75% to about 95%, about 75% to about 90%, about 75% to about 85%, about 75% to about 80%, about 80% to about 100%, about 80% to about 95%, about 80% to about 90%, about 80% to about 85%, about 85% to about 100%, about 85% to about 95%, about 85% to about 90%, about 90% to about 100%, about 90% to about 95%, or about 95% to about 100% in the gut of the subject when compared to the gut of the subject prior to administration of the pharmaceutical composition. [0074] In some embodiments, the EGF polypeptide has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 505 or a fragment thereof.
[0075] In some embodiments, the EGF polypeptide comprises SEQ ID NO: 505 or a fragment thereof.
[0076] In some embodiments, the secretion tag is PhoA, PelB, OmpA, LARD3, or HylA.
[0077] In some embodiments, the secretion tag has a sequence comprising: a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 136; or b. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 161; or c. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 168; or d. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 361; or e. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 362.
[0078] In some embodiments, the secretion tag has a sequence comprising: a. SEQ ID NO: 136; b. SEQ ID NO: 161; c. SEQ ID NO: 168; d. SEQ ID NO: 361; or e. SEQ ID NO: 362.
[0079] In some embodiments, the inducible promoter is an low oxygen-inducible promoter, a temperature-sensitive promoter, or an isopropyl beta-D-1 -thiogalactopyranoside (IPTG) inducible promoter.
[0080] In some embodiments, the inducible promoter is a low oxygen-inducible promoter, and wherein the low oxygen-inducible promoter has a sequence comprising a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of SEQ ID NOs: 1-11, 336 and 337; or b. any one of SEQ ID NOs: 1-11, 336 and 337.
[0081] In some embodiments, the inducible promoter is a temperature-sensitive promoter, and wherein the temperature-sensitive promoter is a pR promoter further comprising a CI857 repressor (CI857 repressor -pR promoter).
[0082] In some embodiments, the CI857 repressor-pR promoter has a sequence comprising a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of SEQ ID NOs: 19-21; or b. any one of SEQ ID NOs: 19-21.
[0083] In some embodiments, the polynucleotide sequence encoding the epidermal growth factor (EGF) polypeptide linked to the secretion tag has a sequence comprising a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of sequences SEQ ID NO: 500, SEQ ID NO: 502, SEQ ID NO: 501, SEQ ID NO: 503, SEQ ID NO: 504, SEQ ID NO: 506, SEQ ID NO: 508, SEQ ID NO: 507, SEQ ID NO: 509, SEQ ID NO: 510, SEQ ID NO: 519, SEQ ID NO: 520, SEQ ID NO: 521, SEQ ID NO: 522, SEQ ID NO: 523, SEQ ID NO: 524, SEQ ID NO: 525, or SEQ ID NO: 526; or b. any one of sequences SEQ ID NO: 500, SEQ ID NO: 502, SEQ ID NO: 501, SEQ ID NO: 503, SEQ ID NO: 504, SEQ ID NO: 506, SEQ ID NO: 508, SEQ ID NO: 507, SEQ ID NO: 509, SEQ ID NO: 510, SEQ ID NO: 519, SEQ ID NO: 520, SEQ ID NO: 521, SEQ ID NO: 522, SEQ ID NO: 523, SEQ ID NO: 524, SEQ ID NO: 525, or SEQ ID NO: 526.
[0084] In some embodiments, the recombinant bacterium further comprises a polynucleotide sequence encoding a peptide bond, a polypeptide linker, and/or a stabilizing polypeptide.
[0085] In some embodiments, the secretion tag is linked to the N terminus of the EGF polypeptide by a peptide bond or a polypeptide linker, or wherein the secretion tag is linked to the C terminus of the EGF polypeptide by a peptide bond or a polypeptide linker.
[0086] In some embodiments, the secretion tag is cleaved from the EGF polypeptide after secretion from the recombinant bacterium.
[0087] In some embodiments, the bacterium is selected from the group consisting of Bacteroides, Bifidobacterium, Clostridium, Escherichia, Lactobacillus, and Lactococcus.
[0088] In some embodiments, the bacterium is selected from the group consisting of Clostridium novyi NT, Clostridium butyricum, and Bifidobacterium longum. In some embodiments, the bacterium is Escherichia coli strain Nissle.
[0089] In some embodiments, the bacterium further comprises a mutated gene encoding a periplasmic protein pal.
[0090] In some embodiments, the bacterium further expresses a Type 1 secretion system capable of secreting the EGF polypeptide linked to the secretion tag.
[0091] In some embodiments, the recombinant bacterium further comprises a deletion in a pks island. [0092] In some embodiments, the disease or disorder is selected from a group consisting of autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, and neurological or neurodegenerative diseases.
[0093] In some embodiments, the disease or disorder is a disease disorder, or condition associated with gut inflammation and/or compromised gut barrier function. In some embodiments, the disease or disorder is an inflammatory bowel disease, diarrheal diseases, or a related disease. In some embodiments, the inflammatory bowel disease is Crohn’s disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, diversion colitis, Bechet’ s disease, indeterminate colitis, short bowel syndrome, and radiation induced GI toxicity.
[0094] In some embodiments, the autoimmune disorder is selected from the group consisting of acute disseminated encephalomyelitis (ADEM), acute necrotizing hemorrhagic leukoencephalitis, Addison’ s disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti- GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune angioedema, autoimmune aplastic anemia, autoimmune dysautonomia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear disease (AIED), autoimmune myocarditis, autoimmune oophoritis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura (ATP), autoimmune thyroid disease, autoimmune urticarial, Axonal & neuronal neuropathies, Balo disease, Behcet’s disease, Bullous pemphigoid, Cardiomyopathy, Castleman disease, Celiac disease, Chagas disease, Chronic inflammatory demyelinating polyneuropathy (CIDP), Chronic recurrent multifocal ostomyelitis (CRMO), Churg- Strauss syndrome, Cicatricial pemphigoid/benign mucosal pemphigoid, Crohn’s disease, Cogan syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis, CREST disease, Essential mixed cryoglobulinemia, Demyelinating neuropathies, Dermatitis herpetiformis, Dermatomyositis, Devic’s disease (neuromyelitis optica), Discoid lupus, Dressier’s syndrome, Endometriosis, Eosinophilic esophagitis, Eosinophilic fasciitis, Erythema nodosum, Experimental allergic encephalomyelitis, Evans syndrome, Fibrosing alveolitis, Giant cell arteritis (temporal arteritis), Giant cell myocarditis, Glomerulonephritis, Goodpasture’s syndrome, Granulomatosis with Polyangiitis (GPA), Graves’ disease, Guillain-Barre syndrome, Hashimoto’s encephalitis, Hashimoto’s thyroiditis, Hemolytic anemia, Henoch-Schonlein purpura, Herpes gestationis, Hypogammaglobulinemia, Idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4- related sclerosing disease, Immunoregulatory lipoproteins, Inclusion body myositis, Interstitial cystitis, Juvenile arthritis, Juvenile idiopathic arthritis, Juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, Linear IgA disease (LAD), Lupus (Systemic Lupus Erythematosus), chronic Lyme disease, Meniere’s disease, Microscopic polyangiitis, Mixed connective tissue disease (MCTD), Mooren’s ulcer, Mucha-Habermann disease, Multiple sclerosis, Myasthenia gravis, Myositis, Narcolepsy, Neuromyelitis optica (Devic’ s), Neutropenia, Ocular cicatricial pemphigoid, Optic neuritis, Palindromic rheumatism, PANDAS (Pediatric autoimmune Neuropsychiatric Disorders Associated with Streptococcus), Paraneoplastic cerebellar degeneration, Paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, Pars planitis
(peripheral uveitis), Pemphigus, Peripheral neuropathy, Perivenous encephalomyelitis, Pernicious anemia, POEMS syndrome, Polyarteritis nodosa, Type I, II, & III autoimmune polyglandular syndromes, Polymyalgia rheumatic, Polymyositis, Postmyocardial infarction syndrome, Postpericardiotomy syndrome, Progesterone dermatitis, Primary biliary cirrhosis, Primary sclerosing cholangitis, Psoriasis, Psoriatic arthritis, Idiopathic pulmonary fibrosis, Pyoderma gangrenosum, Pure red cell aplasia, Raynauds phenomenon, reactive arthritis, reflex sympathetic dystrophy, Reiter’s syndrome, relapsing polychondritis, restless legs syndrome, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis, sarcoidosis, Schmidt syndrome, scleritis, scleroderma, Sjogren’s syndrome, sperm & testicular autoimmunity, stiff person syndrome, subacute bacterial endocarditis (SBE), Susac’s syndrome, sympathetic ophthalmia, Takayasu’s arteritis, temporal arteritis/giant cell arteritis, thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, transverse myelitis, type 1 diabetes, asthma, ulcerative colitis, undifferentiated connective tissue disease (UCTD), uveitis, vasculitis, vesiculobullous dermatosis, vitiligo, and Wegener’ s granulomatosis.
[0095] In some embodiments, the metabolic disorder or condition is selected from the group consisting of: type 1 diabetes; type 2 diabetes; metabolic syndrome; Bardet-Biedel syndrome; Prader- Willi syndrome; non-alcoholic fatty liver disease; tuberous sclerosis; Albright hereditary osteodystrophy; brain-derived neurotrophic factor (BDNF) deficiency; Single-minded 1 (SIM1) deficiency; leptin deficiency; leptin receptor deficiency; pro-opiomelanocortin (POMC) defects; proprotein convertase subtilisin/kexin type 1 (PCSK1) deficiency; Src homology 2B1 (SH2B1) deficiency; pro-hormone convertase 1/3 deficiency; melanocortin-4-receptor (MC4R) deficiency; aniridia, genitourinary anomalies, and mental retardation (WAGR) syndrome; pseudohypoparathyroidism type 1A; Fragile X syndrome; Borjeson-Forsmann-Lehmann syndrome; Alstrom syndrome; Cohen syndrome; and ulnar-mammary syndrome.
[0096] In some embodiments, the method further comprises selecting a human subject who would benefit from an improvement or alleviation of one or more symptoms, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
BRIEF DESCRIPTION OF THE FIGURES
[0097] FIG. 1 depicts a schematic representation of an exemplary bacterium that secretes EGF linked to a signal peptide and under control of an FNR-inducible promoter (left) or a heat-inducible promoter that also expresses a T1S secretion pore (right).
[0098] FIGs. 2A and FIG. 2B depict schematics of the gene organization of exemplary circuits of the disclosure for the expression of therapeutic polypeptides, which are secreted via a diffusible outer membrane (DOM) system. The therapeutic polypeptide of interest is fused to a prototypical N- terminal Sec-dependent secretion signal or Tat-dependent secretion signal, which is cleaved upon secretion into the periplasmic space. Exemplary secretion tags include sec-dependent PhoA, PelB,
OmpF, OmpA, cvaC, and Tat-dependent tags (TorA, FdnG, DmsA). In certain embodiments, the recombinant bacteria comprise deletions in one or more of Ipp, pal, tolA, and/or nlpl. Optionally, periplasmic proteases are also deleted, including, but not limited to, degP and ompT, e.g., to increase stability of the polypeptide in the periplasm. A FRT-KanR-FRT cassette is used for downstream integration. Expression is driven by a tet promoter (FIG. 2A) or an inducible promoter, such as oxygen level-dependent promoters (e.g., FNR-inducible promoter, FIG. 2B) or temperature sensitive promoters, promoters induced by inflammation or an inflammatory response (RNS, ROS promoters), and promoters induced by a metabolite that may or may not be naturally present (e.g., can be exogenously added) in the gut, e.g., arabinose.
[0099] FIGs. 3A-3B show an ELISA of EGF secretion across three different EGF fusion proteins in two different bacterial backgrounds grown in either LB (FIG. 3A) or grown in 2YT (FIG. 3B).
[0100] FIG. 4 shows an ELISA of bioreactivity for secreted hEGF on pERK and pEGFR in HT-29 cells.
[0101] FIG. 5 shows a western blot of phosphorylated downstream targets of EGF after treatment with either EGF, different supernatants, or the presence of AG1478, an EGFR inhibitor.
[0102] FIGs. 6A-6B show an ELISA of pEGFR with secreted EGF.
[0103] FIGs. 7A-7B show an ELISA of pERK with secreted EGF.
[0104] FIG. 8 shows an in vitro activity assay for hEGF production (WT or Apal/DOM grown in either LB or 2YT medium before induction (30°C) and 4 hours after induction (37°C)).
[0105] FIG. 9 shows the production of hEGF (pg/ml) in WT or Apal/DOM grown 2YT media at timepoints of 0 hours, 4 hours after induction and overnight induction.
[0106] FIG. 10 shows the production of hEGF (ng/ml) in WT-CLOmpA-EGF or Apal/DOM-CL OmpA-EGF at timepoints of before induction, 4 hours after induction and overnight induction.
[0107] FIGs. 11A and 11B depict a schematic (FIG. 11 A) and a bar graph showing EGF production (FIG. 11B). FIG. 11A shows a schematic describing four EGF secreting prototype strains. FIG. 11B shows a graph demonstrating EGF production represented as pg EGF produced per 5xl0Al 1 cells in 8 hr (mean ± SEM). Numbers 1-3 indicate three separate experiments.
[0108] FIG. 12 depicts a schematic showing EGF production and secretion by prototype strains over time.
[0109] FIGs. 13A and 13B depicts graphs showing prototype strain bioactivity. FIG. 13A depicts a graph showing representative pEGFR signal in the FRET assay in HT-29 cells after 5 mins stimulation across a range of EGF concentrations using rEGF standards or supernatants collected in one of three independent experiments. FIG. 13B depicts a graph showing EC50 (nM EGF) of pEGFR stimulation in HT-29 cells determined using rEGF standards or supernatants collected in three separate experiments. EC50 values are presented as mean ± 95% CL Dashed lines indicate ± 0.5 log fold-change from the mean of rEGF standards across all three experiments.
[0110] FIG. 14 depicts a chart showing EGF detected in colon effluent of naive mice treated with the prototype strains (le10 CFU) as indicated at a six-hour time point.
[0111] FIGs. 15A-15E depict schematics and graphs relating to an in vivo study. FIG. 15A is a schematic outlining the study protocol. Mice received a single oral bolus of EcN WT (SYN094), A- Temp (SYN8062), A-FNR (SYN8063) at 1 x 10^10 CFU. Strain abundance in tissue effluents (small intestine (FIG. 15B), cecum (FIG. 15C), colon (FIG. 15D) and feces (FIG. 15E) were collected and counted at indicated times. For each time point, data represent the average CFU per gram of sample determined from 5 mice samples ± standard error of the mean.
[0112] FIGs. 16A-16E depict graphs relating to an in vivo study in which mice were gavaged at 1 x 10^10 CFU with prototype strains showing EGF secretion in the gastrointestinal contents of naive mice (stomach effluent (FIG. 16A), small intestine effluent (FIG. 16B), cecum effluent (FIG. 16C), colon effluent (FIG. 16D) and feces (FIG. 16E).
[0113] FIGs. 17A-17C depict graphs relating to an in vivo study in DSS treated mice. Mice received a single oral bolus of SYN8066 (Chassis B, FNR) and SYN8248 (Chassis B) at le10 CFU. Strain abundance in tissue (small intestine effluents (FIG. 17A), cecum effluents (FIG. 17B), and colon contents (FIG. 17C)) were collected and counted at indicated times. For each time point, data represent the average CFU per gram of sample determined from 5 mice samples.
[0114] FIGs. 18A-18C depict graphs relating to an in vivo study in which DSS treated mice were gavaged at le10 CFU with prototype strains showing EGF secretion in the gastrointestinal contents of DSS mice (small intestine effluent (FIG. 18A), cecum effluent (FIG. 18B), and colon contents (FIG.
18C).
[0115] FIG. 19 depicts a bar graph showing in vitro EGF production activity of strains SYN8371, SYN8408, and SYN8510 having 1, 2, or 3 integrated copies, respectively of FNR-ompA-EGF, as compared to the plasmid strain SYN8066 having the same construct.
[0116] FIG. 20A is a schematic showing BID (two times a day) or TID (three times a day) dosing and feces collection schedule in a DSS model. Mice were sacrificed on D6 and colon effluents collected.
[0117] FIG. 20B depicts a graph showing abundance of bacteria in feces (CFU/g feces) collected on D3 and D4 according to the schedule shown in FIG. 20A.
[0118] FIG. 20C depicts a graph showing EGF levels present in feces collected at D3 and D4 according to the schedule shown in FIG. 20A.
[0119] FIG. 20D is a schematic showing BID or TID dosing and mice were sacrificed on D6 at Ih or 3h post last dose. Flushed colon contents were collected.
[0120] FIG. 20E depicts a graph showing the amount of EGF present in colon content on D6.
[0121] FIGs. 20F and 20G depict graphs showing body weight observed during time course of DSS administration as shown in FIG. 20D.
[0122] FIG. 21A depicts a schematic showing transverse sections. Segment 3 (distal colon) was stained by immunohistochemistry (Ki67, PCNA) or immunofluorescence staining, images were quantitated by computational image analysis for proliferation markers.
[0123] FIGs. 21B, 21C and 21D depict graphs showing levels of Ki67 (FIG. 21B), PCNA (FIG.
21C), and Edu (FIG. 21D) observed in mucosa of animals sacrificed at 6 days after treatment according to the schedule shown in FIG. 20A.
[0124] FIG. 21E depicts a graph showing RT-PCR analysis performed on colon tissue of mice at day 6, treated according to the schedule shown in FIG. 20A.
[0125] FIG. 22A depicts a schematic showing administration of le10 EcN or EcN-EGF preceded by lactulose administration in a DSS model combined with streptomycin administration.
[0126] FIG. 22B depicts a graph showing the amount of EGF present in colon content on D6.
[0127] FIG. 23A depicts the formula of the disaccharide lactulose.
[0128] FIG. 23B depicts proliferation of EcN-EGF (SYN8066) in M9 media, with no carbon source, xylulose or lactulose added.
[0129] FIG. 24A is a schematic showing a dosing schedule in which mice are given lactulose 30 minutes prior to gavage with le9 Ecn-EGF (SYN8066).
[0130] FIGs. 24B and 24C depicts graphs showing cecal (FIG. 24B) and colonic ( FIG. 24C) levels of EGF in mice dosed according to the schedule shown in FIG. 24A.
[0131] FIG. 25 A is a schematic showing a dosing schedule in which mice are given lactulose either 1 or 2 hours prior to gavage with le9 Ecn-EGF (SYN8066) in a DSS model.
[0132] FIG. 25B depicts a graph showing colonic EGF levels in mice at 2 and 3 hours post-dose according to the schedule shown in FIG. 25A.
[0133] FIG. 26A is a schematic showing a dosing schedule in which mice are given streptomycin in drinking water from day -7 to day 6; lactulose BID orally and DSS in drinking water from day 0 to day 6; and le10 Ecn (SYN094) or Ecn-EGF (SYN8854) on day -6, -3, -1, 1, 4 in a DSS model. Mice were sacrificed on day 6.
[0134] FIG. 26B depicts a graph showing abundance of bacteria in feces (CFU/g feces) collected on D-6, D-2 and D2 according to the schedule shown in FIG. 26A.
[0135] FIG. 26C depicts a graph showing EGF levels in stool collected on D-2 and D2 according to the schedule shown in FIG. 26A.
[0136] FIG. 27 is a graph showing EGF production over time for three different biomass batches.
[0137] FIG. 28A and FIG. 28B are graphs showing EGF production in EnN-hEGF dosed mice over time in normal light cycle (NLC) rooms (FIG. 28A) and in reverse light cycle (RLC) rooms (FIG. 28B), as measured in fecal matter. Each line represents one experiment which encompasses 4-5 mice. [0138] FIG. 29A and FIG. 29B are graphs showing EGF production in EcN-hEGF (SYN8510) dosed mice over time in normal light cycle (NLC) rooms (FIG. 29 A) and in reverse light cycle rooms
(FIG. 29B) at two different doses, 1E9 and 3.5E9 CFUs, as measured in fecal matter. Each line represents one experiment which encompasses 4-5 mice.
[0139] FIG. 30A and FIG. 30B are graphs showing EGF production over time in mice housed in reverse light cycle room, which were dosed with 5e9 CFU of EcN-hEGF (SYN8510) at T0 and T5. FIG. 30A and FIG. 30B are repeat studies of the same experimental setup. Each line is the average of 4-5 mice per experiment on a single day. Hatched box: Colon content EGF levels at 8 hours post first dose.
[0140] FIG. 31 is a graph showing Ki67 positive cells in DSS treated mice in various study groups. Each dot on the graph corresponds to a mouse colon. Naive: no DSS; DSS vehicle: vehicle control; EcN-EGF: SYN8510. T0/3: treatment at T0 and T3; T0/5: treatment at T0 and T5.
[0141] FIG. 32A is a schematic outlining an in vivo study protocol. DSS drinking water was given for 5 days.
[0142] FIG. 32B is a graph of the body weight as measured over the course of the study described in FIG. 32A.
[0143] FIG. 32C is a graph of CFU/g of colon content as collected according to the protocol described in FIG. 32A.
[0144] FIG. 32D is a graph of CFU/g of mesenteric lymph node as collected according to the protocol described in FIG. 32A.
[0145] FIG. 32E is a graph of CFU/g of liver as collected according to the protocol described in FIG. 32A.
[0146] FIG. 32F is a graph of CFU/g of spleen as collected according to the protocol described in FIG. 32A.
[0147] FIG. 32G is a graph of CFU/g of blood as collected according to the protocol described in FIG. 32A.
[0148] FIG. 3 A and FIG. 33B are bar graphs showing serum levels of EcN-EGF at day 6 (FIG. 33A) or day 9 (FIG. 33B) of a study essentially the same as shown in FIG. 32A. L.O.D is Limit of Detection for the EGF assay.
[0149] FIG. 34A and FIG. 34B are graphs showing the number of Ki67 -positive cells per crypt in a mid-distal colon section (FIG. 34A) and in a distal colon section (FIG. 34B), from two studies in which DSS treated mice were administered EcN-EGF biomass prepared on in two separate batches (Biomass 1 (BM1; Study 1) and Biomass 2 (BM2; Study 2)). Naive: no DSS; vehicle: vehicle control; EcN-EGF BM1: EcN-EGF Biomass 1 (Study 1); EcN-EGF BM2: EcN-EGF Biomass 2 (Study 2). [0150] FIG. 34C, FIG. 34D, and FIG. 34E are graphs showing the total histopath score calculated from distal colon section ~0.5cm from rectum, and mid-distal colon section ~ 1.5cm from rectum from two studies in which DSS treated mice were administered EcN and EcN-EGF biomass in three separate batches (Biomass 1; Study 1 (FIG. 34C), Biomass 2; Study 2 (FIG. 34D), and Biomass 2; Study 3 (FIG. 34E)).
[0151] FIGs. 35A, 35B, and 35C are graphs showing blood concentration of IR dye in 3 identical studies assessing intestinal permeability (Study 1: FIG. 35A, Study 2: FIG. 35B; Study 3: FIG. 35C). Mice orally dosed with 2 mg/kg IRDye 800CW (~lkDa in size) intestinal permeability dye approximately 17 hours prior to sacrifice. Serum was collected and IRDye was measured 800CW fluorescence (excitation/emission 774/789 nm) was measured using a Li-Cor Odyssey CLx.
Fluorescence was converted to serum concentration using a standard curve and relative changes in blood concentration were compared to validate 800CW permeability measurements.
[0152] FIGs. 36A, 36B, and 36C show tissue damage scored in Study 2 from mid-distal colon sections (FIG. 36A), distal colon sections (FIG. 36B) and the average of the tissue damage score from both mid-distal and distal colon sections (FIG. 36C).
[0153] FIGs. 37A, 37B, and 37C show ulceration scored in Study 2 from mid-distal colon sections (FIG. 37 A), distal colon sections (FIG. 37B) and the average of the ulceration score from both mid- distal and distal colon sections (FIG. 37 C).
[0154] FIGs. 38A, 38B, and 38C show immune cell infiltration scored from mid-distal colon sections (FIG. 38A), distal colon sections (FIG. 38B) and the average of the immune cell infiltration score from both mid-distal and distal colon sections (FIG. 38C).
[0155] FIGs. 39A, 39B, and 39C show tissue damage scored in Study 3 from mid-distal colon sections (FIG. 39 A), distal colon sections (FIG. 39B) and the average of the tissue damage score from both mid-distal and distal colon sections (FIG. 39C).
[0156] FIGs. 40A, 40B, and 40C show ulceration scored in Study 3 from mid-distal colon sections (FIG. 40A), distal colon sections (FIG. 40B) and the average of the ulceration score from both mid- distal and distal colon sections (FIG. 40C).
[0157] FIGs. 41A, 41B, and 41C show immune cell infiltration scored in Study 3 from mid-distal colon sections (FIG. 41A), distal colon sections (FIG. 41B) and the average of the immune cell infiltration score from both mid-distal and distal colon sections (FIG. 41C).
[0158] FIGs. 42A, 42B, and 42C show the effects of DSS (i.e., vehicle control only) in the DSS model employed in Studies 1-3, comparing permeability (FIG. 42A), tissue myeloperoxidase (MPO, a measure for immune system activity) (FIG. 42B), and total histological score (FIG. 42C), showing differing disease severity between studies using this DSS model.
[0159] FIG. 43 shows total histopathological score of vehicle control in the DSS model employed in Studies 1-3, showing differing disease severity between Studies 1-3, and greater disease severity in the distal colon than the mid-distal colon in this DSS model.
DETAILED DESCRIPTION
[0160] The present disclosure relates to compositions of recombinant bacteria and methods for secreting EGF from recombinant bacteria for treatment of diseases or disorders. The recombinant
bacteria disclosed herein are capable of high yield production of functionally active EGF, which is secreted as therapeutically active polypeptide.
Definitions
[0161] In order that the disclosure may be more readily understood, certain terms are first defined. These definitions should be read in light of the remainder of the disclosure and as understood by a person of ordinary skill in the art. Unless defined otherwise, all technical and scientific terms used herein have the same meaning as commonly understood by a person of ordinary skill in the art. Additional definitions are set forth throughout the detailed description.
[0162] As used herein, the term “EGF” is used to encompass human, murine, and other species and sources of EGF polypeptides and polynucleotides, including naturally occurring EGF (e.g., naturally occurring EGF isoforms) and non-naturally occurring EGF (e.g., synthetic or engineered variants of EGF). Exemplary EGF sequences are known in the art. See, e.g., Dube et al., Epidermal growth factor receptor inhibits colitis-associated cancer in mice, J Clin Invest 2012; Sinha et al., Epidermal Growth Factor Enemas with Oral Mesalamine for Mild-to-Moderate Left-Sided Ulcerative Colitis or Proctitis, N Engl J Med 2003; Yu et al., Nononcogenic restoration of the intestinal barrier by E. coli- delivered human EGF, JCI Insight 2019; US20200299702A1; WO2013009103 A2; the contents of which are hereby incorporated by reference in their entireties.
[0163] In some embodiments, a human EGF polypeptide comprises SEQ ID NO: 505 (below), a functional fragment and/or variant thereof, or a polypeptide having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 505 or a functional fragment and/or variant thereof, e.g., as assessed by an alignment algorithm such as NCBI BLAST. A human EGF polynucleotide encodes a human EGF polypeptide. A non-limiting example of a human EGF polynucleotide comprises SEQ ID NO: 511.
[0164] Human EGF:
NSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELR (SEQ ID NO: 505)
[0165] Human EGF:
AATAGTGACAGCGAATGTCCGCTGTCGCACGATGGTTATTGCCTTCATGATGGGGTGTGC ATGTACATTGAGGCATTGGACAAATATGCCTGCAACTGTGTTGTCGGCTATATCGGCGAA CGGTGTCAGTACCGTGATCTGAAATGGTGGGAATTACGCTAA (SEQ ID NO: 511) [0166] As used herein, the term “recombinant microorganism” refers to a microorganism, e.g., bacterial, yeast, or viral cell, or bacteria, yeast, or virus, that has been genetically modified from its native state. Thus, a “recombinant bacterial cell” or “recombinant bacteria” refers to a bacterial cell or bacteria that have been genetically modified from their native state. For instance, a recombinant bacterial cell may have nucleotide insertions, nucleotide deletions, nucleotide rearrangements, and nucleotide modifications introduced into their DNA. These genetic modifications may be present in the chromosome of the bacteria or bacterial cell, or on a plasmid in the bacteria or bacterial cell.
Recombinant bacterial cells disclosed herein may comprise exogenous nucleotide sequences on plasmids. Alternatively, recombinant bacterial cells may comprise exogenous nucleotide sequences stably incorporated into their chromosome.
[0167] A “programmed or engineered microorganism” refers to a microorganism, e.g., bacterial or viral cell, or bacteria or virus, that has been genetically modified from its native state to perform a specific function. Thus, a “programmed or engineered bacterial cell” or “programmed or engineered bacteria” refers to a bacterial cell or bacteria that has been genetically modified from its native state to perform a specific function. In certain embodiments, the programmed or engineered bacterial cell has been modified to express one or more proteins, for example, one or more EGF proteins that have a therapeutic activity or serve a therapeutic purpose. The programmed or engineered bacterial cell may additionally have the ability to stop growing or to destroy itself once EGF has been expressed.
[0168] As used herein, the term “gene” refers to a nucleic acid fragment that encodes a protein or fragment thereof, optionally including regulatory sequences preceding (5’ non-coding sequences) and following (3’ non-coding sequences) the coding sequence. In one embodiment, a “gene” does not include regulatory sequences preceding and following the coding sequence. A “native gene” refers to a gene as found in nature, optionally with its own regulatory sequences preceding and following the coding sequence. A “chimeric gene” refers to any gene that is not a native gene, optionally comprising regulatory sequences preceding and following the coding sequence, wherein the coding sequences and/or the regulatory sequences, in whole or in part, are not found together in nature. Thus, a chimeric gene may comprise regulatory sequences and coding sequences that are derived from different sources, or regulatory and coding sequences that are derived from the same source, but arranged differently than is found in nature.
[0169] As used herein, the term “gene sequence” is meant to refer to a genetic sequence, e.g., a nucleic acid sequence. The gene sequence or genetic sequence is meant to include a complete gene sequence or a partial gene sequence. The gene sequence or genetic sequence is meant to include sequence that encodes a protein or polypeptide and is also meant to include genetic sequence that does not encode a protein or polypeptide, e.g., a regulatory sequence, leader sequence, signal sequence, or other non-protein coding sequence.
[0170] In some embodiments, the term EGF “gene” or “gene sequence” is meant to refer to a nucleic acid sequence encoding an EGF effector polypeptide described herein. The nucleic acid sequence may comprise the entire gene sequence or a partial gene sequence encoding a functional molecule. The nucleic acid sequence may be a natural sequence or a synthetic sequence. The nucleic acid sequence may comprise a native or wild-type sequence or may comprise a modified sequence having one or more insertions, deletions, substitutions, or other modifications, for example, the nucleic acid sequence may be codon-optimized.
[0171] As used herein, a “heterologous” gene or “heterologous sequence” refers to a nucleotide sequence that is not normally found in a given cell in nature. As used herein, a heterologous sequence
encompasses a nucleic acid sequence that is exogenously introduced into a given cell and can be a native sequence (naturally found or expressed in the cell) or non-native sequence (not naturally found or expressed in the cell) and can be a natural or wild-type sequence or a variant, non-natural, or synthetic sequence. “Heterologous gene” includes a native gene, or fragment thereof, that has been introduced into the host cell in a form that is different from the corresponding native gene. For example, a heterologous gene may include a native coding sequence that is a portion of a chimeric gene to include non-native regulatory regions that is reintroduced into the host cell. A heterologous gene may also include a native gene, or fragment thereof, introduced into a non-native host cell. Thus, a heterologous gene may be foreign or native to the recipient cell; a nucleic acid sequence that is naturally found in a given cell but expresses an unnatural amount of the nucleic acid and/or the polypeptide which it encodes; and/or two or more nucleic acid sequences that are not found in the same relationship to each other in nature. As used herein, the term “endogenous gene” refers to a native gene in its natural location in the genome of an organism. As used herein, the term “transgene” refers to a gene that has been introduced into the host organism, e.g., host bacterial cell, genome. [0172] As used herein, a “non-native” nucleic acid sequence refers to a nucleic acid sequence not normally present in a microorganism, e.g., an extra copy of an endogenous sequence, or a heterologous sequence such as a sequence from a different species, strain, or substrain of bacteria or virus, or a sequence that is modified and/or mutated as compared to the unmodified sequence from bacteria or virus of the same subtype. In some embodiments, the non-native nucleic acid sequence is a synthetic, non-naturally occurring sequence (see, e.g., Purcell et al., 2013). The non-native nucleic acid sequence may be a regulatory region, a promoter, a gene, and/or one or more genes in gene cassette. In some embodiments, “non-native” refers to two or more nucleic acid sequences that are not found in the same relationship to each other in nature. The non-native nucleic acid sequence may be present on a plasmid or chromosome. In some embodiments, the genetically engineered microorganism of the disclosure comprises a gene that is operably linked to a promoter that is not associated with said gene in nature. For example, in some embodiments, the recombinant bacteria disclosed herein comprise a gene that is operably linked to a directly or indirectly inducible promoter that is not associated with said gene in nature, e.g., an FNR responsive promoter (or other promoter disclosed herein) operably linked to EGF.
[0173] As used herein, the term “coding region” refers to a nucleotide sequence that codes for a specific amino acid sequence. The term “regulatory sequence” refers to a nucleotide sequence located upstream (5’ non-coding sequences), within, or downstream (3’ non-coding sequences) of a coding sequence, and which influences the transcription, RNA processing, RNA stability, or translation of the associated coding sequence. Examples of regulatory sequences include, but are not limited to, promoters, translation leader sequences, effector binding sites, signal sequences, and stem-loop structures. In one embodiment, the regulatory sequence comprises a promoter, e.g., an FNR responsive promoter or other promoter disclosed herein.
[0174] As used herein, a “gene cassette” or “operon” encoding a biosynthetic pathway refers to the two or more genes for the production of an effector molecule such as EGF. In addition to encoding a set of genes capable of producing said molecule, the gene cassette or operon may also comprise additional transcription and translation elements, e.g., a ribosome binding site.
[0175] A regulatory region “operably linked” refers to the association of nucleic acid sequences on a single nucleic acid fragment so that the function of one is affected by the other. A regulatory element is operably linked with a coding sequence when it is capable of affecting the expression of the gene coding sequence, regardless of the distance between the regulatory element and the coding sequence. More specifically, operably linked refers to a nucleic acid sequence, e.g., a gene encoding EGF, that is joined to a regulatory sequence in a manner which allows expression of the nucleic acid sequence, e.g., the gene encoding the EGF molecule described herein. In other words, the regulatory sequence acts in cis. In one embodiment, a gene may be “directly linked” to a regulatory sequence in a manner which allows expression of the gene. In another embodiment, a gene may be “indirectly linked” to a regulatory sequence in a manner which allows expression of the gene. In one embodiment, two or more genes may be directly or indirectly linked to a regulatory sequence in a manner which allows expression of the two or more genes. A regulatory region or sequence is a nucleic acid that can direct transcription of an EGF gene and may comprise promoter sequences, enhancer sequences, response elements, protein recognition sites, inducible elements, promoter control elements, protein binding sequences, 5’ and 3’ untranslated regions, transcriptional start sites, termination sequences, polyadenylation sequences and introns.
[0176] A “promoter” as used herein, refers to a nucleotide sequence that is capable of controlling the expression of a coding sequence or gene. Promoters are generally located 5’ of the sequence that they regulate. Promoters may be derived in their entirety from a native gene, or be composed of different elements derived from promoters found in nature, and/or comprise synthetic nucleotide segments. Those skilled in the art will readily ascertain that different promoters may regulate expression of a coding sequence or gene in response to a particular stimulus, e.g., in a cell- or tissue-specific manner, in response to different environmental or physiological conditions, or in response to specific compounds. Prokaryotic promoters are typically classified into two classes: inducible and constitutive. A “constitutive promoter” refers to a promoter that allows for continual transcription of the coding sequence or gene under its control.
[0177] “Constitutive promoter” refers to a promoter that is capable of facilitating continuous transcription of a coding sequence or gene under its control and/or to which it is operably linked. Constitutive promoters and variants are well known in the art and include, but are not limited to, Ptac promoter, BBa_J23100, a constitutive Escherichia coli aS promoter (e.g., an osmY promoter (International Genetically Engineered Machine (iGEM) Registry of Standard Biological Parts Name BBa_J45992; BBa_J45993)), a constitutive Escherichia coli a32 promoter (e.g., htpG heat shock promoter (BBa_J45504)), a constitutive Escherichia coli a70 promoter (e.g., lacq promoter
(BBa_J54200; BBa_J56015), E. coli CreABCD phosphate sensing operon promoter (BBa_J64951), GlnRS promoter (BBa_K088007), lacZ promoter (BBa_Kl 19000; BBa_Kl 19001); M13K07 gene I promoter (BBa_M13101); M13K07 gene II promoter (BBa_M13102), M13K07 gene III promoter (BBa_M13103), M13K07 gene IV promoter (BBa_M13104), M13K07 gene V promoter (BBa_M13105), M13K07 gene VI promoter (BBa_M13106), M13K07 gene VIII promoter (BBa_M13108), M13110 (BBa_M13110)), a constitutive Bacillus subtilis oA promoter (e.g., promoter veg (BBa_K143013), promoter 43 (BBa_K143013), PliaG (BBa_K823000), PlepA (BBa_K823002), Pveg (BBa_K823003)), a constitutive Bacillus subtilis oB promoter (e.g., promoter etc (BBa_K143010), promoter gsiB (BBa_K143011)), a Salmonella promoter (e.g., Pspv2 from Salmonella (BBa_Kl 12706), Pspv from Salmonella (BBa_Kl 12707)), a bacteriophage T7 promoter (e.g., T7 promoter (BBa_I712074; BBa_I719005; BBa_J34814; BBa_J64997; BBa_Kl 13010; BBa_K113011; BBa_K113012; BBa_R0085; BBa_R0180; BBa_R0181; BBa_R0182; BBa_R0183; BBa_Z0251; BBa_Z0252; BBa_Z0253)), and a bacteriophage SP6 promoter (e.g., SP6 promoter (BBa_J64998)).
[0178] An “inducible promoter” refers to a regulatory region that is operably linked to one or more genes, wherein expression of the gene(s) is increased in the presence of an inducer of said regulatory region. An “inducible promoter” refers to a promoter that initiates increased levels of transcription of the coding sequence or gene under its control in response to a stimulus or an exogenous environmental condition. A “directly inducible promoter” refers to a regulatory region, wherein the regulatory region is operably linked to a gene encoding a protein or polypeptide, where, in the presence of an inducer of said regulatory region, the protein or polypeptide is expressed. An “indirectly inducible promoter” refers to a regulatory system comprising two or more regulatory regions, for example, a first regulatory region that is operably linked to a first gene encoding a first protein, polypeptide, or factor, e.g., a transcriptional regulator, which is capable of regulating a second regulatory region that is operably linked to a second gene, the second regulatory region may be activated or repressed, thereby activating or repressing expression of the second gene. Both a directly inducible promoter and an indirectly inducible promoter are encompassed by “inducible promoter.” [0179] As used herein, “stably maintained” or “stable” bacterium is used to refer to a bacterial host cell carrying non-native genetic material, e.g., a gene encoding one or more EGF molecule(s), which is incorporated into the host genome or propagated on a self-replicating extra-chromosomal plasmid, such that the non-native genetic material is retained, expressed, and propagated. The stable bacterium is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut. For example, the stable bacterium may be a recombinant bacterium comprising a gene encoding a encoding a payload, e.g., one or more EGF molecule(s), in which the plasmid or chromosome carrying the gene is stably maintained in the bacterium, such that the payload can be expressed in the bacterium, and the bacterium is capable of survival and/or growth in vitro and/or in vivo. In some
embodiments, copy number affects the stability of expression of the non-native genetic material. In some embodiments, copy number affects the level of expression of the non-native genetic material. [0180] As used herein, the term “expression” refers to the transcription and stable accumulation of sense (mRNA) or anti-sense RNA derived from a nucleic acid, and/or to translation of an mRNA into a polypeptide.
[0181] As used herein, the term “plasmid” or “vector” refers to an extrachromosomal nucleic acid, e.g., DNA, construct that is not integrated into a bacterial cell’s genome. Plasmids are usually circular and capable of autonomous replication. Plasmids may be low-copy, medium-copy, or high-copy, as is well known in the art. Plasmids may optionally comprise a selectable marker, such as an antibiotic resistance gene, which helps select for bacterial cells containing the plasmid and which ensures that the plasmid is retained in the bacterial cell. A plasmid disclosed herein may comprise a nucleic acid sequence encoding a heterologous gene, e.g., a gene encoding EGF molecule.
[0182] As used herein, the term “transform” or “transformation” refers to the transfer of a nucleic acid fragment into a host bacterial cell, resulting in genetically-stable inheritance. Host bacterial cells comprising the transformed nucleic acid fragment are referred to as “recombinant” or “transgenic” or “transformed” organisms.
[0183] The term “genetic modification,” as used herein, refers to any genetic change. Exemplary genetic modifications include those that increase, decrease, or abolish the expression of a gene, including, for example, modifications of native chromosomal or extrachromosomal genetic material. Exemplary genetic modifications also include the introduction of at least one plasmid, modification, mutation, base deletion, base addition, base substitution, and/or codon modification of chromosomal or extrachromosomal genetic sequence(s), gene over-expression, gene amplification, gene suppression, promoter modification or substitution, gene addition (either single or multi-copy), antisense expression or suppression, or any other change to the genetic elements of a host cell, whether the change produces a change in phenotype or not. Genetic modification can include the introduction of a plasmid, e.g., a plasmid comprising EGF operably linked to a promoter, into a bacterial cell. Genetic modification can also involve a targeted replacement in the chromosome, e.g., to replace a native gene promoter with an inducible promoter, regulated promoter, strong promoter, or constitutive promoter. Genetic modification can also involve gene amplification, e.g., introduction of at least one additional copy of a native gene into the chromosome of the cell. Alternatively, chromosomal genetic modification can involve a genetic mutation.
[0184] As used herein, the term “genetic mutation” refers to a change or changes in a nucleotide sequence of a gene or related regulatory region that alters the nucleotide sequence as compared to its native or wild-type sequence. Mutations include, for example, substitutions, additions, and deletions, in whole or in part, within the wild-type sequence. Such substitutions, additions, or deletions can be single nucleotide changes (e.g., one or more point mutations), or can be two or more nucleotide changes, which may result in substantial changes to the sequence. Mutations can occur within the
coding region of the gene as well as within the non-coding and regulatory sequence of the gene. The term “genetic mutation” is intended to include silent and conservative mutations within a coding region as well as changes which alter the amino acid sequence of the polypeptide encoded by the gene. A genetic mutation in a gene coding sequence may, for example, increase, decrease, or otherwise alter the activity (e.g., enzymatic activity) of the gene’s polypeptide product. A genetic mutation in a regulatory sequence may increase, decrease, or otherwise alter the expression of sequences operably linked to the altered regulatory sequence.
[0185] As used herein, the term “transporter” is meant to refer to a mechanism, e.g., protein, proteins, or protein complex, for importing a molecule, e.g., amino acid, peptide (di-peptide, tri- peptide, polypeptide, etc.), toxin, metabolite, substrate, as well as other biomolecules into the microorganism from the extracellular milieu.
[0186] As used herein, the phrase “exogenous environmental condition” or “exogenous environment signal” refers to settings, circumstances, stimuli, or biological molecules under which a promoter described herein is directly or indirectly induced. The phrase “exogenous environmental conditions” is meant to refer to the environmental conditions external to the engineered microorganism, but endogenous or native to the host subject environment. Thus, “exogenous” and “endogenous” may be used interchangeably to refer to environmental conditions in which the environmental conditions are endogenous to a mammalian body, but external or exogenous to an intact microorganism cell. In some embodiments, the exogenous environmental conditions are specific to the gut of a mammal. In some embodiments, the exogenous environmental conditions are specific to the upper gastrointestinal tract of a mammal. In some embodiments, the exogenous environmental conditions are specific to the lower gastrointestinal tract of a mammal. In some embodiments, the exogenous environmental conditions are specific to the small intestine of a mammal. In some embodiments, the exogenous environmental conditions are low-oxygen, microaerobic, or anaerobic conditions, such as the environment of the mammalian gut. In some embodiments, exogenous environmental conditions are molecules or metabolites that are specific to the mammalian gut, e.g., propionate. In some embodiments, the exogenous environmental condition is a tissue-specific or disease-specific metabolite or molecule(s). In some embodiments, the exogenous environmental condition is specific to an inflammatory disease. In some embodiments, the exogenous environmental condition is a low- pH environment. In some embodiments, the genetically engineered microorganism of the disclosure comprises a pH-dependent promoter. In some embodiments, the genetically engineered microorganism of the disclosure comprises an oxygen level-dependent promoter. In some aspects, bacteria have evolved transcription factors that are capable of sensing oxygen levels. Different signaling pathways may be triggered by different oxygen levels and occur with different kinetics. An “oxygen level-dependent promoter” or “oxygen level-dependent regulatory region” refers to a nucleic acid sequence to which one or more oxygen level-sensing transcription factors is capable of binding,
wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression.
[0187] Examples of oxygen level-dependent transcription factors include, but are not limited to, FNR (fumarate and nitrate reductase), ANR (anaerobic nitrate respiration), and DNR (dissimilatory nitrate respiration regulator). Corresponding FNR -responsive promoters, ANR-responsive promoters, and DNR-responsive promoters are known in the art (see, e.g., Castiglione et al., 2009; Eiglmeier et al., 1989; Galimand et al., 1991; Hasegawa et al., 1998; Hoeren et al., 1993; Salmon et al., 2003), and non-limiting examples are shown in Table 1.
[0188] In a non-limiting example, a promoter (PfnrS) was derived from the E. coll Nissle fumarate and nitrate reductase gene S (fnrS) that is known to be highly expressed under conditions of low or no environmental oxygen (Durand and Storz, 2010; Boysen et al, 2010). The PfnrS promoter is activated under anaerobic conditions by the global transcriptional regulator FNR that is naturally found in Nissle. Under anaerobic conditions, FNR forms a dimer and binds to specific sequences in the promoters of specific genes under its control, thereby activating their expression. However, under aerobic conditions, oxygen reacts with iron-sulfur clusters in FNR dimers and converts them to an inactive form. In this way, the PfnrS inducible promoter is adopted to modulate the expression of proteins or RNA. PfnrS is used interchangeably in this application as FNRS, fnrs, FNR, P-FNRS promoter and other such related designations to indicate the promoter PfnrS.
[0189] As used herein, a “tunable regulatory region” refers to a nucleic acid sequence under direct or indirect control of a transcription factor and which is capable of activating, repressing, derepressing, or otherwise controlling gene expression relative to levels of an inducer. In some embodiments, the tunable regulatory region comprises a promoter sequence. The inducer may be RNS, or other inducer described herein, and the tunable regulatory region may be a RNS-responsive regulatory region or other responsive regulatory region described herein. The tunable regulatory region may be operatively linked to a gene sequence(s) or gene cassette for the production of one or more payloads, e.g., EGF gene cassette or gene sequence(s). For example, in one specific embodiment, the tunable regulatory region is a RNS-derepressible regulatory region, and when RNS is present, a RNS-sensing transcription factor no longer binds to and/or represses the regulatory region, thereby permitting expression of the operatively linked gene or gene cassette. In this instance, the tunable regulatory region derepresses gene or gene cassette expression relative to RNS levels. Each gene or gene
cassette may be operatively linked to a tunable regulatory region that is directly or indirectly controlled by a transcription factor that is capable of sensing at least one RNS.
[0190] In some embodiments, the exogenous environmental conditions are the presence or absence of reactive oxygen species (ROS). In other embodiments, the exogenous environmental conditions are the presence or absence of reactive nitrogen species (RNS). In some embodiments, exogenous environmental conditions are biological molecules that are involved in the inflammatory response, for example, molecules present in an inflammatory disorder of the gut. In some embodiments, the exogenous environmental conditions or signals exist naturally or are naturally absent in the environment in which the recombinant bacterial cell resides. In some embodiments, the exogenous environmental conditions or signals are artificially created, for example, by the creation or removal of biological conditions and/or the administration or removal of biological molecules.
[0191] In some embodiments, the exogenous environmental condition(s) and/or signal(s) stimulates the activity of an inducible promoter. In some embodiments, the exogenous environmental condition(s) and/or signal(s) that serves to activate the inducible promoter is not naturally present within the gut or any other organ of a mammal. In some embodiments, the inducible promoter is stimulated by a molecule or metabolite that is administered in combination with the pharmaceutical composition of the disclosure, for example, tetracycline, arabinose, or any biological molecule that serves to activate an inducible promoter. In some embodiments, the exogenous environmental condition(s) and/or signal(s) is added to culture media comprising a recombinant bacterial cell of the disclosure. In some embodiments, the exogenous environmental condition that serves to activate the inducible promoter is naturally present within the gut of a mammal (for example, low oxygen or anaerobic conditions, or biological molecules involved in an inflammatory response). In some embodiments, the loss of exposure to an exogenous environmental condition (for example, in vivo) inhibits the activity of an inducible promoter, as the exogenous environmental condition is not present to induce the promoter (for example, an aerobic environment outside the gut). “Gut” refers to the organs, glands, tracts, and systems that are responsible for the transfer and digestion of food, absorption of nutrients, and excretion of waste. In humans, the gut comprises the gastrointestinal (GI) tract, which starts at the mouth and ends at the anus, and additionally comprises the esophagus, stomach, small intestine, and large intestine. The gut also comprises accessory organs and glands, such as the spleen, liver, gallbladder, and pancreas. The upper gastrointestinal tract comprises the esophagus, stomach, and duodenum of the small intestine. The lower gastrointestinal tract comprises the remainder of the small intestine, i.e., the jejunum and ileum, and all of the large intestine, i.e., the cecum, colon, rectum, and anal canal. Bacteria can be found throughout the gut, e.g., in the gastrointestinal tract, and particularly in the intestines.
