WO2024053788A1 - ANTIBODY THAT SPECIFICALLY BINDS TO SIRPα VARIANT - Google Patents

ANTIBODY THAT SPECIFICALLY BINDS TO SIRPα VARIANT Download PDF

Info

Publication number
WO2024053788A1
WO2024053788A1 PCT/KR2022/018507 KR2022018507W WO2024053788A1 WO 2024053788 A1 WO2024053788 A1 WO 2024053788A1 KR 2022018507 W KR2022018507 W KR 2022018507W WO 2024053788 A1 WO2024053788 A1 WO 2024053788A1
Authority
WO
WIPO (PCT)
Prior art keywords
antibody
seq
amino acid
antigen
acid sequence
Prior art date
Application number
PCT/KR2022/018507
Other languages
French (fr)
Korean (ko)
Inventor
김윤경
이인규
Original Assignee
주식회사 시프트바이오
Priority date (The priority date is an assumption and is not a legal conclusion. Google has not performed a legal analysis and makes no representation as to the accuracy of the date listed.)
Filing date
Publication date
Application filed by 주식회사 시프트바이오 filed Critical 주식회사 시프트바이오
Publication of WO2024053788A1 publication Critical patent/WO2024053788A1/en

Links

Images

Classifications

    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • C07K16/2896Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants against molecules with a "CD"-designation, not provided for elsewhere
    • CCHEMISTRY; METALLURGY
    • C07ORGANIC CHEMISTRY
    • C07KPEPTIDES
    • C07K16/00Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies
    • C07K16/18Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans
    • C07K16/28Immunoglobulins [IGs], e.g. monoclonal or polyclonal antibodies against material from animals or humans against receptors, cell surface antigens or cell surface determinants
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • GPHYSICS
    • G01MEASURING; TESTING
    • G01NINVESTIGATING OR ANALYSING MATERIALS BY DETERMINING THEIR CHEMICAL OR PHYSICAL PROPERTIES
    • G01N33/00Investigating or analysing materials by specific methods not covered by groups G01N1/00 - G01N31/00
    • G01N33/48Biological material, e.g. blood, urine; Haemocytometers
    • G01N33/50Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing
    • G01N33/68Chemical analysis of biological material, e.g. blood, urine; Testing involving biospecific ligand binding methods; Immunological testing involving proteins, peptides or amino acids
    • G01N33/6854Immunoglobulins

Definitions

  • the present invention relates to an antibody that specifically binds to a SIRP ⁇ variant, and more specifically to an antibody or antigen-binding fragment thereof that specifically binds to a SIRP ⁇ variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2, and a sample using the same. This is about my SIRP ⁇ variant detection method.
  • SIRP ⁇ Signal-regulatory protein alpha
  • ITIM immunoreceptor tyrosine-based inhibition motifs
  • CD47 on red blood cells binds to SIRP ⁇ on macrophages and transmits a “Don’t eat me” signal, thereby avoiding unnecessary phagocytosis of red blood cells.
  • CD47 which is highly expressed on tumor cells, binds to SIRP ⁇ on macrophages and dendritic cells, thereby suppressing the phagocytic ability for tumor cells. Suppression of phagocytosis is expected to lead to subsequent suppression of tumor antigen presentation to T cells and further suppression of tumor immune response.
  • SIRP ⁇ variant-specific antibodies as a means to accurately confirm and quantify the presence of SIRP ⁇ variants during the process of expressing, purifying, and studying SIRP ⁇ variants.
  • the present inventors conducted repeated studies to develop antibodies that specifically bind to SIRP ⁇ variants or fragments thereof containing the amino acid sequence of SEQ ID NO: 2, and antibodies with specific CDR (complementarity determining region) sequences bind to SIRP ⁇ variants.
  • the present invention was completed after discovering that it exhibits very high binding specificity and binding affinity and thus has very high utility.
  • the purpose of the present invention is to provide an antibody or antigen-binding fragment thereof that specifically binds to a SIRP ⁇ variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
  • Another object of the present invention is to provide a polynucleotide encoding the antibody or antigen-binding fragment thereof, a vector containing the polynucleotide, and a cell transformed with the vector.
  • Another object of the present invention is to produce a polypeptide containing a light chain and a heavy chain variable region by culturing the cell under conditions in which the polynucleotide is expressed, and recovering the polypeptide from the cell or the culture medium in which it was cultured.
  • Another object of the present invention is to provide a method for detecting SIRP ⁇ variants comprising the amino acid sequence of SEQ ID NO: 2 in a sample, comprising the following steps:
  • the present invention provides an antibody or antigen-binding fragment thereof that specifically binds to a SIRP ⁇ variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
  • the present invention provides a polynucleotide encoding the antibody or antigen-binding fragment thereof, a vector containing the polynucleotide, and a cell transformed with the vector.
  • the present invention includes the steps of culturing the cells under conditions in which polynucleotides are expressed, producing polypeptides containing light chain and heavy chain variable regions, and producing polypeptides containing light chain and heavy chain variable regions from the cells or the culture medium in which they were cultured.
  • the present invention provides a method for detecting a SIRP ⁇ variant comprising the amino acid sequence of SEQ ID NO: 2 in a sample, comprising the following steps:
  • the present invention provides an antibody or antigen-binding fragment thereof that specifically binds to a SIRP ⁇ variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
  • SIRPa also referred to as SIRP-alpha, SIRP ⁇ , CD172a or SHPS-1
  • SIRPa is expressed in monocytes, most subpopulations of tissue macrophages, granulocytes, DC subsets of lymphoid tissues, and some myeloid progenitor cells. It is a protein expressed at various levels in neurons and contains the amino acid sequence of SEQ ID NO: 1.
  • the amino acid sequence of wild-type SIRP ⁇ , including the amino acid sequence of SEQ ID NO: 1, is NCBI accession No.
  • the antibody provided by the present invention is an antibody that specifically binds to a SIRP ⁇ variant, more specifically, a SIRP ⁇ variant containing the amino acid sequence of SEQ ID NO: 2, or a fragment thereof, and is a wild-type SIRP ⁇ containing the amino acid sequence of SEQ ID NO: 1. Alternatively, it may be characterized as not binding to fragments thereof and showing high binding specificity to SIRP ⁇ variants or fragments thereof containing the amino acid sequence of SEQ ID NO: 2.
  • the "SIRP ⁇ variant” may refer to a protein in which the amino acid sequence of wild-type SIRP ⁇ according to the reference number, excluding the amino acid sequence of SEQ ID NO: 1, is linked to the C-terminus of SEQ ID NO: 2. .
  • the "fragment” refers to the amino acid sequence of SEQ ID NO: 2 and the amino acid sequence of wild-type SIRP ⁇ according to the reference number, in which some of the remaining amino acid sequences excluding the amino acid sequence of SEQ ID NO: 1 are located at the C-terminus of SEQ ID NO: 2. It may mean a protein linked to .
  • antibody is also called immunoglobulin (Ig), and is a general term for proteins that selectively act on antigens and participate in biological immunity.
  • Ig immunoglobulin
  • Whole antibodies found in nature generally consist of two pairs of polypeptides consisting of multiple domains