[0192] As used herein, the term “low oxygen” is meant to refer to a level, amount, or concentration of oxygen (Oj) that is lower than the level, amount, or concentration of oxygen that is present in the atmosphere (e.g., <21% Oj; <160 torr Oj)). Thus, the term “low oxygen condition or conditions” or
“low oxygen environment” refers to conditions or environments containing lower levels of oxygen than are present in the atmosphere. In some embodiments, the term “low oxygen” is meant to refer to the level, amount, or concentration of oxygen (O2) found in a mammalian gut, e.g., lumen, stomach, small intestine, duodenum, jejunum, ileum, large intestine, cecum, colon, distal sigmoid colon, rectum, and anal canal. In some embodiments, the term “low oxygen” is meant to refer to a level, amount, or concentration of O2 that is 0-60 mmHg O2 (0-60 torr O2) (e.g., 0, 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45,46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, and 60 mmHg O2), including any and all incremental fraction(s) thereof (e.g., 0.2 mmHg, 0.5 mmHg O2, 0.75 mmHg O2,
I.25 mmHg O2, 2.175 mmHg O2, 3.45 mmHg O2, 3.75 mmHg O2, 4.5 mmHg O2, 6.8 mmHg O2,
I I.35 mmHg 02, 46.3 mmHg O2, 58.75 mmHg, etc., which exemplary fractions are listed here for illustrative purposes and not meant to be limiting in any way). In some embodiments, “low oxygen” refers to about 60 mmHg O2 or less (e.g., 0 to about 60 mmHg O2). The term “low oxygen” may also refer to a range of O2 levels, amounts, or concentrations between 0-60 mmHg O2 (inclusive), e.g., 0-5 mmHg O2, < 1.5 mmHg O2, 6-10 mmHg, < 8 mmHg, 47-60 mmHg, etc. which listed exemplary ranges are listed here for illustrative purposes and not meant to be limiting in any way. See, for example, Albenberg et al., Gastroenterology, 147(5): 1055-1063 (2014); Bergofsky et al., J Clin. Invest., 41(11): 1971- 1980 (1962); Crompton et al., J Exp. Biol., 43: 473-478 (1965); He et al., PNAS (USA), 96: 4586-4591 (1999); McKeown, Br. J. Radiol., 87:20130676 (2014) (doi:
10.1259/brj .20130676), each of which discusses the oxygen levels found in the mammalian gut of various species and each of which are incorporated by reference herewith in their entireties. In some embodiments, “low oxygen” is meant to refer to the level, amount, or concentration of oxygen (O2) present in partially aerobic, semi aerobic, microaerobic, nanoaerobic, microoxicanoxic, and/or anaerobic conditions. For example, Table 2 summarizes the amount of oxygen present in various organs and tissues. In some embodiments, the level, amount, or concentration of oxygen (O2) is expressed as the amount of dissolved oxygen (“DO”) which refers to the level of free, non-compound oxygen (O2) present in liquids and is typically reported in milligrams per liter (mg/L), parts per million (ppm; Img/L = 1 ppm), or in micromoles (umole) (1 umole O2 = 0.022391 mg/L O2). Fondriest Environmental, Inc., “Dissolved Oxygen”, Fundamentals of Environmental Measurements, 19 Nov 2013, www.fondriest.com/environmental-measurements/parameters/water-quality/dissolved- oxygen/>. In some embodiments, the term “low oxygen” is meant to refer to a level, amount, or concentration of oxygen (O2) that is about 6.0 mg/L DO or less, e.g., 6.0 mg/L, 5.0 mg/L, 4.0 mg/L, 3.0 mg/L, 2.0 mg/L, 1.0 mg/L, or 0 mg/L, and any fraction therein, e.g., 3.25 mg/L, 2.5 mg/L, 1.75 mg/L, 1.5 mg/L, 1.25 mg/L, 0.9 mg/L, 0.8 mg/L, 0.7 mg/L, 0.6 mg/L, 0.5 mg/L, 0.4 mg/L, 0.3 mg/L, 0.2 mg/L and 0.1 mg/L DO, which exemplary fractions are listed here for illustrative purposes and not meant to be limiting in any way. The level of oxygen in a liquid or solution may also be reported as a percentage of air saturation or as a percentage of oxygen saturation (the ratio of the concentration of
dissolved oxygen (O2) in the solution to the maximum amount of oxygen that will dissolve in the solution at a certain temperature, pressure, and salinity under stable equilibrium). Well- aerated solutions (e.g., solutions subjected to mixing and/or stirring) without oxygen producers or consumers are 100% air saturated. In some embodiments, the term “low oxygen” is meant to refer to 40% air saturation or less, e.g., 40%, 39%, 38%, 37%, 36%, 35%, 34%, 33%, 32%, 31%, 30%, 29%, 28%, 27%, 26%, 25%, 24%, 23%, 22%, 21%, 20%, 19%, 18%, 17%, 16%, 15%, 14%, 13%, 12%, 11%, 10%, 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, and 0% air saturation, including any and all incremental fraction(s) thereof (e.g., 30.25%, 22.70%, 15.5%, 7.7%, 5.0%, 2.8%, 2.0%, 1.65%, 1.0%, 0.9%, 0.8%, 0.75%, 0.68%, 0.5%. 0.44%, 0.3%, 0.25%, 0.2%, 0.1%, 0.08%, 0.075%, 0.058%, 0.04%. 0.032%, 0.025%, 0.01%, etc.) and any range of air saturation levels between 0-40%, inclusive (e.g., 0- 5%, 0.05 - 0.1%, 0.1-0.2%, 0.1-0.5%, 0.5 - 2.0%, 0-10%, 5-10%, 10-15%, 15-20%, 20-25%, 25- 30%, etc.). The exemplary fractions and ranges listed here are for illustrative purposes and not meant to be limiting in any way. In some embodiments, the term “low oxygen” is meant to refer to 9% O2 saturation or less, e.g., 9%, 8%, 7%, 6%, 5%, 4%, 3%, 2%, 1%, 0%, O2 saturation, including any and all incremental fraction(s) thereof (e.g., 6.5%, 5.0%, 2.2%, 1.7%, 1.4%, 0.9%, 0.8%, 0.75%, 0.68%, 0.5%. 0.44%, 0.3%, 0.25%, 0.2%, 0.1%, 0.08%, 0.075%, 0.058%, 0.04%. 0.032%, 0.025%, 0.01%, etc.) and any range of O2 saturation levels between 0-9%, inclusive (e.g., 0-5%, 0.05 - 0.1%, 0.1- 0.2%, 0.1-0.5%, 0.5 - 2.0%, 0-8%, 5-7%, 0.3-4.2% O2, etc.). The exemplary fractions and ranges listed here are for illustrative purposes and not meant to be limiting in any way.
0193] “Microorganism” refers to an organism or microbe of microscopic, submicroscopic, or ultramicroscopic size that typically consists of a single cell. Examples of microorganisms include bacteria, viruses, parasites, fungi, certain algae, yeast, e.g., Saccharomyces, and protozoa. In some aspects, the microorganism is engineered (“engineered microorganism”) to produce one or more therapeutic molecules, e.g., an anti-inflammatory or barrier enhancer molecule. In certain embodiments, the engineered microorganism is an engineered bacterium.
[0194] “Non-pathogenic bacteria” refer to bacteria that are not capable of causing disease or harmful responses in a host. In some embodiments, non-pathogenic bacteria are Gram-negative bacteria. In some embodiments, non-pathogenic bacteria are Gram-positive bacteria. In some embodiments, non- pathogenic bacteria do not contain lipopolysaccharides (LPS). In some embodiments, non-pathogenic bacteria are commensal bacteria. Examples of non-pathogenic bacteria include, but are not limited to certain strains belonging to the genus Bacillus, Bacteroides, Bifidobacterium, Brevibacteria,
Clostridium, Enterococcus, Escherichia coli, Lactobacillus, Lactococcus, Saccharomyces, and Staphylococcus, e.g., Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium bifidum, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium butyricum, Enterococcus faecium, Escherichia coli, Escherichia coli Nissle, Lactobacillus acidophilus, Lactobacillus bulgaricus, Lactobacillus casei, Lactobacillus johnsonii, Lactobacillus paracasei, Lactobacillus plantarum, Lactobacillus reuteri, Lactobacillus rhamnosus, Lactococcus lactis and Saccharomyces boulardii (Sonnenborn et al., 2009; Dinleyici et al., 2014; U.S. Patent No. 6,835,376; U.S. Patent No. 6,203,797; U.S. Patent No. 5,589,168; U.S. Patent No. 7,731,976). Non-pathogenic bacteria also include commensal bacteria, which are present in the indigenous microbiota of the gut. In one embodiment, the disclosure further includes non-pathogenic Saccharomyces, such as Saccharomyces boulardii. Naturally pathogenic bacteria may be genetically engineered to reduce or eliminate pathogenicity.
[0195] “Probiotic” is used to refer to live, non-pathogenic microorganisms, e.g., bacteria, which can confer health benefits to a host organism that contains an appropriate amount of the microorganism. In some embodiments, the host organism is a mammal. In some embodiments, the host organism is a human. In some embodiments, the probiotic bacteria are Gram-negative bacteria. In some embodiments, the probiotic bacteria are Gram-positive bacteria. Some species, strains, and/or subtypes of non-pathogenic bacteria are currently recognized as probiotic bacteria. Examples of probiotic bacteria include, but are not limited to, certain strains belonging to the genus Bifidobacteria, Escherichia Coli, Lactobacillus, and Saccharomyces e.g., Bifidobacterium bifidum, Enterococcus faecium, Escherichia coli strain Nissle, Lactobacillus acidophilus, Lactobacillus bulgaricus, Lactobacillus paracasei, and Lactobacillus plantarum, and Saccharomyces boulardii (Dinleyici et al., 2014; U.S. Patent No. 5,589,168; U.S. Patent No. 6,203,797; U.S. Patent 6,835,376). The probiotic may be a variant or a mutant strain of bacterium (Arthur et al., 2012; Cuevas-Ramos et al., 2010; Olier et al., 2012; Nougayrede et al., 2006). Non-pathogenic bacteria may be genetically engineered to enhance or improve desired biological properties, e.g., survivability. Non-pathogenic bacteria may be genetically engineered to provide probiotic properties. Probiotic bacteria may be genetically engineered to enhance or improve probiotic properties.
[0196] As used herein, the term “auxotroph” or “auxotrophic” refers to an organism that requires a specific factor, e.g., an amino acid, a sugar, or other nutrient) to support its growth. An “auxotrophic modification” is a genetic modification that causes the organism to die in the absence of an exogenously added nutrient essential for survival or growth because it is unable to produce said nutrient. As used herein, the term “essential gene” refers to a gene which is necessary to for cell growth and/or survival. Essential genes are described in more detail infra and include, but are not limited to, DNA synthesis genes (such as thyA), cell wall synthesis genes (such as dapA), and amino acid genes (such as serA and metA).
[0197] As used herein, the term “modulate” and its cognates means to alter, regulate, or adjust positively or negatively a molecular or physiological readout, outcome, or process, to effect a change in said readout, outcome, or process as compared to a normal, average, wild-type, or baseline measurement. Thus, for example, “modulate” or “modulation” includes up-regulation and down- regulation. A non-limiting example of modulating a readout, outcome, or process is effecting a change or alteration in the normal or baseline functioning, activity, expression, or secretion of a biomolecule (e.g., a protein, enzyme, cytokine, growth factor, hormone, metabolite, short chain fatty acid, or other compound). Another non-limiting example of modulating a readout, outcome, or process is effecting a change in the amount or level of a biomolecule of interest, e.g., in the serum and/or the gut lumen. In another non-limiting example, modulating a readout, outcome, or process relates to a phenotypic change or alteration in one or more disease symptoms. Thus, “modulate” is used to refer to an increase, decrease, masking, altering, overriding or restoring the normal functioning, activity, or levels of a readout, outcome or process (e.g, biomolecule of interest, and/or molecular or physiological process, and/or a phenotypic change in one or more disease symptoms).
[0198] As used herein, the terms “modulate” and “treat” a disease and their cognates refer to an amelioration of a disease, disorder, and/or condition, or at least one discernible symptom thereof. In another embodiment, “modulate” and “treat” refer to an amelioration of at least one measurable physical parameter, not necessarily discernible by the patient. In another embodiment, “modulate” and “treat” refer to inhibiting the progression of a disease, disorder, and/or condition, either physically (e.g., stabilization of a discernible symptom), physiologically (e.g., stabilization of a physical parameter), or both. In another embodiment, “modulate” and “treat” refer to slowing the progression or reversing the progression of a disease, disorder, and/or condition. As used herein, “prevent” and its cognates refer to delaying the onset or reducing the risk of acquiring a given disease, disorder and/or condition or a symptom associated with such disease, disorder, and/or condition.
[0199] Those in need of treatment may include individuals already having a particular medical disorder, as well as those at risk of having, or who may ultimately acquire the disorder. The need for treatment is assessed, for example, by the presence of one or more risk factors associated with the development of a disorder, the presence or progression of a disorder, or likely receptiveness to treatment of a subject having the disorder. Treating autoimmune disorders and/or diseases and conditions associated with gut inflammation and/or compromised gut barrier function may encompass reducing or eliminating excess inflammation and/or associated symptoms, and does not necessarily encompass the elimination of the underlying disease. Treating the diseases described herein may encompass increasing levels EGF and does not necessarily encompass the elimination of the underlying disease.
[0200] As used herein, “diseases and conditions associated with gut inflammation and/or compromised gut barrier function” include, but are not limited to, inflammatory bowel diseases, diarrheal diseases, and related diseases. “Inflammatory bowel diseases” and “IBD” are used
interchangeably herein to refer to a group of diseases associated with gut inflammation, which include, but are not limited to, Crohn’ s disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, diversion colitis, Bechet’ s disease, indeterminate colitis, short bowel syndrome, and radiation induced GI toxicity. As used herein, “diarrheal diseases” include, but are not limited to, acute watery diarrhea, e.g., cholera; acute bloody diarrhea, e.g.. dysentery; and persistent diarrhea. As used herein, related diseases include, but are not limited to, short bowel syndrome, ulcerative proctitis, proctosigmoiditis, left-sided colitis, pancolitis, and fulminant colitis.
[0201] Symptoms associated with the aforementioned diseases and conditions include, but are not limited to, one or more of diarrhea, bloody stool, mouth sores, perianal disease, abdominal pain, abdominal cramping, fever, fatigue, weight loss, iron deficiency, anemia, appetite loss, weight loss, anorexia, delayed growth, delayed pubertal development, inflammation of the skin, inflammation of the eyes, inflammation of the joints, inflammation of the liver, and inflammation of the bile ducts. [0202] Different parts of the intestine may be affected in different inflammatory bowel diseases. For example, ulcerative colitis (UC) is a chronic type of IBD in which abnormal reactions of the immune system cause inflammation and ulcers on the inner lining of the large intestine, i.e., the colon, and rectum. Crohn's disease (CD) is another type of IBD, which causes intestinal inflammation, leading to abdominal pain, severe diarrhea, fatigue, weight loss and malnutrition. In Crohn's disease, any part of the small or large intestine may be affected. CD may be present in multiple segments, or it may be continuous, but it most commonly affects the last part of the small intestine (ileum) and parts of the colon.
[0203] Mucosal healing is a main treatment target in UC and CD and it is primarily defined through endoscopic and histologic hallmarks. As used herein, the term “mucosal healing” refers to a process in which the integrity of damaged epithelial barrier and homeostatic function is improved or restored after an injury, e.g., mucosal tissue damage (e.g., epithelial or in the lamina propria) or ulceration, which may occur as a result of a disease or disorder described herein, such as CD or UC. Mechanistically, mucosal healing has three phases, (1) epithelial restitution (where epithelial cells first migrate into the injured area), followed by (2) mucosal cell (e.g., epithelial cell) proliferation, and (3) differentiation and maturation (where intestinal stem cells differentiate and mature into all mature intestinal cell types). Accordingly, one way in which mucosal healing can be directly demonstrated and measured in tissue samples and biopsies is immunohistochemically by using proliferation markers (such as KI67, PCNA or others known in the art). Clinically, mucosal healing manifests itself in reduction or alleviation of tissue damage, reduced or alleviated inflammation at the mucosal lining, alleviation or improvement of ulceration, and ultimately, an improvement in intestinal permeability. [0204] As used herein, the phrases “enhancing mucosal healing” or “enhance mucosal healing” or “promote mucosal healing” “induced mucosal healing” or similar, include both mucosal improvement, i.e., grades of mucosal healing (grades of improvement in tissue damage, of reduction in inflammation, of improved ulceration, and of improved intestinal permeability), as well as
complete absence of indicia of a damaged epithelial barrier (absence of inflammatory and ulcerative lesions in the gut, absence of inflammation, absence of tissue damage, absence of abnormal increase in intestinal permeability).
[0205] Currently, endoscopy is a standard test for assessing extent of mucosal pathology, activity and healing in clinical practice. Extent of mucosal healing may also be assessed through combinations of endoscopy and biopsies. Computed tomography enterography (CTE) and magnetic resonance enterography (MRE) as well as capsule endoscopy are newer modalities for diagnosing and assessing disease activity and mucosal healing in IBD patients. Additionally, biomarkers such as fecal calprotectin, fecal lactoferrin, serum C-reactive protein, serum lipocalin-2, and fecal S100A12 may be used as surrogate markers for mucosal pathology and healing.
[0206] When endoscopy and biopsy and/or biopsies are used to assess pathology or efficacy of a therapy to promote mucosal healing, the level of damage or injury and the extent of mucosal healing is measured by assessing various parameters, including, but not limited to, the amount of epithelial tissue damage, the amount of inflammation (i.e., immune cell infiltration, such as neutrophils), and the occurrence of ulcerations. These observations or measurements are combined to come up with a disease activity score as a measurement of disease. There are endoscopic and histological scoring systems exist, which can be used alone or in combination.
[0207] Endoscopic disease activity scores, which assess the condition of the intestinal lining, and are indicative of levels of damage and the extent of mucosal healing, are known in the art, e.g., different scoring systems exist for CD and ulcerative colitis. Examples of endoscopic disease activity scores for UC include but are not limited to: Truelove and Witts score (mucosal assessment (granularity, hyperemia)); Baron score (bleeding, vascular pattern); Powell-Tuck score (bleeding); Sutherland score (bleeding, friability); Mayo endoscopic subscore (vascular pattern, erythema, friability, erosions and ulcerations, bleeding); Rachmilewitz score (granulation, tissue damage (mucosal damage), vascular pattern, bleeding); Modified Baron score (vascular pattern, friability, ulcerations, bleeding). Scores for CD include Crohn's disease endoscopic index of severity (superficial and deep ulceration, ulcerated and nonulcerated stenosis, surface area of ulcerated and diseased segments); Simple endoscopic score for Crohn's disease (ulcer size, ulcerated surface, affected surface, presence of narrowings); Rutgeerts score (ulcerations, inflammation, ulcers, nodules, narrowing). Reviewed in, e.g., Gastroenterol Hepatol (N Y). 2012 Jan; 8(1): 29-38.
[0208] When biopsies are used to characterize disease state and healing on the histopathological level, these are taken from several different areas of the intestinal tract to determine how each area is affected. Similar to endoscopic scoring, several different histopathological scoring methods can be used to look at disease severity and therapeutic efficacy (see e.g., Villanacci, et al., Inflammatory Bowel Diseases: Does One Histological Score Fit All? Diagnostics 2023, 13, 2112). Non-limiting examples of scoring systems include the Simplified Geboes score which inter alia scores inflammatory activity, the presence of certain immune cells in epithelium and lamina propria (basal
plasma cells, eosinophils and neutrophils in lamina propria), and epithelial injury (tissue damage)); the Nancy score, which inter alia scores the inflammatory infiltrate, ulceration, tissue damage and mucin depletion; the Robarts score, which inter alia scores the chronic inflammatory infiltrate and erosion/ulceration; SHMHS score, which inter alia scores infiltrates, tissue damage, and erosions/ulcerations.
[0209] Accordingly, the combination of endoscopy, histological characterization of biopsies, and biomarkers are tools by which pathology and mucosal healing can be measured.
[0210] The terms “gut lining” or “mucosa” are used interchangeably, and as used herein refer to the inner wall of the gut comprising layers: a single layer of epithelial cells, lamina propria, and muscular mucosae.
[0211] As used herein “inflammation” includes a finding infiltration of inflammatory immune cells, e.g., chronic inflammatory infiltrate, into the gut lining. Non-limiting examples include lymphocytes and plasmacytes; e.g., increases in basal plasma cells, and/or eosinophils and/or neutrophils in the lamina propria, neutrophils in the epithelium, inflammation may be measured in a biopsy as noted above as part of the mucosal healing scoring systems. Additionally, levels of blood C-reactive protein (CRP) and fecal calprotectin (which is released by neutrophils when inflammation is present in the gastrointestinal tract) can be used as biomarkers to measure the extent of intestinal inflammation. Lipocalin-2 is produced by epithelial cells and also can be used as a measurement of inflammation and epithelial health. In some embodiments, one or more biomarkers are measured to determine inflammation of the gut in a subject. In some embodiments, the one or more biomarkers are measured from a biological sample from the subject, such as, but not limited to, blood, urine, and/or stool.
[0212] As used herein, the term “ulceration” refers to an endoscopic or histological finding. Extent and quality of ulceration is scored as one element of the UC and Crohn’s disease endoscopic and histological disease scoring methods listed above.
[0213] A finding of ulceration includes a complete loss of epithelial cell lining, which may be observed in a localized area, ulcers or granulation tissue, and erosion, as well as fibrin and regeneration.
[0214] As used herein the term “tissue damage” refers to an endoscopic or histological finding. Tissue damage includes damage to the epithelium, in crypt(s) and/or surface epithelium, e.g., crypts that are lost, distorted, or with altered architecture which can include including crypt hyperplasia and/or fission.
[0215] Measurements of intestinal permeability are another way by which damage to the intestinal lining and extent of mucosal healing is assessed.
[0216] As used herein, the term "intestinal permeability" refers to the ability of the gut lining to permit material passing from inside the gut through the cells in the gut lining into the blood. The gut lining functions as a barrier to uptake of toxic metabolites, including bacterial metabolites, although some permeability exists in the healthy gut to allow nutrient uptake into the blood. In disease state,
such as the disorders described herein, e.g., CD and UC, there is abnormally increased intestinal permeability, which may play a role in disease symptoms and presence of harmful metabolites in the blood and other organs.
[0217] Intestinal permeability can be measured according to a number of methods known in the art. For example, urinary excretion of two orally-administered non-metabolizable sugars, lactulose and mannitol, can be used as a marker for evaluating levels of intestinal permeability. More recently , fluorescent dye base techniques have been developed to measure variations in intestinal permeability. For example, a fluorescent solution containing a clinically approved contrast agent (fluorescein) may be administered orally and the dye permeation from the gut into the bloodstream is measured non- invasively, via fluorescence signal measurement on the fingertip (10.1117/12.2649030). Alternatively, dyes may be administered, and presence of the dyes may be measured in the urine. In some embodiments, the level of instestinal permability is measured in the subject before and after treatment with the pharmaceutical composition as disclosed herein. As used herein, “metabolic diseases” include, but are not limited to, type 1 diabetes; type 2 diabetes; metabolic syndrome; Bardet- Biedel syndrome; Prader-Willi syndrome; non-alcoholic fatty liver disease; tuberous sclerosis;
Albright hereditary osteodystrophy; brain-derived neurotrophic factor (BDNF) deficiency; Single- minded 1 (SIM1) deficiency; leptin deficiency; leptin receptor deficiency; pro-opiomelanocortin (POMC) defects; proprotein convertase subtilisin/kexin type 1 (PCSK1) deficiency; Src homology 2B1 (SH2B1) deficiency; pro-hormone convertase 1/3 deficiency; melanocortin-4-receptor (MC4R) deficiency; aniridia, genitourinary anomalies, and mental retardation (WAGR) syndrome; pseudohypoparathyroidism type 1A; Fragile X syndrome; Borjeson-Forsmann-Lehmann syndrome; Alstrom syndrome; Cohen syndrome; and ulnar-mammary syndrome.
[0218] Symptoms associated with the aforementioned diseases and conditions include, but are not limited to, one or more of weight gain, obesity, fatigue, hyperlipidemia, hyperphagia, hyperdipsia, polyphagia, polydipsia, polyuria, pain of the extremities, numbness of the extremities, blurry vision, nystagmus, hearing loss, cardiomyopathy, insulin resistance, light sensitivity, pulmonary disease, liver disease, liver cirrhosis, liver failure, kidney disease, kidney failure, seizures, hypogonadism, and infertility.
[0219] As used herein a "pharmaceutical composition" refers to a preparation of genetically engineered microorganism of the disclosure, e.g., recombinant bacteria, with other components such as a physiologically suitable carrier and/or excipient.
[0220] The phrases "physiologically acceptable carrier" and "pharmaceutically acceptable carrier" which may be used interchangeably refer to a carrier or a diluent that does not cause significant irritation to an organism and does not abrogate the biological activity and properties of the administered bacterial or viral compound. An adjuvant is included under these phrases.
[0221] The term "excipient" refers to an inert substance added to a pharmaceutical composition to further facilitate administration of an active ingredient. Examples include, but are not limited to,
calcium bicarbonate, sodium bicarbonate calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20.
[0222] The terms “therapeutically effective dose” and “therapeutically effective amount” are used to refer to an amount of a compound that results in prevention, delay of onset of symptoms, or amelioration of symptoms of a condition, e.g., inflammation, diarrhea, an autoimmune disorder. A therapeutically effective amount may, for example, be sufficient to treat, prevent, reduce the severity, delay the onset, and/or reduce the risk of occurrence of one or more symptoms of an autoimmune a disorder and/or a disease or condition as described herein. A therapeutically effective amount, as well as a therapeutically effective frequency of administration, can be determined by methods known in the art and discussed below.
[0223] As used herein, the term "bacteriostatic” or "cytostatic” refers to a molecule or protein which is capable of arresting, retarding, or inhibiting the growth, division, multiplication or replication of recombinant bacterial cell of the disclosure.
[0224] As used herein, the term “bactericidal” refers to a molecule or protein which is capable of killing the recombinant bacterial cell of the disclosure.
[0225] As used herein, the term “toxin” refers to a protein, enzyme, or polypeptide fragment thereof, or other molecule which is capable of arresting, retarding, or inhibiting the growth, division, multiplication or replication of the recombinant bacterial cell of the disclosure, or which is capable of killing the recombinant bacterial cell of the disclosure. The term “toxin” is intended to include bacteriostatic proteins and bactericidal proteins. The term “toxin” is intended to include, but not limited to, lytic proteins, bacteriocins (e.g., microcins and colicins), gyrase inhibitors, polymerase inhibitors, transcription inhibitors, translation inhibitors, DNases, and RNases. The term “anti-toxin” or “antitoxin,” as used herein, refers to a protein or enzyme which is capable of inhibiting the activity of a toxin. The term anti-toxin is intended to include, but not limited to, immunity modulators, and inhibitors of toxin expression. Examples of toxins and antitoxins are known in the art and described in more detail infra.
[0226] As used herein, “payload” refers to one or more molecules of interest to be produced by a genetically engineered microorganism, such as a bacteria or a virus. In some embodiments, the payload is a therapeutic EGF payload. In some embodiments, the payload is a regulatory molecule, e.g., a transcriptional regulator such as FNR. In some embodiments, the payload comprises a regulatory element, such as a promoter or a repressor. In some embodiments, the payload comprises an inducible promoter, such as from FNRS or a cI857 repressor-pR promoter.
[0227] In some embodiments, the payload comprises a repressor element, such as a kill switch. In some embodiments, the payload comprises an antibiotic resistance gene or genes. In some embodiments, the payload is encoded by a gene, multiple genes, gene cassette, or an operon. In alternate embodiments, the payload is produced by a biosynthetic or biochemical pathway, wherein
the biosynthetic or biochemical pathway may optionally be endogenous to the microorganism. In alternate embodiments, the payload is produced by a biosynthetic or biochemical pathway, wherein the biosynthetic or biochemical pathway is not endogenous to the microorganism. In some embodiments, the genetically engineered microorganism comprises two or more payloads.
[0228] As used herein, the term “conventional treatment” or “conventional therapy” refers to treatment or therapy that is currently accepted, considered current standard of care, and/or used by most healthcare professionals for treating a disease or disorder, e.g., autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, neurological or neurodegenerative diseases, or diseases associated with inflammation and/or reduced gut barrier function. It is different from alternative or complementary therapies, which are not as widely used.
[0229] As used herein, the term “polypeptide” includes “polypeptide” as well as “polypeptides,” and refers to a molecule composed of amino acid monomers linearly linked by amide bonds (i.e., peptide bonds). The term “polypeptide” refers to any chain or chains of two or more amino acids, and does not refer to a specific length of the product. Thus, “peptides,” “dipeptides,” “tripeptides, “oligopeptides,” “protein,” “amino acid chain,” or any other term used to refer to a chain or chains of two or more amino acids, are included within the definition of “polypeptide,” and the term “polypeptide” may be used instead of, or interchangeably with any of these terms. The term “polypeptide” is also intended to refer to the products of post-expression modifications of the polypeptide, including but not limited to glycosylation, acetylation, phosphorylation, amidation, derivatization, proteolytic cleavage, or modification by non-naturally occurring amino acids. A polypeptide may be derived from a natural biological source or produced by recombinant technology. In other embodiments, the polypeptide is produced by the recombinant bacteria of the current disclosure. A polypeptide may be of a size of about 3 or more, 5 or more, 10 or more, 20 or more, 25 or more, 50 or more, 75 or more, 100 or more, 200 or more, 500 or more, 1,000 or more, or 2,000 or more amino acids. Polypeptides may have a defined three-dimensional structure, although they do not necessarily have such structure. Polypeptides with a defined three-dimensional structure are referred to as folded, and polypeptides, which do not possess a defined three-dimensional structure, but rather can adopt a large number of different conformations, are referred to as unfolded. The term “peptide” or “polypeptide” may refer to an amino acid sequence that corresponds to a protein or a portion of a protein or may refer to an amino acid sequence that corresponds with non-protein sequence, e.g., a sequence selected from a regulatory peptide sequence, leader peptide sequence, signal peptide sequence, linker peptide sequence, and other peptide sequence.
[0230] An “isolated” polypeptide or a fragment, variant, or derivative thereof refers to a polypeptide that is not in its natural milieu. No particular level of purification is required. Recombinantly produced polypeptides and proteins expressed in host cells, including but not limited to bacterial or mammalian cells, are considered isolated for purposed of the invention, as are native or recombinant polypeptides which have been separated, fractionated, or partially or substantially purified by any
suitable technique. Recombinant peptides, polypeptides or proteins refer to peptides, polypeptides or proteins produced by recombinant DNA techniques, i.e.. produced from cells, microbial or mammalian, transformed by an exogenous recombinant DNA expression construct encoding the polypeptide. Proteins or peptides expressed in most bacterial cultures will typically be free of glycan. Fragments, derivatives, analogs or variants of the foregoing polypeptides, and any combination thereof are also included as polypeptides. The terms “fragment,” “variant,” “derivative” and “analog” include polypeptides having an amino acid sequence sufficiently similar to the amino acid sequence of the original peptide and include any polypeptides, which retain at least one or more properties of the corresponding original polypeptide. Fragments of polypeptides include proteolytic fragments, as well as deletion fragments. Fragments also include specific antibody or bioactive fragments or immunologically active fragments derived from any polypeptides described herein. Variants may occur naturally or be non-naturally occurring. Non-naturally occurring variants may be produced using mutagenesis methods known in the art. Variant polypeptides may comprise conservative or non- conservative amino acid substitutions, deletions or additions.
[0231] Polypeptides also include fusion proteins. As used herein, the term “variant” includes a fusion protein, which comprises a sequence of the original peptide or sufficiently similar to the original peptide. As used herein, the term “fusion protein” refers to a chimeric protein comprising amino acid sequences of two or more different proteins. Typically, fusion proteins result from well known in vitro recombination techniques. Fusion proteins may have a similar structural function (but not necessarily to the same extent), and/or similar regulatory function (but not necessarily to the same extent), and/or similar biochemical function (but not necessarily to the same extent) and/or immunological activity (but not necessarily to the same extent) as the individual original proteins which are the components of the fusion proteins. “Derivatives” include but are not limited to peptides, which contain one or more naturally occurring amino acid derivatives of the twenty standard amino acids. “Similarity” between two peptides is determined by comparing the amino acid sequence of one peptide to the sequence of a second peptide. An amino acid of one peptide is similar to the corresponding amino acid of a second peptide if it is identical or a conservative amino acid substitution. Conservative substitutions include those described in Dayhoff, M. O., ed., The Atlas of Protein Sequence and Structure 5, National Biomedical Research Foundation, Washington, D.C. (1978), and in Argos, EMBO J. 8 (1989), 779-785. For example, amino acids belonging to one of the following groups represent conservative changes or substitutions: -Ala, Pro, Gly, Gin, Asn, Ser, Thr; - Cys, Ser, Tyr, Thr; -Vai, He, Leu, Met, Ala, Phe; -Lys, Arg, His; -Phe, Tyr, Trp, His; and -Asp, Glu. [0232] In some embodiments of the disclosure, the recombinant bacteria comprise one or more gene sequence(s) encoding one or more fusion proteins. In some embodiments, the recombinant bacteria express a fusion protein, in which a secretion tag polypeptide is fused to an EGF polypeptide, i.e., the secretion tag is linked to the polypeptide through a peptide bond or a linker. In some embodiments, the recombinant bacteria express an EGF polypeptide which is fused to a stabilizing polypeptide. As
used herein “stabilizing polypeptide” extends the half-life of the EGF polypeptide to which it is fused. Non-limiting examples of fusion proteins containing such stabilizing polypeptides include Fc fusion proteins, transferrin fusion proteins, and albumin fusion proteins (Strohl, BioDrugs. 2015; 29(4): 215- 239). In some embodiments, the EGF polypeptide is fused to an inert polypeptide to extend the half- life. A non-limiting example of such a polypeptide is XTEN (Schellenberger V, et al. Nat Biotechnol. 2009;27 : 1186-1190). Another non-limiting example of a half-life extending polypeptide is CTP. CTP naturally extends protein’s half-life in human serum, likely because the negatively charged, heavily sialylated CTP impairs renal clearance. Another non-limiting example of a polypeptide which can be fused to EGF to extend half-life is ELPs, which are repeating peptide units containing sequences commonly found in elastin (repeats of V-P-G-x-G, where x is any amino acid except proline (SEQ ID NO: 348 (Strohl et al. . Other non-limiting examples of a polypeptide containing a polypeptide repeat sequence which can be fused to EGF are PAS (polymer using three repeating amino acids, proline, alanine and serine) and HAP (glycine-rich HAP).
[0233] As used herein, the term “sufficiently similar” means a first amino acid sequence that contains a sufficient or minimum number of identical or equivalent amino acid residues relative to a second amino acid sequence such that the first and second amino acid sequences have a common structural domain and/or common functional activity. For example, amino acid sequences that comprise a common structural domain that is at least about 45%, 50%, 55%, 60%, 65%, 70%, 75%, 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100%, identical are defined herein as sufficiently similar. Preferably, variants will be sufficiently similar to the amino acid sequence of the peptides of the disclosure. Such variants generally retain the functional activity of the peptides of the present disclosure. V ariants include peptides that differ in amino acid sequence from the native and wt peptide, respectively, by way of one or more amino acid deletion(s), addition(s), and/or substitution(s). These may be naturally occurring variants as well as artificially designed ones.
[0234] As used herein the term “linker”, “linker peptide” or “peptide linkers” or “linker” refers to synthetic or non-native or non-naturally-occurring amino acid sequences that connect or link two polypeptide sequences, e.g., that link two polypeptide domains. As used herein the term “synthetic” refers to amino acid sequences that are not naturally occurring. Exemplary linkers are described herein. Additional exemplary linkers are provided in US 20140079701 and in Chen et al., Adv Drug Deliv Rev. 2013; 65(10): 1357-1369, the contents of which are herein incorporated by reference in its entirety. Table 3 depicts non-limiting examples of linkers known in the art.
[0235] As used herein the term “codon-optimized” refers to the modification of codons in the gene or coding regions of a nucleic acid molecule to reflect the typical codon usage of the host organism without altering the polypeptide encoded by the nucleic acid molecule. Such optimization includes replacing at least one, or more than one, or a significant number, of codons with one or more codons that are more frequently used in the genes of the host organism. A “codon-optimized sequence” refers to a sequence, which was modified from an existing coding sequence, or designed, for example, to improve translation in an expression host cell or organism of a transcript RNA molecule transcribed from the coding sequence, or to improve transcription of a coding sequence. Codon optimization includes, but is not limited to, processes including selecting codons for the coding sequence to suit the codon preference of the expression host organism. Many organisms display a bias or preference for use of particular codons to code for insertion of a particular amino acid in a growing polypeptide
chain. Codon preference or codon bias, differences in codon usage between organisms, is allowed by the degeneracy of the genetic code, and is well documented among many organisms. Codon bias often correlates with the efficiency of translation of messenger RNA (mRNA), which is in turn believed to be dependent on, inter alia, the properties of the codons being translated and the availability of particular transfer RNA (tRNA) molecules. The predominance of selected tRNAs in a cell is generally a reflection of the codons used most frequently in peptide synthesis. Accordingly, genes can be tailored for optimal gene expression in a given organism based on codon optimization.
[0236] As used herein, the terms “secretion system” or “secretion protein” refers to a native or non- native secretion mechanism capable of secreting or exporting a biomolecule, e.g., polypeptide from the microbial, e.g., bacterial cytoplasm. The secretion system may comprise a single protein or may comprise two or more proteins assembled in a complex e.g., HlyBD. Non-limiting examples of secretion systems for gram negative bacteria include the type I (e.g., hemolysin secretion system), type II, type III, type III flagellar, type IV, type V, type VI, type VII, type VIII secretion systems and modifications thereof, e.g., modified type III, modified type III flagellar, resistance-nodulation- division (RND) multi-drug efflux pumps, and various single membrane secretion systems. Non-liming examples of secretion systems for gram positive bacteria include Sec and TAT secretion systems. In some embodiments, the polypeptide to be secreted include a “secretion tag” of either RNA or peptide origin to direct the polypeptide to specific secretion systems. In some embodiments, the secretion system is able to remove this tag before secreting the polypeptide from the engineered bacteria. For example, in Type V auto-secretion-mediated secretion the N-terminal peptide secretion tag is removed upon translocation of the “passenger” peptide from the cytoplasm into the periplasmic compartment by the native Sec system. Further, once the auto-secretor is translocated across the outer membrane the C-terminal secretion tag can be removed by either an autocatalytic or protease- catalyzed e.g., OmpT cleavage thereby releasing the anti-inflammatory or barrier enhancer molecule(s) into the extracellular milieu. In some embodiments, the secretion system involves the generation of a “leaky” or de-stabilized outer membrane, which may be accomplished by deleting or mutagenizing genes responsible for tethering the outer membrane to the rigid peptidoglycan skeleton, including for example, Ipp, ompC, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl. Lpp functions as the primary ‘staple’ of the bacterial cell wall to the peptidoglycan. TolA-pal and OmpA complexes function similarly to Lpp and are other deletion targets to generate a leaky phenotype. Additionally, leaky phenotypes have been observed when periplasmic proteases, such as degS, degP or nlpl, are deactivated. Thus, in some embodiments, the engineered bacteria have one or more deleted or mutated membrane genes, e.g., selected from lpp, ompA, ompA, ompF, tolA, tolB, and pal genes. In some embodiments, the engineered bacteria have one or more deleted or mutated periplasmic protease genes, e.g., selected from degS, degP, and nlpl. In some embodiments, the engineered bacteria have one or more deleted or mutated gene(s), selected from lpp, ompA, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl genes.
[0237] The terms “phage” and “bacteriophage” are used interchangeably herein. Both terms refer to a virus that infects and replicates within a bacterium. As used herein “phage” or bacteriophage” collectively refers to prophage, lysogenic, dormant, temperate, intact, defective, cryptic, and satellite phage, phage tail bacteriocins, tailiocins, and gene transfer agents. As used therein the term “prophage” refers to the genomic material of a bacteriophage, which is integrated into a replicon of the host cell and replicates along with the host. The prophage may be able to produce phages if specifically activated. In some cases, the prophage is not able to produce phages or has never done so (i.e.. defective or cryptic prophages). In some cases, prophage also refers to satellite phages. The terms “prophage” and “endogenous phage” are used interchangeably herein. “Endogenous phage” or “endogenous prophage” also refers to a phage that is present in the natural state of a bacterium (and its parental strain). As used herein the term “phage knockout” or “inactivated phage” refers to a phage which has been modified so that it can either no longer produce and/or package phage particles or it produces fewer phage particles than the wild type phage sequence. In some embodiments, the inactivated phage or phage knockout refers to the inactivation of a temperate phage in its lysogenic state, i.e., to a prophage. Such a modification refers to a mutation in the phage; such mutations include insertions, deletions (partial or complete deletion of phage genome), substitutions, inversions, at one or more positions within the phage genome, e.g., within one or more genes within the phage genome. As used herein the adjectives “phage-free”, “phage free” and “phageless” are used interchangeably to characterize a bacterium or strain which contains one or more prophages, one or more of which have been modified. The modification can result in a loss of the ability of the prophage to be induced or release phage particles. Alternatively, the modification can result in less efficient or less frequent induction or less efficient or less frequent phage release as compared to the isogenic strain without the modification. Ability to induce and release phage can be measured using a plaque assay as described herein. As used herein phage induction refers to the part of the life cycle of a lysogenic prophage, in which the lytic phage genes are activated, phage particles are produced and lysis occurs.
[0238] The articles “a” and “an,” as used herein, should be understood to mean “at least one,” unless clearly indicated to the contrary.
[0239] The phrase “and/or,” when used between elements in a list, is intended to mean either (1) that only a single listed element is present, or (2) that more than one element of the list is present. For example, “A, B, and/or C” indicates that the selection may be A alone; B alone; C alone; A and B; A and C; B and C; or A, B, and C. The phrase “and/or” may be used interchangeably with “at least one of’ or “one or more of’ the elements in a list.
[0240] Ranges provided herein are understood to be shorthand for all of the values within the range. For example, a range of 1 to 50 is understood to include any number, combination of numbers, or sub- range from the group consisting 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21,
22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48,
49, or 50.
Bacteria
[0241] The genetically engineered microorganisms, or programmed microorganisms, such as recombinant bacteria of the disclosure are capable of producing EGF. In certain embodiments, the recombinant bacteria are obligate anaerobic bacteria. In certain embodiments, the recombinant bacteria are facultative anaerobic bacteria. In certain embodiments, the recombinant bacteria are aerobic bacteria. In some embodiments, the recombinant bacteria are Gram-positive bacteria. In some embodiments, the recombinant bacteria are Gram-positive bacteria and lack LPS. In some embodiments, the recombinant bacteria are Gram-negative bacteria. In some embodiments, the recombinant bacteria are Gram-positive and obligate anaerobic bacteria. In some embodiments, the recombinant bacteria are Gram-positive and facultative anaerobic bacteria. In some embodiments, the recombinant bacteria are non-pathogenic bacteria. In some embodiments, the recombinant bacteria are commensal bacteria. In some embodiments, the recombinant bacteria are probiotic bacteria. In some embodiments, the recombinant bacteria are naturally pathogenic bacteria that are modified or mutated to reduce or eliminate pathogenicity. Exemplary bacteria include, but are not limited to, Bacillus, Bacteroides, Bifidobacterium, Brevibacteria, Caulobacter, Clostridium, Enterococcus, Escherichia coli, Lactobacillus, Lactococcus, Listeria, Mycobacterium, Saccharomyces, Salmonella, Staphylococcus, Streptococcus, Vibrio, Bacillus coagulans, Bacillus subtilis, Bacteroides fragilis, Bacteroides subtilis, Bacteroides thetaiotaomicron, Bifidobacterium adolescentis, Bifidobacterium bifidum, Bifidobacterium breve UCC2003, Bifidobacterium infantis, Bifidobacterium lactis, Bifidobacterium longum, Clostridium acetobutylicum, Clostridium butyricum, Clostridium butyricum M-55, Clostridium cochlearum, Clostridium felsineum, Clostridium histolyticum, Clostridium multife rment ans, Clostridium novyi-NT, Clostridium paraputrificum, Clostridium pasteureanum, Clostridium pectinovorum, Clostridium perfringens, Clostridium roseum, Clostridium sporogenes, Clostridium tertium, Clostridium tetani, Clostridium tyrobutyricum, Corynebacterium parvum, Escherichia coli MG1655, Escherichia coli Nissle 1917, Listeria monocytogenes, Mycobacterium bovis, Salmonella choleraesuis, Salmonella typhimurium, and Vibrio cholera. In certain embodiments, the recombinant bacteria are selected from the group consisting of Enterococcus faecium, Lactobacillus acidophilus, Lactobacillus bulgaricus, Lactobacillus casei, Lactobacillus johnsonii, Lactobacillus paracasei, Lactobacillus plantarum, Lactobacillus reuteri, Lactobacillus rhamnosus, Lactococcus lactis, and Saccharomyces boulardii, Clostridium clusters IV and XlVa of Firmicutes (including species of Eubacterium), Roseburia, Faecalibacterium, Enterobacter, Faecalibacterium prausnitzii, Clostridium difficile, Subdoligranulum, Clostridium sporogenes, Campylobacter jejuni, Clostridium saccharolyticum, Klebsiella, Citrobacter, Pseudobutyrivibrio, and Ruminococcus. In certain embodiments, the recombinant bacteria are selected from Bacteroides fragilis, Bacteroides thetaiotaomicron, Bacteroides subtilis, Bifidobacterium bifidum, Bifidobacterium
infantis, Bifidobacterium lactis, Clostridium butyricum, Escherichia coli, Escherichia coli Nissle, Lactobacillus acidophilus, Lactobacillus plantarum, Lactobacillus reuteri, and Lactococcus lactis [0242] In some embodiments, the recombinant bacterium is a Gram-positive bacterium, e.g., Clostridium, that is naturally capable of producing high levels of butyrate. In some embodiments, the recombinant bacterium is selected from the group consisting of C. butyricum ZJUCB, C. butyricum S21, C. thermobutyricum ATCC 49875, C. beijerinckii, C. populeti ATCC 35295, C. tyrobutyricum JM1, C. tyrobutyricum CIP 1-776, C. tyrobutyricum ATCC 25755, C. tyrobutyricum CNRZ 596, and C. tyrobutyricum ZJU 8235. In some embodiments, the recombinant bacterium is C. butyricum CBM588, a probiotic bacterium that is highly amenable to protein secretion and has demonstrated efficacy in treating IBD (Kanai et al., 2015). In some embodiments, the recombinant bacterium is Bacillus, a probiotic bacterium that is highly genetically tractable and has been a popular chassis for industrial protein production; in some embodiments, the bacterium has highly active secretion and/or no toxic byproducts (Cutting, 2011).
[0243] In one embodiment, the bacterial cell is a Bacteroides fragilis bacterial cell. In one embodiment, the bacterial cell is a Bacteroides thetaiotaomicron bacterial cell. In one embodiment, the bacterial cell is a Bacteroides subtilis bacterial cell. In one embodiment, the bacterial cell is a Bifidobacterium bifidum bacterial cell. In one embodiment, the bacterial cell is a Bifidobacterium infantis bacterial cell. In one embodiment, the bacterial cell is a Bifidobacterium lactis bacterial cell. In one embodiment, the bacterial cell is a Clostridium butyricum bacterial cell. In one embodiment, the bacterial cell is an Escherichia coli bacterial cell. In one embodiment, the bacterial cell is a Lactobacillus acidophilus bacterial cell. In one embodiment, the bacterial cell is a Lactobacillus plantarum bacterial cell. In one embodiment, the bacterial cell is a Lactobacillus reuteri bacterial cell. In one embodiment, the bacterial cell is a Lactococcus lactis bacterial cell.
[0244] In some embodiments, the recombinant bacteria are Escherichia coli strain Nissle 1917 (E. coli Nissle), a Gram-negative bacterium of the Enterobacteriaceae family that has evolved into one of the best characterized probiotics (Ukena et al., 2007). The strain is characterized by its complete harmlessness (Schultz, 2008), and has GRAS (generally recognized as safe) status (Reister et al., 2014, emphasis added). Genomic sequencing confirmed that E. coli Nissle lacks prominent virulence factors (e.g., E. coli a-hemolysin, P-fimbrial adhesins) (Schultz, 2008). In addition, it has been shown that E. coli Nissle does not carry pathogenic adhesion factors, does not produce any enterotoxins or cytotoxins, is not invasive, and not uropathogenic (Sonnenborn et al., 2009). As early as in 1917, E. coli Nissle was packaged into medicinal capsules, called Mutaflor, for therapeutic use. E. coli Nissle has since been used to treat ulcerative colitis in humans in vivo (Rembacken et al., 1999), to treat inflammatory bowel disease, Crohn’s disease, and pouchitis in humans in vivo (Schultz, 2008), and to inhibit enteroinvasive Salmonella, Legionella, Yersinia, and Shigella in vitro (Altenhoefer et al., 2004). It is commonly accepted that E. coli Nissle’ s therapeutic efficacy and safety have convincingly been proven (Ukena et al., 2007). In some embodiments, the recombinant bacteria are E.
coli Nissle and are naturally capable of promoting tight junctions and gut barrier function. In some embodiments, the recombinant bacteria are E. coli and are highly amenable to recombinant protein technologies.
[0245] One of ordinary skill in the art would appreciate that the genetic modifications disclosed herein may be adapted for other species, strains, and subtypes of bacteria. It is known, for example, that the clostridial butyrogenic pathway genes are widespread in the genome-sequenced clostridia and related species (Aboulnaga et al., 2013). Furthermore, genes from one or more different species of bacteria can be introduced into one another, e.g., the butyrogenic genes from Peptoclostridium difficile have been expressed in Escherichia coli (Aboulnaga et al., 2013).
[0246] In one embodiment, the recombinant bacterial cell does not colonize the subject having the disorder. Unmodified E. coli Nissle and the recombinant bacteria may be destroyed, e.g., by defense factors in the gut or blood serum (Sonnenborn et al., 2009) or by activation of a kill switch, several hours or days after administration. Thus, the recombinant bacteria may require continued administration. Residence time in vivo may be calculated for the recombinant bacteria. In some embodiments, the residence time is calculated for a human subject. In some embodiments, residence time in vivo is calculated for the recombinant bacteria of the disclosure, e.g., as described herein. [0247] In some embodiments, the bacterial cell is a recombinant bacterial cell. In some embodiments, the disclosure comprises a colony of bacterial cells disclosed herein. In another aspect, the disclosure provides a recombinant bacterial culture which comprises bacterial cells disclosed herein.
[0248] In some embodiments, the recombinant bacteria comprising a gene sequence encoding EGF further comprise a kill-switch circuit, such as any of the kill-switch circuits provided herein. For example, in some embodiments, the recombinant bacteria further comprise one or more genes encoding one or more recombinase(s) under the control of an inducible promoter, and an inverted toxin sequence. In some embodiments, the recombinant bacteria further comprise one or more genes encoding an antitoxin. In some embodiments, the engineered bacteria further comprise one or more genes encoding one or more recombinase(s) under the control of an inducible promoter and one or more inverted excision genes, wherein the excision gene(s) encode an enzyme that deletes an essential gene. In some embodiments, the recombinant bacteria further comprise one or more genes encoding an antitoxin. In some embodiments, the engineered bacteria further comprise one or more genes encoding a toxin under the control of a promoter having a TetR repressor binding site and a gene encoding the TetR under the control of an inducible promoter that is induced by arabinose, such as ParaBAD. In some embodiments, the recombinant bacteria further comprise one or more genes encoding an antitoxin.
[0249] In some embodiments, the recombinant bacteria is an auxotroph comprising a gene sequence encoding EGF and further comprises a kill-switch circuit, such as any of the kill-switch circuits described herein.
[0250] In some embodiments of the above-described recombinant bacteria, the gene sequence encoding EGF is present on a plasmid in the bacterium. In some embodiments, the gene sequence encoding EGF is present in the bacterial chromosome. In some embodiments, a gene sequence encoding a secretion protein or protein complex, such as any of the secretion systems disclosed herein, for secreting EGF, is present on a plasmid in the bacterium. In some embodiments, the gene sequence encoding a secretion protein or protein complex for secreting a biomolecule, such as any of the secretion systems disclosed herein, is present in the bacterial chromosome. In some embodiments, the gene sequence(s) encoding an antibiotic resistance gene is present on a plasmid in the bacterium. In some embodiments, the gene sequence(s) encoding an antibiotic resistance gene is present in the bacterial chromosome.
[0251] In some embodiments, the genetically engineered bacteria comprise one or more E. coli Nissle bacteriophage sequence(s), and at least one of the bacteriophage sequence(s) is mutated or modified, e.g., to delete the bacteriophage sequence, e.g.. an endogenous prophage sequence, in part or whole. In some embodiments, the deletion prevents the bacteria from being able to express infectious bacteriophage particles. Non-limiting examples of such mutations or modifications are described in PCT/US2018/038840, the contents of which are incorporated by reference in their entirety. In some embodiments, the genetically engineered bacteria comprise one or modifications or mutations in one or more of Phage 1, 2 or 3 as described in PCT/US2018/038840. In some embodiments, the genetically engineered bacteria comprise a modification or mutation in Phage 3. In some embodiments, the mutations include deletions, insertions, substitutions and inversions and are located in or encompass one or more Phage 3 genes. In some embodiments, the one or more insertions comprise an antibiotic cassette. In some embodiments, the mutation is a deletion. In some embodiments, the genetically engineered bacteria comprise one or more deletions, which are located in or comprise one or more genes selected from ECOLIN_09965, ECOLIN_09970, ECOLIN_09975, ECOLIN_09980, ECOLIN_09985, ECOLIN_09990, ECOLIN_09995, ECOLIN_WOOO, ECOLIN_10005, ECOLIN_10010, ECOLIN_10015, ECOLIN_10020, ECOLIN_10025, ECOLIN_10030, ECOLIN_10035, ECOLIN_10040, ECOLIN_10045, ECOLIN_10050, ECOLIN_10055, ECOLIN_10065, ECOLIN_10070, ECOLIN_10075, ECOLIN_10080, ECOLIN_10085, ECOLIN_10090, ECOLIN_10095, ECOLIN_10100, ECOLIN_10105, ECOLIN_10110, ECOLIN_10115, ECOLIN_10120, ECOLIN_10125, ECOLIN_10130, ECOLIN_10135, ECOLIN_10140, ECOLIN_10145, ECOLIN_10150, ECOLIN_10160, ECOLIN_10165, ECOLIN_10170, ECOLIN_10175, ECOLIN_10180, ECOLIN_10185, ECOLIN_10190, ECOLIN_10195, ECOLIN_10200, ECOLIN_10205, ECOLIN_10210, ECOLIN_10220, ECOLIN_10225, ECOLIN_10230, ECOLIN_10235, ECOLIN_10240, ECOLIN_10245, ECOLIN_10250, ECOLIN_10255, ECOLIN_10260, ECOLIN_10265, ECOLIN_10270, ECOLIN_10275, ECOLIN_10280, ECOLIN_10290, ECOLIN_10295, ECOLIN_10300, ECOLIN_10305, ECOLIN_10310, ECOLIN_10315, ECOLIN_10320,
ECOLIN_10325, ECOLIN_10330, ECOLIN_10335, ECOLIN_10340, and ECOLIN_10345. In one embodiment, the genetically engineered bacteria comprise a complete or partial deletion of one or more of ECOLIN_10110, ECOLIN_10115, ECOLIN_10120, ECOLIN_10125, ECOLIN_10130, ECOLIN_10135, ECOLIN_10140, ECOLIN_10145, ECOLIN_10150, ECOLIN_10160, ECOLIN_10165, ECOLIN_10170, and ECOLIN_10175. In one specific embodiment, the deletion is a complete deletion of ECOLIN_10110, ECOLIN_10115, ECOLIN_10120, ECOLIN_10125, ECOLIN_10130, ECOLIN_10135, ECOLIN_10140, ECOLIN_10145, ECOLIN_10150, ECOLIN_10160, ECOLIN_10165, and ECOLIN_10170, and a partial deletion of ECOLIN_10175. In one embodiment, the sequence of SEQ ID NO: 130 of PCT/US2018/038840 (herein SEQ ID NO: 292) is deleted from the Phage 3 genome. In one embodiment, a sequence comprising SEQ ID NO: 130 of PCT/US2018/038840 (herein SEQ ID NO: 292) is deleted from the Phage 3 genome.
PKS Island
[0252] In some embodiments, the engineered bacterium further comprises a modified pks island (colibactin island). Non-limiting examples are described in PCT/US2021/061579, the contents of which are herein incorporated by reference in their entirety. Colibactin is a cyclomodulin that is synthetized by enzymes encoded by the pks genomic island. See Fais 2018. The pks genomic island is “highly conserved” in Enterobacteriaceae. Id. In Escherichia coli, a 54-kilobase pks genomic island contains 19 genes, clbA to clbS, and encodes various enzymes that have been described as an “assembly line responsible for colibactin synthesis.” Id. The pks genomic island assembly line for colibactin synthesis includes three polyketide synthases (ClbC, Clbl, ClbO), three non-ribosomal peptide synthases (ClbH, ClbJ, ClbN), two hybrid non-ribosomal peptide/polyketide synthases (ClbB, ClbK), and nine accessory, tailoring, and editing proteins. The polyketide synthases, non-ribosomal peptide synthases, and hybrid enzymes “are usually organized in mega-complexes as an assembly line, in which the synthesized compound is transferred from one enzymatic module to the following one.” Id. Colibactin undergoes a prodrug activation mechanism that incorporates an N-terminal structural motif, which is removed during the final stage of biosynthesis.
[0253] In some embodiments, the bacterium comprises a partial or full deletion in one or more of clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbl, clbJ, clbK, clbL, clbM, clbN, clbO, clbP, clbQ, clbR, and clbS or operably linked promoter(s) thereof, e.g.. as compared to the microorganism’s native clb gene(s) and operably linked promoter(s). In some embodiments, the bacteria produce less colibactin as compared a control microorganism comprising the native or unmodified pks island and/or is less genotoxic compared a control microorganism comprising the native or unmodified pks island.
[0254] In some embodiments, the bacterium comprises a modified clb sequence selected from one or more of the clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbl, clbJ, clbK, clbL, clbM, clbN, clbO, clbP, clbQ, clbR, and clbS gene sequences, as compared to a suitable control, e.g., the native pks
island in an unmodified bacterium of the same strain and/or subtype. In some embodiments, the modified clb sequence is an insertion, a substitution, and/or a deletion as compared to the control. In some embodiments, the modified clb sequence is a deletion of the clb island, e.g.. clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbl, clbJ, clbK, clbL, clbM, clbN, clbO, clbP, clbQ, clbR, and clbS. In one embodiment, the colibactin deletion is the whole island except for the clbS gene, e.g., a deletion of clbA, clbB, clbC, clbD, clbE, clbF, clbG, clbH, clbl, clbJ, clbK, clbL, clbM, clbN, clbO, clbP, clbQ, and clbR.
[0255] In some embodiments, the modified endogenous colibactin island comprises one or more modified clb sequences selected from clbA (SEQ ID NO: 294), clbB (SEQ ID NO: 295), clbC (SEQ ID NO: 296), clbD (SEQ ID NO: 297), clbE (SEQ ID NO: 298), clbF (SEQ ID NO: 299), clbG (SEQ ID NO: 300), clbH (SEQ ID NO: 301), clbl (SEQ ID NO: 302), clbJ (SEQ ID NO: 303), clbK (SEQ ID NO: 304), clbL (SEQ ID NO: 305), clbM (SEQ ID NO: 306), clbN (SEQ ID NO: 307), clbO (SEQ ID NO: 308), clbP (SEQ ID NO: 309), clbQ (SEQ ID NO: 310), clbR (SEQ ID NO: 311), or clbS (SEQ ID NO: 312) gene. In some embodiments, the modified endogenous colibactin island comprises a deletion of clbA (SEQ ID NO: 294), clbB (SEQ ID NO: 295), clbC (SEQ ID NO: 296), clbD (SEQ ID NO: 297), clbE (SEQ ID NO: 298), clbF (SEQ ID NO: 299), clbG (SEQ ID NO: 300), clbH (SEQ ID NO: 301), clbl (SEQ ID NO: 302), clbJ (SEQ ID NO: 303), clbK (SEQ ID NO: 304), clbL (SEQ ID NO: 305), clbM (SEQ ID NO: 306), clbN (SEQ ID NO: 307), clbO (SEQ ID NO: 308), clbP (SEQ ID NO: 309), clbQ (SEQ ID NO: 310), and clbR (SEQ ID NO: 311).
Secreted EGF Polypeptides
[0256] In some embodiments, the recombinant bacteria are capable of producing EGF, particularly human EGF. EGF mediates signaling pathways by binding Epidermal Growth Factor Receptor (EGFR). The binding of EGF to EGFR promotes phosphorylation of EGFR and subsequent phosphorylation of AKT and ERK. Once cleaved and secreted, EGF functions as a cytokine to ameliorate inflammatory signals. For example, EGF can enhance goblet cell-associated mucosal integrity, while diminished EGF can be associated with inflammatory disorders. EGF plays a role in inflammatory bowel disease, with murine and human studies suggesting a protective and restorative role in disease pathogenesis and activity.
[0257] In some embodiments, the recombinant bacteria comprise a nucleic acid sequence encoding a polypeptide of SEQ ID NO: 505 or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a nucleic acid sequence that is at least about 80%, 85%, 90%, 95%, or 99% homologous to a nucleic acid sequence encoding a polypeptide of SEQ ID NO: 505 or a functional fragment thereof.
[0258] In some embodiments, the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 161 (below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a
fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 161 or a functional fragment thereof. In some embodiments, the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 161. In some specific embodiments, the polypeptide tag comprises SEQ ID NO: 161.
[0259] PelB:
[0260] MKYLLPTAAAGLLLLAAQPAMA (SEQ ID NO: 161)
[0261] In some embodiments, the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 136 (below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 136 or a functional fragment thereof. In some embodiments, the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 136. In some specific embodiments, the polypeptide tag comprises SEQ ID NO: 136.
[0262] PhoA:
[0263] MKQSTIALALLPLLFTPVTKA (SEQ ID NO: 136)
[0264] In some embodiments, the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 168 (below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 168 or a functional fragment thereof. In some embodiments, the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 168. In some specific embodiments, the polypeptide tag comprises SEQ ID NO: 168.
[0265] OmpA:
[0266] MKKTAIAIAVALAGFATVAQA (SEQ ID NO: 168)
[0267] In some embodiments, the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 361 (below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 361 or a functional fragment thereof. In some embodiments, the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 361. In some specific embodiments, the polypeptide tag comprises SEQ ID NO: 361.
[0268] LARD3:
[0269] IEGRGSDGNDLIQGGKGADFIEGGKGNDTIRDNSGHNTFLFSGHFGQDRIIGYQPTDR LVFQGADGSTDLRDHAKAVGADTVLSFGADSVTLVGVGLGGLWSEGVLIS (SEQ ID NO: 361)
[0270] In some embodiments, the recombinant bacteria comprise a nucleic acid sequence encoding a fusion protein which comprises a polypeptide tag of SEQ ID NO: 362 (below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a fusion protein which comprises a polypeptide tag of that is at least about 80%, 85%, 90%, 95%, or 99% identity to a polypeptide tag comprising SEQ ID NO: 362 or a functional fragment thereof. In some embodiments, the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 362. In some specific embodiments, the polypeptide tag comprises SEQ ID NO: 362.
[0271] HylA:
[0272] STYGSQDNLNPLINEISKIISAAGNFDVKEERSAASLLQLSGNASDFSYGRNSITLTASA (SEQ ID NO: 362)
[0273] In some embodiments, the recombinant bacteria comprise a nucleic acid sequence encoding an PelB-EGF fusion protein of (SEQ ID NO: 500 below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a PelB-EGF fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to PelB-EGF fusion protein comprising SEQ ID NO: 500 or a functional fragment thereof. In some embodiments, the PelB-EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 500. In some specific embodiments, the PelB-EGF fusion protein comprises SEQ ID NO: 500.
[0274] PelB-EGF:
[0275] MKYLLPTAAAGLLLLAAQPAMANSDSECPLSHDGYCLHDGVCMYIEALDKYACNC VVGYIGERCQYRDLKWWELR (SEQ ID NO: 500)
[0276] In some embodiments, the recombinant bacteria comprise nucleic acid sequence encoding an PhoA-EGF fusion protein of (SEQ ID NO: 502 below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a PhoA-EGF fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to PhoA-EGF fusion protein comprising SEQ ID NO: 502 or a functional fragment thereof. In some embodiments, the PhoA-EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 502. In some specific embodiments, the PhoA-EGF fusion protein comprises SEQ ID NO: 502.
[0277] PhoA-EGF:
[0278] MKQSTIALALLPLLFTPVTKANSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVG YIGERCQYRDLKWWELR (SEQ ID NO: 502)
[0279] In some embodiments, the recombinant bacteria comprise nucleic acid sequence encoding an OmpA-EGF fusion protein of (SEQ ID NO: 501 below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a OmpA-EGF fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to OmpA-EGF fusion protein comprising SEQ ID NO: 501 or a functional fragment thereof. In some embodiments, the OmpA-EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 501. In some specific embodiments, the OmpA-EGF fusion protein comprises SEQ ID NO: 501.
[0280] OmpA-EGF:
[0281] MKKTAIAIAVALAGFATVAQANSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVV GYIGERCQYRDLKWWELR (SEQ ID NO: 501)
[0282] In some embodiments, the recombinant bacteria comprise nucleic acid sequence encoding an EGF-LARD3 fusion protein of (SEQ ID NO: 503 below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding an EGF-LARD3 fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to EGF-LARD3 fusion protein comprising SEQ ID NO: 503 or a functional fragment thereof. In some embodiments, the EGF- LARD3 fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 503. In some specific embodiments, the EGF-LARD3 fusion protein comprises SEQ ID NO: 503.
[0283] EGF-LARD3:
[0284] MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRI EGRGSDGNDLIQGGKGADFIEGGKGNDTIRDNSGHNTFLFSGHFGQDRIIGYQPTDRLVFQGA DGSTDLRDHAKAVGADTVLSFGADSVTLVGVGLGGLWSEGVLIS (SEQ ID NO: 503)
[0285] In some embodiments, the recombinant bacteria comprise nucleic acid sequence encoding an OmpA-EGF fusion protein of (SEQ ID NO: 504 below) or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a OmpA-EGF fusion protein that is at least about 80%, 85%, 90%, 95%, or 99% identity to OmpA-EGF fusion protein comprising SEQ ID NO: 504 or a functional fragment thereof. In some embodiments, the OmpA-EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 504. In some specific embodiments, the OmpA-EGF fusion protein comprises SEQ ID NO: 504.
[0286] EGF-HylA:
[0287] MNSDSECPLSHDGYCLHDGVCMYIEALDKYACNCVVGYIGERCQYRDLKWWELRS TYGSQDNLNPLINEISKIISAAGNFDVKEERSAASLLQLSGNASDFSYGRNSITLTASA. (SEQ ID NO: 504
[0288] In some embodiments, the recombinant bacteria comprise a nucleic acid sequence encoding a polypeptide set forth in Table 4 or a functional fragment thereof. In some embodiments, recombinant
bacteria comprise a nucleic acid sequence that is at least about 80%, 85%, 90%, 95%, or 99% homologous to a nucleic acid sequence encoding a polypeptide set forth in Table 4 or a functional fragment thereof.
[0289] In some embodiments, the recombinant bacteria comprise a nucleic acid sequence set forth in Table 5 or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a nucleic acid sequence that is at least about 80%, 85%, 90%, 95%, or 99% homologous to a nucleic acid sequence set forth in Table 5 or a functional fragment thereof.
[0290] In some embodiments, the recombinant bacteria are capable of producing EGF under inducing conditions, e.g., under a condition(s) associated with inflammation. In some embodiments, the recombinant bacteria are capable of producing EGF in low-oxygen conditions.
[0291] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) selected from PhoA-EGF, OmpF-EGF, and TorA-EGF.
[0292] In some embodiments, the recombinant bacteria comprise gene(s) encoding an ATP binding cassette transporter or a portion thereof, e.g., one, two, three, or more subunits of an ATP binding cassette transporter as described herein. ATP binding cassette transporters are known in the art and described herein.
[0293] In some embodiments, the recombinant bacteria comprise nucleic acid sequence encoding an ATP binding cassette transporter of SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514 below or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a ATP binding cassette transporter that is at least about 80%, 85%, 90%, 95%, or 99% identity to ATP binding cassette transporter comprising SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514 or a functional fragment thereof. In some embodiments, the ATP binding cassette transporter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514. In some specific embodiments, the ATP binding cassette transporter protein comprises SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514.
[0300] In some embodiments, the recombinant bacteria comprise a gene sequence encoding a linker fusion protein which comprises SEQ ID NO: 335 or a functional fragment thereof. In some embodiments, recombinant bacteria comprise a gene sequence encoding a linker polypeptide that has at least about 80%, 85%, 90%, 95%, or 99% identity to linker polypeptide comprising SEQ ID NO: 335 or a functional fragment thereof. In some embodiments, the linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 335. In some specific embodiments, the linker polypeptide comprises SEQ ID NO: 335. In some embodiments, the gene sequence encoding ECOLIN 19410 secretion tag further comprises SEQ ID NO: 335. In some embodiments, the recombinant bacteria comprise gene sequence encoding a linker fusion protein. In certain embodiments, the linker fusion protein gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 342. In some embodiments, the linker gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 342. In some specific embodiments, the linker gene sequence comprises SEQ ID NO: 342.
[0301] In any of these embodiments, the recombinant bacteria may further comprise gene sequences encoding a secretion tag. Non-limiting examples of such secretion tags are described herein and include PhoA, OmpF, cvaC, TorA, fdnG, dmsA, PelB, the ECOLIN_05715 secretion signal, ECOLIN_16495 secretion signal, ECOLIN_19410 secretion signal, and the ECOLIN_19880 secretion
signal. In some embodiments, the secretion tag is PhoA. In some embodiments, the PhoA secretion tag comprises SEQ ID NO: 136. In some embodiments, the PhoA secretion tag comprises SEQ ID NO: 136.
[0302] In some embodiments, the recombinant bacteria produce 0% to 2%, 2% to 4%, 4% to 6%, 6% to 8%, 8% to 10%, 10% to 12%, 12% to 14%, 14% to 16%, 16% to 18%, 18% to 20%, 20% to 25%, 25% to 30%, 30% to 35%, 35% to 40%, 40% to 45%, 45% to 50%, 50% to 55%, 55% to 60%, 60% to 65%, 65% to 70%, 70% to 80%, 80% to 90%, or 90% to 100% more EGF than unmodified bacteria of the same bacterial subtype under the same conditions. In yet another embodiment, the recombinant bacteria produce 1.0-1.2-fold, 1.2-1.4-fold, 1.4-1.6-fold, 1.6-1.8-fold, 1.8-2-fold, or two- fold more EGF than unmodified bacteria of the same bacterial subtype under the same conditions. In yet another embodiment, the recombinant bacteria produce three-fold, four-fold, five-fold, six-fold, seven-fold, eight-fold, nine-fold, ten-fold, fifteen-fold, twenty-fold, thirty-fold, forty-fold, or fifty- fold, more EGF, than unmodified bacteria of the same bacterial subtype under the same conditions. [0303] In any of these embodiments, the EGF constructs described herein may further comprise a secretion tag. Non-limiting examples of secretion tags are described herein. The secretion tag is at the N-terminus or at the C-terminus.
[0304] In any of these embodiments, the recombinant bacteria may further comprise gene sequences encoding a secretion tag. Non-limiting examples of such secretion tags are described herein and include PhoA, OmpF, cvaC, TorA, fdnG, dmsA, PelB, the ECOLIN_05715 secretion signal, ECOLIN_16495 secretion signal, ECOLIN_19410 secretion signal, and the ECOLIN_19880 secretion signal. In some embodiments, the secretion tag is PhoA. In some embodiments, the secretion tag is ECOLIN 19410. The recombinant bacteria may further comprise one or more mutations to outer membrane proteins, i.e., to generate a diffusible outer membrane phenotype (DOM). Non-limiting examples of such outer membrane proteins are described herein and include Ipp, nlP, tolA, and pal. In one embodiment, the recombinant bacteria comprise a deletion or mutation in pal. In some embodiments, the recombinant bacterium, e.g., Gram-negative bacterium, e.g., E. coli Nissle, may be engineered by deleting the gene encoding the periplasmic protein pal to create a diffusible outer membrane (DOM) phenotype, e.g., to result in a “leaky membrane” bacterium and increase the rate of diffusion of periplasmic proteins to the external environment without compromising cell growth properties.
[0305] In some embodiments, the genetically engineered are capable of producing and secreting EGF. In some embodiments, the EGF gene is functionally replaced, modified, and/or mutated in order to enhance stability and/or increase EGF production or secretion. In some embodiments, the recombinant bacteria are capable of expressing and secreting EGF in low-oxygen conditions, in the presence of certain molecules or metabolites, in the presence of molecules or metabolites associated with inflammation or an inflammatory response, or in the presence of some other metabolite that may
or may not be present in the gut, such as arabinose. Exemplary chemical inducers are described herein.
[0306] In one embodiment, the EGF gene is directly operably linked to a first promoter. In another embodiment, the EGF gene is indirectly operably linked to a first promoter. In one embodiment, the promoter is not operably linked with the EGF gene in nature.
[0307] In some embodiments, the EGF gene is expressed under the control of a constitutive promoter. In another embodiment, the EGF gene is expressed under the control of an inducible promoter. In some embodiments, the EGF gene is expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions. In one embodiment, the EGF gene is expressed under the control of a promoter that is directly or indirectly induced by low-oxygen or anaerobic conditions, wherein expression of the EGF gene is activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut. In one embodiment, the EGF gene is expressed under the control of a temperature-sensitive promoter, e.g., a promoter that is directly or indirectly induced by a temperature between 37°C and 42°C. Inducible promoters are described in more detail herein.
[0308] The EGF gene may be present on a plasmid or chromosome in the bacterial cell. In one embodiment, the EGF gene is located on a plasmid in the bacterial cell. In another embodiment, the EGF gene is located in the chromosome of the bacterial cell. In yet another embodiment, a native copy of the EGF gene is located in the chromosome of the bacterial cell. The EGF gene may be expressed on a low-copy plasmid or a high-copy plasmid. The high-copy plasmid may be useful for increasing expression of EGF.
[0309] In particular embodiments, the bacterium comprises a gene sequence encoding EGF operably linked to a thermoregulated promoter, e.g., cI857; a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the gene sequence encoding EGF; a modification, e.g., knockout, in the Phage 3 genome; a modification, e.g., knockout, in the colibactin pks island; a thymidine auxotrophy, as disclosed herein.
[0310] In particular embodiments, the bacterium comprises a gene sequence encoding EGF operably linked to a thermoregulated promoter, e.g., cI857; a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence; a modification, e.g., knockout, in the Phage 3 genome; a modification, e.g., knockout, in the colibactin pks island; a thymidine auxotrophy; and Apal (diffusible outer membrane), as disclosed herein.
[0311] In particular embodiments, the bacterium comprises a gene sequence encoding EGF operably linked to an oxygen level-dependent promoter, e.g., FNR-responsive promoter; a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence; a modification, e.g., knockout, in the Phage 3 genome; a modification, e.g., knockout, in the colibactin pks island; a thymidine auxotrophy, as disclosed herein.
[0312] In particular embodiments, the bacterium comprises a gene sequence encoding EGF operably linked to an oxygen level-dependent promoter, e.g., FNR-responsive promoter; a gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence; a modification, e.g., knockout, in the Phage 3 genome; a modification, e.g., knockout, in the colibactin pks island; a thymidine auxotrophy; and Apal (diffusible outer membrane), as disclosed herein.
[0313] In particular embodiments, the gene sequences encoding the EGF constructs comprising gene sequences encoding EGF operably linked to an inducible promoter, e.g., an oxygen level-dependent or temperature sensitive promoter, and the gene sequence encoding an N-terminal OmpA secretion tag operably linked to the EGF gene sequence may be integrated into the bacterial chromosome. In some embodiments, the bacterium comprises a single integrated copy of such an EGF gene sequence (i.e., OmpA-EGF). In some embodiments, the genetically engineered bacterium comprises multiple integrated copies of the EGF gene sequence. The multiple copies may be present at the same genomic integration site, e.g., arranged in tandem. In some embodiments, each copy of the EGF gene sequence may be operably linked to the same copy of the same promoter. In some embodiments, each copy of the EGF gene sequence may be operably linked to a different copy of the same promoter or different promoters. Alternatively, multiple copies of EGF gene sequences may be integrated at multiple distinct genomic integration sites, wherein each copy of EGF gene sequence is operably linked to a distinct instance of the promoter. In some embodiments, the promoters are multiple instances of the same promoter. In some embodiments, the promoters are multiple instances of different promoters. In some embodiments, the promoters are inducible promoters, such as a low oxygen inducible FNR promoter, a temperature sensitive promoter, or an IPTG inducible promoter.
[0314] In a particular embodiment, the bacterium comprises two copies of EGF gene sequences, wherein the two copies of the gene sequences are integrated at two distinct integration sites, and wherein each copy of the EGF gene sequence is operably linked to a separate instance of the same promoter. In a particular embodiment, the bacterium comprises three copies of the EGF gene sequences, wherein the three copies of the gene sequences each are integrated at three distinct integration sites, and wherein each copy of the EGF gene is operatively linked to a separate instance of the same promoter. In some embodiments, the promoter is an inducible promoter, e.g., a low oxygen inducible promoter (e.g., FNR promoter), a temperature sensitive promoter, or an IPTG inducible promoter.
[0315] In any of these embodiments, the EGF gene sequences may be operably linked to a gene sequence encoding an N-terminal OmpA secretion tag.
[0316] In any of these embodiments, the bacterium may further comprise one or more of (1) a knockout in the Phage 3 genome; (2) a modification, e.g., knockout, in the colibactin pks island; (3) a thymidine auxotrophy; and (4) Apal (diffusible outer membrane), as disclosed herein.
[0317] In some embodiments, the recombinant bacteria are capable of secreting about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, or 1.0 ng EGF/5el l cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0318] In some embodiments, the recombinant bacteria are capable of secreting about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 ug EGF/5el l cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0319] In some embodiments, the recombinant bacteria are capable of secreting about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, or 120 ug EGF/5el 1 cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0320] In some embodiments, the recombinant bacteria are capable of secreting at least about 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 pg EGF/5el 1 cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0321] In some embodiments, the recombinant bacteria are capable of secreting at least about 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 pg EGF/5el 1 cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0322] In some embodiments, the recombinant bacteria are capable of secreting at least about 350, 400, 450, 500, 550, 600, 650, 700, 750, or 800 pg EGF/5el 1 cells over 4 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0323] In some embodiments, the recombinant bacteria are capable of secreting about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, or 1.0 ug EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0324] In some embodiments, the recombinant bacteria are capable of secreting about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 ug EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0325] In some embodiments, the recombinant bacteria are capable of secreting about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, or 120 ug/mL EGF/5el 1 cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0326] In some embodiments, the recombinant bacteria are capable of secreting at least about 40, 50, 60, 70, 80, 90, or 100 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0327] In some embodiments, the recombinant bacteria are capable of secreting at least about 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0328] In some embodiments, the recombinant bacteria are capable of secreting at least about 210, 220, 230, 240, 250, 260, 270, 280, 290, or 300 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0329] In some embodiments, the recombinant bacteria are capable of secreting at least about 310, 320, 330, 340, 350, 360, 370, 380, 390, or 400 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0330] In some embodiments, the recombinant bacteria are capable of secreting at least about 410, 420, 430, 440, 450, 460, 470, 480, 490, or 500 pg EGF/5el 1 cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0331] In some embodiments, the recombinant bacteria are capable of secreting at least about 510, 520, 530, 540, 550, 560, 570, 580, 590, or 600 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0332] In some embodiments, the recombinant bacteria are capable of secreting at least about 610, 620, 630, 640, 650, 660, 670, 680, 690, or 700 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0333] In some embodiments, the recombinant bacteria are capable of secreting at least about 710, 720, 730, 740, 750, 760, 770, 780, 790, or 800 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0334] In some embodiments, the recombinant bacteria are capable of secreting at least about 350, 400, 450, 500, 550, 600, 650, 700, 750, or 800 pg EGF/5el l cells over 8 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0335] In some embodiments, the recombinant bacteria are capable of secreting about 0.1, 0.2, 0.3, 0.4, 0.5, 0.6, 0.7, 0.8, 0.9, or 1.0 ug EGF/5el l cells over 5 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0336] In some embodiments, the recombinant bacteria are capable of secreting about 1, 1.5, 2, 2.5, 3, 3.5, 4, 4.5, 5, 5.5, 6, 6.5, 7, 7.5, 8, 8.5, 9, 9.5, or 10 ug EGF/5el l cells over 5 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0337] In some embodiments, the recombinant bacteria are capable of secreting about 10, 20, 30, 40, 50, 60, 70, 80, 90, 100, 110, or 120 ug EGF/5el 1 cells over 5 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0338] In some embodiments, the recombinant bacteria are capable of secreting at least 110, 120, 130, 140, 150, 160, 170, 180, 190, or 200 pg EGF/5el 1 cells over 5 hours under inducing conditions, e.g., under low oxygen or anaerobic inducing conditions.
[0339] In any of the embodiments above, inducing conditions may be low oxygen or anaerobic inducing conditions or, alternatively, inducing conditions may be a temperature between about 37°C and 42°C. In some embodiments, inducing conditions may be the presence of an inducer, such as IPTG. In some specific embodiments, the inducing conditions are low oxygen or anaerobic inducing conditions. In some specific embodiments, the inducing conditions are a temperature between about 37°C and about 42°C.
Inducible regulatory regions
[0340] Herein the terms “payload” “polypeptide of interest” or “polypeptides of interest”, “protein of interest”, “proteins of interest”, “payloads” “effector molecule”, “effector” refers to one or more effector molecules described herein and/or one or more enzyme(s) or polypeptide(s) that function as enzymes for the production and secretion of such effector molecules, e.g., EGF.
[0341] In some embodiments, the bacterial cell comprises a stably maintained plasmid or chromosome carrying the gene(s) encoding payload (s), such that the payload(s) can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut. In some embodiments, bacterial cell comprises two or more distinct payloads or operons, e.g., two or more payload genes. In some embodiments, bacterial cell comprises three or more distinct transporters or operons, e.g., three or more payload genes. In some embodiments, bacterial cell comprises 4, 5, 6, 7, 8, 9, 10, or more distinct payloads or operons, e.g., 4, 5, 6, 7, 8, 9, 10, or more payload genes.
[0342] Additional effector molecules, e.g., therapeutic polypeptides, which can be secreted are described in PCT/US2017/013072, filed 01/11/2017; PCT/US2017/016609, filed 02/03/2017; PCT/US2016/039444, filed 06/24/2016; PCT/US2016/069052, filed 12/28/2016; PCT/US2017/012946, filed 01/11/2017; PCT/US2017/017552, filed 02/10/2017;
PCT/US2017/017563, filed 02/10/2017, the contents of which is herein incorporated by reference in its entirety.
[0343] In some embodiments, the recombinant bacteria comprise multiple copies of the same payload gene(s). In some embodiments, the gene encoding the payload is present on a plasmid and operably linked to a directly or indirectly inducible promoter. In some embodiments, the gene encoding the payload is present on a plasmid and operably linked to a constitutive promoter. In some embodiments, the gene encoding the payload is present on a plasmid and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions. In some embodiments, the gene encoding the payload is present on a plasmid and operably linked to a temperature sensitive promoter. In some embodiments, the gene encoding the payload is present on plasmid and operably linked to a promoter that is induced by exposure to tetracycline or arabinose, or another chemical or nutritional inducer described herein.
[0344] In some embodiments, the gene encoding the payload is present on a chromosome and operably linked to a directly or indirectly inducible promoter. In some embodiments, the gene encoding the payload is present on a chromosome and operably linked to a constitutive promoter. In some embodiments, the gene encoding the payload is present in the chromosome and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions. In some embodiments, the gene encoding the payload is present in the chromosome and operably linked to a temperature sensitive promoter. In some embodiments, the gene encoding the payload is present on chromosome
and operably linked to a promoter that is induced by exposure to tetracycline or arabinose, or another chemical or nutritional inducer described herein.
[0345] In some embodiments, the recombinant bacteria comprise two or more payloads, all of which are present on the chromosome. In some embodiments, the recombinant bacteria comprise two or more payloads, all of which are present on one or more same or different plasmids. In some embodiments, the recombinant bacteria comprise two or more payloads, some of which are present on the chromosome and some of which are present on one or more same or different plasmids.
[0346] In any of the nucleic acid embodiments described above, an EGF payload is operably linked to one or more directly or indirectly inducible promoter(s). In some embodiments, the one or more payload(s) are operably linked to a directly or indirectly inducible promoter that is induced under exogenous environmental conditions, e.g., conditions found in the gut, e.g., induced by metabolites found in the gut, or other specific conditions. In some embodiments, the one or more payload(s) are operably linked to a directly or indirectly inducible promoter that is temperature sensitive or induced under low-oxygen or anaerobic conditions, or induced under inflammatory conditions (e.g., RNS, ROS), as described herein. In some embodiments, the two or more gene sequence(s) are linked to a directly or indirectly inducible promoter that is induced by exposure a chemical or nutritional inducer, which may or may not be present under in vivo conditions and which may be present during in vitro conditions (such as strain culture, expansion, manufacture), such as tetracycline or arabinose, or others described herein. In some embodiments, the two or more payloads are all linked to a constitutive promoter, as described herein.
[0347] In some embodiments, the promoter is induced under in vivo conditions, e.g., the gut, as described herein. In some embodiments, the promoter is induced under in vitro conditions, e.g., various cell culture and/or cell manufacturing conditions, as described herein.
[0348] In some embodiments, the promoter that is operably linked to the gene encoding the payload is directly induced by exogenous environmental conditions (e.g., in vivo and/or in vitro and/or production/manufacturing conditions).
[0349] In some embodiments, the promoter is directly or indirectly induced by exogenous environmental conditions specific to the gut of a mammal, e.g., to the small intestine of a mammal. In some embodiments, the promoter is directly or indirectly induced by low-oxygen or anaerobic conditions such as the environment of the mammalian gut. In some embodiments, the promoter is a temperature sensitive promoter. In some embodiments, the promoter is directly or indirectly induced by molecules or metabolites that are specific to the tumor, a particular tissue or the gut of a mammal. In some embodiments, the promoter is directly or indirectly induced by a molecule that is co- administered with the bacterial cell.
FNR dependent Regulation
[0350] The recombinant bacteria comprise a gene or gene cassette for producing EGF, wherein the gene or gene cassette is operably linked to a directly or indirectly inducible promoter that is controlled
by exogenous environmental condition(s). In some embodiments, the inducible promoter is an oxygen level-dependent promoter and EGF is expressed in low-oxygen, microaerobic, or anaerobic conditions. For example, in low oxygen conditions, the oxygen level-dependent promoter is activated by a corresponding oxygen level-sensing transcription factor, thereby driving production of EGF. [0351] Bacteria have evolved transcription factors that are capable of sensing oxygen levels. Different signaling pathways may be triggered by different oxygen levels and occur with different kinetics. An oxygen level-dependent promoter is a nucleic acid sequence to which one or more oxygen level-sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression. In one embodiment, the recombinant bacteria comprise a gene or gene cassette for producing a payload under the control of an oxygen level-dependent promoter. In a more specific aspect, the recombinant bacteria comprise a gene or gene cassette for producing a payload under the control of an oxygen level-dependent promoter that is activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut.
[0352] In certain embodiments, the bacterial cell comprises a gene encoding a pay load expressed under the control of a fumarate and nitrate reductase regulator (FNR) responsive promoter. In E. coli, FNR is a major transcriptional activator that controls the switch from aerobic to anaerobic metabolism (Unden et al., 1997). In the anaerobic state, FNR dimerizes into an active DNA binding protein that activates hundreds of genes responsible for adapting to anaerobic growth. In the aerobic state, FNR is prevented from dimerizing by oxygen and is inactive. Exemplary FNR responsive promoters include, but are not limited to, SEQ ID NO: 1-11, 336 and 337. FNR promoter sequences are known in the art, and any suitable FNR promoter sequence(s) may be used in the recombinant bacteria.
[0353] In some embodiments, the recombinant bacteria comprise one or more of: SEQ ID NOS: 1- 7, nirBl promoter (SEQ ID NO: 1), nirB2 promoter (SEQ ID NO: 8), nirB3 promoter (SEQ ID NO: 9), ydfZ promoter (SEQ ID NO: 2), nirB promoter fused to a strong ribosome binding site (SEQ ID NO: 336), ydfZ promoter fused to a strong ribosome binding site (SEQ ID NO: 4), fnrS, an anaerobically induced small RNA gene (fnrSl promoter SEQ ID NO: 5 or fnrS2 promoter SEQ ID NO: 10), nirB promoter fused to a crp binding site (SEQ ID NO: 11), and fnrS fused to a crp binding site (SEQ ID NO: 337). In some embodiments, the FNR-responsive promoter is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337. [0354] In some embodiments, multiple distinct FNR nucleic acid sequences are inserted in the recombinant bacteria. In alternate embodiments, the recombinant bacteria comprise a gene encoding a payload expressed under the control of an alternate oxygen level-dependent promoter, e.g., DNR (Trunk et al., 2010) or ANR (Ray et al., 1997). In these embodiments, expression of the payload gene is particularly activated in a low-oxygen or anaerobic environment, such as in the gut, e.g., a mammalian gut, e.g., a human gut. In some embodiments, gene expression is further optimized by
methods known in the art, e.g., by optimizing ribosomal binding sites and/or increasing mRNA stability.
[0355] In another embodiment, the recombinant bacteria comprise a gene sequence encoding EGF, expressed under the control of anaerobic regulation of arginine deiminiase and nitrate reduction transcriptional regulator (ANR). In P. aeruginosa, ANR is “required for the expression of physiological functions which are inducible under oxygen-limiting or anaerobic conditions” (Winteler et al., 1996; Sawers 1991). P. aeruginosa ANR is homologous with E. coli FNR, and “the consensus FNR site (TTGAT — ATCAA) was recognized efficiently by ANR and FNR” (Winteler et al., 1996). Like FNR, in the anaerobic state, ANR activates numerous genes responsible for adapting to anaerobic growth. In the aerobic state, ANR is inactive. Pseudomonas fluorescens, Pseudomonas putida, Pseudomonas syringae, and Pseudomonas mendocina all have functional analogs of ANR (Zimmermann et al., 1991). Promoters that are regulated by ANR are known in the art, e.g., the promoter of the arcDABC operon (see, e.g., Hasegawa et al., 1998).
[0356] In other embodiments, the one or more gene sequence(s) for producing a payload are expressed under the control of an oxygen level-dependent promoter fused to a binding site for a transcriptional activator, e.g., CRP. CRP (cyclic AMP receptor protein or catabolite activator protein or CAP) plays a major regulatory role in bacteria by repressing genes responsible for the uptake, metabolism, and assimilation of less favorable carbon sources when rapidly metabolizable carbohydrates, such as glucose, are present (Wu et al., 2015). This preference for glucose has been termed glucose repression, as well as carbon catabolite repression (Deutscher, 2008; Gbrke and Stiilke, 2008). In some embodiments, the gene or gene cassette for producing EGF is controlled by an oxygen level-dependent promoter fused to a CRP binding site. In some embodiments, the one or more gene sequence(s) for a payload are controlled by a FNR promoter fused to a CRP binding site. In these embodiments, cyclic AMP binds to CRP when no glucose is present in the environment. This binding causes a conformational change in CRP, and allows CRP to bind tightly to its binding site. CRP binding then activates transcription of the gene or gene cassette by recruiting RNA polymerase to the FNR promoter via direct protein-protein interactions. In the presence of glucose, cyclic AMP does not bind to CRP and transcription of the gene or gene cassette for producing an payload is repressed. In some embodiments, an oxygen level-dependent promoter (e.g., an FNR promoter) fused to a binding site for a transcriptional activator is used to ensure that the gene or gene cassette for producing a payload is not expressed under anaerobic conditions when sufficient amounts of glucose are present, e.g., by adding glucose to growth media in vitro.
[0357] In some embodiments, the recombinant bacteria comprise an oxygen level-dependent promoter from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise an oxygen level-sensing transcription factor, e.g., FNR, ANR or DNR, from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise an oxygen level-sensing transcription factor and corresponding promoter from a
different species, strain, or substrain of bacteria. The heterologous oxygen-level dependent transcriptional regulator and/or promoter increases the transcription of genes operably linked to said promoter, e.g., one or more gene sequence(s) for producing the payload(s) in a low-oxygen or anaerobic environment, as compared to the native gene(s) and promoter in the bacteria under the same conditions. In certain embodiments, the non-native oxygen-level dependent transcriptional regulator is an FNR protein from N. gonorrhoeae (see, e.g., Isabella et al., 2011). In some embodiments, the corresponding wild-type transcriptional regulator is left intact and retains wild-type activity. In alternate embodiments, the corresponding wild-type transcriptional regulator is deleted or mutated to reduce or eliminate wild-type activity.
[0358] In some embodiments, the recombinant bacteria comprise a wild-type oxygen-level dependent transcriptional regulator, e.g., FNR, ANR, or DNR, and corresponding promoter that is mutated relative to the wild-type promoter from bacteria of the same subtype. The mutated promoter enhances binding to the wild-type transcriptional regulator and increases the transcription of genes operably linked to said promoter, e.g., the gene encoding the payload, in a low-oxygen or anaerobic environment, as compared to the wild-type promoter under the same conditions. In some embodiments, the recombinant bacteria comprise a wild-type oxygen-level dependent promoter, e.g., FNR, ANR, or DNR promoter, and corresponding transcriptional regulator that is mutated relative to the wild-type transcriptional regulator from bacteria of the same subtype. The mutated transcriptional regulator enhances binding to the wild-type promoter and increases the transcription of genes operably linked to said promoter, e.g., the gene encoding the payload, in a low-oxygen or anaerobic environment, as compared to the wild-type transcriptional regulator under the same conditions. In certain embodiments, the mutant oxygen-level dependent transcriptional regulator is an FNR protein comprising amino acid substitutions that enhance dimerization and FNR activity (see, e.g., Moore et al., (2006). In some embodiments, both the oxygen level-sensing transcriptional regulator and corresponding promoter are mutated relative to the wild-type sequences from bacteria of the same subtype in order to increase expression of the payload in low-oxygen conditions.
[0359] In some embodiments, the bacterial cells comprise multiple copies of the endogenous gene encoding the oxygen level-sensing transcriptional regulator, e.g., the FNR gene. In some embodiments, the gene encoding the oxygen level-sensing transcriptional regulator is present on a plasmid. In some embodiments, the gene encoding the oxygen level- sensing transcriptional regulator and the gene encoding the payload are present on different plasmids. In some embodiments, the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding the payload are present on the same plasmid.
[0360] In some embodiments, the gene encoding the oxygen level-sensing transcriptional regulator is present on a chromosome. In some embodiments, the gene encoding the oxygen level-sensing transcriptional regulator and the gene encoding the payload are present on different chromosomes. In some embodiments, the gene encoding the oxygen level-sensing transcriptional regulator and the gene
encoding the payload are present on the same chromosome. In some instances, it may be advantageous to express the oxygen level-sensing transcriptional regulator under the control of an inducible promoter in order to enhance expression stability. In some embodiments, expression of the transcriptional regulator is controlled by a different promoter than the promoter that controls expression of the gene encoding the payload. In some embodiments, expression of the transcriptional regulator is controlled by the same promoter that controls expression of the payload. In some embodiments, the transcriptional regulator and the payload are divergently transcribed from a promoter region.
RNS-dependent regulation
[0361] In some embodiments, the recombinant bacteria comprise a gene encoding a payload that is expressed under the control of an inducible promoter. In some embodiments, the recombinant bacterium that expresses a payload under the control of a promoter that is activated by inflammatory conditions. In one embodiment, the gene for producing the payload is expressed under the control of an inflammatory-dependent promoter that is activated in inflammatory environments, e.g., a reactive nitrogen species or RNS promoter.
[0362] As used herein, “reactive nitrogen species” and “RNS” are used interchangeably to refer to highly active molecules, ions, and/or radicals derived from molecular nitrogen. RNS can cause deleterious cellular effects such as nitrosative stress. RNS includes, but is not limited to, nitric oxide (NO*), peroxynitrite or peroxynitrite anion (ONOO-), nitrogen dioxide (*NO2), dinitrogen trioxide (N2O3), peroxynitrous acid (ONOOH), and nitroperoxycarbonate (ONOOCO2-) (unpaired electrons denoted by •). Bacteria have evolved transcription factors that are capable of sensing RNS levels. Different RNS signaling pathways are triggered by different RNS levels and occur with different kinetics.
[0363] As used herein, “RNS-inducible regulatory region” refers to a nucleic acid sequence to which one or more RNS-sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression; in the presence of RNS, the transcription factor binds to and/or activates the regulatory region. In some embodiments, the RNS-inducible regulatory region comprises a promoter sequence. In some embodiments, the transcription factor senses RNS and subsequently binds to the RNS-inducible regulatory region, thereby activating downstream gene expression. In alternate embodiments, the transcription factor is bound to the RNS-inducible regulatory region in the absence of RNS; in the presence of RNS, the transcription factor undergoes a conformational change, thereby activating downstream gene expression. The RNS-inducible regulatory region may be operatively linked to a gene or genes, e.g., a payload gene sequence(s), e.g., any of the payloads described herein. For example, in the presence of RNS, a transcription factor senses RNS and activates a corresponding RNS-inducible regulatory region, thereby driving expression of an operatively linked gene sequence. Thus, RNS induces expression of the gene or gene sequences.
[0364] Each regulatory region is capable of binding at least one corresponding RNS-sensing transcription factor. Examples of transcription factors that sense RNS and their corresponding RNS- responsive genes, promoters, and/or regulatory regions include, but are not limited to, those shown in Table 6.
[0365] In some embodiments, the recombinant bacteria comprise a tunable regulatory region that is directly or indirectly controlled by a transcription factor that is capable of sensing at least one reactive nitrogen species. The tunable regulatory region is operatively linked to a gene or genes capable of directly or indirectly driving the expression of a payload, thus controlling expression of the payload relative to RNS levels. For example, the tunable regulatory region is a RNS-inducible regulatory region, and the payload is a payload, such as any of the payloads provided herein; when RNS is present, e.g., in an inflamed tissue, a RNS-sensing transcription factor binds to and/or activates the regulatory region and drives expression of the payload gene or genes. Subsequently, when inflammation is ameliorated, RNS levels are reduced, and production of the payload is decreased or eliminated.
[0366] In some embodiments, the tunable regulatory region is a RNS-inducible regulatory region; in the presence of RNS, a transcription factor senses RNS and activates the RNS-inducible regulatory region, thereby driving expression of an operatively linked gene or genes. In some embodiments, the transcription factor senses RNS and subsequently binds to the RNS-inducible regulatory region, thereby activating downstream gene expression. In alternate embodiments, the transcription factor is bound to the RNS-inducible regulatory region in the absence of RNS; when the transcription factor senses RNS, it undergoes a conformational change, thereby inducing downstream gene expression. [0367] In some embodiments, the tunable regulatory region is a RNS-inducible regulatory region, and the transcription factor that senses RNS is NorR. NorR “is an NO-responsive transcriptional activator that regulates expression of the norVW genes encoding flavorubredoxin and an associated flavoprotein, which reduce NO to nitrous oxide” (Spiro 2006). The recombinant bacteria may comprise any suitable RNS-responsive regulatory region from a gene that is activated by NorR.
Genes that are capable of being activated by NorR are known in the art (see, e.g., Spiro 2006; Vine et al., 2011; Karlinsey et al., 2012). In certain embodiments, the recombinant bacteria comprise a RNS- inducible regulatory region from nor VW that is operatively linked to a gene or genes, e.g., one or more payload gene sequence(s). In the presence of RNS, a NorR transcription factor senses RNS and
activates to the norVW regulatory region, thereby driving expression of the operatively linked gene(s) and producing the payload(s).
[0368] In some embodiments, the tunable regulatory region is a RNS-inducible regulatory region, and the transcription factor that senses RNS is DNR. DNR (dissimilatory nitrate respiration regulator) “promotes the expression of the nir, the nor and the nos genes” in the presence of nitric oxide (Castiglione et al., 2009). The recombinant bacteria may comprise any suitable RNS-responsive regulatory region from a gene that is activated by DNR. Genes that are capable of being activated by DNR are known in the art (see, e.g., Castiglione et al., 2009; Giardina et al., 2008). In certain embodiments, the recombinant bacteria comprise a RNS-inducible regulatory region from norCB that is operatively linked to a gene or gene cassette, e.g., a butyrogenic gene cassette. In the presence of RNS, a DNR transcription factor senses RNS and activates to the norCB regulatory region, thereby driving expression of the operatively linked gene or genes and producing one or more payloads. In some embodiments, the DNR is Pseudomonas aeruginosa DNR. Any suitable transcriptional regulator that is controlled by exogenous environmental conditions and corresponding regulatory region may be used. Non-limiting examples include ArcA/B, ResD/E, NreA/B/C, and AirSR, and others are known in the art.
[0369] In some embodiments, the tunable regulatory region is a RNS-derepressible regulatory region, and binding of a corresponding transcription factor represses downstream gene expression; in the presence of RNS, the transcription factor no longer binds to the regulatory region, thereby derepressing the operatively linked gene or gene cassette.
[0370] In some embodiments, the tunable regulatory region is a RNS-derepressible regulatory region, and the transcription factor that senses RNS is NsrR. NsrR is “an Rrf2-type transcriptional repressor [that] can sense NO and control the expression of genes responsible for NO metabolism” (Isabella et al., 2009). The recombinant bacteria may comprise any suitable RNS-responsive regulatory region from a gene that is repressed by NsrR. In some embodiments, the NsrR is Neisseria gonorrhoeae NsrR. Genes that are capable of being repressed by NsrR are known in the art (see, e.g., Isabella et al., 2009; Dunn et al., 2010). In certain embodiments, the recombinant bacteria comprise a RNS- derepressible regulatory region from norB that is operatively linked to a gene or genes, e.g., a payload gene or genes. In the presence of RNS, an NsrR transcription factor senses RNS and no longer binds to the norB regulatory region, thereby derepressing the operatively linked a payload gene or genes and producing the encoding a payload(s).
[0371] In some embodiments, it is advantageous for the recombinant bacteria to express a RNS- sensing transcription factor that does not regulate the expression of a significant number of native genes in the bacteria. In some embodiments, the recombinant bacterium expresses a RNS-sensing transcription factor from a different species, strain, or substrain of bacteria, wherein the transcription factor does not bind to regulatory sequences in the recombinant bacterium. In some embodiments, the recombinant bacterium is Escherichia coli, and the RNS-sensing transcription factor is NsrR, e.g.,
from is Neisseria gonorrhoeae, wherein the Escherichia coli does not comprise binding sites for said NsrR. In some embodiments, the heterologous transcription factor minimizes or eliminates off-target effects on endogenous regulatory regions and genes in the recombinant bacteria.
[0372] In these embodiments, the recombinant bacteria may comprise a two-repressor activation regulatory circuit, which is used to express a payload. The two-repressor activation regulatory circuit comprises a first RNS-sensing repressor and a second repressor, which is operatively linked to a gene or gene cassette, e.g., encoding a payload. In one aspect of these embodiments, the RNS-sensing repressor inhibits transcription of the second repressor, which inhibits the transcription of the gene or gene cassette. Examples of second repressors useful in these embodiments, include, but are not limited to, TetR, Cl, and LexA. In the absence of binding by the first repressor (which occurs in the absence of RNS), the second repressor is transcribed, which represses expression of the gene or genes. In the presence of binding by the first repressor (which occurs in the presence of RNS), expression of the second repressor is repressed, and the gene or genes, e.g., a payload gene or genes is expressed. [0373] A RNS-responsive transcription factor may induce, derepress, or repress gene expression depending upon the regulatory region sequence used in the recombinant bacteria. One or more types of RNS-sensing transcription factors and corresponding regulatory region sequences may be present in recombinant bacteria. In some embodiments, the recombinant bacteria comprise one type of RNS- sensing transcription factor, e.g., NsrR, and one corresponding regulatory region sequence, e.g., from norB. In some embodiments, the recombinant bacteria comprise one type of RNS-sensing transcription factor, e.g., NsrR, and two or more different corresponding regulatory region sequences, e.g., from norB and aniA. In some embodiments, the recombinant bacteria comprise two or more types of RNS-sensing transcription factors, e.g., NsrR and NorR, and two or more corresponding regulatory region sequences, e.g., from norB and norR, respectively. One RNS-responsive regulatory region may be capable of binding more than one transcription factor. In some embodiments, the recombinant bacteria comprise two or more types of RNS-sensing transcription factors and one corresponding regulatory region sequence. Nucleic acid sequences of several RNS-regulated regulatory regions are known in the art (see, e.g., Spiro 2006; Isabella et al., 2009; Dunn et al., 2010; Vine et al., 2011; Karlinsey et al., 2012).
[0374] In some embodiments, the recombinant bacteria comprise a gene encoding a RNS-sensing transcription factor, e.g., the nsrR gene, that is controlled by its native promoter, an inducible promoter, a promoter that is stronger than the native promoter, e.g., the GlnRS promoter or the P(Bla) promoter, or a constitutive promoter. In some instances, it may be advantageous to express the RNS- sensing transcription factor under the control of an inducible promoter in order to enhance expression stability. In some embodiments, expression of the RNS-sensing transcription factor is controlled by a different promoter than the promoter that controls expression of EGF. In some embodiments, expression of the RNS-sensing transcription factor is controlled by the same promoter that controls
expression of EGF. In some embodiments, the RNS-sensing transcription factor and EGF are divergently transcribed from a promoter region.
[0375] In some embodiments, the recombinant bacteria comprise a gene for a RNS-sensing transcription factor from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise a RNS-responsive regulatory region from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise a RNS- sensing transcription factor and corresponding RNS-responsive regulatory region from a different species, strain, or substrain of bacteria. The heterologous RNS-sensing transcription factor and regulatory region may increase the transcription of genes operatively linked to said regulatory region in the presence of RNS, as compared to the native transcription factor and regulatory region from bacteria of the same subtype under the same conditions.
[0376] In some embodiments, the recombinant bacteria comprise a RNS-sensing transcription factor, NsrR, and corresponding regulatory region, nsrR, from Neisseria gonorrhoeae. In some embodiments, the native RNS-sensing transcription factor, e.g., NsrR, is left intact and retains wild- type activity. In alternate embodiments, the native RNS-sensing transcription factor, e.g., NsrR, is deleted or mutated to reduce or eliminate wild-type activity.
[0377] In some embodiments, the recombinant bacteria comprise multiple copies of the endogenous gene encoding the RNS-sensing transcription factor, e.g., the nsrR gene. In some embodiments, the gene encoding the RNS-sensing transcription factor is present on a plasmid. In some embodiments, the gene encoding the RNS-sensing transcription factor and the gene or gene cassette for producing EGF are present on different plasmids. In some embodiments, the gene encoding the RNS-sensing transcription factor and the gene or gene cassette for producing EGF are present on the same plasmid. In some embodiments, the gene encoding the RNS-sensing transcription factor is present on a chromosome. In some embodiments, the gene encoding the RNS-sensing transcription factor and the gene or gene cassette for producing EGF are present on different chromosomes. In some embodiments, the gene encoding the RNS-sensing transcription factor and the gene or gene cassette for producing EGF are present on the same chromosome.
[0378] In some embodiments, the recombinant bacteria comprise a wild-type gene encoding a RNS- sensing transcription factor, e.g., the NsrR gene, and a corresponding regulatory region, e.g., a norB regulatory region, that is mutated relative to the wild-type regulatory region from bacteria of the same subtype. The mutated regulatory region increases the expression of the payload in the presence of RNS, as compared to the wild-type regulatory region under the same conditions. In some embodiments, the recombinant bacteria comprise a wild-type RNS-responsive regulatory region, e.g., the norB regulatory region, and a corresponding transcription factor, e.g., NsrR, that is mutated relative to the wild-type transcription factor from bacteria of the same subtype. The mutant transcription factor increases the expression of the payload in the presence of RNS, as compared to the wild-type transcription factor under the same conditions. In some embodiments, both the RNS-
sensing transcription factor and corresponding regulatory region are mutated relative to the wild-type sequences from bacteria of the same subtype in order to increase expression of the payload in the presence of RNS.
[0379] In some embodiments, the gene or gene cassette for producing the e molecule(s) is present on a plasmid and operably linked to a promoter that is induced by RNS. In some embodiments, expression is further optimized by methods known in the art, e.g., by optimizing ribosomal binding sites, manipulating transcriptional regulators, and/or increasing mRNA stability.
[0380] In some embodiments, any of the gene(s) of the present disclosure may be integrated into the bacterial chromosome at one or more integration sites. For example, one or more copies of one or more encoding a pay load gene(s) may be integrated into the bacterial chromosome. Having multiple copies of the gene or gen(s) integrated into the chromosome allows for greater production of the payload(s) and also permits fine-tuning of the level of expression. Alternatively, different circuits described herein, such as any of the secretion or exporter circuits, in addition to the EGF gene(s) or gene cassette(s) could be integrated into the bacterial chromosome at one or more different integration sites to perform multiple different functions.
[0381] In some embodiments, the recombinant bacteria produce at least one payload in the presence of RNS to reduce local gut inflammation by at least about 1.5 -fold, at least about 2-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1,000-fold, or at least about 1,500-fold as compared to unmodified bacteria of the same subtype under the same conditions. Inflammation may be measured by methods known in the art, e.g., counting disease lesions using endoscopy; detecting T regulatory cell differentiation in peripheral blood, e.g., by fluorescence activated sorting; measuring T regulatory cell levels; measuring cytokine levels; measuring areas of mucosal damage; assaying inflammatory biomarkers, e.g., by qPCR; PCR arrays; transcription factor phosphorylation assays; immunoassays; and/or cytokine assay kits (Mesoscale, Cayman Chemical, Qiagen).
[0382] In some embodiments, the recombinant bacteria produce at least about 1.5-fold, at least about 2-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1,000-fold, or at least about 1,500-fold more of payload in the presence of RNS than unmodified bacteria of the same subtype under the same conditions. Certain unmodified bacteria will not have detectable levels of the payload. In embodiments using genetically modified forms of these bacteria, payload will be detectable in the presence of RNS.
ROS-dependent regulation
[0383] In some embodiments, the recombinant bacteria comprise a gene for producing a payload that is expressed under the control of an inducible promoter. In some embodiments, the recombinant bacterium that expresses a payload under the control of a promoter that is activated by conditions of cellular damage. In one embodiment, the gene for producing the payload is expressed under the control of a cellular damaged-dependent promoter that is activated in environments in which there is cellular or tissue damage, e.g., a reactive oxygen species or ROS promoter.
[0384] As used herein, “reactive oxygen species” and “ROS” are used interchangeably to refer to highly active molecules, ions, and/or radicals derived from molecular oxygen. ROS can be produced as byproducts of aerobic respiration or metal -catalyzed oxidation and may cause deleterious cellular effects such as oxidative damage. ROS includes, but is not limited to, hydrogen peroxide (H2O2), organic peroxide (ROOH), hydroxyl ion (OH-), hydroxyl radical (*OH), superoxide or superoxide anion (*O2-), singlet oxygen (102), ozone (03), carbonate radical, peroxide or peroxyl radical (*O2- 2), hypochlorous acid (HOC1), hypochlorite ion (OC1-), sodium hypochlorite (NaOCl), nitric oxide (NO*), and peroxynitrite or peroxynitrite anion (ONOO-) (unpaired electrons denoted by •). Bacteria have evolved transcription factors that are capable of sensing ROS levels. Different ROS signaling pathways are triggered by different ROS levels and occur with different kinetics (Marinho et al., 2014).
[0385] As used herein, “ROS-inducible regulatory region” refers to a nucleic acid sequence to which one or more ROS-sensing transcription factors is capable of binding, wherein the binding and/or activation of the corresponding transcription factor activates downstream gene expression; in the presence of ROS, the transcription factor binds to and/or activates the regulatory region. In some embodiments, the ROS-inducible regulatory region comprises a promoter sequence. In some embodiments, the transcription factor senses ROS and subsequently binds to the ROS-inducible regulatory region, thereby activating downstream gene expression. In alternate embodiments, the transcription factor is bound to the ROS-inducible regulatory region in the absence of ROS; in the presence of ROS, the transcription factor undergoes a conformational change, thereby activating downstream gene expression. The ROS-inducible regulatory region may be operatively linked to a gene sequence or gene sequence, e.g., a sequence or sequences encoding one or more payload(s). For example, in the presence of ROS, a transcription factor, e.g., OxyR, senses ROS and activates a corresponding ROS-inducible regulatory region, thereby driving expression of an operatively linked gene sequence or gene sequences. Thus, ROS induces expression of the gene or genes. Alternatively, in the presence of ROS, a transcription factor, e.g., PerR, senses ROS and binds to a corresponding ROS-repressible regulatory region, thereby blocking expression of an operatively linked gene sequence or gene sequences. Thus, ROS represses expression of the gene or genes.
[0386] Each regulatory region is capable of binding at least one corresponding ROS-sensing transcription factor. Examples of transcription factors that sense ROS and their corresponding ROS-
responsive genes, promoters, and/or regulatory regions include, but are not limited to, those shown in
Table 7.
[0387] In some embodiments, the recombinant bacteria comprise a tunable regulatory region that is directly or indirectly controlled by a transcription factor that is capable of sensing at least one reactive oxygen species. The tunable regulatory region is operatively linked to a gene or gene cassette capable of directly or indirectly driving the expression of a payload, thus controlling expression of the payload relative to ROS levels. For example, the tunable regulatory region is a ROS-inducible regulatory region, and the molecule is a payload; when ROS is present, e.g.. in an inflamed tissue, a ROS- sensing transcription factor binds to and/or activates the regulatory region and drives expression of the gene sequence for the payload, thereby producing the payload. Subsequently, when inflammation is ameliorated, ROS levels are reduced, and production of the payload is decreased or eliminated.
[0388] In some embodiments, the tunable regulatory region is a ROS-inducible regulatory region; in the presence of ROS, a transcription factor senses ROS and activates the ROS-inducible regulatory region, thereby driving expression of an operatively linked gene or gene cassette. In some embodiments, the transcription factor senses ROS and subsequently binds to the ROS-inducible regulatory region, thereby activating downstream gene expression. In alternate embodiments, the transcription factor is bound to the ROS-inducible regulatory region in the absence of ROS; when the transcription factor senses ROS, it undergoes a conformational change, thereby inducing downstream gene expression.
[0389] In some embodiments, the tunable regulatory region is a ROS-inducible regulatory region, and the transcription factor that senses ROS is OxyR. OxyR “functions primarily as a global regulator of the peroxide stress response” and is capable of regulating dozens of genes, e.g., “genes involved in H2O2 detoxification (katE, ahpCF), heme biosynthesis (hemH), reductant supply (grxA, gor, trxC),
thiol-disulfide isomerization (dsbG), Fe-S center repair (sufA-E, sufS), iron binding (yaaA), repression of iron import systems (fur)” and “OxyS, a small regulatory RNA” (Dubbs et al., 2012). The recombinant bacteria may comprise any suitable ROS -responsive regulatory region from a gene that is activated by OxyR. Genes that are capable of being activated by OxyR are known in the art (see, e.g., Zheng et al., 2001; Dubbs et al., 2012). In certain embodiments, the recombinant bacteria comprise a ROS-inducible regulatory region from oxyS that is operatively linked to a gene, e.g., a payload gene. In the presence of ROS, e.g., H2O2, an OxyR transcription factor senses ROS and activates to the oxyS regulatory region, thereby driving expression of the operatively linked payload gene and producing the payload. In some embodiments, OxyR is encoded by an E. coll oxyR gene. In some embodiments, the oxyS regulatory region is an E. coll oxyS regulatory region. In some embodiments, the ROS-inducible regulatory region is selected from the regulatory region of katG, dps, and ahpC.
[0390] In alternate embodiments, the tunable regulatory region is a ROS-inducible regulatory region, and the corresponding transcription factor that senses ROS is SoxR. When SoxR is “activated by oxidation of its [2Fe-2S] cluster, it increases the synthesis of SoxS, which then activates its target gene expression” (Koo et al., 2003). “SoxR is known to respond primarily to superoxide and nitric oxide” (Koo et al., 2003), and is also capable of responding to H2O2. The recombinant bacteria may comprise any suitable ROS-responsive regulatory region from a gene that is activated by SoxR. Genes that are capable of being activated by SoxR are known in the art (see, e.g., Koo et al., 2003). In certain embodiments, the recombinant bacteria comprise a ROS-inducible regulatory region from soxS that is operatively linked to a gene, e.g., a payload. In the presence of ROS, the SoxR transcription factor senses ROS and activates the soxS regulatory region, thereby driving expression of the operatively linked a payload gene and producing the payload.
[0391] In some embodiments, the tunable regulatory region is a ROS-derepressible regulatory region, and binding of a corresponding transcription factor represses downstream gene expression; in the presence of ROS, the transcription factor no longer binds to the regulatory region, thereby derepressing the operatively linked gene or gene cassette.
[0392] In some embodiments, the tunable regulatory region is a ROS-derepressible regulatory region, and the transcription factor that senses ROS is OhrR. OhrR “binds to a pair of inverted repeat DNA sequences overlapping the ohrA promoter site and thereby represses the transcription event,” but oxidized OhrR is “unable to bind its DNA target” (Duarte et al., 2010). OhrR is a “transcriptional repressor [that] . . . senses both organic peroxides and NaOQ” (Dubbs et al., 2012) and is “weakly activated by H2O2 but it shows much higher reactivity for organic hydroperoxides” (Duarte et al., 2010). The recombinant bacteria may comprise any suitable ROS-responsive regulatory region from a gene that is repressed by OhrR. Genes that are capable of being repressed by OhrR are known in the art (see, e.g., Dubbs et al., 2012). In certain embodiments, the recombinant bacteria comprise a ROS- derepressible regulatory region from ohrA that is operatively linked to a gene or gene cassette, e.g., a
payload gene. In the presence of ROS, e.g., NaOCl, an OhrR transcription factor senses ROS and no longer binds to the ohrA regulatory region, thereby derepressing the operatively linked payload gene and producing the payload.
[0393] OhrR is a member of the MarR family of ROS -responsive regulators. “Most members of the MarR family are transcriptional repressors and often bind to the -10 or -35 region in the promoter causing a steric inhibition of RNA polymerase binding” (Bussmann et al., 2010). Other members of this family are known in the art and include, but are not limited to, OspR, MgrA, RosR, and SarZ. In some embodiments, the transcription factor that senses ROS is OspR, MgRA, RosR, and/or SarZ, and the recombinant bacteria comprises one or more corresponding regulatory region sequences from a gene that is repressed by OspR, MgRA, RosR, and/or SarZ. Genes that are capable of being repressed by OspR, MgRA, RosR, and/or SarZ are known in the art (see, e.g., Dubbs et al., 2012).
[0394] In some embodiments, the tunable regulatory region is a ROS-derepressible regulatory region, and the corresponding transcription factor that senses ROS is RosR. RosR is “a MarR-type transcriptional regulator” that binds to an “18-bp inverted repeat with the consensus sequence TTGTTGAYRYRTCAACWA (SEQ ID NO: 359)” and is “reversibly inhibited by the oxidant H2O2” (Bussmann et al., 2010). RosR is capable of repressing numerous genes and putative genes, including but not limited to “a putative polyisoprenoid-binding protein (cgl322, gene upstream of and divergent from rosR), a sensory histidine kinase (cgtS9), a putative transcriptional regulator of the Crp/FNR family (cg3291), a protein of the glutathione S-transferase family (cgl426), two putative FMN reductases (cgl l50 and cgl850), and four putative monooxygenases (cg0823, cgl848, cg2329, and cg3084)” (Bussmann et al., 2010). The recombinant bacteria may comprise any suitable ROS- responsive regulatory region from a gene that is repressed by RosR. Genes that are capable of being repressed by RosR are known in the art (see, e.g., Bussmann et al., 2010). In certain embodiments, the recombinant bacteria comprise a ROS-derepressible regulatory region from cgtS9 that is operatively linked to a gene or gene cassette, e.g., a payload. In the presence of ROS, e.g., H2O2, a RosR transcription factor senses ROS and no longer binds to the cgtS9 regulatory region, thereby derepressing the operatively linked payload gene and producing the payload.
[0395] In some embodiments, it is advantageous for the recombinant bacteria to express a ROS- sensing transcription factor that does not regulate the expression of a significant number of native genes in the bacteria. In some embodiments, the recombinant bacterium expresses a ROS-sensing transcription factor from a different species, strain, or substrain of bacteria, wherein the transcription factor does not bind to regulatory sequences in the recombinant bacterium. In some embodiments, the recombinant bacterium is Escherichia coli, and the ROS-sensing transcription factor is RosR, e.g., from Corynebacterium glutamicum, wherein the Escherichia coli does not comprise binding sites for said RosR. In some embodiments, the heterologous transcription factor minimizes or eliminates off- target effects on endogenous regulatory regions and genes in the recombinant bacteria.
[0396] In some embodiments, the tunable regulatory region is a ROS-repressible regulatory region, and the transcription factor that senses ROS is PerR. In Bacillus subtilis, PerR “when bound to DNA, represses the genes coding for proteins involved in the oxidative stress response (katA, ahpC, and mrgA), metal homeostasis (hemAXCDBL, fur, and zoaA) and its own synthesis (perR)” (Marinho et al., 2014). PerR is a “global regulator that responds primarily to H2O2” (Dubbs et al., 2012) and “interacts with DNA at the per box, a specific palindromic consensus sequence (TTATAATNATTATAA (SEQ ID NO: 360)) residing within and near the promoter sequences of PerR-controlled genes” (Marinho et al., 2014). PerR is capable of binding a regulatory region that “overlaps part of the promoter or is immediately downstream from it” (Dubbs et al., 2012). The recombinant bacteria may comprise any suitable ROS-responsive regulatory region from a gene that is repressed by PerR. Genes that are capable of being repressed by PerR are known in the art (see, e.g., Dubbs et al., 2012).
[0397] In these embodiments, the recombinant bacteria may comprise a two-repressor activation regulatory circuit, which is used to express a payload. The two-repressor activation regulatory circuit comprises a first ROS-sensing repressor, e.g., PerR, and a second repressor, e.g., TetR, which is operatively linked to a gene or gene cassette, e.g., a payload. In one aspect of these embodiments, the ROS-sensing repressor inhibits transcription of the second repressor, which inhibits the transcription of the gene or gene cassette. Examples of second repressors useful in these embodiments include, but are not limited to, TetR, Cl, and LexA. In some embodiments, the ROS-sensing repressor is PerR. In some embodiments, the second repressor is TetR. In this embodiment, a PerR-repressible regulatory region drives expression of TetR, and a TetR-repressible regulatory region drives expression of the gene or gene cassette, e.g., a payload. In the absence of PerR binding (which occurs in the absence of ROS), tetR is transcribed, and TetR represses expression of the gene or gene cassette, e.g., a payload. In the presence of PerR binding (which occurs in the presence of ROS), tetR expression is repressed, and the gene or gene cassette, e.g., a payload, is expressed.
[0398] A ROS-responsive transcription factor may induce, derepress, or repress gene expression depending upon the regulatory region sequence used in the recombinant bacteria. For example, although “OxyR is primarily thought of as a transcriptional activator under oxidizing conditions. OxyR can function as either a repressor or activator under both oxidizing and reducing conditions” (Dubbs et al., 2012), and OxyR “has been shown to be a repressor of its own expression as well as that of fhuF (encoding a ferric ion reductase) and flu (encoding the antigen 43 outer membrane protein)” (Zheng et al., 2001). The recombinant bacteria may comprise any suitable ROS-responsive regulatory region from a gene that is repressed by OxyR. In some embodiments, OxyR is used in a two-repressor activation regulatory circuit, as described above. Genes that are capable of being repressed by OxyR are known in the art (see, e.g., Zheng et al., 2001). Or, for example, although RosR is capable of repressing a number of genes, it is also capable of activating certain genes, e.g., the narKGHJI operon. In some embodiments, the recombinant bacteria comprise any suitable ROS-
responsive regulatory region from a gene that is activated by RosR. In some embodiments, the recombinant bacteria comprise any suitable ROS -responsive regulatory region from a gene that is activated by PerR.
[0399] One or more types of ROS-sensing transcription factors and corresponding regulatory region sequences may be present in recombinant bacteria. For example, “OhrR is found in both Gram- positive and Gram-negative bacteria and can coreside with either OxyR or PerR or both” (Dubbs et al., 2012). In some embodiments, the recombinant bacteria comprise one type of ROS-sensing transcription factor, e.g., OxyR, and one corresponding regulatory region sequence, e.g., from oxyS. In some embodiments, the recombinant bacteria comprise one type of ROS-sensing transcription factor, e.g., OxyR, and two or more different corresponding regulatory region sequences, e.g., from oxyS and katG. In some embodiments, the recombinant bacteria comprise two or more types of ROS- sensing transcription factors, e.g., OxyR and PerR, and two or more corresponding regulatory region sequences, e.g., from oxyS and katA, respectively. One ROS-responsive regulatory region may be capable of binding more than one transcription factor. In some embodiments, the recombinant bacteria comprise two or more types of ROS-sensing transcription factors and one corresponding regulatory region sequence.
[0400] In some embodiments, recombinant bacteria comprise nucleic acid sequences comprising OxyR binding sites. In some embodiments, recombinant bacteria comprise a nucleic acid sequence that is at least about 80%, 85%, 90%, 95%, or 99% homologous to the DNA sequence of SEQ ID NO: 370, SEQ ID NO: 371, or SEQ ID NO: 372, or SEQ ID NO: 373, or a functional fragment thereof. In some embodiments, the regulatory region sequence is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of SEQ ID NO: 370, SEQ ID NO: 371, SEQ ID NO: 372, and/or SEQ ID NO: 373.
[0401] In some embodiments, the recombinant bacteria comprise a gene encoding a ROS-sensing transcription factor, e.g., the oxyR gene, that is controlled by its native promoter, an inducible promoter, a promoter that is stronger than the native promoter, e.g., the GlnRS promoter or the P(Bla) promoter, or a constitutive promoter. In some instances, it may be advantageous to express the ROS- sensing transcription factor under the control of an inducible promoter in order to enhance expression stability. In some embodiments, expression of the ROS-sensing transcription factor is controlled by a different promoter than the promoter that controls expression of EGF. In some embodiments, expression of the ROS-sensing transcription factor is controlled by the same promoter that controls expression of EGF. In some embodiments, the ROS-sensing transcription factor and EGF are divergently transcribed from a promoter region.
[0402] In some embodiments, the recombinant bacteria comprise a gene for a ROS-sensing transcription factor from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise a ROS-responsive regulatory region from a different species, strain, or substrain of bacteria. In some embodiments, the recombinant bacteria comprise a ROS-
sensing transcription factor and corresponding ROS -responsive regulatory region from a different species, strain, or substrain of bacteria. The heterologous ROS-sensing transcription factor and regulatory region may increase the transcription of genes operatively linked to said regulatory region in the presence of ROS, as compared to the native transcription factor and regulatory region from bacteria of the same subtype under the same conditions.
[0403] In some embodiments, the recombinant bacteria comprise a ROS-sensing transcription factor, OxyR, and corresponding regulatory region, oxyS, from Escherichia coli. In some embodiments, the native ROS-sensing transcription factor, e.g., OxyR, is left intact and retains wild-type activity. In alternate embodiments, the native ROS-sensing transcription factor, e.g., OxyR, is deleted or mutated to reduce or eliminate wild-type activity.
[0404] In some embodiments, the recombinant bacteria comprise multiple copies of the endogenous gene encoding the ROS-sensing transcription factor, e.g., the oxyR gene. In some embodiments, the gene encoding the ROS-sensing transcription factor is present on a plasmid. In some embodiments, the gene encoding the ROS-sensing transcription factor and the gene or gene cassette for producing EGF are present on different plasmids. In some embodiments, the gene encoding the ROS-sensing transcription factor and the gene or gene cassette for producing EGF are present on the same plasmid. In some embodiments, the gene encoding the ROS-sensing transcription factor is present on a chromosome. In some embodiments, the gene encoding the ROS-sensing transcription factor and the gene or gene cassette for producing EGF are present on different chromosomes. In some embodiments, the gene encoding the ROS-sensing transcription factor and the gene or gene cassette for producing EGF are present on the same chromosome.
[0405] In some embodiments, the recombinant bacteria comprise a wild-type gene encoding a ROS- sensing transcription factor, e.g., the soxR gene, and a corresponding regulatory region, e.g., a soxS regulatory region, that is mutated relative to the wild-type regulatory region from bacteria of the same subtype. The mutated regulatory region increases the expression of the payload in the presence of ROS, as compared to the wild-type regulatory region under the same conditions. In some embodiments, the recombinant bacteria comprise a wild-type ROS -responsive regulatory region, e.g., the oxyS regulatory region, and a corresponding transcription factor, e.g., OxyR, that is mutated relative to the wild-type transcription factor from bacteria of the same subtype. The mutant transcription factor increases the expression of the payload in the presence of ROS, as compared to the wild-type transcription factor under the same conditions. In some embodiments, both the ROS- sensing transcription factor and corresponding regulatory region are mutated relative to the wild-type sequences from bacteria of the same subtype in order to increase expression of the payload in the presence of ROS.
[0406] In some embodiments, the gene or gene cassette for producing the payload is present on a plasmid and operably linked to a promoter that is induced by ROS. In some embodiments, the gene or gene cassette for producing the payload is present in the chromosome and operably linked to a
promoter that is induced by ROS. In some embodiments, the gene or gene cassette for producing the payload is present on a chromosome and operably linked to a promoter that is induced by exposure to tetracycline. In some embodiments, the gene or gene cassette for producing the payload is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline. In some embodiments, expression is further optimized by methods known in the art, e.g., by optimizing ribosomal binding sites, manipulating transcriptional regulators, and/or increasing mRNA stability. [0407] In some embodiments, the recombinant bacteria may comprise multiple copies of the gene(s) capable of producing a payload(s). In some embodiments, the gene(s) capable of producing a payload(s) is present on a plasmid and operatively linked to a ROS -responsive regulatory region. In some embodiments, the gene(s) capable of producing a payload is present in a chromosome and operatively linked to a ROS -responsive regulatory region.
[0408] Thus, in some embodiments, the recombinant bacteria produce one or more payloads under the control of an oxygen level-dependent promoter, a reactive oxygen species (ROS)-dependent promoter, or a reactive nitrogen species (RNS)-dependent promoter, and a corresponding transcription factor.
[0409] In some embodiments, the recombinant bacteria comprise a stably maintained plasmid or chromosome carrying a gene for producing a payload, such that the payload can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo. In some embodiments, a bacterium may comprise multiple copies of the gene encoding the payload. In some embodiments, the gene encoding the payload is expressed on a low-copy plasmid. In some embodiments, the low-copy plasmid may be useful for increasing stability of expression. In some embodiments, the low-copy plasmid may be useful for decreasing leaky expression under non- inducing conditions. In some embodiments, the gene encoding the payload is expressed on a high- copy plasmid. In some embodiments, the high-copy plasmid may be useful for increasing expression of the payload. In some embodiments, the gene encoding the payload is expressed on a chromosome. Propionate and other promoters
[0410] In some embodiments, the recombinant bacteria comprise the gene or gene cassette for producing EGF polypeptides, expressed under the control of an inducible promoter that is responsive to specific molecules or metabolites in the environment, e.g., r the mammalian gut. For example, the short-chain fatty acid propionate is a major microbial fermentation metabolite localized to the gut (Hosseini et al., 2011). In one embodiment, the gene or gene cassette for producing EGF is under the control of a propionate-inducible promoter. In a more specific embodiment, the gene or gene cassette for producing EGF is under the control of a propionate-inducible promoter that is activated by the presence of propionate in the mammalian gut. Any molecule or metabolite found in the mammalian gut, in a healthy and/or disease state, may be used to induce payload expression. Non-limiting examples of inducers include propionate, bilirubin, aspartate aminotransferase, alanine aminotransferase, blood coagulation factors II, VII, IX, and X, alkaline phosphatase, gamma glutamyl
transferase, hepatitis antigens and antibodies, alpha fetoprotein, anti-mitochondrial, smooth muscle, and anti-nuclear antibodies, iron, transferrin, ferritin, copper, ceruloplasmin, ammonia, and manganese. In alternate embodiments, the gene or gene cassette for producing EGF is under the control of a pBAD promoter, which is activated in the presence of the sugar arabinose.
[0411] In some embodiments, the gene or gene cassette for producing the EGF is present on a plasmid and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions. In some embodiments, the gene or gene cassette for producing the EGF is present on a plasmid and operably linked to a temperature sensitive promoter. In some embodiments, the gene or gene cassette for producing EGF is present in the chromosome and operably linked to a promoter that is induced under low-oxygen or anaerobic conditions. In some embodiments, the gene or gene cassette for producing the EGF is present in the chromosome and operably linked to a temperature sensitive promoter. In some embodiments, the gene or gene cassette for producing EGF is present on a plasmid and operably linked to a promoter that is induced by molecules or metabolites that are specific to the mammalian gut. In some embodiments, the gene or gene cassette for producing EGF is present on a chromosome and operably linked to a promoter that is induced by molecules or metabolites that are specific to the mammalian gut. In some embodiments, the gene or gene cassette for producing EGF is present on a chromosome and operably linked to a promoter that is induced by exposure to tetracycline. In some embodiments, the gene or gene cassette for producing EGF is present on a plasmid and operably linked to a promoter that is induced by exposure to tetracycline. In some embodiments, expression is further optimized by methods known in the art, e.g., by optimizing ribosomal binding sites, manipulating transcriptional regulators, and/or increasing mRNA stability. [0412] In some embodiments, the recombinant bacteria comprise a stably maintained plasmid or chromosome carrying the gene or gene cassette for producing EGF, such that the gene or gene cassette can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut. In some embodiments, a bacterium may comprise multiple copies of the gene or gene cassette for producing EGF. In some embodiments, gene or gene cassette for producing the payload is expressed on a low-copy plasmid. In some embodiments, the low-copy plasmid may be useful for increasing stability of expression. In some embodiments, the low-copy plasmid may be useful for decreasing leaky expression under non- inducing conditions. In some embodiments, gene or gene cassette for producing EGF is expressed on a high-copy plasmid. In some embodiments, the high-copy plasmid may be useful for increasing gene or gene cassette expression. In some embodiments, gene or gene cassette for producing EGF is expressed on a chromosome.
[0413] In some embodiments, the recombinant bacteria comprise a regulatory region comprising a propionate promoter, which is induced in the mammalian gut. In some embodiments, the propionate promoter sequence is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of SEQ ID NO: 374.
Other Inducible Promoters
[0414] In some embodiments, the gene encoding EGF is present on a plasmid and operably linked to a promoter that is induced by one or more nutritional and/or chemical inducer(s) and/or metabolite(s). In some embodiments, the gene encoding EGF is present in the chromosome and operably linked to a promoter that is induced by one or more nutritional and/or chemical inducer(s) and/or metabolite(s). [0415] In some embodiments, the bacterial cell comprises a stably maintained plasmid or chromosome carrying the one or more gene sequences(s), inducible by one or more nutritional and/or chemical inducer(s) and/or metabolite(s), encoding EGF, such that EGF can be expressed in the host cell, and the host cell is capable of survival and/or growth in vitro, e.g., in medium, and/or in vivo, e.g., in the gut. In some embodiments, bacterial cell comprises two or more distinct copies of the one or more gene sequences(s) encoding EGF, which is controlled by a promoter inducible one or more nutritional and/or chemical inducer(s) and/or metabolite(s). In some embodiments, the recombinant bacteria comprise multiple copies of the same one or more gene sequences(s) encoding EGF, which is controlled by a promoter inducible one or more nutritional and/or chemical inducer(s) and/or metabolite(s). In some embodiments, the one or more gene sequences(s) encoding EGF, is present on a plasmid and operably linked to a directly or indirectly inducible promoter inducible by one or more nutritional and/or chemical inducer(s) and/or metabolite(s). In some embodiments, the one or more gene sequences(s) encoding EGF, is present on a chromosome and operably linked to a directly or indirectly inducible by one or more nutritional and/or chemical inducer(s) and/or metabolite(s).
[0416] In some embodiments, expression of EGF is driven directly or indirectly by one or more promoter(s) induced by a chemical and/or nutritional inducer and/or metabolite during in vitro growth, preparation, or manufacturing of the strain prior to in vivo administration. In some embodiments, the promoter(s) induced by a chemical and/or nutritional inducer and/or metabolite are induced in culture, e.g., grown in a flask, fermenter or other appropriate culture vessel, e.g., used during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture. In some embodiments, the promoter is directly or indirectly induced by a molecule that is added to in the bacterial culture to induce expression and pre-load the bacterium with EGF prior to administration. In some embodiments, the cultures, which are induced by a chemical and/or nutritional inducer and/or metabolite, are grown aerobically. In some embodiments, the cultures, which are induced by a chemical and/or nutritional inducer and/or metabolite, are grown anaerobically.
[0417] In some embodiments, expression of one or more EGF molecules is driven directly or indirectly by one or more arabinose inducible promoter(s) in vivo. In some embodiments, the promoter is directly or indirectly induced by a chemical and/or nutritional inducer and/or metabolite which is co-administered with the recombinant bacteria, e.g., arabinose.
[0418] The genes of arabinose metabolism are organized in one operon, AraBAD, which is controlled by the PAraBAD promoter. The PAraBAD (or Para) promoter suitably fulfills the criteria
of inducible expression systems. PAraBAD displays tighter control of payload gene expression than many other systems, likely due to the dual regulatory role of AraC, which functions both as an inducer and as a repressor. Additionally, the level of ParaBAD-based expression can be modulated over a wide range of L-arabinose concentrations to fine-tune levels of expression of the payload. However, the cell population exposed to sub-saturating L-arabinose concentrations is divided into two subpopulations of induced and uninduced cells, which is determined by the differences between individual cells in the availability of L-arabinose transporter (Zhang et al., Development and Application of an Arabinose-Inducible Expression System by Facilitating Inducer Uptake in Corynebacterium glutamicum; Appl. Environ. Microbiol. August 2012 vol. 78 no. 16 5831-5838). Alternatively, inducible expression from the ParaBad can be controlled or fine-tuned through the optimization of the ribosome binding site (RBS), as described herein.
[0419] In one embodiment, the arabinose inducible promoter drives the expression of a construct comprising EGF, jointly with a second promoter, e.g., a second constitutive or inducible promoter. In some embodiments, two promoters are positioned proximally to the construct and drive its expression, wherein the arabinose inducible promoter drives expression under a first set of exogenous conditions, and the second promoter drives the expression under a second set of exogenous conditions. In a non- limiting example, the first and second conditions may be two sequential culture conditions (i.e., during preparation of the culture in a flask, fermenter or other appropriate culture vessel, e.g., arabinose and IPTG). In another non-limiting example, the first inducing conditions may be culture conditions, e.g., including arabinose presence, and the second inducing conditions may be in vivo conditions. Such in vivo conditions include low-oxygen, microaerobic, or anaerobic conditions, presence of gut metabolites, and/or metabolites administered in combination with the bacterial strain. In some embodiments, the one or more arabinose promoters drive expression of EGF, in combination with the FNR promoter driving the expression of the same gene sequence(s).
[0420] In some embodiments, EGF is knocked into the arabinose operon and are driven by the native arabinose inducible promoter.
[0421] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 376. In some embodiments, the arabinose inducible construct further comprises a gene encoding AraC, which is divergently transcribed from the same promoter as EGF. In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 376. In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 377.
[0422] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) which are inducible through a rhamnose inducible system. The genes rhaB AD are organized in one operon which is controlled by the rhaP BAD promoter. The rhaP BAD promoter is regulated by two activators, RhaS and RhaR, and the corresponding genes belong to one transcription unit which divergently transcribed in the opposite direction of rhaB AD. In the presence of L-rhamnose, RhaR binds to the rhaP RS promoter and activates the production of RhaR and RhaS. RhaS together with L- rhamnose then bind to the rhaP BAD and the rhaP T promoter and activate the transcription of the structural genes. In contrast to the arabinose system, in which AraC is provided and divergently transcribed in the gene sequence(s), it is not necessary to express the regulatory proteins in larger quantities in the rhamnose expression system because the amounts expressed from the chromosome are sufficient to activate transcription even on multi-copy plasmids. Therefore, only the rhaP BAD promoter is cloned upstream of the gene that is to be expressed. Full induction of rhaB AD transcription also requires binding of the CRP-cAMP complex, which is a key regulator of catabolite repression. Alternatively, inducible expression from the rhaB AD can be controlled or fine-tuned through the optimization of the ribosome binding site (RBS), as described herein.
[0423] In one embodiment, expression of EGF is driven directly or indirectly by one or more rhamnose inducible promoter(s). In one embodiment, expression of the payload is driven directly or indirectly by a rhamnose inducible promoter.
[0424] In some embodiments, the rhamnose inducible promoter is useful for or induced during in vivo expression of EGF. In some embodiments, expression of EGF is driven directly or indirectly by one or more rhamnose inducible promoter(s) in vivo. In some embodiments, the promoter is directly or indirectly induced by a molecule that is co-administered with the recombinant bacteria, e.g.. rhamnose.
[0425] In one embodiment, the rhamnose inducible promoter drives the expression of a construct comprising EGF jointly with a second promoter, e.g., a second constitutive or inducible promoter. In some embodiments, two promoters are positioned proximally to the construct and drive its expression, wherein the rhamnose inducible promoter drives expression under a first set of exogenous conditions, and the second promoter drives the expression under a second set of exogenous conditions.
[0426] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 378.
[0427] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) which are inducible through an Isopropyl -D-1 -thiogalactopyranoside (IPTG) inducible system or other compound which induced transcription from the Lac Promoter. IPTG is a molecular mimic of allolactose, a lactose metabolite that activates transcription of the lac operon. In contrast to allolactose, the sulfur atom in IPTG creates a non-hydrolyzable chemical blond, which prevents the degradation of IPTG, allowing the concentration to remain constant. IPTG binds to the lac repressor
and releases the tetrameric repressor (lacl) from the lac operator in an allosteric manner, thereby allowing the transcription of genes in the lac operon. Since IPTG is not metabolized by E. coli, its concentration stays constant and the rate of expression of Lac promoter-controlled is tightly controlled, both in vivo and in vitro. IPTG intake is independent on the action of lactose permease, since other transport pathways are also involved. Inducible expression from the PLac can be controlled or fine-tuned through the optimization of the ribosome binding site (RBS), as described herein. Other compounds which inactivate Lacl, can be used instead of IPTG in a similar manner. [0428] In one embodiment, expression of EGF is driven directly or indirectly by one or more IPTG inducible promoter(s). In some embodiments, the IPTG inducible promoter is useful for or induced during in vivo expression of EGF. In some embodiments, expression of EGF is driven directly or indirectly by one or more IPTG inducible promoter(s) in vivo. In some embodiments, the promoter is directly or indirectly induced by a molecule that is co -administered with the recombinant bacteria, e.g., IPTG.
[0429] In one embodiment, the IPTG inducible promoter drives the expression of a construct comprising EGF jointly with a second promoter, e.g., a second constitutive or inducible promoter. In some embodiments, two promoters are positioned proximally to the construct and drive its expression, wherein the IPTG inducible promoter drives expression under a first set of exogenous conditions, and the second promoter drives the expression under a second set of exogenous conditions.
[0430] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 350. In some embodiments, the IPTG inducible construct further comprises a gene encoding lacl, which is divergently transcribed from the same promoter EGF. In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 350. In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 16.
[0431] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) which are inducible through a tetracycline inducible system. The initial system Gossen and Bujard (Tight control of gene expression in mammalian cells by tetracycline-responsive promoters. Gossen M & Bujard H. PNAS, 1992 Jun 15;89(12):5547-51) developed is known as tetracycline off: in the presence of tetracycline, expression from a tet-inducible promoter is reduced. Tetracycline-controlled transactivator (tTA) was created by fusing tetR with the C-terminal domain of VP16 (virion protein 16) from herpes simplex virus. In the absence of tetracycline, the tetR portion of tTA will bind tetO sequences in the tet promoter, and the activation domain promotes expression. In the presence of tetracycline, tetracycline binds to tetR, precluding tTA from binding to the tetO sequences. Next, a reverse Tet repressor (rTetR), was developed which created a reliance on the presence of tetracycline for induction, rather than repression. The new transactivator rtTA (reverse tetracycline-controlled transactivator) was created by fusing rTetR with VP16. The tetracycline on system is also known as the rtTA-dependent system.
[0432] In one embodiment, expression of EGF is driven directly or indirectly by one or more tetracycline inducible promoter(s). In some embodiments, the tetracycline inducible promoter is useful for or induced during in vivo expression of EGF. In some embodiments, expression of EGF and/or transcriptional regulator(s), e.g., FNRS24Y, is driven directly or indirectly by one or more
tetracycline inducible promoter(s) in vivo. In some embodiments, the promoter is directly or indirectly induced by a molecule that is co-administered with the recombinant bacteria, e.g., tetracycline [0433] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) whose expression is controlled by a temperature sensitive mechanism. Thermoregulators are advantageous because of strong transcriptional control without the use of external chemicals or specialized media (see, e.g. , Nemani et al., Magnetic nanoparticle hyperthermia induced cytosine deaminase expression in microencapsulated E. coli for enzyme-prodrug therapy; J Biotechnol. 2015 Jun 10; 203: 32-40, and references therein). Thermoregulated protein expression using the mutant cI857 repressor and the pL and/or pR phage X promoters have been used to engineer recombinant bacterial strains. The EGF gene cloned downstream of the X promoters can then be efficiently regulated by the mutant thermolabile cI857 repressor of bacteriophage X. At temperatures below 37 °C, cI857 binds to the oL or regions of the pR promoter and blocks transcription by RNA polymerase. At higher temperatures, the functional cI857 dimer is destabilized, binding to the oL or oR DNA sequences is abrogated, and mRNA transcription is initiated. An exemplary construct is depicted in in the figures and examples. Inducible expression from the temperature sensitive promoter can be controlled or further fine-tuned through the optimization of the ribosome binding site (RBS), as described herein.
[0434] In one embodiment, expression of EGF is driven directly or indirectly by one or more thermoregulated promoter(s). In some embodiments, thermoregulated promoter is useful for or induced during in vivo expression of EGF. In some embodiments, expression of EGF is driven directly or indirectly by one or more thermoregulated promoter(s) in vitro.
[0435] In some embodiments, expression of EGF is driven directly or indirectly by one or more thermoregulated promoter(s) during in vitro growth, preparation, or manufacturing of the strain prior to in vivo administration. In some embodiments, it may be advantageous to shut off production of EGF. This can be done in a thermoregulated system by growing the strain at lower temperatures, e.g., 30°C. Expression can then be induced by elevating the temperature to 37°C and/or 42°C. In some embodiments, thermoregulated promoter(s) are induced in culture, e.g., grown in a flask, fermenter or other appropriate culture vessel, e.g., used during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture. In some embodiments, the cultures, which are induced by temperatures between 37°C and 42°C, are grown aerobically. In some embodiments, the cultures, which are induced by induced by temperatures between 37°C and 42°C, are grown anaerobically. [0436] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 19. In some embodiments, thermoregulated construct further comprises a gene encoding mutant cI857 repressor, which is divergently transcribed from the same promoter as EGF. In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%,
84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 20. In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 369.
[0437] In some instances, thermoregulators may be advantageous because of strong transcriptional control without the use of external chemicals or specialized media. Thermoregulated protein expression using the mutant cI857 repressor and the pL and/or pR phage λ promoters have been used to engineer recombinant bacterial strains. For example, a gene of interest cloned downstream of the λ promoters can be efficiently regulated by the mutant thermolabile cI857 repressor of bacteriophage λ. At temperatures below 37°C, cI857 binds to the oL or oR regions of the pR promoter and inhibits transcription by RNA polymerase. At higher temperatures, the functional cI857 dimer is destabilized, binding to the oL or oR DNA sequences is abrogated, and mRNA transcription is initiated.
[0438] In certain instances, it may be advantageous to reduce, diminish, or shut off production of one or more protein(s) of interest. This can be done in a thermoregulated system by growing a bacterial strain at temperatures at which the temperature regulated system is not optimally active. Temperature regulated expression can then be induced as desired by changing the temperature to a temperature where the system is more active or optimally active.
[0439] For example, a thermoregulated promoter may be induced in culture, e.g.. grown in a flask, fermenter or other appropriate culture vessel, e.g., used during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture. Bacteria comprising gene sequences or gene cassettes either indirectly or directly operably linked to a temperature sensitive system or promoter may, for example, could be induced by temperatures between 37°C and 42°C. In some instances, the cultures may be grown aerobically. Alternatively, the cultures are grown anaerobically.
[0440] In some embodiments, the bacteria described herein comprise one or more gene sequence(s) or gene cassette(s) which are directly or indirectly operably linked to a temperature regulated promoter. In some embodiments, the gene sequence(s) or gene cassette(s) are induced in vitro during growth, preparation, or manufacturing of the strain prior to in vivo administration. In some embodiments, the gene sequence(s) are induced upon or during in vivo administration. In some embodiments, the gene sequence(s) are induced during in vitro growth, preparation, or manufacturing of the strain prior to in vivo administration and upon or during in vivo administration. In some embodiments, the genetically engineered bacteria further comprise gene sequence (s) encoding a transcription factor which is capable of binding to the temperature sensitive promoter. In some embodiments, the transcription factor is a repressor of transcription.
[0441] In some embodiments, the thermoregulated promoter drives the expression of one or more protein(s) of interest from a low-copy plasmid or a high copy plasmid. In some embodiments, the
thermoregulated promoter drives the expression of one or more protein(s) of interest from a construct which is integrated into the bacterial chromosome. Exemplary insertion sites are described herein. [0442] In some embodiments, the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 19. In some embodiments, the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 22. In some embodiments, the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 25. In some embodiments, the thermoregulated construct further comprises a gene encoding mutant cI857 repressor, which is divergently transcribed from the same promoter as the one or more one or more protein(s) of interest. In some embodiments, the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 20. In some embodiments, the genetically engineered bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 21. In some embodiments, the thermoregulated construct further comprises a gene encoding mutant cI38 repressor, which is divergently transcribed from the same promoter as the one or more one or more protein(s) of interest. In some embodiments, the genetically engineered bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 23. In some embodiments, the genetically engineered bacteria comprise one or more gene sequence(s) encoding a polypeptide having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the polypeptide encoded by any of the sequences of SEQ ID NO: 24. [0443] SEQ ID NOs: 19-25 and 367 are shown in Table 9.
[0444] The following is an exemplary construct comprising a temperature sensitive promoter-ompA- EGF and mutant cI857 repressor driven by temperature sensitive promoter in reverse orientation:
disclosed herein comprises a sequence that is 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 515 or a fragment thereof.
[0446] The following is an exemplary temperature sensitive promoter (SEQ ID NO: 22):
[0447] ACGTTAAATCTATCACCGCAAGGGATAAATATCTAACACCGTGCGTGTTGACTAT TTTACCTCTGGCGGTGATAATGGTTGCAT. In some embodiments, the bacterium disclosed herein comprises a sequence that is 80%, 85%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, 99%, or 100% identical to SEQ ID NO: 22 or a fragment thereof.
[0448] In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) which are indirectly inducible through a system driven by the PssB promoter. The Pssb promoter is active under aerobic conditions, and shuts off under anaerobic conditions.
[0449] This promoter can be used to express an EGF gene under aerobic conditions. This promoter can also be used to tightly control the expression of a gene product such that it is only expressed under anaerobic conditions. In this case, the oxygen induced PssB promoter induces the expression of a repressor, which represses the expression of an EGF gene. As a result, the EGF gene is only expressed in the absence of the repressor, i.e., under anaerobic conditions. This strategy has the advantage of an additional level of control for improved fine-tuning and tighter control.
[0450] In one embodiment, expression of EGF is indirectly regulated by a repressor expressed under the control of one or more PssB promoter(s). In some embodiments, induction of the RssB promoter(s) indirectly drives the in vivo expression of EGF. In some embodiments, induction of the RssB promoter(s) indirectly drives the expression of EGF during in vitro growth, preparation, or manufacturing of the strain prior to in vivo administration.
[0451] Bacteria comprising one or more sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences disclosed herein are also contemplated. In some embodiments, the bacterium comprises one or more sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with a promoter disclosed herein, e.g., a thermoregulated promoter or a promoter induced under low-oxygen or anaerobic conditions. In some embodiments, the bacterium comprises one or more sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with a secretion molecule disclosed herein, e.g., nucleotide or amino acid sequence, e.g., ompA. In some embodiments, the bacterium comprises one or more sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with an EGF disclosed herein, e.g., nucleotide or amino acid sequence.
[0452] In a non-limiting example, this strategy can be used to control expression of thyA and/or dapA, e.g., to make a conditional auxotroph. The chromosomal copy of dapA or ThyA is knocked out. Under anaerobic conditions, dapA or thyA -as the case may be- are expressed, and the strain can grow in the absence of dap or thymidine. Under aerobic conditions, dapA or thyA expression is shut off, and the strain cannot grow in the absence of dap or thymidine. Such a strategy can, for example be employed to allow survival of bacteria under anaerobic conditions, e.g., the gut, but prevent survival under aerobic conditions (biosafety switch). In some embodiments, the recombinant bacteria comprise one or more gene sequence(s) having at least 80%, 81%, 82%, 83%, 84%, 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with any of the sequences of SEQ ID NO: 387. In some embodiments, the inducible promoters, as described above, drive the expression of EGF from a low -copy plasmid or a high copy plasmid or a biosafety system plasmid described herein. In some embodiments, the inducible promoters drive the expression of EGF from a construct which is integrated into the bacterial chromosome.
Constitutive promoters
[0453] In some embodiments, the gene encoding the payload is present on a plasmid and operably linked to a constitutive promoter. In some embodiments, the gene encoding the payload is present on a chromosome and operably linked to a constitutive promoter.
[0454] In some embodiments, the constitutive promoter is active under in vivo conditions, e.g., the gut, as described herein. In some embodiments, the promoters is active under in vitro conditions, e.g., various cell culture and/or cell manufacturing conditions, as described herein. In some embodiments, the constitutive promoter is active under in vivo conditions, e.g., the gut, as described herein, and under in vitro conditions, e.g., various cell culture and/or cell production and/or manufacturing conditions, as described herein.
[0455] In some embodiments, the constitutive promoter that is operably linked to the gene encoding the payload is active in various exogenous environmental conditions (e.g., in vivo and/or in vitro and/or production/manufacturing conditions).
[0456] In some embodiments, the constitutive promoter is active in exogenous environmental conditions specific to the gut of a mammal. In some embodiments, the constitutive promoter is active in exogenous environmental conditions specific to the small intestine of a mammal. In some embodiments, the constitutive promoter is active in low-oxygen or anaerobic conditions such as the environment of the mammalian gut. In some embodiments, the constitutive promoter is active in the presence of molecules or metabolites that are specific to the gut of a mammal. In some embodiments, the constitutive promoter is directly or indirectly induced by a molecule that is co-administered with the bacterial cell. In some embodiments, the constitutive promoter is active in the presence of molecules or metabolites or other conditions, that are present during in vitro culture, cell production and/or manufacturing conditions.
[0457] Bacterial constitutive promoters are known in the art. Exemplary constitutive promoters include E. coli a70, such as BBa I14034 (SEQ ID NO: 39), BBa I732021 (SEQ ID NO: 40),
constitutive promoters further include constitutive B. subtilis oA promoters, e.g., BBa_K780003 (SEQ ID NO: 98), BBa_K823000 (SEQ ID NO: 99), BBa_K823002 (SEQ ID NO: 100), and BBa_K823003 (SEQ ID NO: 101), BBa_K143012 (SEQ ID NO: 96), BBa_K143010 (SEQ ID NO: 102), BBa_K143013 (SEQ ID NO: 97). Exemplary constitutive promoters further include constitutive B. subtilis oB promoters, e.g., BBa_K143010 (SEQ ID NO: 102), BBa_K143011 (SEQ ID NO: 103), BBa_K143013 (SEQ ID NO: 97). Exemplary constitutive promoters further include BBa_Kl 12706 (SEQ ID NO: 104) and BBa_Kl 12707 (SEQ ID NO: 105) promoters.
[0458] Exemplary promoters from Bacteriophage T7 or SP6 or various prokaryotes include BBa_K143010 (SEQ ID NO: 102), BBa_K143011 (SEQ ID NO: 103), BBa_K143013 (SEQ ID NO: 97), BBa_I712074 (SEQ ID NO: 106), BBa_I719005 (SEQ ID NO: 107), BBa_J34814 (SEQ ID NO: 108), BBa_J64997 (SEQ ID NO: 109), BBa_Kl 13010 (SEQ ID NO: 110), BBa_Kl 13011 (SEQ ID NO: 111), BBa_Kl 13012 (SEQ ID NO: 112), BBa_K1614000 (SEQ ID NO: 113), BBa_R0085 (SEQ ID NO: 107), BBa_R0180 (SEQ ID NO: 114), BBa_R0181 (SEQ ID NO: 115), BBa_R0182 (SEQ ID NO: 116), BBa_R0183 (SEQ ID NO: 117), BBa_Z0251 (SEQ ID NO: 118), BBa_Z0252 (SEQ ID NO: 119), BBa_Z0253 (SEQ ID NO: 120), BBa_J64998 (SEQ ID NO: 121), BBa_Kl 12706 (SEQ ID NO: 104), BBa_Kl 12707 (SEQ ID NO: 105). Exemplary promoters from yeast and various eukaryotes include BBa_I766557 (SEQ ID NO: 124), BBa_J63005 (SEQ ID NO: 125), BBa_K105027 (SEQ ID NO: 126), BBa_K105028 (SEQ ID NO: 126), BBa_K105029 (SEQ ID NO: 126), BBa_K105030 (SEQ ID NO: 126), BBa_K105031 (SEQ ID NO: 126), BBa_K122000), SEQ ID NO: 127), BBa_K124000 (SEQ ID NO: 122), BBa_K124002 (SEQ ID NO: 128), BBa_K319005 (SEQ ID NO: 123), BBa_M31201 (SEQ ID NO: 129), BBa_I766555 (SEQ ID NO: 122), BBa_I766556 (SEQ ID NO: 123), BBa_I712004 (SEQ ID NO: 130), and BBa_K076017 (SEQ ID NO: 131).
[0459] Additional exemplary promoters are listed in Table 10.
0460] Bacterial constitutive promoters are known in the art. In some embodiments, the constitutive promoter is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NOs: 37-135.
Ribosome Binding Sites
[0461] In some embodiments, ribosome binding sites are added, switched out or replaced. By testing a few ribosome binding sites, expression levels can be fine-tuned to the desired level. Various RBS are suitable for prokaryotic expression and can be used to achieve the desired expression levels (See, e.g., Registry of standard biological parts). Exemplary ribosome binding sites include those derived from Master sequence SEQ ID NO: 241. Non limiting examples of such ribosome binding sites include BBa_J61100, BBa_J61101, BBa_J61102, BBa_J61103, BBa_J61104, BBa_J61105, BBa_J61106, BBa_J61107, BBa_J61108, BBa_J61109, BBa_J61110, BBa_J61111, BBa_J61112, BBa_J61113, BBa_J61114, BBa_J61115, BBa_J61116, BBa_J61117, BBa_J61118, BBa_J61119, BBa_J61120, BBa_J61121, BBa_J61122, BBa_J61123, BBa_J61124, BBa_J61125, BBa_J61126, BBa_J61127, BBa_J61128, BBa_J6112, BBa_J61130, BBa_J61131, BBa_J61132, BBa_J61133, BBa_J61134, BBa_J61135, BBa_J61136, BBa_J61137, BBa_J61138,BBa_J61139, BBa_B0029, BBa_B0030, BBa_B0031, BBa_B0032, BBa_B0033, BBa_B0034, BBa_B0035, and BBa_B0064 (SEQ ID NO: 241-289).
Nucleic Acids
[0462] In some embodiments, the disclosure provides novel nucleic acids for producing and secreting EGF. In some embodiments, the nucleic acid encodes one or more EGF or EGF fusion protein polypeptides. Thus, in some embodiments, the nucleic acid comprises gene sequence(s) encoding one or more EGF or EGF fusion protein polypeptides. In some embodiments, the one or more EGF or EGF fusion protein polypeptide(s) comprises a polypeptide sequence selected from any of Sequences SEQ ID NO: 505, SEQ ID NO: 161, SEQ ID NO: 136, SEQ ID NO: 168, SEQ ID NO: 361, SEQ ID NO: 362, SEQ ID NO: 500, SEQ ID NO: 502, SEQ ID NO: 501, SEQ ID NO: 503, or SEQ ID NO: 504 a functional fragment and/or variant thereof, or a polypeptide having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereof, e.g., as assessed by an alignment algorithm such as NCBI BLAST. In some embodiments, the nucleic acid comprises one or more EGF or EGF fusion protein cassettes. In some embodiments, the EGF fusion nucleic acid comprises a polynucleotide selected from Sequences SEQ ID NO: 511, SEQ ID NO: 506, SEQ ID NO: 508, SEQ ID NO: 507,
SEQ ID NO: 509, SEQ ID NO: 510, SEQ ID NO: 162, SEQ ID NO: 364, SEQ ID NO: 363, SEQ ID NO: 365, or SEQ ID NO: 366 (see below), a functional fragment and/or variant thereof, or a polynucleotide having at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity thereof, e.g., as assessed by an alignment algorithm such as NCBI BLAST. [0463] PelB-EGF:
[0473] In some embodiments, the nucleic acid comprises gene sequence encoding a human EGF polypeptide linked to an FNR-responsive promoter. In certain embodiments, the human EGF polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 505
(EGF). In some embodiments, the FNR -responsive promoter is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337. In some embodiments, the human EGF polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 505. In some embodiments, the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337. In some specific embodiments, the human EGF polypeptide comprises SEQ ID NO: 505. In other specific embodiments, the human EGF polypeptide consists of SEQ ID NO: 505. In some embodiments, the nucleic acid comprises a gene sequence linked to an FNR- responsive element.
[0474] In some embodiments, the nucleic acid comprises gene sequence encoding a human EGF polypeptide linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor. In certain embodiments, the human EGF polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 505 (EGF). In some embodiments, the temperature sensitive promoter construct comprises a gene encoding mutant cI857 repressor that is at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21. In some embodiments, the human EGF polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 505. In some embodiments, the temperature sensitive promoter construct comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21. In some specific embodiments, the human EGF polypeptide comprises SEQ ID NO: 505. In other specific embodiments, the human EGF polypeptide consists of SEQ ID NO: 505. In some embodiments, the nucleic acid comprises a gene sequence linked to a temperature sensitive element.
[0475] In certain embodiments, the nucleic acid comprising the human EGF gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 511 (EGF) linked to an FNR- responsive element. In some embodiments, the nucleic acid comprising the human EGF gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 511. In some embodiments, the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337. In some specific embodiments, the nucleic acid comprising the human EGF gene sequence comprises SEQ ID NO: 511 with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336 and 337. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 511 with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336 and 337.
[0476] In certain embodiments, the nucleic acid comprising the human EGF gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 511 (EGF) linked to a
temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor. In some embodiments, the nucleic acid comprising the human EGF gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 511. In some embodiments, the temperature sensitive promoter construct further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21. In some specific embodiments, the nucleic acid comprising the human EGF gene sequence comprises SEQ ID NO: 511 with a temperature sensitive element of any one of SEQ ID NO: 19-21. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 511 with a temperature sensitive element of any one of SEQ ID NO: 19-21.
[0477] In some embodiments, the nucleic acid comprises a gene sequence encoding a PelB polypeptide. In certain embodiments, the PelB polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 161 (PelB). In some embodiments, the PelB polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 161. In some specific embodiments, the PelB polypeptide comprises SEQ ID NO: 161. In other specific embodiments, the PelB polypeptide consists of SEQ ID NO: 161. In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the PelB gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 162 (see below). In some embodiments, the nucleic acid comprising the PelB gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 162. In some specific embodiments, the nucleic acid comprising the PelB gene sequence comprises SEQ ID NO: 162. In other specific embodiments the nucleic acid comprising the PelB gene sequence consists of SEQ ID NO: 162.
[0478] PelB:
[0479] Atgaaatatctgttgcccacggctgccgcgggtctgctgctgctggcagcgcaaccggctatggca (SEQ ID NO: 162) [0480] In some embodiments, the nucleic acid comprises a gene sequence encoding a PhoA polypeptide. In certain embodiments, the PhoA polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 136 (PhoA). In some embodiments, the PhoA polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 136. In some specific embodiments, the PhoA polypeptide comprises SEQ ID NO: 136. In other specific embodiments, the PhoA polypeptide consists of SEQ ID NO: 136. In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the PhoA gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 364 (see below). In some embodiments, the nucleic acid comprising the PhoA gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 364. In some specific embodiments, the nucleic acid
comprising the PhoA gene sequence comprises SEQ ID NO: 364. In other specific embodiments the nucleic acid comprising the PhoA gene sequence consists of SEQ ID NO: 364.
[0481] PhoA:
[0482] Atgaaacaaagcactattgcactggcactcttaccgttactgtttacccctgtgacaaaagcg (SEQ ID NO: 364) [0483] In some embodiments, the nucleic acid comprises a gene sequence encoding a OmpA polypeptide. In certain embodiments, the OmpA polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 168 (OmpA). In some embodiments, the OmpA polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 168. In some specific embodiments, the OmpA polypeptide comprises SEQ ID NO: 168. In other specific embodiments, the OmpA polypeptide consists of SEQ ID NO: 168. In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the OmpA gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 363 (See below). In some embodiments, the nucleic acid comprising the OmpA gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 363. In some specific embodiments, the nucleic acid comprising the OmpA gene sequence comprises SEQ ID NO: 363. In other specific embodiments the nucleic acid comprising the OmpA gene sequence consists of SEQ ID NO: 363.
[0484] OmpA:
[0485] ATGAAGAAAACCGCAATTGCAATCGCCGTCGCTCTGGCGGGGTTCGCTACGGTCG CCCAAGCC (SEQ ID NO: 363)
[0486] In some embodiments, the nucleic acid comprises a gene sequence encoding a LARD3 polypeptide. In certain embodiments, the LARD3 polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 361 (LARD3). In some embodiments, the LARD3 polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 361. In some specific embodiments, the LARD3 polypeptide comprises SEQ ID NO: 361. In other specific embodiments, the LARD3 polypeptide consists of SEQ ID NO: 361. In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the LARD3 gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 365 (See below). In some embodiments, the nucleic acid comprising the LARD3 gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 365. In some specific embodiments, the nucleic acid comprising the LARD3 gene sequence comprises SEQ ID NO: 365. In other specific embodiments the nucleic acid comprising the LARD3 gene sequence consists of SEQ ID NO: 365.
[0487] LARD3:
[0488] Attgagggccggggttctgacggtaatgatcttatccaaggcggtaagggcgcggacttcattgaaggcggcaaaggtaatgataca atccgcgataactccggtcacaacacctttttgttctcagggcattttggtcaggatcgtattataggatatcagccgaccgatcggctggtattccagg
gcgctgacggcagcacggatctgcgcgaccatgcgaaagccgttggagcagatacggtgctgagttttggcgccgattcggttactctcgtcggg gtggggttaggaggcctgtggagcgagggtgtgctgattagttaa (SEQ ID NO: 365)
[0489] In some embodiments, the nucleic acid comprises a gene sequence encoding a HylA polypeptide. In certain embodiments, the HylA polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 362 (HylA). In some embodiments, the HylA polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 362. In some specific embodiments, the HylA polypeptide comprises SEQ ID NO: 362. In other specific embodiments, the HylA polypeptide consists of SEQ ID NO: 362. In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the HylA gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 366 (See below). In some embodiments, the nucleic acid comprising the HylA gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 366. In some specific embodiments, the nucleic acid comprising the HylA gene sequence comprises SEQ ID NO: 366. In other specific embodiments the nucleic acid comprising the HylA gene sequence consists of SEQ ID NO: 366.
[0490] HylA:
[0491] Tcaacttatgggagccaggacaatcttaatccattaattaatgaaatcagcaaaatcatttcagctgcaggtaacttcgatgttaaggagg aaagatctgccgcttctttattgcagttgtccggtaatgccagtgatttttcatatggacggaactcaataactttgacagcatcagcataa (SEQ ID NO: 366)
[0492] In some embodiments, the nucleic acid comprises a gene sequence encoding an ATP-binding cassette transporter polypeptide. In certain embodiments, the ATP-binding cassette transporter polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514. In some embodiments, the ATP-binding cassette transporter polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514. In some specific embodiments, the HylA polypeptide comprises SEQ ID NO: 362. In other specific embodiments, the HylA polypeptide consists of SEQ ID NO: 362. In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the ATP- binding cassette transporter gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 516, SEQ ID NO: 517, and/ or SEQ ID NO: 518 (See below). In some embodiments, the nucleic acid comprising the ATP-binding cassette transporter gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 516, SEQ ID NO: 517, and/ or SEQ ID NO: 518. In some specific embodiments, the nucleic acid comprising the ATP-binding cassette transporter gene sequence comprises SEQ ID NO: 516, SEQ ID NO: 517, and/ or SEQ ID NO: 518. In other specific embodiments the nucleic acid comprising the ATP-binding cassette transporter gene sequence consists of SEQ ID NO: 516, SEQ ID NO: 517, and/ or SEQ ID NO: 518.
[0499] In some embodiments, the nucleic acid comprises gene encoding a human EGF polypeptide fused to a PelB secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 500 (PelB-EGF). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 500. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 500. In some embodiments, the gene encoding the fusion is operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337. In some embodiments, the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
[0500] In some embodiments, the nucleic acid comprises gene encoding a human EGF polypeptide fused to a PelB secretion tag, optionally wherein the gene is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 500 (PelB-EGF). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 500. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 500. In some embodiments, the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any
one of SEQ ID NO: 19-21. In some embodiments, the temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
[0501] In some embodiments, the nucleic acid comprises gene encoding a human EGF polypeptide fused to a PhoA secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 502 (PhoA-EGF). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 502. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 502. In some embodiments, the gene encoding the fusion is operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337. In some embodiments, the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
[0502] In some embodiments, the nucleic acid comprises gene encoding a human EGF polypeptide fused to a PhoA secretion tag, optionally wherein the gene is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 502 (PhoA-EGF). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 502. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 502. In some embodiments, the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21. In some embodiments, the Temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
[0503] In some embodiments, the nucleic acid comprises gene encoding a human EGF polypeptide fused to a OmpA secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 501 (OmpA-EGF). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 501. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 501. In some embodiments, the gene encoding the fusion is
operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337. In some embodiments, the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
[0504] In some embodiments, the nucleic acid comprises a gene encoding a human EGF polypeptide fused to a OmpA secretion tag, optionally wherein the gene is operably linked to an temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 501 (OmpA-EGF). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 501. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 501. In some embodiments, the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21. In some embodiments, the temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
[0505] In some embodiments, the nucleic acid comprises gene encoding a human EGF polypeptide fused to a LARD3 secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 503 (EGF-LARD3). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 503. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 503. In some embodiments, the gene encoding the fusion is operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337. In some embodiments, the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
[0506] In some embodiments, the nucleic acid comprises a gene encoding a human EGF polypeptide fused to a LARD3 secretion tag, optionally wherein the gene is operably linked to an temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 503 (EGF-LARD3). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99%
identity with SEQ ID NO: 503. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 503. In some embodiments, the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21. In some embodiments, the temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
[0507] In some embodiments, the nucleic acid comprises gene encoding a human EGF polypeptide fused to a HylA secretion tag, optionally wherein the gene is operably linked to an FNR-inducible promoter. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 504 (EGF-HylA). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 504. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 504. In some embodiments, the gene encoding the fusion is operably linked to an FNR-responsive promoter having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 1-11, 336 and 337. In some embodiments, the FNR-responsive promoter has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 1-11, 336 and 337.
[0508] In some embodiments, the nucleic acid comprises a gene encoding a human EGF polypeptide fused to a HylA secretion tag, optionally wherein the gene is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor. In certain embodiments, the human EGF fusion protein has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 504 (EGF-HylA). In some embodiments, the human EGF fusion protein has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 504. In some specific embodiments, the human EGF fusion protein comprises SEQ ID NO: 504. In some embodiments, the gene encoding the fusion is operably linked to a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that having at least about 80%, 85%, 90%, 95%, or 99% homologous to the sequence of any one of SEQ ID NO: 19-21. In some embodiments, the temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with the sequence of any one of SEQ ID NO: 19-21.
[0509] In some embodiments, the nucleic acid comprises gene sequence encoding a Fc (IgA) polypeptide. In certain embodiments, the Fc (IgA) polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 415. In some embodiments, the Fc (IgA) polypeptide has at
least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 415. In some specific embodiments, the Fc (IgA) polypeptide comprises SEQ ID NO: 415. In other specific embodiments, the Fc (IgA) polypeptide consists of SEQ ID NO: 415. In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the Fc (IgA) gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 416. In some embodiments, the nucleic acid comprising the Fc (IgA) gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 416. In some specific embodiments, the nucleic acid comprising the Fc (IgA) gene sequence comprises SEQ ID NO: 416. In other specific embodiments the nucleic acid comprising the Fc (IgA) gene sequence consists of SEQ ID NO: 416.
[0510] In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the Fc (IgA) gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 417. In some embodiments, the nucleic acid comprising the Fc (IgA) gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 417. In some specific embodiments, the nucleic acid comprising the Fc (IgA) gene sequence comprises SEQ ID NO: 417. In other specific embodiments the nucleic acid comprising the Fc (IgA) gene sequence consists of SEQ ID NO: 417.
[0511] In some embodiments, the nucleic acid comprises gene sequence encoding a Linker polypeptide. In certain embodiments, the Linker polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 212. In some embodiments, the Linker polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 212. In some specific embodiments, the Linker polypeptide comprises SEQ ID NO: 212. In other specific embodiments, the Linker polypeptide consists of SEQ ID NO: 212. In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the LINKER gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 418. In some embodiments, the nucleic acid comprising the Linker gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 418. In some specific embodiments, the nucleic acid comprising the Linker gene sequence comprises SEQ ID NO: 418. In other specific embodiments the nucleic acid comprising the linker gene sequence consists of SEQ ID NO: 418. In some embodiments, the nucleic acid comprises gene sequence encoding a EGF-linker Fc (IgA) polypeptide. [0512] In some embodiments, the nucleic acid comprises gene sequence encoding a PhoA-EGF-Fc (hlgA) polypeptide.
[0513] In some embodiments, the nucleic acid comprises gene sequence encoding a PelB-EGF-Fc (hlgA) polypeptide.
[0514] In some embodiments, the nucleic acid comprises gene sequence encoding a OmpA-EGF-Fc (hlgA) polypeptide.
[0515] In some embodiments, the nucleic acid comprises gene sequence encoding a ECOLIN 19410- EGF polypeptide.
[0516] In some embodiments, the nucleic acid comprises gene sequence encoding a ECOLIN 19410- EGF- Fc (hlgA) polypeptide.
[0517] In some embodiments, the nucleic acid comprises gene sequence encoding an EGF-LARD3- Fc (hlgA) polypeptide.
[0518] In some embodiments, the nucleic acid comprises gene sequence encoding an EGF-HylA-Fc (hlgA) polypeptide. In some embodiments, the nucleic acid comprises gene sequence encoding a mutated EGF polypeptide. In certain embodiments, the mutated EGF polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 505. In some embodiments, the mutated EGF polypeptide has at least about 85%, SEQ ID NO: 505. In some specific embodiments, the mutated EGF polypeptide comprises SEQ ID NO: 505. In other specific embodiments, the mutated EGF polypeptide consists of SEQ ID NO: 505. In some embodiments, the nucleic acid comprises a gene sequence. In certain embodiments, the nucleic acid comprising the mutated EGF gene sequence has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 511. In some embodiments, the nucleic acid comprising the mutated EGF gene sequence has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 511. In some specific embodiments, the nucleic acid comprising the mutated EGF gene sequence comprises SEQ ID NO: 511. In other specific embodiments the nucleic acid comprising the mutated EGF gene sequence consists of SEQ ID NO: 511.
[0519] In some embodiments, the nucleic acid comprises gene sequence encoding a mutated EGF- linker Fc (IgA) polypeptide.
[0520] In some embodiments, the nucleic acid comprises gene sequence encoding a Pho A- mutated EGF polypeptide.
[0521] In some embodiments, the nucleic acid comprises gene sequence encoding a PhoA-mutated EGF-Fc (hlgA) polypeptide.
[0522] In some embodiments, the nucleic acid comprises gene sequence encoding a PelB- mutated EGF polypeptide.
[0523] In some embodiments, the nucleic acid comprises gene sequence encoding a PelB-mutated EGF-Fc (hlgA) polypeptide.
[0524] In some embodiments, the nucleic acid comprises gene sequence encoding a OmpA- mutated EGF polypeptide.
[0525] In some embodiments, the nucleic acid comprises gene sequence encoding a OmpA-mutated EGF-Fc (hlgA) polypeptide.
[0526] In some embodiments, the nucleic acid comprises gene sequence encoding a the ECOLIN 19410-mutated EGF polypeptide.
[0527] In some embodiments, the nucleic acid comprises gene sequence encoding an EGF-LARD3- mutated polypeptide.
[0528] In some embodiments, the nucleic acid comprises gene sequence encoding an EGF-LARD3- mutated-Fc (hlgA) polypeptide.
[0529] In some embodiments, the nucleic acid comprises gene sequence encoding an EGF-HylA- mutated polypeptide.
[0530] In some embodiments, the nucleic acid comprises gene sequence encoding an EGF-HylA- mutated-Fc (hlgA) polypeptide.
[0531] In any of the above embodiments, the nucleic acid may further comprise one or more of the following sequences: (1) promoter, (2) enhancer, (3) regulatory sequence, (4) ribosome binding site - nonlimiting examples of RBS are provided herein and include SEQ ID NO: 241-289, (5) secretion tag, non-limiting examples of secretion tags are provided herein and include SEQ ID NO: 136-145 (6) leader sequence, (7) auxotrophy, (8) antibiotic resistance.
[0532] In any of these embodiments, the nucleic acid may be functionally replaced, modified, and/or mutated in order to enhance stability and/or increase polypeptide production or secretion. In some embodiments, the nucleic acid is expressed and secreted in low-oxygen conditions, in the presence of certain molecules or metabolites, in the presence of molecules or metabolites associated with inflammation or an inflammatory response, or in the presence of some other metabolite that may or may not be present in the gut, such as arabinose. Exemplary chemical inducers are described herein. In some embodiments, the nucleic acid is directly operably linked to a first promoter. In some embodiments, the nucleic acid is indirectly operably linked to a first promoter. In one embodiment, the promoter is not operably linked with the nucleic acid in nature.
[0533] In some embodiments, nucleic acid is expressed under the control of a constitutive promoter. Non-limiting examples constitutive promoters are provided herein and include SEQ ID NO: 39-56 and 58-75.
[0534] In another embodiment, the nucleic acid is expressed under the control of an inducible promoter. In some embodiments, the nucleic acid is expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions. In one embodiment, the nucleic acid is expressed under the control of a promoter that is directly or indirectly induced by low- oxygen or anaerobic conditions, wherein expression of the nucleic acid is activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut. Inducible promoters are described in more detail infra. Non-limiting examples of low oxygen inducible promoters are provided herein and include SEQ ID NO: 1-11, 336 and 337. Non-limiting examples of OxyR inducible promoters are provided herein and include SEQ ID NO: 370-373. Non-limiting examples of promoters regulated by chemical inducers are provided herein and include SEQ ID NO: 15, 16, 19-21, 350, 369, 375-378, and 386-387.
[0535] In some embodiments, the nucleic acid sequence comprises an FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide. In certain embodiments, the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 519. In some embodiments, the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 519. In some specific embodiments, the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 519 (PelB-EGF) with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 519 with an FNR-responsive element of any one of SEQ ID NO: 1- 11, 336, and 337.
[0538] In some embodiments, the nucleic acid sequence comprises an FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide. In certain embodiments, the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 520. In some embodiments, the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 520. In some specific embodiments, the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 502 (PhoA-EGF) with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 502 with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337.
[0540] In some embodiments, the nucleic acid sequence comprises an FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide. In certain embodiments, the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 521. In some embodiments, the nucleic acid comprising the FNR-responsive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 521. In some specific embodiments, the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 501 (OmpA-EGF) with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 501 with an FNR-responsive element of any one of SEQ ID NO: 1-11, 336, and 337.
[0542] In some embodiments, the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide. In certain embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 522. In some embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 522. In some specific embodiments, the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 500 (PelB-EGF) with a temperature sensitive element of any one of SEQ ID NO: 19-21. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 500 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
[0545] In some embodiments, the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide. In certain embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 523. In some embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 523. In some specific embodiments, the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 502 (PhoA-EGF) with a temperature sensitive element of any one of SEQ ID NO: 19-21. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 502 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
[0548] In some embodiments, the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide. In certain embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 524. In some embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 524. In some specific embodiments, the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 501 (OmpA-EGF) with a temperature sensitive element of any one of SEQ ID NO: 19-21. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 501 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
[0549] CI857-pR-OmpA-EGF:
[0551] In some embodiments, the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide. In certain embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 525. In some embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 525. In some specific embodiments, the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 503 (EGF-LARD3) with a temperature sensitive element of any one of SEQ ID NO: 19-21. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 503 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
[0554] In some embodiments, the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide. In certain embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 526. In some embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an EGF fusion polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 526. In some specific embodiments, the nucleic acid comprising the gene sequence encoding an EGF fusion polypeptide comprises SEQ ID NO: 504 (EGF-HylA) with a temperature sensitive element of any one of SEQ ID NO: 19-21. In other specific embodiments the nucleic acid comprising the human EGF
gene sequence consists of SEQ ID NO: 504 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19- 21.
[0557] In some embodiments, the nucleic acid sequence comprises a temperature sensitive promoter linked to a gene sequence encoding an ATP-binding cassette transporter polypeptide. In certain embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an ATP-binding cassette transporter polypeptide has at least about 80%, 85%, 90%, 95%, or 99% identity with SEQ ID NO: 527. In some embodiments, the nucleic acid comprising the temperature sensitive promoter linked to a gene sequence encoding an ATP-binding cassette transporter polypeptide has at least about 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity with SEQ ID NO: 527. In some specific embodiments, the nucleic acid comprising the gene sequence encoding an ATP-binding cassette transporter polypeptide comprises SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514 (ATP-binding cassette transporter) with a temperature sensitive element of any one of SEQ ID NO: 19-21. In other specific embodiments the nucleic acid comprising the human EGF gene sequence consists of SEQ ID NO: 512, SEQ ID NO: 513, and/ or SEQ ID NO: 514 with a temperature sensitive promoter construct that further comprises a gene encoding mutant cI857 repressor that comprises any one of SEQ ID NO: 19-21.
[0560] The nucleic acid may be present on a plasmid or chromosome in the bacterial cell. In one embodiment, the nucleic acid is located on a plasmid in the bacterial cell. In another embodiment, the nucleic acid is located in the chromosome of the bacterial cell. In yet another embodiment, a native copy of the nucleic acid is located in the chromosome of the bacterial cell.
Multiple mechanisms of action
[0561] In some embodiments, the bacteria are genetically engineered to include multiple mechanisms of action (MO As), e.g., circuits producing multiple copies of the same product (e.g., to enhance copy number) or circuits performing multiple different functions. Examples of insertion sites include, but are not limited to, malE/K, insB/I, araC/BAD, lacZ, dapA, cea. For example, the recombinant bacteria may include four copies of EGF inserted at four different insertion sites, e.g., malE/K, insB/I, araC/BAD, and lacZ. Alternatively, the recombinant bacteria may include three copies of EGF inserted at three different insertion sites, e.g., malE/K, insB/I, and lacZ.
[0562] In some embodiments, the bacteria are genetically engineered to include multiple mechanisms of action (MO As), e.g., circuits producing multiple copies of the same product (e.g., to enhance copy number) or circuits performing multiple different functions. For example, the recombinant bacteria may include four copies of the gene, gene(s), or gene cassettes for producing the payload(s) inserted
at four different insertion sites. Alternatively, the recombinant bacteria may include three copies of the gene, gene(s), or gene cassettes for producing the payload(s) inserted at three different insertion sites and three copies of the gene, gene(s), or gene cassettes for producing the payload(s) inserted at three different insertion sites.
[0563] In some embodiments, under conditions where the gene, gene(s), or gene cassettes for producing the payload(s) is expressed, the recombinant bacteria of the disclosure produce at least about 1.5-fold, at least about 2-fold, at least about 10-fold, at least about 15-fold, at least about 20- fold, at least about 30-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1,000-fold, or at least about 1,500-fold more of the payload(s) as compared to unmodified bacteria of the same subtype under the same conditions.
[0564] In some embodiments, the recombinant bacteria produce at least about 1.5-fold, at least about 2-fold, at least about 10-fold, at least about 15-fold, at least about 20-fold, at least about 30-fold, at least about 50-fold, at least about 100-fold, at least about 200-fold, at least about 300-fold, at least about 400-fold, at least about 500-fold, at least about 600-fold, at least about 700-fold, at least about 800-fold, at least about 900-fold, at least about 1,000-fold, or at least about 1,500-fold more of a payload under inducing conditions than unmodified bacteria of the same subtype under the same conditions. Certain unmodified bacteria will not have detectable levels of the payload. In embodiments using genetically modified forms of these bacteria, the payload will be detectable under inducing conditions.
[0565] In some embodiments, quantitative PCR (qPCR) is used to amplify, detect, and/or quantify mRNA expression levels of the gene, gene(s), or gene cassettes for producing the payload(s). Primers may be designed and used to detect mRNA in a sample according to methods known in the art. In some embodiments, a fluorophore is added to a sample reaction mixture that may contain payload RNA, and a thermal cycler is used to illuminate the sample reaction mixture with a specific wavelength of light and detect the subsequent emission by the fluorophore. The reaction mixture is heated and cooled to predetermined temperatures for predetermined time periods. In certain embodiments, the heating and cooling is repeated for a predetermined number of cycles. In some embodiments, the reaction mixture is heated and cooled to 90-100°C, 60-70°C, and 30-50°C for a predetermined number of cycles. In a certain embodiment, the reaction mixture is heated and cooled to 93-97°C, 55-65°C, and 35-45°C for a predetermined number of cycles. In some embodiments, the accumulating amplicon is quantified after each cycle of the qPCR. The number of cycles at which fluorescence exceeds the threshold is the threshold cycle (CT). At least one CT result for each sample is generated, and the CT result(s) may be used to determine mRNA expression levels of the payload(s).
[0566] The gene sequence(s) encoding EGF peptides for secretion may be expressed under the control of a constitutive promoter or an inducible promoter. The gene sequence(s) encoding the one or more EGF peptides for secretion are expressed under the control of a promoter that is directly or indirectly induced by exogenous environmental conditions, e.g., low-oxygen or anaerobic conditions, wherein expression of the gene sequence(s) encoding the one or more EGF peptides for secretion are activated under low-oxygen or anaerobic environments, such as the environment of the mammalian gut. The gene sequence(s) encoding the one or more EGF peptides for secretion are expressed under the control of a temperature-sensitive promoter. Alternatively, the gene sequence(s) encoding the one or more EGF peptides for secretion are expressed under the control of a promoter that is directly or indirectly induced by inflammatory conditions. Exemplary inducible promoters described herein include oxygen level-dependent promoters (e.g., FNR-inducible promoter), promoters induced by inflammation or an inflammatory response (RNS, ROS promoters), and promoters induced by a metabolite that may or may not be naturally present (e.g., can be exogenously added) in the gut, e.g., arabinose and tetracycline. Examples of inducible promoters include, but are not limited to, an FNR responsive promoter, a Parac promoter, a ParaBAD promoter, and a PTBIR promoter, each of which are described in more detail herein. Inducible promoters are described in more detail infra.
[0567] The at least one gene encoding EGF for secretion may be present on a plasmid or chromosome in the bacterial cell. In one embodiment, a native copy of the gene sequence(s) encoding EGF for secretion are located in the chromosome of the bacterial cell, and at least one gene encoding EGF for secretion from a different species of bacteria are located on a plasmid in the bacterial cell. In yet another embodiment, a native copy of the gene sequence(s) encoding EGF for secretion are located on a plasmid in the bacterial cell, and at least one gene encoding EGF for secretion from a different species of bacteria are located on a plasmid in the bacterial cell. In yet another embodiment, a native copy of the gene sequence(s) encoding EGF for secretion are located in the chromosome of the bacterial cell, and at least one gene encoding EGF for secretion from a different species of bacteria are located in the chromosome of the bacterial cell.
[0568] In some embodiments, the gene sequence(s) encoding the one or more EGF peptides for secretion are expressed on a low-copy plasmid. In some embodiments, the gene sequence(s) encoding the one or more EGF peptides for secretion are expressed on a high-copy plasmid. In some embodiments, the high-copy plasmid may be useful for increasing expression of EGF for secretion. [0569] In some embodiments, a recombinant bacterial cell comprising at least one gene encoding EGF for secretion are expressed on a high-copy plasmid do not increase tryptophan catabolism as compared to a recombinant bacterial cell comprising the same gene expressed on a low-copy plasmid in the absence of a heterologous importer of tryptophan and/or its metabolites and additional copies of a native importer of tryptophan and/or its metabolites. In alternate embodiments, the importer of tryptophan and/or its metabolites is used in conjunction with a high-copy plasmid.
[0570] In some embodiments, the recombinant bacteria described above further comprise one or more of the modifications, mutations, and/or deletions in endogenous genes described herein. [0571] In some embodiments, the genetically engineered microorganism further comprises a mutation and/or deletion in IdhA. In some embodiments, the genetically engineered microorganism further comprises a mutation and/or deletion in frdA. In some embodiments, the genetically engineered microorganism further comprises a mutation and/or deletion in adhE. In some embodiments, the genetically engineered microorganism further comprises a mutation and/or deletion in one or more of IdhA, frdA, and adhE.
[0572] In some embodiments, surface display could be used to display EGF on the surface of the genetically modified bacterium. In some embodiments, the recombinant bacteria and/or microorganisms encode one or more gene(s) and/or gene cassette(s) encoding EGF, which is anchored or displayed on the surface of the bacteria and/or microorganisms.
Induction of Payloads During Strain Culture
[0573] In some embodiments, it is desirable to pre-induce payload or EGF expression and/or payload activity prior to administration. Such payload or EGF may be an effector intended for secretion or may be an enzyme which catalyzes a metabolic reaction to produce an effector. In other embodiments, the protein of interest is an enzyme which catabolizes a harmful metabolite. In such situations, the strains are pre-loaded with active payload or EGF. In such instances, the recombinant bacteria express EGF, under conditions provided in bacterial culture during cell growth, expansion, purification, fermentation, and/or manufacture prior to administration in vivo. Such culture conditions can be provided in a flask, fermenter or other appropriate culture vessel, e.g.. used during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture. As used herein, the term “bacterial culture” or bacterial cell culture” or “culture” refers to bacterial cells or microorganisms, which are maintained or grown in vitro during several production processes, including cell growth, cell expansion, recovery, purification, fermentation, and/or manufacture. As used herein, the term “fermentation” refers to the growth, expansion, and maintenance of bacteria under defined conditions. Fermentation may occur under a number of cell culture conditions, including anaerobic or low oxygen or oxygenated conditions, in the presence of inducers, nutrients, at defined temperatures, and the like.
[0574] Culture conditions are selected to achieve optimal activity and viability of the cells, while maintaining a high cell density (high biomass) yield. A number of cell culture conditions and operating parameters are monitored and adjusted to achieve optimal activity, high yield and high viability, including oxygen levels (e.g., low oxygen, microaerobic, aerobic), temperature of the medium, and nutrients and/or different growth media, chemical and/or nutritional inducers and other components provided in the medium.
[0575] In some embodiments, EGF and are directly or indirectly induced, while the strains is grown up for in vivo administration. Without wishing to be bound by theory, pre-induction may boost in vivo
activity. This is particularly important in proximal regions of the gut which are reached first by the bacteria, e.g., the small intestine. If the bacterial residence time in this compartment is relatively short, the bacteria may pass through the small intestine without reaching full in vivo induction capacity. In contrast, if a strain is pre-induced and preloaded, the strains are already fully active, allowing for greater activity more quickly as the bacteria reach the intestine. Ergo, no transit time is “wasted”, in which the strain is not optimally active. As the bacteria continue to move through the intestine, in vivo induction occurs under environmental conditions of the gut (e.g., low oxygen, or in the presence of gut metabolites).
[0576] In one embodiment, expression of one or more payload(s), is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture. In one embodiment, expression EGF is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture. In one embodiment, expression of one or more payload(s), is driven from the same promoter as a multicistronic message. In one embodiment, expression of one or more payload(s) is driven from the same promoter as two or more separate messages. In one embodiment, expression of one or more payload(s) is driven from the one or more different promoters.
[0577] In some embodiments, the strains are administered without any pre-induction protocols during strain growth prior to in vivo administration.
Anaerobic induction
[0578] In some embodiments, cells are induced under anaerobic or low oxygen conditions in culture. In such instances, cells are grown (e.g., for 1.5 to 3 hours) until they have reached a certain OD, e.g., ODs within the range of 0.1 to 10, indicating a certain density e.g., ranging from 1X10^8 to 1X10^11, and exponential growth and are then switched to anaerobic or low oxygen conditions for approximately 3 to 5 hours. In some embodiments, strains are induced under anaerobic or low oxygen conditions, e.g., to induce FNR promoter activity and drive expression of one or more payload(s) under the control of one or more FNR promoters.
[0579] In one embodiment, expression of one or more payload(s), is under the control of one or more anaerobic or low oxygen inducible promoter(s), e.g., FNR promoter(s), and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under anaerobic or low oxygen conditions. In one embodiment, expression of EGF is under the control of one or more anaerobic or low oxygen inducible promoter(s), e.g., FNR promoter(s) and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under anaerobic or low oxygen conditions.
[0580] In one embodiment, expression of two or more payload(s), is under the control of one or more anaerobic or low oxygen inducible promoter(s), e.g., FNR promoter(s), and is driven from the same promoter in the form of a multicistronic message under anaerobic or low oxygen conditions. In one embodiment, expression of one or more payload(s), is under the control of one or more anaerobic or low oxygen inducible promoter(s), e.g., FNR promoter(s), and is driven from the same promoter as
two or more separate messages under anaerobic or low oxygen conditions. In one embodiment, expression of one or more payload(s) under the control of one or more anaerobic or low oxygen inducible promoter(s), e.g., FNR promoter(s), and is driven from the one or more different promoters under anaerobic or low oxygen conditions.
[0581] Without wishing to be bound by theory, strains that comprise one or more payload(s) under the control of an FNR promoter, may allow expression of payload(s) from these promoters in vitro, under anaerobic or low oxygen culture conditions, and in vivo, under the low oxygen conditions found in the gut.
[0582] In some embodiments, promoters inducible by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers can be induced under anaerobic or low oxygen conditions in the presence of the chemical and/or nutritional inducer. In some embodiments, strains may comprise a combination of gene sequence(s), some of which are under control of FNR promoters and others which are under control of promoters induced by chemical and/or nutritional inducers. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of one or more FNR promoter(s) and one or more payload gene sequence(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. In some embodiments, strains may comprise one or more payload gene sequence(s) and/or under the control of one or more FNR promoter(s), and one or more payload gene sequence(s) under the control of a one or more constitutive promoter(s) described herein. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more thermoregulated promoter(s) described herein.
[0583] In one embodiment, expression of one or more payload gene sequence(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under anaerobic and/or low oxygen conditions. In one embodiment, the chemical and/or nutritional inducer is arabinose and the promoter is inducible by arabinose. In one embodiment, the chemical and/or nutritional inducer is IPTG and the promoter is inducible by IPTG. In one embodiment, the chemical and/or nutritional inducer is rhamnose and the promoter is inducible by rhamnose. In one embodiment, the chemical and/or nutritional inducer is tetracycline and the promoter is inducible by tetracycline.
[0584] In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter in the form of a multicistronic message under anaerobic and/or low oxygen conditions. In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter as two or
more separate messages under anaerobic and/or low oxygen conditions. In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the one or more different promoters under anaerobic and/or low oxygen conditions.
[0585] In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers, under anaerobic or low oxygen conditions. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers. In some embodiments, the strains comprise gene sequence(s) under the control of a third inducible promoter, e.g., an anaerobic/low oxygen promoter, e.g., FNR promoter. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced promoter or a low oxygen promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a FNR promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. Additionally the strains may comprise a construct which is under thermoregulatory control. In some embodiments, the bacteria strains further comprise payload sequence(s) under the control of one or more constitutive promoter(s) active under low oxygen conditions.
[0586 ] Aerobic induction
[0587] In some embodiments, it is desirable to prepare, pre-load and pre-induce the strains under aerobic conditions. This allows more efficient growth and viability, and, in some cases, reduces the build-up of toxic metabolites. In such instances, cells are grown (e.g., for 1.5 to 3 hours) until they have reached a certain OD, e.g., ODs within the range of 0.1 to 10, indicating a certain density e.g., ranging from 1X10^8 to 1X10^11, and exponential growth and are then induced through the addition of the inducer or through other means, such as shift to a permissive temperature, for approximately 3 to 5 hours.
[0588] In some embodiments, promoters inducible by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art can be induced under aerobic conditions in the presence of the chemical and/or nutritional inducer during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture. In one embodiment, expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under aerobic conditions.
[0589] In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter in the form of a multicistronic message under aerobic conditions. In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter as two or more separate messages under aerobic conditions. In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the one or more different promoters under aerobic conditions.
[0590] In one embodiment, the chemical and/or nutritional inducer is arabinose and the promoter is inducible by arabinose. In one embodiment, the chemical and/or nutritional inducer is IPTG and the promoter is inducible by IPTG. In one embodiment, the chemical and/or nutritional inducer is rhamnose and the promoter is inducible by rhamnose. In one embodiment, the chemical and/or nutritional inducer is tetracycline and the promoter is inducible by tetracycline.
[0591] In some embodiments, promoters regulated by temperature are induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture. In one embodiment, expression of one or more payload(s) is driven directly or indirectly by one or more thermoregulated promoter(s) and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under aerobic conditions.
[0592] In one embodiment, expression of one or more payload(s) is driven directly or indirectly by one or more thermoregulated promoter(s) and is driven from the same promoter in the form of a multicistronic message under aerobic conditions. In one embodiment, expression of one or more payload(s) is driven directly or indirectly by one or more thermoregulated promo ter(s) and is driven from the same promoter as two or more separate messages under aerobic conditions. In one embodiment, expression of one or more payload(s) is driven directly or indirectly by one or more thermoregulated promoter(s) and is driven from the one or more different promoters under aerobic conditions.
[0593] In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced under aerobic conditions. In some embodiments, a strain comprises three or more different promoters which are induced under aerobic culture conditions.
[0594] In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically inducible promoter, and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter under aerobic culture conditions. In some embodiments two or more chemically induced promoter gene sequence(s) are combined with a thermoregulated construct described herein. In one embodiment, the chemical and/or nutritional inducer is arabinose and the promoter is inducible by arabinose. In one embodiment, the chemical and/or nutritional inducer is IPTG and the promoter is inducible by IPTG. In one embodiment, the chemical and/or nutritional inducer is rhamnose and the promoter is inducible by rhamnose. In one embodiment, the chemical and/or nutritional inducer is tetracycline and the promoter is inducible by tetracycline.
[0595] In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a FNR promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. Additionally the strains may comprise a construct which is under thermoregulatory control. In some embodiments, the bacteria strains further comprise payload sequences under the control of one or more constitutive promoter(s) active under aerobic conditions.
[0596] In some embodiments, genetically engineered strains comprise gene sequence(s) which are induced under aerobic culture conditions. In some embodiments, these strains further comprise FNR inducible gene sequence(s) for in vivo activation in the gut. In some embodiments, these strains do not further comprise FNR inducible gene sequence(s) for in vivo activation in the gut.
[0597] In some embodiments, genetically engineered strains comprise gene sequence(s), which are arabinose inducible under aerobic culture conditions. In some embodiments, these strains do not further comprise FNR inducible gene sequence(s) for in vivo activation in the gut.
[0598] In some embodiments, genetically engineered strains comprise gene sequence(s), which are IPTG inducible under aerobic culture conditions. In some embodiments, these strains further comprise FNR inducible gene sequence(s) for in vivo activation in the gut. In some embodiments, these strains do not further comprise FNR inducible gene sequence(s) for in vivo activation in the gut.
[0599] In some embodiments, genetically engineered strains comprise gene sequence(s) which are arabinose inducible under aerobic culture conditions. In some embodiments, such a strain further comprises sequence(s) which are IPTG inducible under aerobic culture conditions. In some embodiments, these strains further comprise FNR inducible gene payload sequence(s) for in vivo activation in the gut. In some embodiments, these strains do not further comprise FNR inducible gene sequence(s) for in vivo activation in the gut.
[0600] As evident from the above non-limiting examples, genetically engineered strains comprise inducible gene sequence(s) which can be induced numerous combinations. For example, rhamnose or tetracycline can be used as an inducer with the appropriate promoters in addition or in lieu of arabinose and/or IPTG or with thermoregulation. Additionally, such bacterial strains can also be induced with the chemical and/or nutritional inducers under anaerobic conditions.
Microaerobic Induction
[0601] In some embodiments, viability, growth, and activity are optimized by pre-inducing the bacterial strain under microaerobic conditions. In some embodiments, microaerobic conditions are best suited to “strike a balance” between optimal growth, activity and viability conditions and optimal conditions for induction; in particular, if the expression of the one or more payload(s) are driven by an anaerobic and/or low oxygen promoter, e.g., a FNR promoter. In such instances, cells are grown (e.g., for 1.5 to 3 hours) until they have reached a certain OD, e.g., ODs within the range of 0.1 to 10, indicating a certain density e.g., ranging from 1X10^8 to 1X10^11, and exponential growth and are then induced through the addition of the inducer or through other means, such as shift to at a permissive temperature, for approximately 3 to 5 hours.
[0602] In one embodiment, expression of one or more payload(s) is under the control of one or more FNR promoter(s) and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under microaerobic conditions.
[0603] In one embodiment, expression of one or more payload(s), is under the control of one or more FNR promoter(s) and is driven from the same promoter in the form of a multicistronic message under microaerobic conditions. In one embodiment, expression of one or more payload(s), is under the control of one or more FNR promoter(s) and is driven from the same promoter as two or more separate messages under microaerobic conditions. In one embodiment, expression of one or more payload(s), is under the control of one or more FNR promoter(s) and is driven from the one or more different promoters under microaerobic conditions.
[0604] Without wishing to be bound by theory, strains that comprise one or more payload(s) under the control of an FNR promoter, may allow expression of payload(s) from these promoters in vitro, under microaerobic culture conditions, and in vivo, under the low oxygen conditions found in the gut. [0605] In some embodiments, promoters inducible by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers can be induced under microaerobic conditions in the presence of the chemical and/or nutritional inducer. In particular, strains may comprise a combination
of gene sequence(s), some of which are under control of FNR promoters and others which are under control of promoters induced by chemical and/or nutritional inducers. In some embodiments, strains may comprise one or more payload gene sequence(s) sequence(s) under the control of one or more FNR promoter(s) and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of one or more FNR promoter(s), and one or more payload gene sequence(s) under the control of a one or more constitutive promoter(s) described herein. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more thermoregulated promoter(s) described herein.
[0606] In one embodiment, expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under microaerobic conditions.
[0607] In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter in the form of a multicistronic message under microaerobic conditions. In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter as two or more separate messages under microaerobic conditions. In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the one or more different promoters under microaerobic conditions.
[0608] In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers, under microaerobic conditions. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers. In some embodiments, the strains comprise gene sequence(s) under the control of a third inducible promoter, e.g., an anaerobic/low oxygen promoter or microaerobic promoter, e.g., FNR promoter. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced promoter or a low oxygen or microaerobic promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a FNR promoter and others which are
under control of a second inducible promoter, e.g., a temperature sensitive promoter. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. Additionally the strains may comprise a construct which is under thermoregulatory control. In some embodiments, the bacteria strains further comprise payload under the control of one or more constitutive promoter(s) active under low oxygen conditions.
[0609] Induction of Strains using Phasing, Pulsing and/or Cycling
[0610] In some embodiments, cycling, phasing, or pulsing techniques are employed during cell growth, expansion, recovery, purification, fermentation, and/or manufacture to efficiently induce and grow the strains prior to in vivo administration. This method is used to “strike a balance” between optimal growth, activity, cell health, and viability conditions and optimal conditions for induction; in particular, if growth, cell health or viability are negatively affected under inducing conditions. In such instances, cells are grown (e.g., for 1.5 to 3 hours) in a first phase or cycle until they have reached a certain OD, e.g., ODs within the range of 0.1 to 10, indicating a certain density e.g., ranging from 1X10^8 to 1X10^11, and are then induced through the addition of the inducer or through other means, such as shift to a permissive temperature (if a promoter is thermoregulated), or change in oxygen levels (e.g., reduction of oxygen level in the case of induction of an FNR promoter driven construct) for approximately 3 to 5 hours. In a second phase or cycle, conditions are brought back to the original conditions which support optimal growth, cell health and viability. Alternatively, if a chemical and/or nutritional inducer is used, then the culture can be spiked with a second dose of the inducer in the second phase or cycle.
[0611] In some embodiments, two cycles of optimal conditions and inducing conditions are employed (i.e, growth, induction, recovery and growth, induction). In some embodiments, three cycles of optimal conditions and inducing conditions are employed. In some embodiments, four or more cycles of optimal conditions and inducing conditions are employed. In a non-liming example, such cycling and/or phasing is used for induction under anaerobic and/or low oxygen conditions (e.g., induction of FNR promoters). In one embodiment, cells are grown to the optimal density and then induced under anaerobic and/or low oxygen conditions. Before growth and/or viability are negatively impacted due to stressful induction conditions, cells are returned to oxygenated conditions to recover, after which they are then returned to inducing anaerobic and/or low oxygen conditions for a second time. In some embodiments, these cycles are repeated as needed.
[0612] In some embodiments, growing cultures are spiked once with the chemical and/or nutritional inducer. In some embodiments, growing cultures are spiked twice with the chemical and/or nutritional inducer. In some embodiments, growing cultures are spiked three or more times with the chemical and/or nutritional inducer. In a non-limiting example, cells are first grown under optimal growth conditions up to a certain density, e.g., for 1.5 to 3 hour, to reach an OD of 0.1 to 10, until the cells are at a density ranging from 1X10^8 to 1X10^11. Then the chemical inducer, e.g., arabinose or IPTG, is added to the culture. After 3 to 5 hours, an additional dose of the inducer is added to re-initiate the induction. Spiking can be repeated as needed.
[0613] In some embodiments, phasing or cycling changes in temperature in the culture. In another embodiment, adjustment of temperature may be used to improve the activity of a payload. For example, lowering the temperature during culture may improve the proper folding of the payload. In such instances, cells are first grown at a temperature optimal for growth (e.g., 37 C). In some embodiments, the cells are then induced, e.g., by a chemical inducer, to express the payload. Concurrently or after a set amount of induction time, the temperature in the media is lowered, e.g., between 25 and 35 C, to allow improved folding of the expressed payload.
[0614] In some embodiments, payload(s) are under the control of different inducible promoters, for example two different chemical inducers. In other embodiments, the payload is induced under low oxygen conditions or microaerobic conditions and a second payload is induced by a chemical inducer. [0615] In one embodiment, expression of one or more payload(s) is under the control of one or more FNR promoter(s) and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture by using phasing or cycling or pulsing or spiking techniques.
[0616] In one embodiment, expression of one or more payload(s), is under the control of one or more FNR promoter(s) and is driven from the same promoter in the form of a multicistronic message through the employment of phasing or cycling or pulsing or spiking techniques. In one embodiment, expression of one or more payload(s), is under the control of one or more FNR promoter(s) and is driven from the same promoter as two or more separate messages through the employment of phasing or cycling or pulsing or spiking techniques. In one embodiment, expression of one or more payload(s), is under the control of one or more FNR promoter(s) and is driven from the one or more different promoters through the employment of phasing or cycling or pulsing or spiking techniques. [0617] In some embodiments, promoters inducible by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers can be induced through the employment of phasing or cycling or pulsing or spiking techniques in the presence of the chemical and/or nutritional inducer. In particular, strains may comprise a combination of gene sequence(s), some of which are under control of FNR promoters and others which are under control of promoters induced by chemical and/or nutritional inducers. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of one or more FNR promoter(s) and one or more payload gene
sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of one or more FNR promoter(s), and one or more payload gene sequence(s) under the control of a one or more constitutive promoter(s) described herein and are induced through the employment of phasing or cycling or pulsing or spiking techniques. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more thermoregulated promoter(s) described herein, and are induced through the employment of phasing or cycling or pulsing or spiking techniques.
[0618] Any of the strains described herein can be grown through the employment of phasing or cycling or pulsing or spiking techniques. In one embodiment, expression of one or more payload(s) is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is induced during cell growth, cell expansion, fermentation, recovery, purification, formulation, and/or manufacture under anaerobic and/or low oxygen conditions.
[0619] In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter in the form of a multicistronic message and which are induced through the employment of phasing or cycling or pulsing or spiking techniques. In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the same promoter as two or more separate messages and is grown through the employment of phasing or cycling or pulsing or spiking techniques. In one embodiment, expression of one or more payload(s), is under the control of one or more promoter(s) regulated by chemical and/or nutritional inducers and is driven from the one or more different promoters, all of which are induced through the employment of phasing or cycling or pulsing or spiking techniques.
[0620] In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers, through the employment of phasing or cycling or pulsing or spiking techniques. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter and others which are under control of a second inducible promoter, both induced by chemical and/or nutritional inducers through the employment of phasing or cycling or pulsing or spiking techniques. In some embodiments, the strains comprise gene sequence(s) under the control of a third inducible promoter, e.g., an anaerobic/low oxygen promoter, e.g., FNR promoter. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced promoter or a low oxygen promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In one embodiment,
strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a FNR promoter and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In one embodiment, strains may comprise a combination of gene sequence(s), some of which are under control of a first inducible promoter, e.g., a chemically induced and others which are under control of a second inducible promoter, e.g., a temperature sensitive promoter. In some embodiments, strains may comprise one or more payload gene sequence(s) under the control of an FNR promoter and one or more payload gene sequence(s) under the control of a one or more promoter(s) which are induced by a one or more chemical and/or nutritional inducer(s), including, but not limited to, by arabinose, IPTG, rhamnose, tetracycline, and/or other chemical and/or nutritional inducers described herein or known in the art. Additionally the strains may comprise a construct which is under thermoregulatory control. In some embodiments, the bacteria strains further comprise payload sequence(s) under the control of one or more constitutive promoter(s) active under low oxygen conditions. Any of the strains described in these embodiments may be induced through the employment of phasing or cycling or pulsing or spiking techniques. Aerobic induction of the FNR promoter
[0621] FNRS24Y is a mutated form of FNR which is more resistant to inactivation by oxygen, and therefore can activate FNR promoters under aerobic conditions (see e.g., Jervis AJ The 02 sensitivity of the transcription factor FNR is controlled by Ser24 modulating the kinetics of [4Fe-4S] to [2Fe-2S] conversion, Proc Natl Acad Sci U S A. 2009 Mar 24;106(12):4659-64, the contents of which is herein incorporated by reference in its entirety). In some embodiments, an oxygen bypass system shown and described in figures and examples is used. In this oxygen bypass system, FNRS24Y is induced by addition of arabinose and then drives the expression of EGF by binding and activating the FNR promoter under aerobic conditions. Thus, strains can be grown, produced or manufactured efficiently under aerobic conditions, while being effectively pre-induced and pre-loaded, as the system takes advantage of the strong FNR promoter resulting in of high levels of expression of EGF. This system does not interfere with or compromise in vivo activation, since the mutated FNRS24Y is no longer expressed in the absence of arabinose, and wild type FNR then binds to the FNR promoter and drives expression of EGF.
[0622] In some embodiments, FNRS24Y is expressed during aerobic culture growth and induces EGF. In other embodiments described herein, a second payload expression can also be induced aerobically, e.g., by arabinose. In a non-limiting example, EGF and FNRS24Y can in some embodiments be induced simultaneously, e.g., from an arabinose inducible promoter. In some embodiments, FNRS24Y and EGF are transcribed as a bicistronic message whose expression is driven by an arabinose promoter. In some embodiments, FNRS24Y is knocked into the arabinose operon, allowing expression to be driven from the endogenous Para promoter.
[0623] In some embodiments, a LacI promoter and IPTG induction are used in this system (in lieu of Para and arabinose induction). In some embodiments, a rhamnose inducible promoter is used in this
system. In some embodiments, a temperature sensitive promoter is used to drive expression of FNRS24Y.
Secretion
[0624] In any of the embodiments described herein, in which the genetically engineered organism, e.g., engineered bacteria, produces a protein, polypeptide, or peptide, DNA, RNA, small molecule or other molecule intended to be secreted from the microorganism, the engineered microorganism may comprise a secretion mechanism and corresponding gene sequence(s) encoding the secretion system. [0625] In some embodiments, the recombinant bacteria further comprise a native secretion mechanism or non-native secretion mechanism that is capable of secreting the EGF molecule from the bacterial cytoplasm in the extracellular environment. Many bacteria have evolved sophisticated secretion systems to transport substrates across the bacterial cell envelope. Substrates, such as small molecules, proteins, and DNA, may be released into the extracellular space or periplasm (such as the gut lumen or other space), injected into a target cell, or associated with the bacterial membrane.
[0626] In Gram-negative bacteria, secretion machineries may span one or both of the inner and outer membranes. In some embodiments, the recombinant bacteria further comprise a non-native double membrane-spanning secretion system. Double membrane- spanning secretion systems include, but are not limited to, the type I secretion system (T1SS), the type II secretion system (T2SS), the type III secretion system (T3SS), the type IV secretion system (T4SS), the type VI secretion system (T6SS), and the resistance-nodulation-division (RND) family of multi-drug efflux pumps (Pugsley 1993; Gerlach et al., 2007; Collinson et al., 2015; Costa et al., 2015; Reeves et al., 2015;
WO2014138324A1, incorporated herein by reference). Examples of such secretion systems are shown in figures and examples. Mycobacteria, which have a Gram-negative-like cell envelope, may also encode a type VII secretion system (T7SS) (Stanley et al., 2003). With the exception of the T2SS, double membrane-spanning secretions generally transport substrates from the bacterial cytoplasm directly into the extracellular space or into the target cell. In contrast, the T2SS and secretion systems that span only the outer membrane may use a two-step mechanism, wherein substrates are first translocated to the periplasm by inner membrane-spanning transporters, and then transferred to the outer membrane or secreted into the extracellular space. Outer membrane-spanning secretion systems include, but are not limited to, the type V secretion or autotransporter system or autosecreter system (T5SS), the curli secretion system, and the chaperone-usher pathway for pili assembly (Saier, 2006; Costa et al., 2015).
[0627] In some embodiments in which EGF is secreted or exported from the microorganism, the engineered microorganism comprises gene sequence(s) that includes a secretion tag. In some embodiments, the EGF protein includes a “secretion tag” of either RNA or peptide origin to direct the EGF protein to specific secretion systems. For example, a secretion tag for the Type I Hemolysin secretion system is encoded in the C-terminal 53 amino acids of the alpha hemolysin protein (HlyA).
[0628] In some embodiments, a Hemolysin-based Secretion System is used to secrete EGF. Type I Secretion systems offer the advantage of translocating their passenger peptide directly from the cytoplasm to the extracellular space, obviating the two-step process of other secretion types. The alpha-hemolysin (HlyA) of uropathogenic Escherichia coli uses HlyB, an ATP-binding cassette transporter; HlyD, a membrane fusion protein; and TolC, an outer membrane protein. The assembly of these three proteins forms a channel through both the inner and outer membranes. HlyB inserts into inner membrane to form a pore, HlyD aligns HlyB with TolC (outer membrane pore) thereby forming a channel through inner and outer membrane. Natively, this channel is used to secrete HlyA, however, to secrete EGF, the secretion signal-containing C-terminal portion of HlyA is fused to the C-terminal portion of an EGF peptide (star) to mediate secretion of this peptide. The C-terminal secretion tag can be removed by either an autocatalytic or protease-catalyzed e.g., OmpT cleavage thereby releasing the EGF protein into the extracellular milieu. In some embodiments one or more EGF proteins contain expressed as fusion protein with the 53 amino acids of the C termini of alpha-hemolysin (hlyA) of E. coli CFT073 (C terminal secretion tag).
[0629] In some embodiments, a Type V Autotransporter Secretion System is used to secrete EGF. The Type V Auto-secretion System utilizes an N-terminal Sec-dependent peptide tag (inner membrane) and C-terminal tag (outer-membrane). This system uses the Sec-system to get from the cytoplasm to the periplasm. The C-terminal tag then inserts into the outer membrane forming a pore through which the “passenger protein” threads through. Due to the simplicity of the machinery and capacity to handle relatively large protein fluxes, the Type V secretion system is attractive for the extracellular production of recombinant proteins. EGF can be fused to an N-terminal secretion signal, a linker, and the beta-domain of an autotransporter. The N-terminal, Sec-dependent signal sequence directs the protein to the SecA-YEG machinery which moves the protein across the inner membrane into the periplasm, followed by subsequent cleavage of the signal sequence. The Beta- domain is recruited to the Bam complex (‘Beta-barrel assembly machinery’) where the beta-domain is folded and inserted into the outer membrane as a beta-barrel structure. EGF is threaded through the hollow pore of the beta-barrel structure ahead of the linker sequence. Once across the outer membrane, the passenger is released from the membrane-embedded C-terminal tag by either an autocatalytic, intein-like mechanism (left side of Bam complex) or via a membrane-bound protease (black scissors; right side of Bam complex) (i.e., OmpT). For example, a membrane-associated peptidase to a complimentary protease cut site in the linker. Thus, in some embodiments, the secreted molecule, such as a heterologous protein or peptide comprises an N-terminal secretion signal, a linker, and beta-domain of an autotransporter so as to allow the molecule to be secreted from the bacteria. [0630] The N-terminal tag is removed by the Sec system. Thus, in some embodiments, the secretion system is able to remove this tag before secreting EGF from the engineered bacteria. In the Type V auto-secretion-mediated secretion the N-terminal peptide secretion tag is removed upon translocation of the “passenger” peptide from the cytoplasm into the periplasmic compartment by the native Sec
system. Further, once the auto-secretor is translocated across the outer membrane the C-terminal secretion tag can be removed by either an autocatalytic or protease-catalyzed e.g., OmpT cleavage thereby releasing the molecule(s) into the extracellular milieu.
[0631] In some embodiments, the recombinant bacteria comprise a type III or a type Ill-like secretion system (T3SS) from Shigella, Salmonella, E. coll, Bivrio, Burkholderia, Yersinia, Chlamydia, or Pseudomonas. The traditional T3SS is capable of transporting a protein from the bacterial cytoplasm to the host cytoplasm through a needle complex. In the Type III traditional secretion system, the basal body closely resembles the flagella, however, instead of a “tail"/whip, the traditional T3SS has a syringe to inject the passenger proteins into host cells. The secretion tag is encoded by an N-terminal peptide (lengths vary and there are several different tags, see PCT/US14/020972). The N-terminal tag is not removed from the polypeptides in this secretion system.
[0632] The T3SS may be modified to secrete the molecule from the bacterial cytoplasm, but not inject the molecule into the host cytoplasm. Thus, the molecule is secreted into the gut lumen. In some embodiments, the recombinant bacteria comprise said modified T3SS and are capable of secreting the EGF from the bacterial cytoplasm. In some embodiments, the secreted molecule, such as a heterologous protein or peptide comprises a type III secretion sequence that EGF to be secreted from the bacteria.
[0633] In the Flagellar modified Type III Secretion, the tag is encoded in 5’ untranslated region of the mRNA and thus there is no peptide tag to cleave/remove. This modified system does not contain the “syringe” portion and instead uses the basal body of the flagella structure as the pore to translocate across both membranes and out through the forming flagella. If the fliC/fliD genes (encoding the flagella “tail’Vwhip) are disrupted the flagella cannot fully form and this promotes overall secretion. In some embodiments, the tail portion can be removed entirely.
[0634] In some embodiments, a flagellar type III secretion pathway is used to EGF. In some embodiments, an incomplete flagellum is used to secrete EGF by recombinantly fusing the peptide to an N-terminal flagellar secretion signal of a native flagellar component. In this manner, the intracellularly expressed chimeric peptide can be mobilized across the inner and outer membranes into the surrounding host environment.
[0635] For example, a modified flagellar type III secretion apparatus in which untranslated DNA fragment upstream of the gene lliC (encoding flagellin), e.g., a 173-bp region, is fused to the gene encoding the heterologous protein or peptide can be used to secrete polypeptides of interest (See, e.g., Majander et al., Extracellular secretion of polypeptides using a modified Escherichia coli flagellar secretion apparatus. Nat Biotechnol. 2005 Apr;23(4):475-81). In some cases, the untranslated region from the fliC loci may not be sufficient to mediate translocation of the passenger peptide through the flagella. Here it may be necessary to extend the N-terminal signal into the amino acid coding sequence of FliC, for example, by using the 173 bp of untranslated region along with the first 20 amino acids of FliC (see, e.g., Duan et al., Secretion of Insulinotropic Proteins by Commensal
Bacteria: Rewiring the Gut To Treat Diabetes, Appl. Environ. Microbiol. December 2008 vol. 74 no. 23 7437-7438).
[0636] In alternate embodiments, the recombinant bacteria further comprise a non-native single membrane-spanning secretion system. Single membrane- spanning transporters may act as a component of a secretion system, or may export substrates independently. Such transporters include, but are not limited to, ATP-binding cassette translocases, flagellum/virulence-related translocases, conjugation-related translocases, the general secretory system (e.g., the SecYEG complex in E. coll), the accessory secretory system in mycobacteria and several types of Gram-positive bacteria (e.g., Bacillus anthracis, Lactobacillus johnsonii, Corynebacterium glutamicum, Streptococcus gordonii, Staphylococcus aureus), and the twin-arginine translocation (TAT) system (Saier, 2006; Rigel and Braunstein, 2008; Albiniak et al., 2013). It is known that the general secretory and TAT systems can both export substrates with cleavable N-terminal signal peptides into the periplasm, and have been explored in the context of biopharmaceutical production. The TAT system may offer particular advantages, however, in that it is able to transport folded substrates, thus eliminating the potential for premature or incorrect folding. In certain embodiments, the recombinant bacteria comprise a TAT or a TAT-like system and are capable of secreting EGF from the bacterial cytoplasm. One of ordinary skill in the art would appreciate that the secretion systems disclosed herein may be modified to act in different species, strains, and subtypes of bacteria, and/or adapted to deliver different payloads.
[0637] In order to translocate EGF to the extracellular space, the polypeptide must first be translated intracellularly, mobilized across the inner membrane and finally mobilized across the outer membrane. EGF contains disulphide bonds to stabilize the tertiary and quaternary structures. While these bonds are capable of correctly forming in the oxidizing periplasmic compartment with the help of periplasmic chaperones, in order to translocate the polypeptide across the outer membrane the disulphide bonds must be reduced and the protein unfolded again.
[0638] One way to secrete properly folded proteins in gram-negative bacteria- particularly those requiring disulphide bonds - is to target the reducing-environment periplasm in conjunction with a destabilizing outer membrane. In this manner the protein is mobilized into the oxidizing environment and allowed to fold properly. In contrast to orchestrated extracellular secretion systems, the protein is then able to escape the periplasmic space in a correctly folded form by membrane leakage. These “leaky” gram-negative mutants are therefore capable of secreting bioactive, properly disulphide- bonded polypeptides. In some embodiments, the recombinant bacteria have a “leaky” or de-stabilized outer membrane. Destabilizing the bacterial outer membrane to induce leakiness can be accomplished by deleting or mutagenizing genes responsible for tethering the outer membrane to the rigid peptidoglycan skeleton, including for example, Ipp, ompC, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl. Lpp is the most abundant polypeptide in the bacterial cell existing at -500,000 copies per cell and functions as the primary ‘staple’ of the bacterial cell wall to the peptidoglycan. Silhavy, T. J., Kahne, D. & Walker, S. The bacterial cell envelope. Cold Spring Harb Perspect Biol 2, a000414
(2010). TolA-pal and OmpA complexes function similarly to Lpp and are other deletion targets to generate a leaky phenotype. Additionally, leaky phenotypes have been observed when periplasmic proteases are inactivated. The periplasm is very densely packed with protein and therefore encode several periplasmic proteins to facilitate protein turnover. Removal of periplasmic proteases such as degS, degP or nlpl can induce leaky phenotypes by promoting an excessive build-up of periplasmic protein. Mutation of the proteases can also preserve the EGF polypeptide by preventing targeted degradation by these proteases. Moreover, a combination of these mutations may synergistically enhance the leaky phenotype of the cell without major sacrifices in cell viability. Thus, in some embodiments, the engineered bacteria have one or more deleted or mutated membrane genes. In some embodiments, the engineered bacteria have a deleted or mutated lpp gene. In some embodiments, the engineered bacteria have one or more deleted or mutated gene(s), selected from ompA, ompA, and ompF genes. In some embodiments, the engineered bacteria have one or more deleted or mutated gene(s), selected from tolA, tolB, and pal genes, in some embodiments, the engineered bacteria have one or more deleted or mutated periplasmic protease genes. In some embodiments, the engineered bacteria have one or more deleted or mutated periplasmic protease genes selected from degS, degP, and nlpl. In some embodiments, the engineered bacteria have one or more deleted or mutated gene(s), selected from lpp, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl genes.
[0639] To minimize disturbances to cell viability, the leaky phenotype can be made inducible by placing one or more membrane or periplasmic protease genes, e.g.. selected from lpp, ompA, ompF, tolA, tolB, pal, degS, degP, and nlpl, under the control of an inducible promoter. For example, expression of lpp or other cell wall stability protein or periplasmic protease can be repressed in conditions where EGF needs to be delivered (secreted). For instance, under inducing conditions a transcriptional repressor protein or a designed antisense RNA can be expressed which reduces transcription or translation of a target membrane or periplasmic protease gene. Conversely, over expression of certain peptides can result in a destabilized phenotype, e.g., overexpression of colicins or the third topological domain of TolA, wherein peptide overexpression can be induced in conditions in which EGF needs to be delivered (secreted). These sorts of strategies would decouple the fragile, leaky phenotypes from biomass production. Thus, in some embodiments, the engineered bacteria have one or more membrane and/or periplasmic protease genes under the control of an inducible promoter.
[0640] Table 11 and Table 12 below lists secretion systems for Gram-positive bacteria and Gram- negative bacteria.
[0641] The above tables for Gram-positive and Gram-negative bacteria list secretion systems that can be used to secrete polypeptides and other molecules from the engineered bacteria (Milton H. Saier, Jr. Microbe / Volume 1, Number 9, 2006 “Protein Secretion Systems in Gram-Negative Bacteria Gram- negative bacteria possess many protein secretion-membrane insertion systems that apparently evolved independently”, the contents of which is herein incorporated by reference in its entirety).
[0642] In some embodiments, the recombinant bacterial comprise a native or non-native secretion system described herein for the secretion of a molecule, e.g.. a cytokine, antibody (e.g.. scFv), metabolic enzyme, e.g., kynureninase, an others described herein.
[0643] Polypeptide Sequences of exemplary secretion tags include PhoA (SEQ ID NO: 136), PhoA (SEQ ID NO: 137), OmpF (SEQ ID NO: 138), cvaC (SEQ ID NO: 139), TorA (SEQ ID NO: 140), fdnG (SEQ ID NO: 141), dmsA (SEQ ID NO: 142), PelB (SEQ ID NO: 143), HlyA secretion signal (SEQ ID NOs: 144 and 145), and PelB (SEQ ID NO: 161). In some embodiments, secretion tags of endogenous secreted proteins from E. coll can be used to secrete EGF. Exemplary secretion tags from secreted E coll Nissle include ECOLIN_05715 Secretion signal (SEQ ID NO: 146), ECOLIN_16495 Secretion signal (SEQ ID NO: 147), ECOLIN_19410 Secretion signal (SEQ ID NO: 148), and ECOLIN_19880 Secretion signal (SEQ ID NO: 149). Additional secretion tags include adhesion (SEQ ID NOS: 149 and 150), DsbA (SEQ ID NOS: 151 and 152), GltI (SEQ ID NOS: 153 and 154), GspD (SEQ ID NOS: 147 and 155), HdeB (SEQ ID NOS: 148 and 156), MalE (SEQ ID NOS: 157 and 158), OppA (SEQ ID NOS: 159 and 160), PelB (SEQ ID NOS: 161 and 162), PhoA (SEQ ID NOS: 136 and 163) and PpiA (SEQ ID NOS: 164 and 165).
[0644] In some embodiments, recombinant bacteria comprise a nucleic acid sequence that encodes a polypeptide which is at least about 80%, 85%, 90%, 95%, or 99% homologous to one or more of the sequences of SEQ ID NOS: 136-165, or a nucleic acid sequence which is at least about 80%, 85%, 90%, 95%, or 99% homologous to one or more of the sequences of SEQ ID NOS: 136-165. Any
secretion tag or secretion system can be combined with any cytokine described herein, and can be used to generate a construct (plasmid based or integrated) which is driven by a directly or indirectly inducible or constitutive promoter described herein. In some embodiments, the secretion system is used in combination with one or more genomic mutations, which leads to the leaky or diffusible outer membrane phenotype (DOM), including but not limited to, Ipp, nlP, tolA, pal.
[0645] In some embodiments, the secretion system is selected from the type I (e.g., hemolysin secretion system), type II, type III, type III flagellar, type IV, type V, type VI, type VII, type VIII secretion systems and modifications thereof, e.g., modified type III, modified type III flagellar secretion systems, resistance-nodulation-division (RND) multi-drug efflux pumps, a single membrane secretion system, Sec and, TAT secretion systems.
[0646] Any of the secretion systems described herein may according to the disclosure be employed to secrete EGF. In some embodiments, EGF secreted by the recombinant bacteria is modified to increase resistance to proteases, e.g., intestinal proteases.
[0647] In some embodiments, the genetically engineered microorganisms are capable of expressing any one or more of the described circuits in low-oxygen conditions, and/or in the gut, or tissue specific molecules or metabolites, and/or in the presence of molecules or metabolites associated with inflammation or immune suppression, and/or in the presence of metabolites that may be present in the gut, and/or in the presence of metabolites that may or may not be present in vivo, and may be present in vitro during strain culture, expansion, production and/or manufacture, such as arabinose and others described herein. In some embodiments, the gene sequences(s) are controlled by a promoter inducible by such conditions and/or inducers. In some embodiments, the gene sequences(s) are controlled by a constitutive promoter, as described herein. In some embodiments, the gene sequences(s) are controlled by a constitutive promoter, and are expressed in in vivo conditions and/or in vitro conditions, e.g., during expansion, production and/or manufacture, as described herein.
[0648] In some embodiments, any one or more of the described circuits are present on one or more plasmids (e.g., high copy or low copy) or are integrated into one or more sites in the microorganism’s chromosome. Also, in some embodiments, the genetically engineered microorganisms are further capable of expressing any one or more of the described circuits and further comprise one or more of the following: (1) one or more auxotrophies, such as any auxotrophies known in the art and provided herein, e.g., thyA auxotrophy, (2) one or more kill switch circuits, such as any of the kill-switches described herein or otherwise known in the art, (3) one or more antibiotic resistance circuits, (4) one or more transporters for importing biological molecules or substrates, such any of the transporters described herein or otherwise known in the art, (5) one or more secretion circuits, such as any of the secretion circuits described herein and otherwise known in the art, (6) one or more surface display circuits, such as any of the surface display circuits described herein and otherwise known in the art and (7) one or more circuits for the production or degradation of one or more metabolites described herein (8) combinations of one or more of such additional circuits.
[0649] Non-limiting examples of EGF are described herein. These polypeptides may be mutated to increase stability, resistance to protease digestion, and/or activity.
[0650] In some embodiments, EGF secreted using components of the flagellar type III secretion system. In a non-limiting example, EGF is secreted via Type I Hemolysin Secretion, is assembled behind a fliC-5’UTR (e.g., 173-bp untranslated region from the fliC loci), and is driven by the native promoter. In other embodiments, the expression of EGF secreted using components of the flagellar type III secretion system is driven by a tet-inducible promoter. In alternate embodiments, an inducible promoter such as oxygen level-dependent promoters (e.g., FNR-inducible promoter), promoters induced by IBD specific molecules or promoters induced by inflammation or an inflammatory response (RNS, ROS promoters), and promoters induced by a metabolite that may or may not be naturally present (e.g., can be exogenously added) in the gut, e.g., arabinose is used. In some embodiments, EGF is expressed from a plasmid (e.g., a medium copy plasmid). In some embodiments, EGF is expressed from a construct which is integrated into fliC locus (thereby deleting fliC) , where it is driven by the native FliC promoter. In some embodiments, an N terminal part of FliC (e.g., the first 20 amino acids of FliC) is included in the construct, to further increase secretion efficiency.
[0651] In some embodiments, EGF is secreted via Type I Hemolysin Secretion, are secreted using via a diffusible outer membrane (DOM) system. In some embodiments, EGF is fused to a N-terminal Sec-dependent secretion signal. Non-limiting examples of such N-terminal Sec-dependent secretion signals include Pho A, OmpF, OmpA, and cvaC. In alternate embodiments, EGF is fused to a Tat- dependent secretion signal. Exemplary Tat-dependent tags include TorA, FdnG, and DmsA.
[0652] In certain embodiments, the recombinant bacteria comprise deletions or mutations in one or more of the outer membrane and/or periplasmic proteins. Non-limiting examples of such proteins, one or more of which may be deleted or mutated, include Ipp, pal, tolA, and/or nlpl. In some embodiments, Ipp is deleted or mutated. In some embodiments, pal is deleted or mutated. In some embodiments, tolA is deleted or mutated. In other embodiments, nlpl is deleted or mutated. In yet
other embodiments, certain periplasmic proteases are deleted or mutated, e.g., to increase stability of the polypeptide in the periplasm. Non-limiting examples of such proteases include degP and ompT. In some embodiments, degP is deleted or mutated. In some embodiments, ompT is deleted or mutated. In some embodiments, degP and ompT are deleted or mutated.
[0653] In some embodiments, EGF is secreted via Type I Hemolysin Secretion, are secreted via a Type V Auto-secreter (pic Protein) Secretion. In some embodiments, EGF is expressed as a fusion protein with the native Nissle auto-secreter E. coli_01635 (where the original passenger protein is replaced by EGF.
[0654] In some embodiments, EGF is secreted via Type I Hemolysin Secretion, are secreted via Type I Hemolysin Secretion. In one embodiment, EGF is expressed as fusion protein with the 53 amino acids of the C terminus of alpha-hemolysin (hlyA) of E. coll CFT073.
Essential genes and auxotrophs
[0655] As used herein, the term “essential gene” refers to a gene which is necessary to for cell growth and/or survival. Bacterial essential genes are well known to one of ordinary skill in the art, and can be identified by directed deletion of genes and/or random mutagenesis and screening (see, e.g., Zhang, 2009, Nucl. Acids Res., 37:D455-D458 and Gerdes et al., Curr. Opin. Biotechnol., 17(5):448-456, the entire contents of each reference are incorporated herein by reference).
[0656] An “essential gene” may be dependent on the circumstances and environment in which an organism lives. For example, a mutation of, modification of, or excision of an essential gene may result in the recombinant bacteria of the disclosure becoming an auxotroph. An auxotrophic modification is intended to cause bacteria to die in the absence of an exogenously added nutrient essential for survival or growth because they lack the gene(s) necessary to produce that essential nutrient.
[0657] An auxotrophic modification is intended to cause bacteria to die in the absence of an exogenously added nutrient essential for survival or growth because they lack the gene(s) necessary to produce that essential nutrient. In some embodiments, any of the recombinant bacteria described herein also comprise a deletion or mutation in a gene required for cell survival and/or growth. In one embodiment, the essential gene is a DNA synthesis gene, for example, thyA. In another embodiment, the essential gene is a cell wall synthesis gene, for example, dapA. In yet another embodiment, the essential gene is an amino acid gene, for example, serA or MetA. Any gene required for cell survival and/or growth may be targeted, including but not limited to, cysE, gin A, ilvD, leuB, lysA, serA, metA, glyA, hisB, ilvA, pheA, proA, thrC, trpC, tyrA, thyA, uraA, dapA, dapB, dapD, dapE, dapF, flhD, metB, metC, pro AB, and thil, as long as the corresponding wild-type gene product is not produced in the bacteria.
[0658] Table 14 lists exemplary bacterial genes which may be disrupted or deleted to produce an auxotrophic strain. These include, but are not limited to, genes required for oligonucleotide synthesis, amino acid synthesis, and cell wall synthesis.
Table 14. Non-limiting Examples of Bacterial Genes Useful for Generation of an Auxotroph
[0659] Table 15 shows the survival of various amino acid auxotrophs in the mouse gut, as detected 24 hrs and 48 hrs post-gavage. These auxotrophs were generated using BW25113, a non-Nissle strain of E. coli.
[0660] For example, thymine is a nucleic acid that is required for bacterial cell growth; in its absence, bacteria undergo cell death. The thyA gene encodes thimidylate synthetase, an enzyme that
catalyzes the first step in thymine synthesis by converting dUMP to dTMP (Sat et al., 2003). In some embodiments, the bacterial cell of the disclosure is a thyA auxotroph in which the thyA gene is deleted and/or replaced with an unrelated gene. A thyA auxotroph can grow only when sufficient amounts of thymine are present, e.g., by adding thymine to growth media in vitro, or in the presence of high thymine levels found naturally in the human gut in vivo. In some embodiments, the bacterial cell of the disclosure is auxotrophic in a gene that is complemented when the bacterium is present in the mammalian gut. Without sufficient amounts of thymine, the thyA auxotroph dies. In some embodiments, the auxotrophic modification is used to ensure that the bacterial cell does not survive in the absence of the auxotrophic gene product (e.g., outside of the gut).
[0661] Diaminopimelic acid (DAP) is an amino acid synthetized within the lysine biosynthetic pathway and is required for bacterial cell wall growth (Meadow et al., 1959; Clarkson et al., 1971). In some embodiments, any of the recombinant bacteria described herein is a dapD auxotroph in which dapD is deleted and/or replaced with an unrelated gene. A dapD auxotroph can grow only when sufficient amounts of DAP are present, e.g., by adding DAP to growth media in vitro. Without sufficient amounts of DAP, the dapD auxotroph dies. In some embodiments, the auxotrophic modification is used to ensure that the bacterial cell does not survive in the absence of the auxotrophic gene product (e.g., outside of the gut).
[0662] In other embodiments, the recombinant bacterium of the present disclosure is a uraA auxotroph in which uraA is deleted and/or replaced with an unrelated gene. The uraA gene codes for UraA, a membrane-bound transporter that facilitates the uptake and subsequent metabolism of the pyrimidine uracil (Andersen et al., 1995). A uraA auxotroph can grow only when sufficient amounts of uracil are present, e.g., by adding uracil to growth media in vitro. Without sufficient amounts of uracil, the uraA auxotroph dies. In some embodiments, auxotrophic modifications are used to ensure that the bacteria do not survive in the absence of the auxotrophic gene product (e.g., outside of the gut).
[0663] In complex communities, it is possible for bacteria to share DNA. In very rare circumstances, an auxotrophic bacterial strain may receive DNA from a non- auxotrophic strain, which repairs the genomic deletion and permanently rescues the auxotroph. Therefore, engineering a bacterial strain with more than one auxotroph may greatly decrease the probability that DNA transfer will occur enough times to rescue the auxotrophy. In some embodiments, the recombinant bacteria comprise a deletion or mutation in two or more genes required for cell survival and/or growth.
[0664] Other examples of essential genes include, but are not limited to yhbV, yagG, hemB, secD, secF, ribD, ribE, thiL, dxs, ispA, dnaX, adk, hemH, IpxH, cysS, fold, rplT, infC, thrS, nadE, gapA, yeaZ, aspS, argS, pgsA, yefM, metG, folE, yejM, gyrA, nrdA, nrdB, folC, accD, fabB, gltX, ligA, zipA, dapE, dapA, der, hisS, ispG, suhB, tadA, acpS, era, rnc, ftsB, eno, pyrG, chpR, Igt, fbaA, pgk, yqgD, metK, yqgF, plsC, ygiT, pare, ribB, cca, ygjD, tdcF, yraL, yihA, ftsN, murl, murB, birA, secE, nusG, rplJ, rplL, rpoB, rpoC, ubiA, plsB, lexA, dnaB, ssb, alsK, groS, psd, orn, yjeE, rpsR, chpS, ppa,
valS, yjgP, yjgQ, dnaC, ribF, IspA, ispH, dapB, folA, imp, yabQ, ftsL, ftsl, murE, murF, mraY, murD, ftsW, murG, murC, ftsQ, ftsA, ftsZ, IpxC, secM, sec A, can, folK, hernL, yadR, dapD, map, rpsB, infB ,nusA, ftsH, obgE, rpmA, rplU, ispB, murA, yrbB, yrbK, yhbN, rpsl, rplM, degS, mreD, mreC, mreB, accB, accC, yrdC, def, fmt, rplQ, rpoA, rpsD, rpsK, rpsM, entD, mrdB, mrdA, nadD, hlepB, rpoE, pssA, yfiO, rplS, trmD, rpsP, ffh, grpE, yfjB, csrA, ispF, ispD, rplW, rplD, rplC, rpsJ, fusA, rpsG, rpsL, trpS, yrfF, asd, rpoH, ftsX, ftsE, ftsY, frr, dxr, ispU, rfaK, kdtA, coaD, rpmB, dfp, dut, gmk, spot, gyrB, dnaN, dnaA, rpmH, rnpA, yidC, tnaB, glmS, glmU, wzyE, hemD, hemC, yigP, ubiB, ubiD, hemG, secY, rplO, rpmD, rpsE, rplR, rplF, rpsH, rpsN, rplE, rplX, rplN, rpsQ, rpmC, rplP, rpsC, rplV, rpsS, rplB, cdsA, yaeL, yaeT, IpxD, fabZ, IpxA, IpxB, dnaE, accA, tilS, proS, yafF, tsf, pyrH, olA, rlpB, leuS, Int, glnS, fldA, cydA, infA, cydC, ftsK, lolA, serS, rpsA, msbA, IpxK, kdsB, mukF, mukE, mukB, asnS, fabA, mviN, rne, yceQ, fabD, fabG, acpP, tmk, holB, lolC, lolD, lolE, purB, yrnfK, minE, mind, pth, rsA, ispE, lolB, hemA, prfA, prmC, kdsA, topA, ribA, fabl, racR, dicA, ydfB, tyrS, ribC, ydiL, pheT, pheS, yhhQ, bcsB, glyQ, yibJ, and gpsA. Other essential genes are known to those of ordinary skill in the art.
[0665] In some embodiments, the recombinant bacterium of the present disclosure is a synthetic ligand-dependent essential gene (SLiDE) bacterial cell. SLiDE bacterial cells are synthetic auxotrophs with a mutation in one or more essential genes that only grow in the presence of a particular ligand (see Lopez and Anderson, ACS Synthetic Biology (2015), the entire contents of which are expressly incorporated herein by reference).
[0666] In some embodiments, the SLiDE bacterial cell comprises a mutation in an essential gene. In some embodiments, the essential gene is selected from the group consisting of pheS, dnaN, tyrS, metG, and adk. In some embodiments, the essential gene is dnaN comprising one or more of the following mutations: H191N, R240C, I317S, F319V, L340T, V347I, and S345C. In some embodiments, the essential gene is dnaN comprising the mutations H191N, R240C, I317S, F319V, L340T, V347I, and S345C. In some embodiments, the essential gene is pheS comprising one or more of the following mutations: F125G, P183T, P184A, R186A, and I188L. In some embodiments, the essential gene is pheS comprising the mutations F125G, P183T, P184A, R186A, and I188L. In some embodiments, the essential gene is tyrS comprising one or more of the following mutations: L36V, C38A and F40G. In some embodiments, the essential gene is tyrS comprising the mutations L36V, C38A and F40G. In some embodiments, the essential gene is metG comprising one or more of the following mutations: E45Q, N47R, I49G, and A51C. In some embodiments, the essential gene is metG comprising the mutations E45Q, N47R, I49G, and A51C. In some embodiments, the essential gene is adk comprising one or more of the following mutations: I4L, L5I and L6G. In some embodiments, the essential gene is adk comprising the mutations I4L, L5I and L6G.
[0667] In some embodiments, the recombinant bacterium is complemented by a ligand. In some embodiments, the ligand is selected from the group consisting of benzothiazole, indole, 2- aminobenzothiazole, indole-3 -butyric acid, indole-3-acetic acid, and L-histidine methyl ester. For
example, bacterial cells comprising mutations in metG (E45Q, N47R, I49G, and A51C) are complemented by benzothiazole, indole, 2-aminobenzothiazole, indole-3 -butyric acid, indole-3 -acetic acid or L-histidine methyl ester. Bacterial cells comprising mutations in dnaN (H191N, R240C, I317S, F319V, L340T, V347I, and S345C) are complemented by benzothiazole, indole or 2- aminobenzothiazole. Bacterial cells comprising mutations in pheS (F125G, P183T, P184A, R186A, and I188L) are complemented by benzothiazole or 2-aminobenzothiazole. Bacterial cells comprising mutations in tyrS (L36V, C38A, and F40G) are complemented by benzothiazole or 2- aminobenzothiazole. Bacterial cells comprising mutations in adk (I4L, L5I and L6G) are complemented by benzothiazole or indole.
[0668] In some embodiments, the recombinant bacterium comprises more than one mutant essential gene that renders it auxotrophic to a ligand. In some embodiments, the bacterial cell comprises mutations in two essential genes. For example, in some embodiments, the bacterial cell comprises mutations in tyrS (L36V, C38A, and F40G) and metG (E45Q, N47R, I49G, and A51C). In other embodiments, the bacterial cell comprises mutations in three essential genes. For example, in some embodiments, the bacterial cell comprises mutations in tyrS (L36V, C38A, and F40G), metG (E45Q, N47R, I49G, and A51C), and pheS (F125G, P183T, P184A, R186A, and I188L).
[0669] In some embodiments, the recombinant bacterium is a conditional auxotroph, wherein the expression of a heterologous gene is activated by an exogenous environmental signal. In some embodiments, the recombinant bacterium is a conditional auxotroph whose essential gene(s) is replaced using an arabinose system. In the absence of arabinose, the AraC transcription factor adopts a conformation that represses transcription of the essential gene under the control of the araBAD promoter and the bacterial cell cannot survive. In the presence of arabinose, the AraC transcription factor undergoes a conformational change that allows it to bind to and activate the araBAD promoter, which induces expression of the essential gene and maintains viability of the bacterial cell.
[0670] In some embodiments, the recombinant bacterium of the disclosure is an auxotroph and also comprises kill-switch circuitry, such as any of the kill-switch components and systems described herein. For example, the recombinant bacteria may comprise a deletion or mutation in an essential gene required for cell survival and/or growth, for example, in a DNA synthesis gene, for example, thy A, cell wall synthesis gene, for example, dapA and/or an amino acid gene, for example, serA or MetA and may also comprise a toxin gene that is regulated by one or more transcriptional activators that are expressed in response to an environmental condition(s) and/or signal(s) (such as the described arabinose system) or regulated by one or more recombinases that are expressed upon sensing an exogenous environmental condition(s) and/or signal(s) (such as the recombinase systems described herein). Other embodiments are described in Wright et al., ACS Synthetic Biology (2015) 4: 307-16, the entire contents of which are expressly incorporated herein by reference. In some embodiments, the recombinant bacterium of the disclosure is an auxotroph and also comprises kill-switch circuitry, such as any of the kill-switch components and systems described herein, as well as another
biosecurity system, such a conditional origin of replication (Wright et al., 2015). In other embodiments, auxotrophic modifications may also be used to screen for mutant bacteria that produce the EGF molecule.
Antibiotic resistance
[0671] In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to antibiotics. As used herein, “Antibiotics” are substances that kill bacteria (bactericidal), or inhibit bacterial growth (bacteriostatic). Antibiotics may be natural products, many common antibiotics used in labs today are semi-synthetic or fully synthetic compounds. An antibiotic resistance gene can be added to a bacterium of interest, either on a plasmid or integrated into the chromosome in conjunction with the EGF gene, allowing the simple detection of bacteria containing the EGF gene by growing the bacteria on selective media containing the antibiotic.
[0672] In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to aminoglycosides. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to a beta-lactam. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to glycopeptides. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to macrolides. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to polypeptide antibiotics. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to a tetracycline.
[0673] In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Kanamycin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Spectinomycin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Streptomycin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Ampicillin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Carbenicillin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Bleomycin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Erythromycin. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Polymyxin B. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Tetracycline. In some embodiments, the recombinant bacteria comprise one or more genes providing resistance to Chloramphenicol.
Methods of Screening
Mutagenesis
[0674] In some embodiments, the inducible promoter is operably linked to a detectable product, e.g., GFP, and can be used to screen for mutants. In some embodiments, the inducible promoter is mutagenized, and mutants are selected based upon the level of detectable (L.O.D.) product, e.g., by flow cytometry, fluorescence-activated cell sorting (FACS) when the detectable product fluoresces.
In some embodiments, one or more transcription factor binding sites is mutagenized to increase or decrease binding. In alternate embodiments, the wild-type binding sites are left intact, and the remainder of the regulatory region is subjected to mutagenesis. In some embodiments, the mutant promoter is inserted into the recombinant bacteria to increase expression of the EGF molecule under inducing conditions, as compared to unmutated bacteria of the same subtype under the same conditions. In some embodiments, the inducible promoter and/or corresponding transcription factor is a synthetic, non-naturally occurring sequence.
[0675] In some embodiments, the gene encoding EGF is mutated to increase expression and/or stability of said molecule under inducing conditions, as compared to unmutated bacteria of the same subtype under the same conditions. In some embodiments, one or more of the genes in a gene cassette for producing EGF is mutated to increase expression of said molecule under inducing conditions, as compared to unmutated bacteria of the same subtype under the same conditions. In some embodiments, the efficacy or activity of any of the importers and exporters for metabolites of interest can be improved through mutations in any of these genes. Mutations increase uptake or export of such metabolites, including but not limited to, tryptophan, e.g., under inducing conditions, as compared to unmutated bacteria of the same subtype under the same conditions. Methods for directed mutation and screening are known in the art.
Pharmaceutical Compositions and Formulations
[0676] Pharmaceutical compositions comprising one or more recombinant bacteria, alone or in combination with prophylactic agents, therapeutic agents, and/or pharmaceutically acceptable carriers are provided.
[0677] In certain embodiments, the pharmaceutical composition comprises one species, strain, or subtype of bacteria that are engineered to comprise the genetic modifications described herein, e.g., to produce EGF. In alternate embodiments, the pharmaceutical composition comprises two or more species, strains, and/or subtypes of bacteria that are each engineered to comprise the genetic modifications described herein, e.g., to produce EGF.
[0678] In certain embodiments, a combination of two or more different genetically engineered microorganisms can be administered at the same time. In some embodiments, the method comprises administering a subject a combination of two or more genetically engineered microorganisms, a first microorganism which expresses a first payload, and at least a second microorganism which expresses a second payload. In some embodiments, the method comprises compositions comprising a combination of two or more genetically engineered microorganisms, a first microorganisms which expresses a first payload, and at least a second microorganism which expresses a second payload. [0679] The pharmaceutical compositions described herein may be formulated in a conventional manner using one or more physiologically acceptable carriers comprising excipients and auxiliaries, which facilitate processing of the active ingredients into compositions for pharmaceutical use. Methods of formulating pharmaceutical compositions are known in the art (see, e.g., "Remington's
Pharmaceutical Sciences," Mack Publishing Co., Easton, PA). In some embodiments, the pharmaceutical compositions are subjected to tabletting, lyophilizing, direct compression, conventional mixing, dissolving, granulating, levigating, emulsifying, encapsulating, entrapping, or spray drying to form tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated. Appropriate formulation depends on the route of administration.
[0680] The genetically engineered microorganisms may be formulated into pharmaceutical compositions in any suitable dosage form (e.g., liquids, capsules, sachet, hard capsules, soft capsules, tablets, enteric coated tablets, suspension powders, granules, or matrix sustained release formations for oral administration) and for any suitable type of administration (e.g., oral, topical, injectable, intravenous, sub-cutaneous, immediate-release, pulsatile-release, delayed-release, or sustained release). Suitable dosage amounts for the recombinant bacteria may range from about 10e5 to 10el2 bacteria, e.g., approximately 10e5 bacteria, approximately 10e6 bacteria, approximately 10e7 bacteria, approximately 10e8 bacteria, approximately 10e9 bacteria, approximately 10e10 bacteria, approximately Well bacteria, or approximately 10el2 bacteria. The composition may be administered once or more daily, weekly, or monthly. The composition may be administered before, during, or following a meal. In one embodiment, the pharmaceutical composition is administered before the subject eats a meal. In one embodiment, the pharmaceutical composition is administered concurrently with a meal. In one embodiment, the pharmaceutical composition is administered after the subject eats a meal.
[0681] The recombinant bacteria may be formulated into pharmaceutical compositions comprising one or more pharmaceutically acceptable carriers, thickeners, diluents, buffers, buffering agents, surface active agents, neutral or cationic lipids, lipid complexes, liposomes, penetration enhancers, carrier compounds, and other pharmaceutically acceptable carriers or agents. For example, the pharmaceutical composition may include, but is not limited to, the addition of calcium bicarbonate, sodium bicarbonate, calcium phosphate, various sugars and types of starch, cellulose derivatives, gelatin, vegetable oils, polyethylene glycols, and surfactants, including, for example, polysorbate 20. In some embodiments, the recombinant bacteria may be formulated in a solution of sodium bicarbonate, e.g., 1 molar solution of sodium bicarbonate (to buffer an acidic cellular environment, such as the stomach, for example). The recombinant bacteria may be administered and formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with anions such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with cations such as those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2-ethylamino ethanol, histidine, procaine, etc.
[0682] The genetically engineered microorganisms may be administered intravenously, e.g., by infusion or injection. The genetically engineered microorganisms of the disclosure may be administered intrathecally. In some embodiments, the genetically engineered microorganisms may be
administered orally. The genetically engineered microorganisms disclosed herein may be administered topically and formulated in the form of an ointment, cream, transdermal patch, lotion, gel, shampoo, spray, aerosol, solution, emulsion, or other form well known to one of skill in the art. See, e.g., "Remington's Pharmaceutical Sciences," Mack Publishing Co., Easton, PA. In an embodiment, for non-sprayable topical dosage forms, viscous to semi-solid or solid forms comprising a carrier or one or more excipients compatible with topical application and having a dynamic viscosity greater than water are employed. Suitable formulations include, but are not limited to, solutions, suspensions, emulsions, creams, ointments, powders, liniments, salves, etc., which may be sterilized or mixed with auxiliary agents (e.g., preservatives, stabilizers, wetting agents, buffers, or salts) for influencing various properties, e.g., osmotic pressure. Other suitable topical dosage forms include sprayable aerosol preparations wherein the active ingredient in combination with a solid or liquid inert carrier, is packaged in a mixture with a pressurized volatile (e.g., a gaseous propellant, such as freon) or in a squeeze bottle. Moisturizers or humectants can also be added to pharmaceutical compositions and dosage forms. Examples of such additional ingredients are well known in the art. In one embodiment, the pharmaceutical composition comprising the recombinant bacteria may be formulated as a hygiene product. For example, the hygiene product may be an antibacterial formulation, or a fermentation product such as a fermentation broth. Hygiene products may be, for example, shampoos, conditioners, creams, pastes, lotions, and lip balms.
[0683] The genetically engineered microorganisms disclosed herein may be administered orally and formulated as tablets, pills, dragees, capsules, liquids, gels, syrups, slurries, suspensions, etc. Pharmacological compositions for oral use can be made using a solid excipient, optionally grinding the resulting mixture, and processing the mixture of granules, after adding suitable auxiliaries if desired, to obtain tablets or dragee cores. Suitable excipients include, but are not limited to, fillers such as sugars, including lactose, sucrose, mannitol, or sorbitol; cellulose compositions such as maize starch, wheat starch, rice starch, potato starch, gelatin, gum tragacanth, methyl cellulose, hydroxypropylmethyl-cellulose, sodium carbomethylcellulose; and/or physiologically acceptable polymers such as polyvinylpyrrolidone (PVP) or polyethylene glycol (PEG). Disintegrating agents may also be added, such as cross-linked polyvinylpyrrolidone, agar, alginic acid or a salt thereof such as sodium alginate.
[0684] Tablets or capsules can be prepared by conventional means with pharmaceutically acceptable excipients such as binding agents (e.g., pregelatinised maize starch, polyvinylpyrrolidone, hydroxypropyl methylcellulose, carboxymethylcellulose, polyethylene glycol, sucrose, glucose, sorbitol, starch, gum, kaolin, and tragacanth); fillers (e.g., lactose, microcrystalline cellulose, or calcium hydrogen phosphate); lubricants (e.g., calcium, aluminum, zinc, stearic acid, polyethylene glycol, sodium lauryl sulfate, starch, sodium benzoate, L-leucine, magnesium stearate, talc, or silica); disintegrants (e.g., starch, potato starch, sodium starch glycolate, sugars, cellulose derivatives, silica powders); or wetting agents (e.g., sodium lauryl sulphate). The tablets may be coated by methods
well known in the art. A coating shell may be present, and common membranes include, but are not limited to, polylactide, polyglycolic acid, polyanhydride, other biodegradable polymers, alginate - polylysine-alginate (APA), alginate-polymethylene-co-guanidine-alginate (A-PMCG-A), hydroymethylacrylate-methyl methacrylate (HEMA-MMA), multilayered HEMA-MMA-MAA, polyacrylonitrilevinylchloride (PAN-PVC), acrylonitrile/sodium methallylsulfonate (AN-69), polyethylene glycol/poly pentamethylcyclopentasiloxane/polydimethylsiloxane (PEG/PD5/PDMS), poly N,N- dimethyl acrylamide (PDMAAm), siliceous encapsulates, cellulose sulphate/sodium alginate/polymethylene-co-guanidine (CS/A/PMCG), cellulose acetate phthalate, calcium alginate, k- carrageenan-locust bean gum gel beads, gellan-xanthan beads, poly(lactide-co-glycolides), carrageenan, starch poly-anhydrides, starch polymethacrylates, polyamino acids, and enteric coating polymers.
[0685] In some embodiments, the genetically engineered microorganisms are enterically coated for release into the gut or a particular region of the gut, for example, the large intestine. The typical pH profile from the stomach to the colon is about 1-4 (stomach), 5.5-6 (duodenum), 7.3-8.0 (ileum), and 5.5-6.5 (colon). In some diseases, the pH profile may be modified. In some embodiments, the coating is degraded in specific pH environments in order to specify the site of release. In some embodiments, at least two coatings are used. In some embodiments, the outside coating and the inside coating are degraded at different pH levels.
[0686] Liquid preparations for oral administration may take the form of solutions, syrups, suspensions, or a dry product for constitution with water or other suitable vehicle before use. Such liquid preparations may be prepared by conventional means with pharmaceutically acceptable agents such as suspending agents (e.g., sorbitol syrup, cellulose derivatives, or hydrogenated edible fats); emulsifying agents (e.g., lecithin or acacia); non-aqueous vehicles (e.g., almond oil, oily esters, ethyl alcohol, or fractionated vegetable oils); and preservatives (e.g., methyl or propyl-p-hydroxybenzoates or sorbic acid). The preparations may also contain buffer salts, flavoring, coloring, and sweetening agents as appropriate. Preparations for oral administration may be suitably formulated for slow release, controlled release, or sustained release of the genetically engineered microorganisms described herein.
[0687] In one embodiment, the genetically engineered microorganisms of the disclosure may be formulated in a composition suitable for administration to pediatric subjects. As is well known in the art, children differ from adults in many aspects, including different rates of gastric emptying, pH, gastrointestinal permeability, etc. (Ivanovska et al., Pediatrics, 134(2):361-372, 2014). Moreover, pediatric formulation acceptability and preferences, such as route of administration and taste attributes, are critical for achieving acceptable pediatric compliance. Thus, in one embodiment, the composition suitable for administration to pediatric subjects may include easy-to-swallow or dissolvable dosage forms, or more palatable compositions, such as compositions with added flavors,
sweeteners, or taste blockers. In one embodiment, a composition suitable for administration to pediatric subjects may also be suitable for administration to adults.
[0688] In one embodiment, the composition suitable for administration to pediatric subjects may include a solution, syrup, suspension, elixir, powder for reconstitution as suspension or solution, dispersible/effervescent tablet, chewable tablet, gummy candy, lollipop, freezer pop, troche, chewing gum, oral thin strip, orally disintegrating tablet, sachet, soft gelatin capsule, sprinkle oral powder, or granules. In one embodiment, the composition is a gummy candy, which is made from a gelatin base, giving the candy elasticity, desired chewy consistency, and longer shelf-life. In some embodiments, the gummy candy may also comprise sweeteners or flavors.
[0689] In one embodiment, the composition suitable for administration to pediatric subjects may include a flavor. As used herein, "flavor" is a substance (liquid or solid) that provides a distinct taste and aroma to the formulation. Flavors also help to improve the palatability of the formulation. Flavors include, but are not limited to, strawberry, vanilla, lemon, grape, bubble gum, and cherry.
[0690] In certain embodiments, the genetically engineered microorganisms may be orally administered, for example, with an inert diluent or an assimilable edible carrier. The compound may also be enclosed in a hard- or soft-shell gelatin capsule, compressed into tablets, or incorporated directly into the subject’s diet. For oral therapeutic administration, the compounds may be incorporated with excipients and used in the form of ingestible tablets, buccal tablets, troches, capsules, elixirs, suspensions, syrups, wafers, and the like. To administer a compound by other than parenteral administration, it may be necessary to coat the compound with, or co-administer the compound with, a material to prevent its inactivation.
[0691] In another embodiment, the pharmaceutical composition comprising the recombinant bacteria may be a comestible product, for example, a food product. In one embodiment, the food product is milk, concentrated milk, fermented milk (yogurt, sour milk, frozen yogurt, lactic acid bacteria- fermented beverages), milk powder, ice cream, cream cheeses, dry cheeses, soybean milk, fermented soybean milk, vegetable-fruit juices, fruit juices, sports drinks, confectionery, candies, infant foods (such as infant cakes), nutritional food products, animal feeds, or dietary supplements. In one embodiment, the food product is a fermented food, such as a fermented dairy product. In one embodiment, the fermented dairy product is yogurt. In another embodiment, the fermented dairy product is cheese, milk, cream, ice cream, milk shake, or kefir. In another embodiment, the recombinant bacteria are combined in a preparation containing other live bacterial cells intended to serve as probiotics. In another embodiment, the food product is a beverage. In one embodiment, the beverage is a fruit juice-based beverage or a beverage containing plant or herbal extracts. In another embodiment, the food product is a jelly or a pudding. Other food products suitable for administration of the recombinant bacteria are well known in the art. For example, see U.S. 2015/0359894 and US 2015/0238545, the entire contents of each of which are expressly incorporated herein by reference. In
yet another embodiment, the pharmaceutical composition is injected into, sprayed onto, or sprinkled onto a food product, such as bread, yogurt, or cheese.
[0692] In some embodiments, the composition is formulated for intraintestinal administration, intrajejunal administration, intraduodenal administration, intraileal administration, gastric shunt administration, or intracolic administration, via nanoparticles, nanocapsules, microcapsules, or microtablets, which are enterically coated or uncoated. The pharmaceutical compositions may also be formulated in rectal compositions such as suppositories or retention enemas, using, e.g., conventional suppository bases such as cocoa butter or other glycerides. The compositions may be suspensions, solutions, or emulsions in oily or aqueous vehicles, and may contain suspending, stabilizing and/or dispersing agents.
[0693] The genetically engineered microorganisms described herein may be administered intranasally, formulated in an aerosol form, spray, mist, or in the form of drops, and conveniently delivered in the form of an aerosol spray presentation from pressurized packs or a nebulizer, with the use of a suitable propellant (e.g., dichlorodifluoromethane, trichlorofluoromethane, dichlorotetrafluoroethane, carbon dioxide or other suitable gas). Pressurized aerosol dosage units may be determined by providing a valve to deliver a metered amount. Capsules and cartridges (e.g., of gelatin) for use in an inhaler or insufflator may be formulated containing a powder mix of the compound and a suitable powder base such as lactose or starch.
[0694] The genetically engineered microorganisms may be administered and formulated as depot preparations. Such long acting formulations may be administered by implantation or by injection, including intravenous injection, subcutaneous injection, local injection, direct injection, or infusion. For example, the compositions may be formulated with suitable polymeric or hydrophobic materials (e.g., as an emulsion in an acceptable oil) or ion exchange resins, or as sparingly soluble derivatives (e.g., as a sparingly soluble salt).
[0695] In some embodiments, disclosed herein are pharmaceutically acceptable compositions in single dosage forms. Single dosage forms may be in a liquid or a solid form. Single dosage forms may be administered directly to a patient without modification or may be diluted or reconstituted prior to administration. In certain embodiments, a single dosage form may be administered in bolus form, e.g., single injection, single oral dose, including an oral dose that comprises multiple tablets, capsule, pills, etc. In alternate embodiments, a single dosage form may be administered over a period of time, e.g., by infusion.
[0696] Single dosage forms of the pharmaceutical composition may be prepared by portioning the pharmaceutical composition into smaller aliquots, single dose containers, single dose liquid forms, or single dose solid forms, such as tablets, granulates, nanoparticles, nanocapsules, microcapsules, microtablets, pellets, or powders, which may be enterically coated or uncoated. A single dose in a solid form may be reconstituted by adding liquid, typically sterile water or saline solution, prior to administration to a patient.
[0697] In other embodiments, the composition can be delivered in a controlled release or sustained release system. In one embodiment, a pump may be used to achieve controlled or sustained release. In another embodiment, polymeric materials can be used to achieve controlled or sustained release of therapies of the present disclosure (see e.g., U.S. Patent No. 5,989,463). Examples of polymers used in sustained release formulations include, but are not limited to, poly(2-hydroxy ethyl methacrylate), poly(methyl methacrylate), poly(acrylic acid), poly(ethylene-co-vinyl acetate), poly(methacrylic acid), polyglycolides (PLG), polyanhydrides, poly(N- vinyl pyrrolidone), poly(vinyl alcohol), polyacrylamide, poly(ethylene glycol), polylactides (PLA), poly(lactide-co-glycolides) (PLGA), and poly orthoesters. The polymer used in a sustained release formulation may be inert, free of leachable impurities, stable on storage, sterile, and biodegradable. In some embodiments, a controlled or sustained release system can be placed in proximity of the prophylactic or therapeutic target, thus requiring only a fraction of the systemic dose. Any suitable technique known to one of skill in the art may be used.
[0698] Dosage regimens may be adjusted to provide a therapeutic response. Dosing can depend on several factors, including severity and responsiveness of the disease, route of administration, time course of treatment (days to months to years), and time to amelioration of the disease. For example, a single bolus may be administered at one time, several divided doses may be administered over a predetermined period of time, or the dose may be reduced or increased as indicated by therapeutic situation. The specification for the dosage is dictated by the unique characteristics of the active compound and the particular therapeutic effect to be achieved. Dosage values may vary with the type and severity of the condition to be alleviated. For any particular subject, specific dosage regimens may be adjusted over time according to the individual need and the professional judgment of the treating clinician. Toxicity and therapeutic efficacy of compounds provided herein can be determined by standard pharmaceutical procedures in cell culture or animal models. For example, LD50, ED50, EC50, and IC50 may be determined, and the dose ratio between toxic and therapeutic effects (LD50/ED50) may be calculated as therapeutic index. Compositions that exhibit toxic side effects may be used, with careful modifications to minimize potential damage to reduce side effects. Dosing may be estimated initially from cell culture assays and animal models. The data obtained from in vitro and in vivo assays and animal studies can be used in formulating a range of dosage for use in humans.
[0699] The ingredients are supplied either separately or mixed together in unit dosage form, for example, as a dry lyophilized powder or water-free concentrate in a hermetically sealed container such as an ampoule or sachet indicating the quantity of active agent. If the mode of administration is by injection, an ampoule of sterile water for injection or saline can be provided so that the ingredients may be mixed prior to administration.
[0700] The pharmaceutical compositions may be packaged in a hermetically sealed container such as an ampoule or sachet indicating the quantity of the agent. In one embodiment, one or more of the
pharmaceutical compositions is supplied as a dry sterilized lyophilized powder or water-free concentrate in a hermetically sealed container and can be reconstituted (e.g., with water or saline) to the appropriate concentration for administration to a subject. In an embodiment, one or more of the prophylactic or therapeutic agents or pharmaceutical compositions is supplied as a dry sterile lyophilized powder in a hermetically sealed container stored between 2° C and 8° C and administered within 1 hour, within 3 hours, within 5 hours, within 6 hours, within 12 hours, within 24 hours, within 48 hours, within 72 hours, or within one week after being reconstituted. Cryoprotectants can be included for a lyophilized dosage form, principally 0-10% sucrose (optimally 0.5- 1.0%). Other suitable cryoprotectants include trehalose and lactose. Other suitable bulking agents include glycine and arginine, either of which can be included at a concentration of 0-0.05%, and polysorbate-80 (optimally included at a concentration of 0.005-0.01%). Additional surfactants include but are not limited to polysorbate 20 and BRIJ surfactants. The pharmaceutical composition may be prepared as an injectable solution and can further comprise an agent useful as an adjuvant, such as those used to increase absorption or dispersion, e.g., hyaluronidase.
Methods of Treatment
[0701] Another aspect provides methods of treating autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, neurological or neurodegenerative diseases, diarrheal diseases, IBD, related diseases, and other diseases that benefit from reduced gut inflammation and/or enhanced gut barrier function. In some embodiments, the invention provides for the use of at least one genetically engineered species, strain, or subtype of bacteria described herein for the manufacture of a medicament. In some embodiments, the invention provides for the use of at least one genetically engineered species, strain, or subtype of bacteria described herein for the manufacture of a medicament for treating autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, neurological or neurodegenerative diseases, diarrheal diseases, IBD, related diseases, and other diseases that benefit from reduced gut inflammation and/or enhanced gut barrier function. In some embodiments, the invention provides at least one genetically engineered species, strain, or subtype of bacteria described herein for use in treating autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, neurological or neurodegenerative diseases, diarrheal diseases, IBD, related diseases, and other diseases that benefit from reduced gut inflammation and/or enhanced gut barrier function.
[0702] In some embodiments, the diarrheal disease is selected from the group consisting of acute watery diarrhea, e.g., cholera, acute bloody diarrhea, e.g., dysentery, and persistent diarrhea. In some embodiments, the IBD or related disease is selected from the group consisting of Crohn’s disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, diversion colitis, Behcet’ s disease, intermediate colitis, short bowel syndrome, ulcerative proctitis, proctosigmoiditis, left-sided colitis, pancolitis, gastric ulcers, duodenal ulcers, and fulminant colitis.
[0703] In some embodiments, the disease or condition is an autoimmune disorder selected from the group consisting of acute disseminated encephalomyelitis (ADEM), acute necrotizing hemorrhagic leukoencephalitis, Addison’ s disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune angioedema, autoimmune aplastic anemia, autoimmune dysautonomia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear disease (AIED), autoimmune myocarditis, autoimmune oophoritis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura (ATP), autoimmune thyroid disease, autoimmune urticarial, axonal & neuronal neuropathies, Balo disease, Behcet’s disease, bullous pemphigoid, cardiomyopathy, Castleman disease, celiac disease, Chagas disease, chronic inflammatory demyelinating polyneuropathy (CIDP), chronic recurrent multifocal ostomyelitis (CRMO), Churg-Strauss syndrome, cicatricial pemphigoid/benign mucosal pemphigoid, Crohn’s disease, Cogan’s syndrome, cold agglutinin disease, congenital heart block, Coxsackie myocarditis, CREST disease, essential mixed cryoglobulinemia, demyelinating neuropathies, dermatitis herpetiformis, dermatomyositis, Devic’ s disease (neuromyelitis optica), discoid lupus, Dressier’s syndrome, endometriosis, eosinophilic esophagitis, eosinophilic fasciitis, erythema nodosum, experimental allergic encephalomyelitis, Evans syndrome, fibrosing alveolitis, giant cell arteritis (temporal arteritis), giant cell myocarditis, glomerulonephritis, Goodpasture’s syndrome, granulomatosis with polyangiitis (GPA), Graves’ disease, Guillain -Barre syndrome, Hashimoto’s encephalitis, Hashimoto’s thyroiditis, hemolytic anemia, Henoch-Schonlein purpura, herpes gestationis, hypogammaglobulinemia, idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4-related sclerosing disease, immunoregulatory lipoproteins, inclusion body myositis, interstitial cystitis, juvenile arthritis, juvenile idiopathic arthritis, juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, leukocytoclastic vasculitis, lichen planus, lichen sclerosus, ligneous conjunctivitis, linear IgA disease (LAD), lupus (systemic lupus erythematosus), chronic Lyme disease, Meniere’s disease, microscopic polyangiitis, mixed connective tissue disease (MCTD), Mooren’s ulcer, Mucha-Habermann disease, multiple sclerosis, myasthenia gravis, myositis, narcolepsy, neuromyelitis optica (Devic’ s), neutropenia, ocular cicatricial pemphigoid, optic neuritis, palindromic rheumatism, PANDAS (Pediatric Autoimmune Neuropsychiatric Disorders Associated with Streptococcus), paraneoplastic cerebellar degeneration, paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, pars planitis (peripheral uveitis), pemphigus, peripheral neuropathy, perivenous encephalomyelitis, pernicious anemia, POEMS syndrome, polyarteritis nodosa, type I, II, & III autoimmune polyglandular syndromes, polymyalgia rheumatic, polymyositis, postmyocardial infarction syndrome, postpericardiotomy syndrome, progesterone dermatitis, primary biliary cirrhosis, primary sclerosing cholangitis, psoriasis, psoriatic arthritis, idiopathic pulmonary fibrosis, pyoderma gangrenosum, pure red cell aplasia, Raynaud’s phenomenon, reactive arthritis, reflex sympathetic dystrophy, Reiter’s syndrome, relapsing
polychondritis, restless legs syndrome, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis, sarcoidosis, Schmidt syndrome, scleritis, scleroderma, Sjogren’s syndrome, sperm & testicular autoimmunity, stiff person syndrome, subacute bacterial endocarditis (SBE), Susac’s syndrome, sympathetic ophthalmia, Takayasu’s arteritis, temporal arteritis/giant cell arteritis, thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, transverse myelitis, type 1 diabetes, asthma, ulcerative colitis, undifferentiated connective tissue disease (UCTD), uveitis, vasculitis, vesiculobullous dermatosis, vitiligo, and Wegener’s granulomatosis. In some embodiments, the invention provides methods for reducing, ameliorating, or eliminating one or more symptom(s) associated with these diseases, including but not limited to diarrhea, bloody stool, mouth sores, perianal disease, abdominal pain, abdominal cramping, fever, fatigue, weight loss, iron deficiency, anemia, appetite loss, weight loss, anorexia, delayed growth, delayed pubertal development, and inflammation of the skin, eyes, joints, liver, and bile ducts. In some embodiments, the invention provides methods for reducing gut inflammation and/or enhancing gut barrier function, thereby ameliorating or preventing a systemic autoimmune disorder, e.g., asthma (Arrieta et al., 2015).
[0704] The method may comprise preparing a pharmaceutical composition with at least one genetically engineered species, strain, or subtype of bacteria described herein, and administering the pharmaceutical composition to a subject in a therapeutically effective amount.
[0705] In certain embodiments, the pharmaceutical composition described herein is administered to reduce gut inflammation, enhance gut barrier function, and/or treat or prevent an autoimmune disorder in a subject. In some embodiments, the methods of the present disclosure may reduce gut inflammation in a subject by at least about 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or more as compared to levels in an untreated or control subject. In some embodiments, the methods of the present disclosure may enhance gut barrier function in a subject by at least about 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 85%, 90%, 95%, or more as compared to levels in an untreated or control subject. In some embodiments, changes in inflammation and/or gut barrier function are measured by comparing a subject before and after administration of the pharmaceutical composition. In some embodiments, the method of treating or ameliorating the autoimmune disorder and/or the disease or condition associated with gut inflammation and/or compromised gut barrier function allows one or more symptoms of the disease or condition to improve by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more.
[0706] In some embodiments, reduction is measured by comparing the levels of inflammation in a subject before and after administration of the pharmaceutical composition. In one embodiment, the levels of inflammation is reduced in the gut of the subject. In one embodiment, gut barrier function is enhanced in the gut of the subject. In another embodiment, levels of inflammation is reduced in the blood of the subject. In another embodiment, the levels of inflammation is reduced in the plasma of the subject. In another embodiment, levels of inflammation is reduced in the brain of the subject.
[0707] In one embodiment, the pharmaceutical composition described herein is administered to reduce levels of inflammation in a subject to normal levels. In another embodiment, the pharmaceutical composition described herein is administered to reduce levels of inflammation in a subject below normal.
[0708] In some embodiments, the method of treating the autoimmune disorder allows one or more symptoms of the condition or disorder to improve by at least about 10%, 20%, 30%, 40%, 50%, 60%, 70%, 80%, 90%, 95%, or more. In some embodiments, the method of treating the disorder, allows one or more symptoms of the condition or disorder to improve by at least about two-fold, three-fold, four-fold, five-fold, six-fold, seven-fold, eight-fold, nine-fold, or ten-fold.
[0709] Before, during, and after the administration of the pharmaceutical composition, gut inflammation and/or barrier function in the subject may be measured in a biological sample, such as blood, serum, plasma, urine, fecal matter, peritoneal fluid, intestinal mucosal scrapings, a sample collected from a tissue, and/or a sample collected from the contents of one or more of the following: the stomach, duodenum, jejunum, ileum, cecum, colon, rectum, and anal canal. In some embodiments, the methods may include administration of the compositions to enhance gut barrier function and/or to reduce gut inflammation to baseline levels, e.g., levels comparable to those of a healthy control, in a subject. In some embodiments, the methods may include administration of the compositions to reduce gut inflammation to undetectable levels in a subject, or to less than about 1%, 2%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, or 80% of the subject’s levels prior to treatment. In some embodiments, the methods may include administration of the compositions to enhance gut barrier function in a subject by about 1%, 2%, 5%, 10%, 20%, 25%, 30%, 40%, 50%, 60%, 70%, 75%, 80%, 90%, 100% or more of the subject’s levels prior to treatment.
[0710] In certain embodiments, the recombinant bacteria are E. coll Nissle. The recombinant bacteria may be destroyed, e.g., by defense factors in the gut or blood serum (Sonnenborn et al., 2009) or by activation of a kill switch, several hours or days after administration. Thus, the pharmaceutical composition comprising the recombinant bacteria may be re-administered at a therapeutically effective dose and frequency. In alternate embodiments, the recombinant bacteria are not destroyed within hours or days after administration and may propagate and colonize the gut.
[0711] The pharmaceutical composition may be administered alone or in combination with one or more additional therapeutic agents, e.g., corticosteroids, aminosalicylates, anti-inflammatory agents. In some embodiments, the pharmaceutical composition is administered in conjunction with an anti- inflammatory drug (e.g., mesalazine, prednisolone, methylprednisolone, butesonide), an immunosuppressive drug (e.g., azathioprine, 6-mercaptopurine, methotrexate, cyclosporine, tacrolimus), an antibiotic (e.g., metronidazole, ornidazole, clarithromycin, rifaximin, ciprofloxacin, anti-TB), other probiotics, and/or biological agents (e.g., infliximab, adalimumab, certolizumab pegol) (Triantafillidis et al., 2011). An important consideration in the selection of the one or more additional therapeutic agents is that the agent(s) should be compatible with the recombinant bacteria, e.g., the
agent(s) must not kill the bacteria. In one embodiment, the bacterial cells disclosed herein are administered to a subject once daily. In another embodiment, the bacterial cells disclosed herein are administered to a subject twice daily. In another embodiment, the bacterial cells disclosed herein are administered to a subject in combination with a meal, prior to a meal, or after a meal. The dosage of the pharmaceutical composition and the frequency of administration may be selected based on the severity of the symptoms and the progression of the disease. The appropriate therapeutically effective dose and/or frequency of administration can be selected by a treating clinician.
[0712] The recombinant bacteria may be destroyed, e.g., by defense factors in tissues or blood serum (Sonnenborn et al., 2009), or by activation of a kill switch, several hours or days after administration. Thus, the pharmaceutical composition comprising the gene or gene cassette for producing the EGF molecule may be re-administered at a therapeutically effective dose and frequency.
[0713] The immunostimulatory activity of bacterial DNA is mimicked by synthetic oligodeoxynucleotides (ODNs) expressing unmethylated CpG motifs. Bode et al., Expert Rev Vaccines. 2011 Apr; 10(4): 499-511. CpG DNA as a vaccine adjuvant. When used as vaccine adjuvants, CpG ODNs improve the function of professional antigen-presenting cells and boost the generation of humoral and cellular vaccine-specific immune responses. In some embodiments, CpG can be administered in combination with the genetically engineered bacteria of the invention.
[0714] The dosage of the pharmaceutical composition and the frequency of administration may be selected based on the severity of the symptoms and the progression of the disease or disorder. The appropriate therapeutically effective dose and the frequency of administration can be selected by a treating clinician.
EXAMPLES
[0715] The following examples provide illustrative embodiments of the disclosure. One of ordinary skill in the art will recognize the numerous modifications and variations that may be performed without altering the spirit or scope of the disclosure. Such modifications and variations are encompassed within the scope of the disclosure. The Examples do not in any way limit the disclosure.
Example 1. EGF Strain Construction
[0716] The human epidermal growth factor (hEGF) cDNA sequence was sourced from NCBI accession number: gq214314.1 and codon optimized for expression in E. coll. Sec secretion signal - hEGF fusion protein sequences were designed by adding the codon optimized hEGF sequence to the N-terminal sec secretion signal sequence of PhoA (21 amino acids), PelB (22 amino acids), or OmpA (21 amino acids). dsDNA encoding each fusion protein open reading frame was synthesized with the addition of a strong 5’ ribosome binding site (RBS) upstream of the start codon and 20 bp flanking homology to an expression vector containing apl5a origin of replication, kanamycin resistance
cassette, and the PfnrS promoter from the fumarate and nitrate reductase gene S in E. coli Nissle. Gibson assembly methods yielded expression plasmids for PhoA-hEGF (pl5a_Kan_fnr_PhoA-EGF), PelB-hEGF (pl5a_Kan_fnr_PelB-EGF) and OmpA-hEGF (pl5a_Kan_fnr_OmpA-EGF) (Sequences SEQ ID NO: 508, SEQ ID NO: 507, SEQ ID NO: 509). Each construct was confirmed via PCR amplification and sequencing.
[0717] A second set of expression constructs was created by synthesizing each fusion protein downstream of the cI857 temperature responsive promoter and corresponding repressor protein derived from lambda phage, a 5’ RBS, and 20 bp flanking homology. Synthesized expression constructs were introduced into an expression vector containing a pl5a origin of replication and kanamycin resistance cassette using Gibson assembly methods to yield (pl5a_Kan_cI857_PhoA- EGF), (pl5a_Kan_cI857_PelB-EGF), and (pl5a_Kan_cI857_OmpA-EGF).
[0718] An expression vector containing SC 101 origin of replication and Carbenicillin resistance cassette was used to express all three units of prtDEF ABC transporter: prtD (ATP-binding cassette), prtE (membrane fusion protein), and prtF (outer membrane protein) from E. chrysanthemi. Each unit was codon optimized for E. coli, and the synthesized expression construct consisted of a temperature sensitive promoter (cI857), a ribosome binding site (RBS) upstream of each unit (prtD, prtE and prtF) respectively, and included a 20 bp flanking homology to the expression vector. Gibson assembly methods was used to assemble the expression constructs into their respective expression vector, which resulted in following expression plasmids: hEGF-LARD3 (pl5a_Kan_cI857_EGF-LARD3, SEQ ID NO: 523), hEGF-HlyA (pl5a_KAN_cI857_EGF-HlyA, SEQ ID NO: 524) and prtDEF (pSC101_Carb_cI857_PrtDEF, SEQ ID NO: 527). Each construct was confirmed via PCR amplification and sequencing. Expression plasmids were introduced into SYN094, a wild type E. coli Nissle strain in sets of two: hEGF-LARD3 & prtDEF or hEGF-HlyA & prtDEF, which generated strains SYN7984 & SYN7985 respectively (Table 16).
[0719] To create a Gram-negative bacterium capable of secreting bioactive proteins, a diffusible outer membrane (DOM) phenotype in the E. coli Nissle background was engineered by deleting the gene encoding the periplasmic protein pal. This alteration results in an increased rate of diffusion of periplasmic proteins to the external environment without compromising cell growth properties. The resulting “leaky membrane” chassis strain is designated SYN1557. Each expression plasmid was introduced into either SYN094, a wild type E. coli Nissle strain, or SYN1557, E. coli Nissle containing a deletion of the pal gene (DOM), generating strains SYN7881-SYN7886, SYN7838- SYN7839, and SYN9001-SYN9004 (Table 16).
Example 2. EGF Production
[0720] To assay for production of EGF from engineered strains, cells were grown overnight in 10 ml of LB media containing respective antibiotics (Kanamycin 50 for EGF plasmids in all strains, and Chloramphenicol 30 for DOM chassis) in 50 ml baffled flasks, 250 rpm. 4 ml of overnight culture was added to 100 ml of LB (containing respective antibiotics) in a 250 ml baffled flask, 37C, 250 RPM. After 4 hours, OD 600 was measured for all cells and specific volumes of the cultures were spun down and resuspended in 10 mL of fresh LB (+respective antibiotics) to yield a 10mL culture with a final OD 600 of 2.5. Cultures were then poured in 50 ml flask and were left for 5 hours in anaerobic chamber to induce the PfnrS promoter. After induction, cultures were spun down for 8 minutes, 8000 RPM, supernatants were filtered with a 0.22 micron PES filter and used for ELISA analysis.
Example 3. EGF in Bacterial Supernatants
[0721] EGF was measured in bacterial supernatants using a human EGF specific ELISA kit from R&D systems as per the manufacturer’s instructions (Cat. number DY236). Briefly, supernatants are diluted into the working range of the assay, added to wells coated with a monoclonal mouse anti- human EGF antibody specific for human EGF and incubated for one hour. Following a wash step, a polyclonal biotinylated goat anti-human EGF antibody is added and incubated for two hours. Following a second wash step, streptavidin-horseradish peroxidase is added and incubated for 20 minutes. After an additional wash step, the HRP substrate tetramethylbenzidine and hydrogen peroxide are added and incubated for 20 minutes. A stop solution of sulfuric acid is then added and 450 nm absorbance recorded. EGF concentrations of the unknowns are calculated against a standard curve constructed from recombinant EGF processed concurrently as above. EGF was measured for the EGF-secreting strains with this method.
Example 4. EGF Activity in Human Cell Lines
[0722] HCT116 (ATCC, cat. number CCL-247) or HT29 cells (ATCC, cat. number HTB-38) were used to measure activity of recombinant EGF secreted into the supernatant of engineered E coli strains. Briefly, cells were treated with varying concentrations of EGF for 5 minutes, after which media was removed and the cells were washed one time with PBS. Lysis buffer specific for the downstream application was used to lyse the cells in preparation for further analysis. For experiments using the EGFR inhibitor AG- 1478, inhibitor was added to the wells 1 hr before treatment of EGF containing samples to a final concentration of 1 uM.
[0723] For analysis by western blot, cells in a 24 well dish were lysed with 200 uL of RIPA buffer containing the recommended amount of HALT protease and phosphatase inhibitor (ThermoFisher, cat. Number 78442). Samples were left to lyse at 4°C for 15 minutes. After lysis, samples were transferred to a 1.5mL Eppendorf tube and spun down at 15,000g for 15 minutes at 4°C. 7 uL of clarified lysate was added to 6 uL of DI water, 5uL of LDS samples buffer (4x), and 2 uL of reducing agent (10x). Samples were heated to 70°C for 10 minutes. Samples were run on a NuPage protein gel and transferred to a pvdf membrane using the iBlot2 transfer device per the manufacturer’ s specifications. Membrane was blocked with 5% BSA in TBST overnight and probed for EGFR, AKT, ERK, pEGFR, pAKT, and pERK using commercially available antibodies.
[0724] For analysis by ELISA, cells in a 96-well plate were lysed with 10OuL of lysis buffer specific for target phospho-protein of interest as specified by the manufacturer’ s instructions. All lysis buffer was supplemented with Halt Protease and Phosphatase inhibitor (ThermoFisher, cat. Number 78442). For phospho-EGFR, DuoSet Human Phospho-EGFR ELISA kit (R&D Systems, cat. Number, DYC1095B-5) was used. For phosphor-ERK, DuoSet Phospho-ERK1/ERK2 ELISA kit (R&D Systems, cat. Number, DYC1018B-5) was used. For phosphor-AKT, DuoSet Phospho-AKTl ELISA kit (R&D Systems, cat. Number, DYC2289C-2) was used. After lysis, cells were spun down in the 96-well plate at 500g for 15 minutes at 4°C. Supernatant was gently removed and diluted based on manufacturer’s instructions.
Example 5: EGF Production - Temperature Sensitive Promoter
[0725] Cultures were set up for overnight growth at 30°C. Overnight cultures were subcultured, 4mL in 10OmL of the same media used in the overnight culture. Subcultures were placed at 30°C in a shaking incubator. After around 3hr, cells were removed from the incubator and ODs were taken. To calculate the amount of the morning culture to spin down and then resuspend in 10mL, X was solved using:
(OD of morning culture)( X mL of culture to spin down) = (Desired OD - OD of 2.5 is standard) (10mL final volume)
[0726] The volume of cells calculated for each culture was spun down at 5,000g for 5 minutes. Supernatant was removed from pelleted cells and the cells were then resuspended in 10mL fresh media and appropriate antibiotics. ODs of these cultures were taken as well to give the starting OD at the beginning of induction, e.g., close to 2.5. Cultures were placed at 37°C in a shaking incubator to induce protein expression. As a control, separate cultures set to the same initial OD were placed at 30°C in a shaking incubator. After 4 hr, aliquots of the culture were spun down at 5,000g for 5 minutes and supernatant was collected for further downstream analysis. ODs and CFUs were collected for these cultures at each timepoint. Supernatant EGF was measured in an ELISA (R&D Systems) as shown in Table 17.
Example 6: EGF Production - FNR Promoter
[0727] Cultures were set up for overnight growth at 37°C. In the morning, overnight cultures were subcultured, 4mL in 10OmL of the same media used in the overnight culture. Subcultures were placed at 37°C in a shaking incubator. After around 3hr, cells were removed from the incubator and ODs were taken. To calculate the amount of the morning culture to spin down and then resuspend in 10mL, X was solved using:
(OD of morning culture)( X mL of culture to spin down) = (Desired OD →→ of 2.5 for low density, 5.0 for medium density and 10.0 for high density) ( 10mL final volume)
[0728] The volume of cells calculated for each culture was spun down at 5,000g for 5 minutes. Supernatant was removed from pelleted cells and the cells were then resuspended in 10mL fresh media and appropriate antibiotics. ODs of these cultures were taken as well to give the starting OD at the beginning of induction, e.g., close to the calculated OD. Cultures were brought into a vinyl anaerobic chamber (Coy Lab Products, 5% H2 gas mix) and placed in a standing 37°C incubator within the chamber to induce protein expression. After 5 hr, aliquots of the culture were spun down at 5,000g for 5 minutes and supernatant was collected for further downstream analysis. ODs and CFUs were collected for these cultures at the 5hr timepoint. Supernatant EGF was measured in an ELISA (R&D Systems) as shown in Table 18.
Table 18. EGF Production
Example 7: EGF Production - FNR Promoter
[0729] Cultures were set up for overnight growth at 37°C. In the morning, overnight cultures were subcultured, 4mL in 10OmL of the same media used in the overnight culture. Subcultures were placed at 37°C in a shaking incubator. After around 3hr, cells were removed from the incubator and ODs were taken. To calculate the amount of the morning culture to spin down and then resuspend in 10mL, X was solved using:
(OD of morning culture)( X mL of culture to spin down) = (Desired OD
→ of 2.5 for low density, 5.0 for medium density and 10.0 for high density) (10mL final volume)
[0730] The volume of cells we calculated for each culture was spun down at 5,000g for 5 minutes. Supernatant was removed from pelleted cells and the cells were then resuspended in 10mL fresh media and appropriate antibiotics. ODs of these cultures were taken as well to give the starting OD at the beginning of induction, e.g., close to the calculated OD. Cultures were placed at 37°C in a shaking incubator to induce protein expression. After 5 hr, aliquots of the culture were spun down at 5,000g for 5 minutes and supernatant was collected for further downstream analysis. ODs and CFUs were collected for these cultures at the 5hr timepoint. Supernatant EGF was measured in an ELISA (R&D Systems) as shown in Table 19.
Table 19. EGF Production
Example 8: Prototype Strains
[0731] Next, additional plasmid-based, engineered E. coli Nissle 1917 strains that secrete human EGF (EcNEGF prototypes) were constructed using EcN background strains (chassis) harboring features that are advantageous for clinical development of engineered live bacterial therapeutics. The EcN chassis used in this study are described in Table 20.
[0732] Selected prototypes for secretion of bioactive human EGF are shown in Table 21. These strains include variants on both Chassis A (diffusible outer membrane) and Chassis B (wild-type membrane) backgrounds, as well as EGF under the control of temperature-inducible (cI857) or anaerobic-inducible (FNR) promoters. All strains used in this study harbor the human EGF constructs on medium-copy plasmids.
[0733] Biomass of EcN-EGF prototypes used in this study are described in Table 22. EcN-EGF biomass was prepared in AMBR250 bioreactors, using Fermentation Medium 3 (FM3) containing 10 mM Thymidine. The bioreactors were inoculated at 0.5 OD (600 nm) from overnight seed cultures. Cells were centrifuged at 7,800 x g and resuspended in 100 mM phosphate buffer containing 15%
glycerol. EcN-EGF aliquots were stored at -80°C. Total cells / mL in frozen aliquots were enumerated using by Cellometer assay (K2 Matrix software, Nexelcom, Inc.). Percent viability was determined by Sytox exclusion dye assay (ThermoFisher Scientific CatalogNum. S34862).
Example 9: Secretion of Bioactive Human EGF by EcN-Egf Prototypes in vitro hEGF Production Assay
[0734] Frozen aliquots of each EcN-EGF prototype were removed from -80°C and thawed on ice. A 30 mL aliquot of FM3 containing 50 pg/mL kanamycin was prepared for each prototype strain. Total cells / mL in frozen aliquots were enumerated using by Cellometer assay (K2 Matrix software, Nexelcom, Inc.). In vitro hEGF production assays were performed by adjusting EcN-EGF cell density 2.5xl09 total cells / mL.
[0735] Thawed EcN-EGF cells were added to the 30 mL media to obtain a final concentration of 2.5xl09 total cells / mL. Resuspended EcN-EGF cultures were then split into three 10 mLaliquots in 50 mL flasks and incubated at 37°C under atmospheric conditions in a shaking incubator at 250 rpm for 8 hrs.
[0736] EGF-containing supernatants were then collected by centrifuging cultures at 4,000 rpm for 10 mins in a benchtop hanging bucket centrifuge. Supernatant samples were frozen and stored at -80°C until EGF quantitation by ELISA. in vitro hEGF Bioactivity Assay
[0737] HT-29 cells were seeded into a 96-well tissue culture treated plate at 90,000 cells in 90uL and incubated overnight in a tissue culture incubator to adhere to the plate. The following morning, 10uL of desired treatment was added to each of the wells with four replicates for each treatment group and incubated for 5 minutes. After 5 minutes stimulation, the supernatant was removed from the 96-well plate by flicking and 75uL of Lysis buffer #4 (Cisbio Cat. number 64KL4FDF) with Halt protease/phosphatase inhibitor (Halt™ Protease and Phosphatase Inhibitor Cocktail(100X)) was added to the cells. Lysates were then stored in a -80°C freezer until pEGFR quantitation by FRET assay.
Bioanalytical Methods hEGF Quantitation
[0738] EGF was measured in bacterial supernatants using a human EGF specific ELISA kit from R&D systems as per the manufacturer’s instructions (Cat. number DY236). Briefly, supernatants were diluted into the working range of the assay, added to wells coated with a monoclonal mouse anti- human EGF antibody specific for human EGF and incubated for 2 hr. Following a wash step, a polyclonal biotinylated goat anti-human EGF antibody is added and incubated for two hours.
[0739] Following a second wash step, streptavidin-horseradish peroxidase is added and incubated for 20mins. After an additional wash step, the HRP substrate tetramethylbenzidine and hydrogen peroxide were added and incubated for 20 minutes. A stop solution of sulfuric acid was then added and the absorbance of wells at both 570 nm and 450 nm was measured. After subtracting the absorbance values at 450 nm from those at 570 nm for all the samples, EGF concentrations of the unknowns were calculated against a standard curve constructed from recombinant EGF processed concurrently as above. EGF was measured for all EGF-secreting strains with this method. Dilutions of 1 in 10,000 were made in sample buffer (0.1% BSA in PBS) to bring secreted EGF in the supernatants within the range of this assay. pEGFR Quantitation
[0740] Phospho-EGFR was measured using a pEGFR HTRF kit specific for Tyrl068 from Cisbio (Cat. 64EG1PEG) as per manufacturer’s instructions. Thawed lysates were briefly mixed on a plate shaker and transferred to an opaque 384 well plate. Donor Eu3+ cryptate and acceptor d2 pEGFR antibodies were diluted in the provided detection buffer to the working concentration of the assayand combined in equal proportions immediately before use. The antibody mixture was added to each well and incubated for 4h at RT. The FRET signal from each sample was read at 665 nm and 615 nm, and the ratio between 665 nm and 615 nm signals was taken.
Data analysis and Results
[0741] EcN-EGF total cell counts and viability were obtained using Cellometer K2 Matrix software (Nexelcom, Inc.). All other data were analyzed using Microsoft Excel and GraphPad Prism v9.0. EGF production values (reported in Tables 8-10) were converted from raw concentrations using Equation 1.
[0743] Three replicate experiments were performed demonstrating hEGF production in vitro by the EcN-EGF lead prototypes of secreted hEGF (Experiment 1, Experiment 2, and Experiment 3; see FIG. 11B, Tables 23-25). Three subsequent experiments were performed to determine the bioactivity
of secreted hEGF by stimulating HT-29 cells using supernatants from the three production experiments (see FIG. 13; Tables 26-28).
[0744] These data demonstrate that each of the EcN-EGF prototypes (SYN8062, SYN8063, SYN8065, and SYN8066) display in vitro EGF production of > 1 pg hEGF / 5 x 10^l 1 cells in vitro across three replicate experiments.
[0745] The results of experiments demonstrating the in vitro bioactivity of secreted hEGF in stimulated HT-29 cells are shown in FIG. 13 and Tables 25-27. Overall, these data demonstrate that each of the EcN-EGF prototypes (SYN8062, SYN8063, SYN8065, and SYN8066) are capable of inducing Phospho-EGFR levels comparable to signals observed with recombinant EGF in vitro across three replicate experiments. In all cases, the 95% confidence interval for the EC50 (calculated using GraphPad Prism v9.0 software) intersects this range, indicating that the EC50 estimate is consistent with the expected bioactivity of human EGF.
[0746] In conclusion, the results presented in this study demonstrate that the four EcN-EGF prototypes investigated (SYN8062, SYN8063, SYN8065, and SYN8066) all secretes > 1 pg hEGF /5el 1 cells in vitro across three replicate experiments. Moreover, phospho-EGFR levels measured by ELISA in human epithelial cells induced by secreted hEGF are comparable to signals observed with recombinant EGF (rEGF). Comparability is defined as signal at EC50 values of rEGF (± 0.5 log) across three replicate experiments.
Example 10. In vivo Biodistribution of Engineered EcN
[0747] The objective of this study was to determine the biodistribution in the gastrointestinal (GI) tract of prototype EGF-secreting strains and to assess the effect of bacterial engineering on GI distribution and fecal excretion of SYN8062 and SYN8063 in C57BL/6J mice using CFU measurements. EcN prototypes used in this study are described in Table 29.
[0748] EcN biomass was prepared in AMBR250 bioreactors and cells were centrifuged at 7,800 x g and resuspended in 100 mM phosphate buffer containing 15% glycerol. EcN-EGF aliquots were stored at -80°C. EcN strain biomass used in this study is described in Table 30.
In Vivo Study Design
In vivo EcN Fitness and Viability Experimental Design
[0749] A description of the experimental design and treatment groups used to determine in vivo fitness and viability of EcN is provided in Table 31.
Table 31. In Vivo EcN Fitness and Viability Experimental Design
Bioanalytical Methods
In Vivo Experimental Design for CFU Measurements
[0750] C57BL/6J mice were group housed and assigned to treatment groups. Mice received a single oral dose of the treatment and were sacrificed by CO2 asphyxiation at their assigned time. Feces were collected fresh by free catch, and gut effluents were collected from stomach, small intestine, cecum, and colon by flushing with 500 uL of PBS. Feces and gut effluents were placed into pre- weighed bead-bug tubes containing 500 uL of PBS, weighed, and then processed for serial dilution plating to determine viable colony-forming units (CFUs) immediately after collection.
Quantitation of Bacterial CFUs in Feces.
[0751] Feces and gut effluents were processed for quantification of bacteria by serial dilution and plating on streptomycin- or thymidine- and kanamycin-containing plates. For serial dilution, 1 mL of PBS was added to each bead-bug tube. The tubes were then homogenized and 150 uL wasremoved from each tube and plated into Row A of a 96-well conical-bottom plate (12 samples per plate). From Row A , 10 uL of homogenate was removed and placed into each consecutive well in that sample column (eg, taken from Row A1; 10 uL into Row Bl, Row Cl, Row D1 and so on). A 10-point dilution series was performed, making a 1: 10 serial dilution with PBS from the initial 10 uL fecal sample (90 uL of PBS was added). The dilutions were then plated on LB agar plates supplemented with streptomycin (300 ug/mL) or kanamycin (3 mM) and thymidine (3 mM) and incubated overnight at 37°C. Twenty-four hours after the incubation began, plates were removed from the incubator, and colonies were manually counted.
Data Analysis And Results
[0752] EcN total cell counts and viability were obtained using Cellometer K2 Matrix software (Nexelcom, Inc.). Raw data were entered in Microsoft excel (Microsoft Excel, Seattle, WA) spreadsheet and transferred to GraphPad Prism v9.0 (GraphPad Software, San Diego, CA). Statistical
analysis was performed using GraphPad Prism, and the specific tests used are indicated in the legend to each respective figure. Significance was set as p < 0.05.
[0753] To determine in vivo viability and gut transit of chassis A EcN expressing EGF, two strains were and compared to wildtype EcN. Mice received a single oral bolus of EcN WT (S YN094), A- PcI857-EGF (SYN8062), A-PfnrS -EGF (SYN8063) at 1 x 1010 CFU. FIG. 15 shows abundance in effluents that were collected and counted at indicated times from the small intestine, cecum, colon, and feces. The tabular CFU counts used for construction of these charts are included in Table 32 and
Table 33. In the effluents obtained from the small intestine, cecum, and colon of mice dosed with either SYN094 (control), SYN8062 or SYN8063, no substantial difference was observed in the survival or GI distribution over the duration of the study. No significant difference in fecal recovery was observed between the three strains at all-time points.
N=5 mice per group per time point.
Table 33. Tabular Results Supporting Bacterial Strain Fecal Recovery
n=5 mice per group per time point, except for 24h time point SYN094, SYN8063 n=4 per group
[0754] The results in this study demonstrate the biodistribution of engineered EcN. EcN-EGF prototypes (SYN8062, SYN8063) in chassis A follow the same CFU kinetics as EcN WT strain (SYN094). EcN rapidly clears SI and is abundant in distal gut up to 6 hrs post dose. Data suggests no significant effect of modifications on transit.
Example 11. In vivo EGF Secretion by prototype strains in naive mice
[0755] The objective of this study was to determine the ability of prototype EGF-secreting strains to produce EGF in the GI tract. C57BL/6J mice (female, n=5) were group housed and assigned to treatment groups. Mice received a single oral dose of bacterial cells (le10) and were sacrificed by CO2 asphyxiation at 1, 3, 6 or 24 hours. Effluents (small intestine, cecum, colon) were collected as described above in Example 10. ELISA for EGF was performed per manufacturer’s instructions (Invitrogen). Preliminary results are shown in FIG. 16. High levels of hEGF were detected in small intestine (SI) and cecum at 1 hr post-dose and in colon 3 hr post-dose. At 6 hours post dose, these quantities dropped to nanogram levels.
Example 12. In vivo Biodistribution and EGF Secretion of Engineered EcN in a DSS model [0756] Two studies were conducted to determine (1) the biodistribution in the gastrointestinal (GI) tract of prototype EGF-secreting strains and (2) the ability of the strains to produce and secrete EGF in the various GI compartments over time in a DDS model of IBD. EcN prototypes used in these studies are SYN8066 (Chassis B, FNR) and SYN8248 (Chassis B).
[0757] In both studies, female mice were randomized into different treatment groups (n=5) by weight and put on 3% DSS drinking water for 7 days. After day 6, DSS water was removed and substituted with normal water. On day 7, mice (female, N=5) received a single oral dose of the treatment (le10 cells) and were sacrificed by CO2 asphyxiation at 1, 3, 6 or 24 hours and effluents were collected as described in Example 10 above.
[0758] For the biodistribution study, bacteria were quantitated as described above in Example 10. Results are shown in FIG. 17. No substantial difference was observed in the survival or GI distribution over the duration of the study between the EGF secreting strain SYN8066 and the chassis B only strain SYN8248. Data suggests no significant effect of modifications on transit. In the DSS model, EcN cleared the small intestine and was abundant in distal gut up to 24 hrs post dose, which is substantially longer than in naive mice, where much lower bacterial levels were observed at the 24- hour timepoint. These results demonstrate that the biodistribution of engineered EcN in the gastrointestinal tract in the DSS model differs from the biodistribution in naive mice, in that transit through the lower intestine is delayed in DSS mice as compared to naive mice.
[0759] To assess secretion levels in the gastrointestinal tract, mice (female, n=5) were treated with DSS as described above and on day 8 received a single oral dose of bacteria (le10 cells). Mice were sacrificed at the 1-, 3-, or 6-hour time points, and effluents were collected for measurement of EFG
secretion by ELISA. Results are shown in FIG. 18. In this initial study, similar levels of hEGF were produced in DSS colitis mice as observed previously in healthy mice (~30 ng in colon at 3h post-dose and -10 ng at 6h post-dose).
Example 13. Construction of Integrated strains
[0760] Strains having 1-, 2-, and 3-copies of integrated FNR-EGF in a chassis B background were generated. Integrated strains are listed in Table 36.
[0761] To determine the EGF production capability of the integrated strains EcN-EGF cells were added to 30 mL media to obtain a final concentration of 2.5x10^9 total cells / mL. Resuspended EcN- EGF cultures were then split into three 10 mL aliquots in 50 mL flasks and incubated at 37°C under atmospheric conditions in a shaking incubator at 250 rpm for 8 hrs. EGF- containing supernatants were then collected by centrifuging cultures at 4,000 rpm for 10 mins in a benchtop hanging bucket centrifuge. Supernatant samples were frozen and stored at - 80°C until EGF quantitation by ELISA. Results show that 2-3 copy integrated strains show favorable in vitro activity compared to plasmid- based B-FNR (SYN8066) (FIG. 19).
Example 14. EGFR Target Engagement By EcN-EGF In A Colitis Mouse Model
[0762] The objective of this study was to determine if oral administration of EcN-EGF to DSS- treated mice over 6 days results in statistically significant epithelial cell changes compared to vehicle and/or EcN chassis in DSS-treated mice.
[0763] Female C57BL/6J mice (12-14 weeks old; n=5 per group per time point) were group housed and assigned to groups. As outlined in FIG. 20A, mice were placed on normal diet with 4.5% DSS in their drinking water, and received BID or TID an oral dose of EcN-EGF (SYN8510; 1 x 109 CFU) or EcN (SYN8248; 1 x 109 CFU), or vehicle control, and were weighed every day of the study. Body weight loss was observed upon DSS administration, but no significant changes were seen in any of the treatment groups (FIGs. 20E and 20F).
[0764] To assess EcN-EGF viability and dosage effect, on Day 3 and 4 feces were collected 6 hours post first dose and placed into preweighed bead-bug tubes. The tubes containing feces were weighed,
500ul of phosphate-buffered saline added, followed by homogenization. The homogenate then was diluted, plated, and incubated at 37 °C overnight. The number of colonies were recorded the next day to determine total CFU and CFU/g of feces. Results in FIG. 20B show that feces abundance of EcN (SYN8248) and EcN-EGF (SYN8510 induced) are similar on both Day 3 and Day 4, indicating EcN- and EcN-EGF both transit through the GI tract and are viable. Feces collected on Day 3 and 4 showed ng quantities of EGF present in fecal pellets, confirming EGF production (FIG. 20C).
[0765] To assess in vivo EGF production, mice were sacrificed by COj asphyxiation at their assigned time for colon contents and colon tissue collection. Colon contents were collected from the colon by flushing with 500 uL of phosphate-buffered saline and then placed into preweighed bead-bug tube and flash frozen in LN2. These samples were then thawed, weighed, and homogenized for EGF concentration analysis via ELISA using Abeam Human EGF ELISA Kit according to manufacturer’s instructions. Results shown in FIG. 20D confirm EGF production.
[0766] To assess EGFR target engagement by EcN-EGF, tissue samples were stained for three proliferation markers, PCNA, Ki67, and Edu/BrdU. PCNA is expressed in Gl and S, to a lesser extent in S and G2, and is low or absent in GO and early GL Ki67 is expressed in the cell cycle phases Gl, S, G2 and M, but is absent in GO. EdU/Brdu labels proliferating cells and daughter cells based on incorporation of "clickable" nucleotide analogue.
[0767] Once the colon tissue was flushed and content collected in both studies, the tissue was placed vertically in card stock to maintain the colon’s structural integrity and was placed in 4% PFA overnight at 4C. The fixed tissue then was placed in 70% EtOH. The tissue then was embedded in paraffin wax, sliced 4 pm thin, skipping 40um between slices and stained for epithelial markers Ki67, PCNA and Edu. Slides were imaged and analyzed via Qupath for positive cell staining. Results are shown in FIGs. 21B, 21C, and 21D. The changes observed with strain administration were localized to the distal colon, which is the site of greatest inflammation. Statistically significant increases in epithelial cell proliferation compared to vehicle confirmed target engagement were seen. In the distal colon, increased epithelial cell proliferation (Ki67+, PCNA+, Edu+) was observed with EcN-EGF PO treatment as compared to vehicle or EcN control. An increased Ki67 and PCNA signal was observed when administered TID compared to appropriate vehicle.
[0768] RT-PCR analysis on RNA extracted from colonic tissue (middle of the colon) revealed a statistically significant Increase of Phldal observed with EcN-EGF PO TID over vehicle and EcN alone. A trend of increased Egrl over vehicle and EcN alone was also observed (FIG. 21E).
Example 15. EGF production in a colonization model.
[0769] EGF production in a streptomycin colonization model was assessed according to the scheme shown in in FIG. 22A.
[0770] Naive mice (c57b!6J) were given 3% DSS in the drinking water from day 0 through day 5. On day 5, mice were given streptomycin (5g/ml in drinking water) for the duration of the study (day 6).
Mice were dosed with water or lactulose (100μL of Ig/mL lactulose solution) on day 6, one hour prior to a dose of 1X1010 EcN (SYN7901) or EcN-EGF (SYN8854, having StrR (streptomycin resistance), no auxo trophy, and 3 copies of integrated hEGF).
[0771] Animals were sacrificed at the 2, 3, and 4 hour timepoints post-EcN dose on day 6, effluents were collected, and colonic EGF was measured, essentially as described above. Results are shown in FIG. 22B and demonstrate that a single lactulose dose before strain administration increases the total amount of EGF present at each timepoint, suggesting it can sustain EGF production in vivo over a longer period.
Example 16. Carbon supplementation to increase EGF production in vivo
[0772] Whether EGF production could be increased in vivo by co-administration of lactose was assessed. Lactulose is a disaccharide of galactose and fructose that is non-absorbable by the host, but can be utilized by gut bacteria, including E. coli Nissle.
[0773] First EcN-EGF were grown in M9 media with or without xylose or lactulose supplementation. Results depicted in FIG. 23B show that EcN-EGF (SYN8066) can grow on lactulose as a sole carbon source.
[0774] Next, EGF production in the cecum and colon with the addition of lactulose was assessed. Healthy naive mice (n=5 per group) were dosed at time 0 ( T0) orally with either water or 100μL of Ig/mL lactulose solution. At time 0.5 (T0.5, 30min later) mice were dosed orally with 1X109 EcN- hEGF (SYN8066). Mice were sacrificed at respective time points (T2.5, T3.5 and T4.5). Cecum and colon tissue were harvested, weighed, and homogenized to measure hEGF production. Total hEGF values are plotted in ng hEGF in FIGs. 24B and 24C and demonstrate that a single lactulose dose before strain administration increases the total amount of EGF present at each timepoint, suggesting it can sustain EGF production in vivo over a longer period.
[0775] Next, the effects of lactulose on EGF production in colon were assessed in a DSS model (according to the scheme shown in FIG. 25A. Healthy naive mice (n=5 per group) were given 3% DSS from day 0-day 5. On day 6, mice (c57B16/J) were dosed with water or lactulose (100μL of 1g/ml lactulose solution) either at two hours (T-2) or one hour (T-1) prior to gavage at T0 with 1X1010 EcN (SYN8248) or EcN-EGF (SYN8066). Mice were sacrificed at 2 hours (T2) and 3 hours (T3) post bacterial dose and effluents were analyzed for EGF levels by ELISA essentially as described above. Results are shown in FIG. 25B indicating that the lactulose effect is greatest at 1 hour prior to EcN dosing.
[0776] Additionally, RNA was extracted from the mid-colon at each time point and gene expression changes were measured for EGF target genes, and an increase of Ereg was seen at 3 hours post dosing (data not shown).
Example 17. Carbon supplementation to increase EGF production in vivo in a colonization model
[0777] EGF production was assessed in a colonization model (according to the scheme shown in FIG. 26A). Mice (c57B16/J) were given streptomycin (5g/ml in drinking water) from day -7 (D-7) through the end of the study on day 6 (D6). On Day 0, 3% DSS was added in drinking water throughout the remainder of the study (to day 6). Lactulose (10OpL of Ig/mL solution) was administered BID until the end of the study. EcN (SYN094) or EcN-EGF (SYN8854, having StrR, no auxotrophy, and 3 copies of integrated hEGF) were administered at day -6 (D-6), day -3 (D-3), day - l(D-1) and day 4(D4). Stool was collected on day -6 (D-6) 6 hours post dose, on day -2 (D-2), and day 2 (D2), and mice were sacrificed on day 6 (D6). Bacterial abundance and levels of EGF in stool are shown in FIGs. 26A and 26B, showing that lactose boosts CFUs and EGF production in the colonization model.
Example 18. In vitro EGF production from fermenter batches
[0778] EGF production from fermenter batches prepared using different processes was assessed. For the in vitro assay, frozen EcN-EGF biomass was thawed and washed with M9 minimal media containing 0.2% Tween80 to remove any fermenter-made EGF. This wash process was repeated two additional times then live cell measurements taken on the cellometer. De novo EGF secretion was measured by inoculating 1 x 10^8 cells/ml in triplicate into assay buffer for up to 4 hours. EGF secretion was determined at Oh, 2h, and 4h post-inoculation, and EGF levels were measured using a commercially available EGF AlphaLISA kit. Results are shown in FIG. 27. Three biomasses prepared on different days produced an average of 14.39 ± 1.89 ng of EGF per 1 x 10^8 cells/ml. Consistent de novo EGF production was observed between batches produced on different days.
Example 19. Optimization of in vivo EGF production
[0779] EGF production by mice dosed with EnN-hEGF was assessed in normal light cycle and reverse light cycle.
[0780] Animals were allowed to acclimate to the animal housing facility for at least 3 days (Normal light cycle (NLC) room) or 12 days (reverse light cycle (RLC) room) prior to manipulation for study- related purposes. NLC signifies ‘normal’ light-dark cycle. By definition, the time of light onset is zeitgeber time 0 ([ZT 0], 07:00), while time of lights off is ZT 12 (19:00). RLC signifies ‘reverse’ light-dark cycle. By definition, the time of light onset is ZT 0 (19:00), while time of lights off is ZT 12 (07:00).
[0781] Mice were orally administered a single dose of 1e9 CFU of EcN-EGF(SYN8510) biomass and were immediately single housed in metabolic cages for 8 hours. At every hour post-dose, feces was collected and snap frozen for hEGF measurement. Results in FIGs. 28A and 28B show that EGF excretion is higher in EcN-hEGF dosed mice housed in reverse light cycle (RLC) rooms than those in
normal light cycle (NLC) rooms. Mice are nocturnal mammals that show relatively short periods of activity during the light phase, and as a result the mice do not eat during the day. Mice housed in RLC rooms were dosed when the mice were awake and taking in food during the “dark” phase, while the mice housed in NLC rooms were dosed during the “light” phase when mice were sleeping and no or little food was ingested. Samples collected from the cages on the reverse light cycle were collected within an 8-hour period during the active period of the mice, at a time at which mice had begun to consume their food. Accordingly, the results obtained indicate that the ability of EcN to produce and secrete EGF is improved when food with nutrients are present in the gut environment, which may improve metabolic activity. In contrast, when dosing was performed at a time when the mice were resting or asleep, nutrients were limited in the gut and likely limiting metabolic activity in EcN, resulting in production and secretion of low amounts of EGF. Thus, the best strain activity was observed when the strain is administered in the presence of or in combination with food.
Example 20. Optimization of EGF production in mice dosed with a single dose of EcN-EGF [0782] Mice acclimated in the reverse light cycle room or kept at normal light cycle were orally administered a single dose of le9 CFU or 3.5e9 CFU of SYN8510 biomass and were immediately single housed in metabolic cages for 8 hours. At every hour post-dose, feces was collected and snap frozen for hEGF measurement. Cumulative hEGF detected in feces is plotted. Each line is the average of 4-5 mice per experiment on a single day. Results are depicted in FIGs. 29A and 29B and show that increasing the dose of cells increases the amount of EGF excreted over 8 hours in the reverse light cycle.
Example 21. Optimization of 2-time dosing regimen
[0783] Next administration of more than one dose was optimized. Mice acclimated in the reverse light cycle room were orally administered a single dose of 5e9 CFU of SYN8510 biomass at T0 and T5. Mice were single housed in metabolic cages for 8 hours. At every hour post-dose feces was collected and snap frozen for hEGF measurement and cumulative hEGF and colon content EGF levels were plotted.
[0784] In previous studies not shown, we observed no more EGF production after 5 hours. Therefore, a study was conducted in which a second dose was administered at the 5 hour time point. Results of this study shown in FIGs. 30A and 30B confirm that T0/T5 dosing is the regimen that maximizes EGF exposure over the longest time (during feeding time).
Example 22. Assessment of EcN-EGF effects on epithelial cell proliferation in a mouse model of colitis
[0785] Next, the effects of administration of EcN-EGF (SYN8510) on epithelial cell proliferation were assessed in a mouse model of colitis. Female C57BL/6J mice acclimated in the reverse light
cycle room were group housed and assigned to groups (10 mice per group). Mice were placed on normal diet, 4.5% DSS (day 0 to 5) in their drinking water and received treatment starting on day 0. All groups except naive group received daily PO BID treatment until end of study. EcN groups were either administered le9/dose at T0/T3, or 5e9/dose at T0/T5. Ki67 positive expression was determined by importing slide images to Qupath vO.3.2. Next, 10-30 individual crypt regions of interest (RO’s )were drawn in each individual image and the average of KI67 positive cells was calculated per mouse. Results depicted in FIG. 31 show overall increased proliferation over vehicle, and that the 5e9/dose BID (T0/T5) has increased epithelial cell proliferation (ki67) compared to le9/dose BID (T0/T3).
Example 23. Confirmation of containment of EFG-EcN to the colon
[0786] Absence of bacterial CFUs from various tissues despite compromised barrier in the DSS model was confirmed. Mice, who had received DSS water for 5 days received an oral bolus of SYN8510 at 1X10^9 CFU, according to the study protocol shown in FIG. 32A. Mice were weighed and samples of colon contents, mesenteric lymph node, liver, spleen and blood were collected on day 1, 2, 4 , 6 and 11 post removal of DSS from the drinking water, and CFUs counted. Results are shown in FIG. 32. For each time point, data represent the average CFU per gram of sample determined from 5 mice samples ± standard error of the mean. Results shown in FIGs. 32B-G demonstrate that despite damaged barrier integrity in the model, bacteria are not present in any of the compartments outside of the colon.
Example 24. Assessment of levels of EGF present in serum
[0787] The potential of secreted EGF to cross the epithelial cell barrier in the gut was assessed.
Female C57BL/6J mice acclimated in the normal light cycle room were group housed and assigned to groups. Mice were placed on normal diet, 4.5% DSS (day 0 to 5) in their drinking water and received treatment starting on day 0. All groups except the naive group received daily PO BID (T0/T3) treatment until end of study. EcN groups received le9 CFU/dose. SYN8248 EcN chassis alone is designated as EcN on the graph. SYN8510 EcN-EGF induced (5% dissolved oxygen at OD2 in fermenter) biomass is designated as EcN-EGF on the graph. EcN biomass was thawed and pre- adapted at 37C for 2hrs with 1% arabinose prior to dosing. Mice were sacrificed on day 6 and day 9. Serum was collected for EGF measurement. Results are shown in FIGs. 32A and 32B and demonstrate that EGF is not observed in the serum of mice when treated with EcN-EGF.
[0788] Additionally, the presence of any changes in other hematological markers was assessed. Female C57BL/6J mice acclimated in the reverse light cycle room were group housed and assigned to groups. Mice received daily BID (T0/T5) treatment starting on day 0 to day 12. Vehicle group received p.o. BID (n=3). A rhEGF control group received 1 mg/kg rhEGF s.c. BID (n=3). EcN group received 5e9 CFU SYN8248 (EcN chassis) p.o. BID (n=6). EcN-EGF group received 5e9 CFU
SYN8510 (10% dissolved oxygen induced EcN-EGF) p.o. BID (n=6). On day 13, mice were sacrificed. Organ weights (brain, spleen, liver, kidneys) were measured. No significant changes of organ weights were observed with EcN treatment when compared to vehicle group. Serum was collected for clinical chemistry and hematology analysis, and no significant changes were observed with EcN treatment when compared to vehicle group (data not shown).
Example 25. Effects of EGF on proliferation and mucosal healing in a mouse model of colitis [0789] The effects of administration of EcN-EGF (SYN8510) on epithelial cell proliferation and mucosal healing were assessed in a mouse model of colitis. Recapitulation of human IBD disease was best observed mid-distal and distal sections of the mouse colon, which were analyzed in this study. [0790] Female C57BL/6J mice acclimated in the reverse light cycle room were group housed and assigned to groups (10 mice per group). Mice were placed on normal diet, 4.5% DSS (day 0 to 5) in their drinking water and received treatment starting on day 0. All groups except naive group received daily PO BID treatment until end of study. EcN groups were given 5e9/dose at T0/T5.
[0791] To assess level of proliferation, Ki67 positive expression was determined by importing slide images to Qupath vO.3.2. Next, 10-30 individual crypt regions of interest (ROIs) were drawn in each individual image and the average of KI67 positive cells was calculated per mouse. Results depicted in FIGs. 34A and 34B show increased proliferation over vehicle in mid-distal colon (FIG. 34A) and distal colon (FIG. 34B), and that two separately fermented EcN-EGF biomasses both show proliferation.
[0792] To assess mucosal healing a histology score was used (summarized in Table 35). The histopathology score is made up of inflammatory score (0-3), tissue damage score (0-4), and ulceration score (0-3). Histopathology was blindly scored on hematoxylin and eosin (H&E) images. Averaged total histopathology score calculated from distal colon section ~0.5cm from rectum, and mid-distal colon section ~ 1.5cm from rectum.
[0793] Results depicted in FIGs. 34C and 34D show the overall histoscore, showing that the disease score is decreased. FIGs. 36A-C, FIGs. 37A-C, and FIG. 38A-C show the results from Study 2, broken out by region (mid-distal, distal, and average) and by the components of the total score (tissue damage, (FIGs. 36A-C), ulceration (FIGs. 37A-C) and immune cell infiltration (FIGs. 38A-C) for Study 2. Complete scoring data for Study 1 and 2 are shown in Tables 36 and 37. Scoring data for the third study, Study 3, is shown in Table 38. The overall histoscore for Study 3 is depicted in FIG. 34E, again showing that the disease score is decreased. FIGs. 39A-C, FIGs. 40A-C, and FIG. 41A-C show the Study 3 results, broken out by region (mid-distal, distal, and average) and by the components of the total score (tissue damage, (FIGs. 39A-C), ulceration (FIGs. 40A-C) and immune cell infiltration (FIGs. 41A-C).
Example 26. Effects of EGF on gut barrier permeability in a mouse model of colitis
[0794] The effects of administration of EcN -EGF (SYN8510) on intestinal permeability in a mouse model of colitis. Mice were orally dosed with 2 mg/kg IRDye 800CW (~lkDa in size) intestinal permeability dye approximately 17 hours prior to sacrifice. Serum was collected and IRDye was measured; 800CW fluorescence (excitation/emission 774/789 nm) was measured using a Li-Cor Odyssey CLx. Fluorescence was converted to serum concentration using a standard curve and relative changes in blood concentration were compared to validate 800CW permeability measurements.
[0795] Results are shown in FIGs. 35A-35C and Table 39.
Claims
1. A method of treating a disease or disorder in a human subject, the method comprising administering to the human subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein mucosal healing is induced in the gut of the human subject after administration of the pharmaceutical composition, thereby treating the disease or disorder in the human subject.
2. The method of claim 1, wherein mucosal healing comprises improvement or alleviation of one or more symptoms of the disease or disorder after the administration of the pharmaceutical composition as compared to the one or more symptoms prior to the administration of the pharmaceutical composition, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration and/or ulcerative lesions.
3. A method of inducing mucosal healing in the gut of a human subject in need thereof, the method comprising administering to the human subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, thereby inducing mucosal healing.
4. The method of claim 3, wherein mucosal healing comprises improvement or alleviation of one or more symptoms exhibited by the subject after administration of the pharmaceutical composition as compared to the one or more symptoms exhibited by the subject prior to the administration of the pharmaceutical composition, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
5. A method of treating a disease or disorder in a human subject, the method comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter,
wherein mucosal cell proliferation is induced in the gut mucosa of the subject after administration of the pharmaceutical composition, thereby treating the disease or disorder in the human subject.
6. The method of any one of claims 1-5, wherein an expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in the gut mucosa of the subject after administration of the pharmaceutical composition as compared to before administration of the pharmaceutical composition.
7. A method of treating a disease or disorder in a human subject, the method comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, wherein an expression level of one or more of the markers, Ki67, PCNA, and/or Edu, are increased in the gut mucosa of the subject after administration of the pharmaceutical composition as compared to before administration of the pharmaceutical composition, thereby treating the disease or disorder in the human subject.
8. The method of claim 6 or 7, wherein the one or more markers is Ki67.
9. The method of claim 8, wherein the expression level of Ki67 is increased by at least 1.2 fold, at least 1.4 fold, at least 1.6 fold, at least 1.8 fold, at least 2.0 fold, at least 2.2 fold, at least 2.4 fold, at least 2.6 fold, at least 2.8 fold, at least 3.0 fold, or at least 3.2 fold in the gut of the subject as compared an expression level of expression of Ki67 in the gut of the subject prior receiving the pharmaceutical composition.
10. The method of any one of claims 6-9, wherein the one or more markers is PCNA.
11. The method of claim 10, wherein the expression level of PCNA is increased at least 1.2 fold, at least 1.4 fold, at least 1.6 fold, at least 1.8 fold, at least 2.0 fold, at least 2.2 fold, at least 2.4 fold, at least 2.6 fold, at least 2.8 fold, at least 3.0 fold, or at least 3.2 fold as compared to an expression level of PCNA in the gut of the subject prior receiving the pharmaceutical composition.
12. The method of any one of claims 6-11, wherein the one or more markers is Edu.
13. The method of claim 12, wherein the expression level of Edu is increased by at least 1.2 fold, at least 1.4 fold, at least 1.6 fold, at least 1.8 fold, at least 2.0 fold, at least 2.2 fold, at least 2.4 fold, at least 2.6 fold, at least 2.8 fold, at least 3.0 fold, or at least 3.2 fold as compared to an expression level of Edu in the gut of the subject prior receiving the pharmaceutical composition.
14. The method of any one of claims 1-13, wherein the pharmaceutical composition is administered to the subject two times a day or three times a day.
15. The method of any one of the previous claims, further comprising administering a carbon source to the subject.
16. The method of claim 15, wherein the carbon source is lactulose.
17. A method of treating a disease or disorder in a human subject, the method comprising administering to the subject a pharmaceutical composition comprising a pharmaceutically acceptable carrier and a recombinant bacterium, wherein the recombinant bacterium comprises a polynucleotide sequence encoding an epidermal growth factor (EGF) polypeptide linked to a secretion tag, wherein the polynucleotide sequence is operably linked to an inducible promoter, and administering a carbon source to the subject, thereby treating the disease or disorder in the human subject.
18. The method of claim 17, wherein the carbon source is lactulose.
19. The method of any one of claims 15-18, wherein the carbon source is administered at the same time as the pharmaceutical composition, in the same pharmaceutical composition, or at a different time as the pharmaceutical composition.
20. The method of any one of claims 15-19, wherein secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject is increased after administration of the carbon source as compared to a level of secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject prior to administration of the carbon source.
21. The method of claim 20, wherein secretion of the EGF polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject is increased at least 10-fold or at least 100- fold after administration of the carbon source as compared to the level of secretion of the EGF
polypeptide linked to the secretion tag from the recombinant bacterium into the gut of the subject prior to administration of the carbon source.
22. The method of any one of the previous claims, wherein the pharmaceutical composition is administered to the subject with food.
23. The method of any one of the previous claims, wherein the pharmaceutical composition is administered to the subject once per day or twice per day.
24. The method of any one of claims 1-23, wherein mucosal healing is induced in the gut of the subject after administration of the pharmaceutical composition.
25. The method of any one of the previous claims, wherein the pharmaceutical composition is administered orally.
26. The method of any one of claims 15-25, wherein the carbon source is administered orally.
27. The method of ant one of claims 24-26, wherein mucosal healing comprises improvement or alleviation of one or more symptoms exhibited by the subject after administration as compared to the one or more symptoms exhibited by the subject prior to administration, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
28. The method of any one of claims 1-27, wherein intestinal permeability is decreased in the gut of the subject after administration of the pharmaceutical composition as compared to the intestinal permeability in the gut of the subject prior to administration of the pharmaceutical composition.
29. The method of claim 28, wherein the intestinal permeability is decreased at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the intestinal permeability in the gut of the subject prior to administration of the pharmaceutical composition.
30. The method of claim 1-29, wherein inflammation is decreased in the gut of the subject after administration of the pharmaceutical composition as compared to the inflammation in the gut of the subject prior to administration of the pharmaceutical composition.
31. The method of claim 30, wherein inflammation is decreased by at least 10%, at least 20%, at least 30%, at least 40%, at least 50%, at least 60%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the inflammation in the gut of the subject prior to administration of the pharmaceutical composition.
32. The method of any one of claims 30 or 31, wherein inflammation is measured by determining the level immune cell infiltration in the mucosa of the upper GI tract, lower GI tract, the colon and/or rectum of the subject.
33. The method of any one of claims 1-32, wherein tissue damage is decreased in the gut of the subject after administration of the pharmaceutical composition as compared to the tissue damage in the gut of the subject prior to administration of the pharmaceutical composition.
34. The method of claim 33, wherein tissue damage in the gut of the subject is decreased at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the tissue damage in the gut of the subject prior to administration of the pharmaceutical composition.
35. The method of any one of claims 1-34, wherein mucosal ulceration and/or ulcerative lesions are decreased in the gut of the subject after administration of the pharmaceutical composition as compared to mucosal ulceration and/or ulcerative lesions in the gut of the subject prior to administration of the pharmaceutical composition.
36. The method of claim 35, wherein mucosal ulceration and/or ulcerative lesions is determined by endoscopy or biopsy from the upper GI tract, lower GI tract, the colon and/or rectum.
37. The method 35 or 36, wherein the mucosal ulceration and/or ulcerative lesions is decreased at least 1%, at least 5%, at least 10%, at least 20%, at least 30%, at least 35%, at least 40%, at least 45%, at least 50%, at least 55%, at least 60%, at least 65%, at least 70%, at least 75%, at least 80%, at least 85%, at least 90%, at least 95%, or at least 100% in the gut of the subject after administration of the pharmaceutical composition as compared to the mucosal ulceration and/or ulcerative lesions in the gut of the subject prior to administration of the pharmaceutical composition.
38. The method of any one of the previous claims, wherein the EGF polypeptide has at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 505, or a fragment thereof.
39. The method of claim 38, wherein the EGF polypeptide comprises SEQ ID NO: 505, or a fragment thereof.
40. The method of any one of the previous claims, wherein the secretion tag is PhoA, PelB, OmpA, LARD3, or HylA.
41. The method of any one of the previous claims, wherein the secretion tag has a sequence comprising: a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 136; or b. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 161; or c. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 168; or d. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 361; or e. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 362.
42. The method of claim 41, wherein the secretion tag has a sequence comprising: a. SEQ ID NO: 136; b. SEQ ID NO: 161; c. SEQ ID NO: 168; d. SEQ ID NO: 361; or e. SEQ ID NO: 362.
43. The method of any one of the previous claims, wherein the inducible promoter is a low oxygen-inducible promoter, a temperature-sensitive promoter, or an isopropyl beta-D-1- thiogalactopyranoside (IPTG) inducible promoter.
44. The method of claim 43, wherein the inducible promoter is a low oxygen-inducible promoter, and wherein the low oxygen-inducible promoter has a sequence comprising a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of SEQ ID NOs: 1-11, 336, and 337; or b. any one of SEQ ID NOs: 1-11, 336, and 337.
45. The method of claim 44, wherein the inducible promoter is a temperature- sensitive promoter, and wherein the temperature- sensitive promoter is a pR promoter further comprising a CI857 repressor (CI857 repressor-pR promoter).
46. The method of claim 45, wherein the CI857 repressor-pR promoter has a sequence comprising a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of SEQ ID NOs: 19-21; or b. any one of SEQ ID NOs: 19-21.
47. The method of any one of the previous claims, wherein the polynucleotide sequence encoding the epidermal growth factor (EGF) polypeptide linked to the secretion tag has a sequence comprising a. at least 80%, 85%, 90%, 95%, 96%, 97%, 98%, or 99% identity to any one of sequences SEQ ID NO: 500, SEQ ID NO: 502, SEQ ID NO: 501, SEQ ID NO: 503, SEQ ID NO: 504, SEQ ID NO: 506, SEQ ID NO: 508, SEQ ID NO: 507, SEQ ID NO: 509, SEQ ID NO: 510, SEQ ID NO: 519, SEQ ID NO: 520, SEQ ID NO: 521, SEQ ID NO: 522, SEQ ID NO: 523, SEQ ID NO: 524, SEQ ID NO: 525, or SEQ ID NO: 526; or b. any one of sequences SEQ ID NO: 500, SEQ ID NO: 502, SEQ ID NO: 501, SEQ ID NO: 503, SEQ ID NO: 504, SEQ ID NO: 506, SEQ ID NO: 508, SEQ ID NO: 507, SEQ ID NO: 509, SEQ ID NO: 510, SEQ ID NO: 519, SEQ ID NO: 520, SEQ ID NO: 521, SEQ ID NO: 522, SEQ ID NO: 523, SEQ ID NO: 524, SEQ ID NO: 525, or SEQ ID NO: 526.
48. The method of any one of the previous claims, wherein the recombinant bacterium further comprises a polynucleotide sequence encoding a peptide bond, a polypeptide linker, and/or a stabilizing polypeptide.
49. The method of claim 48, wherein the secretion tag is linked to the N terminus of the EGF polypeptide by a peptide bond or a polypeptide linker, or wherein the secretion tag is linked to the C terminus of the EGF polypeptide by a peptide bond or a polypeptide linker.
50. The method of any one of the previous claims, wherein the secretion tag is cleaved from the EGF polypeptide after secretion from the recombinant bacterium.
51. The method of any one of the previous claims, wherein the bacterium is selected from the group consisting of Bacteroides, Bifidobacterium, Clostridium, Escherichia, Lactobacillus, and Lactococcus.
52. The method of claim 51, wherein the bacterium is selected from the group consisting of Clostridium novyi NT, Clostridium butyricum, and Bifidobacterium longum.
53. The method of claim 52, wherein the bacterium is Escherichia coli strain Nissle.
54. The method of any one of the previous claims, wherein the bacterium further comprises a mutated gene encoding a periplasmic protein pal.
55. The method of any one of the previous claims, wherein the bacterium further expresses a Type 1 secretion system capable of secreting the EGF polypeptide linked to the secretion tag.
56. The method of any one of the previous claims, wherein the recombinant bacterium further comprises a deletion in a pks island.
57. The method of any one of the previous claims, wherein the disease or disorder is selected from a group consisting of autoimmune disorders, metabolic diseases, diseases relating to inborn errors of metabolism, and neurological or neurodegenerative diseases.
58. The method of any one of the previous claims, wherein the disease or disorder is a disease disorder, or condition associated with gut inflammation and/or compromised gut barrier function.
59. The method of claim 58, wherein the disease or disorder is an inflammatory bowel disease, diarrheal diseases, or a related disease.
60. The method of claim 59, wherein the inflammatory bowel disease is Crohn’s disease, ulcerative colitis, collagenous colitis, lymphocytic colitis, diversion colitis, Bechet’ s disease, indeterminate colitis, short bowel syndrome, or radiation induced GI toxicity.
61. The method of claim 57, wherein the autoimmune disorder is selected from the group consisting of acute disseminated encephalomyelitis (ADEM), acute necrotizing hemorrhagic leukoencephalitis, Addison’ s disease, agammaglobulinemia, alopecia areata, amyloidosis, ankylosing spondylitis, anti-GBM/anti-TBM nephritis, antiphospholipid syndrome (APS), autoimmune angioedema, autoimmune aplastic anemia, autoimmune dysautonomia, autoimmune hemolytic anemia, autoimmune hepatitis, autoimmune hyperlipidemia, autoimmune immunodeficiency, autoimmune inner ear disease (AIED), autoimmune myocarditis, autoimmune oophoritis, autoimmune pancreatitis, autoimmune retinopathy, autoimmune thrombocytopenic purpura (ATP), autoimmune thyroid disease, autoimmune urticarial, Axonal & neuronal neuropathies, Balo disease, Behcet’s disease, Bullous pemphigoid, Cardiomyopathy, Castleman disease, Celiac disease, Chagas disease, Chronic inflammatory demyelinating polyneuropathy (CIDP), Chronic recurrent multifocal
ostomyelitis (CRMO), Churg-Strauss syndrome, Cicatricial pemphigoid/benign mucosal pemphigoid, Crohn’s disease, Cogan syndrome, Cold agglutinin disease, Congenital heart block, Coxsackie myocarditis, CREST disease, Essential mixed cryoglobulinemia, Demyelinating neuropathies, Dermatitis herpetiformis, Dermatomyositis, Devic’s disease (neuromyelitis optica), Discoid lupus, Dressier’s syndrome, Endometriosis, Eosinophilic esophagitis, Eosinophilic fasciitis, Erythema nodosum, Experimental allergic encephalomyelitis, Evans syndrome, Fibrosing alveolitis, Giant cell arteritis (temporal arteritis), Giant cell myocarditis, Glomerulonephritis, Goodpasture’s syndrome, Granulomatosis with Polyangiitis (GPA), Graves’ disease, Guillain-Barre syndrome, Hashimoto’s encephalitis, Hashimoto’s thyroiditis, Hemolytic anemia, Henoch-Schonlein purpura, Herpes gestationis, Hypogammaglobulinemia, Idiopathic thrombocytopenic purpura (ITP), IgA nephropathy, IgG4-related sclerosing disease, Immunoregulatory lipoproteins, Inclusion body myositis, Interstitial cystitis, Juvenile arthritis, Juvenile idiopathic arthritis, Juvenile myositis, Kawasaki syndrome, Lambert-Eaton syndrome, Leukocytoclastic vasculitis, Lichen planus, Lichen sclerosus, Ligneous conjunctivitis, Linear IgA disease (LAD), Lupus (Systemic Lupus Erythematosus), chronic Lyme disease, Meniere’s disease, Microscopic polyangiitis, Mixed connective tissue disease (MCTD), Mooren’s ulcer, Mucha-Habermann disease, Multiple sclerosis, Myasthenia gravis, Myositis, Narcolepsy, Neuromyelitis optica (Devic’ s), Neutropenia, Ocular cicatricial pemphigoid, Optic neuritis, Palindromic rheumatism, PANDAS (Pediatric autoimmune Neuropsychiatric Disorders Associated with Streptococcus), Paraneoplastic cerebellar degeneration, Paroxysmal nocturnal hemoglobinuria (PNH), Parry Romberg syndrome, Parsonnage-Turner syndrome, Pars planitis (peripheral uveitis), Pemphigus, Peripheral neuropathy, Perivenous encephalomyelitis, Pernicious anemia, POEMS syndrome, Polyarteritis nodosa, Type I, II, & III autoimmune polyglandular syndromes, Polymyalgia rheumatic, Polymyositis, Postmyocardial infarction syndrome, Postpericardiotomy syndrome, Progesterone dermatitis, Primary biliary cirrhosis, Primary sclerosing cholangitis, Psoriasis, Psoriatic arthritis, Idiopathic pulmonary fibrosis, Pyoderma gangrenosum, Pure red cell aplasia, Raynauds phenomenon, reactive arthritis, reflex sympathetic dystrophy, Reiter’s syndrome, relapsing polychondritis, restless legs syndrome, retroperitoneal fibrosis, rheumatic fever, rheumatoid arthritis, sarcoidosis, Schmidt syndrome, scleritis, scleroderma, Sjogren’s syndrome, sperm & testicular autoimmunity, stiff person syndrome, subacute bacterial endocarditis (SBE), Susac’s syndrome, sympathetic ophthalmia, Takayasu’s arteritis, temporal arteritis/giant cell arteritis, thrombocytopenic purpura (TTP), Tolosa-Hunt syndrome, transverse myelitis, type 1 diabetes, asthma, ulcerative colitis, undifferentiated connective tissue disease (UCTD), uveitis, vasculitis, vesiculobullous dermatosis, vitiligo, and Wegener’ s granulomatosis.
62. The method of claim 57, wherein the metabolic disorder or condition is selected from the group consisting of: type 1 diabetes; type 2 diabetes; metabolic syndrome; Bardet-Biedel syndrome; Prader-Willi syndrome; non-alcoholic fatty liver disease; tuberous sclerosis; Albright hereditary
osteodystrophy; brain-derived neurotrophic factor (BDNF) deficiency; Single-minded 1 (SIM1) deficiency; leptin deficiency; leptin receptor deficiency; pro-opiomelanocortin (POMC) defects; proprotein convertase subtilisin/kexin type 1 (PCSK1) deficiency; Src homology 2B1 (SH2B1) deficiency; pro-hormone convertase 1/3 deficiency; melanocortin-4-receptor (MC4R) deficiency; aniridia, genitourinary anomalies, and mental retardation (WAGR) syndrome; pseudohypoparathyroidism type 1A; Fragile X syndrome; Borjeson-Forsmann-Lehmann syndrome; Alstrom syndrome; Cohen syndrome; and ulnar-mammary syndrome.
63. The method of any one of the previous claims, further comprising selecting a human subject who would benefit from an improvement or alleviation of one or more symptoms, wherein the one or more symptoms are selected from the group consisting of: (1) intestinal permeability, (2) inflammation, (3) tissue damage, and (4) mucosal ulceration or ulcerative lesions.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202263415338P | 2022-10-12 | 2022-10-12 | |
US63/415,338 | 2022-10-12 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2024081768A1 true WO2024081768A1 (en) | 2024-04-18 |
Family
ID=88778726
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2023/076665 WO2024081768A1 (en) | 2022-10-12 | 2023-10-12 | Bacteria engineered to produce active epidermal growth factor (egf) and their medical uses |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2024081768A1 (en) |
Citations (13)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA1332813C (en) * | 1988-08-31 | 1994-11-01 | W.K. Raymond Wong | Excretion of heterologous protein from e. coli |
US5589168A (en) | 1991-04-08 | 1996-12-31 | Unilever Patent Holdings B.V. | Probiotic |
US5989463A (en) | 1997-09-24 | 1999-11-23 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release devices |
US6203797B1 (en) | 1998-01-06 | 2001-03-20 | Stephen C. Perry | Dietary supplement and method for use as a probiotic, for alleviating the symptons associated with irritable bowel syndrome |
US6835376B1 (en) | 1999-03-11 | 2004-12-28 | Nestec S.A. | Lactobacillus paracasei strain for preventing diarrhea caused by pathogenic bacteria |
US7731976B2 (en) | 2003-08-29 | 2010-06-08 | Cobb And Company, Llp | Treatment of irritable bowel syndrome using probiotic composition |
WO2013009103A2 (en) | 2011-07-11 | 2013-01-17 | 부산대학교 산학협력단 | Recombinant microorganism which secretes egf via an abc transporter, and composition for alleviating or treating peptic ulcers comprising same as an active ingredient |
US20140079701A1 (en) | 2010-12-23 | 2014-03-20 | Biogen Idec Ma Inc. | Linker peptides and polypeptides comprising same |
WO2014138324A1 (en) | 2013-03-07 | 2014-09-12 | The General Hospital Corporation | Compositions and methods for bacterial delivery of polypeptides |
US20150238545A1 (en) | 2000-07-25 | 2015-08-27 | Thomas Julius Borody | Probiotic recolonisation therapy |
US20150359894A1 (en) | 2006-09-27 | 2015-12-17 | Little Calumet Holdings, Llc | Probiotic oral dosage forms |
WO2016141108A1 (en) | 2015-03-02 | 2016-09-09 | Synlogic, Inc. | Bacteria engineered to treat diseases that benefit from reduced gut inflammation and/or tightened gut mucosal barrier |
US20200299702A1 (en) | 2017-09-07 | 2020-09-24 | Korea Advanced Institute Of Science And Technology | Extracellular secretion of target protein |
-
2023
- 2023-10-12 WO PCT/US2023/076665 patent/WO2024081768A1/en unknown
Patent Citations (14)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
CA1332813C (en) * | 1988-08-31 | 1994-11-01 | W.K. Raymond Wong | Excretion of heterologous protein from e. coli |
US5589168A (en) | 1991-04-08 | 1996-12-31 | Unilever Patent Holdings B.V. | Probiotic |
US5989463A (en) | 1997-09-24 | 1999-11-23 | Alkermes Controlled Therapeutics, Inc. | Methods for fabricating polymer-based controlled release devices |
US6203797B1 (en) | 1998-01-06 | 2001-03-20 | Stephen C. Perry | Dietary supplement and method for use as a probiotic, for alleviating the symptons associated with irritable bowel syndrome |
US6835376B1 (en) | 1999-03-11 | 2004-12-28 | Nestec S.A. | Lactobacillus paracasei strain for preventing diarrhea caused by pathogenic bacteria |
US20150238545A1 (en) | 2000-07-25 | 2015-08-27 | Thomas Julius Borody | Probiotic recolonisation therapy |
US7731976B2 (en) | 2003-08-29 | 2010-06-08 | Cobb And Company, Llp | Treatment of irritable bowel syndrome using probiotic composition |
US20150359894A1 (en) | 2006-09-27 | 2015-12-17 | Little Calumet Holdings, Llc | Probiotic oral dosage forms |
US20140079701A1 (en) | 2010-12-23 | 2014-03-20 | Biogen Idec Ma Inc. | Linker peptides and polypeptides comprising same |
WO2013009103A2 (en) | 2011-07-11 | 2013-01-17 | 부산대학교 산학협력단 | Recombinant microorganism which secretes egf via an abc transporter, and composition for alleviating or treating peptic ulcers comprising same as an active ingredient |
WO2013009103A9 (en) * | 2011-07-11 | 2013-06-13 | 부산대학교 산학협력단 | Recombinant microorganism which secretes egf via an abc transporter, and composition for alleviating or treating peptic ulcers comprising same as an active ingredient |
WO2014138324A1 (en) | 2013-03-07 | 2014-09-12 | The General Hospital Corporation | Compositions and methods for bacterial delivery of polypeptides |
WO2016141108A1 (en) | 2015-03-02 | 2016-09-09 | Synlogic, Inc. | Bacteria engineered to treat diseases that benefit from reduced gut inflammation and/or tightened gut mucosal barrier |
US20200299702A1 (en) | 2017-09-07 | 2020-09-24 | Korea Advanced Institute Of Science And Technology | Extracellular secretion of target protein |
Non-Patent Citations (31)
Title |
---|
"NCBI", Database accession no. gq214314.1 |
"The Atlas of Protein Sequence and Structure", 1978, NATIONAL BIOMEDICAL RESEARCH FOUNDATION |
ALBENBERG ET AL., GASTROENTEROLOGY, vol. 147, no. 5, 2014, pages 1055 - 1063 |
ARGOS, EMBO J., vol. 8, 1989, pages 779 - 785 |
BERGOFSKY ET AL., J CLIN. INVEST., vol. 41, no. 11, 1962, pages 1971 - 1980 |
BODE ET AL., EXPERT REV VACCINES, vol. 10, no. 4, April 2011 (2011-04-01), pages 499 - 511 |
CHEN ET AL., ADV DRUG DELIV REV., vol. 65, no. 10, 2013, pages 1357 - 1369 |
CROMPTON ET AL., J EXP. BIOL., vol. 43, 1965, pages 473 - 478 |
DUAN ET AL.: "Secretion of Insulinotropic Proteins by Commensal Bacteria: Rewiring the Gut To Treat Diabetes", APPL. ENVIRON. MICROBIOL, vol. 74, no. 23, December 2008 (2008-12-01), pages 7437 - 7438, XP002632694, DOI: 10.1128/AEM.01019-08 |
DUBE ET AL.: "Epidermal growth factor receptor inhibits colitis-associated cancer in mice", J CLIN INVEST, 2012 |
GASTROENTEROL HEPATOL (N Y, vol. 8, no. 1, January 2012 (2012-01-01), pages 29 - 38 |
GERDES ET AL., CURR. OPIN. BIOTECHNOL., vol. 17, no. 5, pages 448 - 456 |
GOSSEN MBUJARD H, PNAS, vol. 89, no. 12, 15 June 1992 (1992-06-15), pages 5547 - 51 |
HE ET AL., PNAS (USA, vol. 96, 1999, pages 4586 - 4591 |
IVANOVSKA ET AL., PEDIATRICS, vol. 134, no. 2, 2014, pages 361 - 372 |
JERVIS AJ: "The O2 sensitivity of the transcription factor FNR is controlled by Ser24 modulating the kinetics of [4Fe-4S] to [2Fe-2S] conversion", PROC NATL ACAD SCI USA, vol. 106, no. 12, 24 March 2009 (2009-03-24), pages 4659 - 64 |
MAJANDER ET AL.: "Extracellular secretion of polypeptides using a modified Escherichia coli flagellar secretion apparatus", NAT BIOTECHNOL., vol. 23, no. 4, April 2005 (2005-04-01), pages 475 - 81, XP002426110, DOI: 10.1038/nbt1077 |
MCKEOWN, BR., J. RADIOL., vol. 87, 2014, pages 20130676 |
MERGULHAO ET AL., BIOTECHNOLOGY ADVANCES, vol. 23, 2005, pages 177 - 202 |
MILTON H. SAIER, JR.: "Protein Secretion Systems in Gram-Negative Bacteria Gram-negative bacteria possess many protein secretion-membrane insertion systems that apparently evolved independently", MICROBE, vol. 1, no. 9, 2006 |
NEMANI ET AL.: "Magnetic nanoparticle hyperthermia induced cytosine deaminase expression in microencapsulated E. coli for enzyme-prodrug therapy", J BIOTECHNOL, vol. 203, 10 June 2015 (2015-06-10), pages 32 - 40 |
SCHELLENBERGER V ET AL., NAT BIOTECHNOL., vol. 27, 2009, pages 1186 - 1190 |
SILHAVY, T. J.KAHNE, DWALKER, S: "The bacterial cell envelope", COLD SPRING HARB PERSPECT BIOL, vol. 2 |
SINHA ET AL.: "Epidermal Growth Factor Enemas with Oral Mesalamine for Mild-to-Moderate Left-Sided Ulcerative Colitis or Proctitis", N ENGL J MED, 2003 |
STROHL, BIODRUGS, vol. 29, no. 4, 2015, pages 215 - 239 |
VILLANACCI ET AL.: "Inflammatory Bowel Diseases: Does One Histological Score Fit All?", DIAGNOSTICS, vol. 13, 2023, pages 2112 |
WRIGHT ET AL., ACS SYNTHETIC BIOLOGY, vol. 4, 2015, pages 307 - 16 |
YU ET AL.: "Nononcogenic restoration of the intestinal barrier by E. coli-delivered human EGF", JCI INSIGHT, 2019 |
YU MIRA ET AL: "Nononcogenic restoration of the intestinal barrier by E. coli-delivered human EGF", JCI INSIGHT, vol. 4, no. 16, 22 August 2019 (2019-08-22), XP055943686, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC6777819/pdf/jciinsight-4-125166.pdf> DOI: 10.1172/jci.insight.125166 * |
ZHANG ET AL.: "Development and Application of an Arabinose-Inducible Expression System by Facilitating Inducer Uptake in Corynebacterium glutamicum", APPL. ENVIRON. MICROBIOL, vol. 78, no. 16, August 2012 (2012-08-01), pages 5831 - 5838, XP055312833, DOI: 10.1128/AEM.01147-12 |
ZHANG, NUCL. ACIDS RES., vol. 37, 2009 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
AU2018290278B2 (en) | Bacteria for the treatment of disorders | |
AU2016262569B2 (en) | Bacteria engineered to reduce hyperphenylalaninemia | |
US20220233609A1 (en) | Bacteria engineered to treat disorders in which oxalate is detrimental | |
ES2925049T3 (en) | Engineered bacteria to reduce hyperphenylalaninemia | |
EP4103690A1 (en) | Recombinant bacteria engineered to treat diseases associated with methionine metabolism and methods of use thereof | |
US20230332164A1 (en) | Bacteria engineered to secrete active proteins | |
US20240197843A1 (en) | Bacteria engineered to treat disorders in which oxalate is detrimental | |
US11859189B2 (en) | Recombinant bacteria engineered to treat diseases associated with methionine metabolism and methods of use thereof | |
US20230174926A1 (en) | Bacteria engineered to treat disorders involving the catabolism of leucine | |
US20230092431A1 (en) | Bacteria engineered to treat disorders in which oxalate is detrimental | |
WO2024081768A1 (en) | Bacteria engineered to produce active epidermal growth factor (egf) and their medical uses | |
US20240191176A1 (en) | Bacteria engineered to secrete active proteins | |
WO2023245171A1 (en) | Bacteria engineered to treat diseases associated with bile acid metabolism and methods of use thereof | |
WO2023245168A1 (en) | Bacteria engineered to treat diseases associated with bile acid metabolism and methods of use thereof | |
WO2024129974A1 (en) | Recombinant bacteria for use in the treatment of disorders in which oxalate is detrimental | |
WO2023250478A1 (en) | Recombinant bacteria engineered to treat diseases associated with methionine metabolism and methods of use thereof | |
CN117083068A (en) | Bacteria engineered to treat conditions in which oxalate is detrimental |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23805359 Country of ref document: EP Kind code of ref document: A1 |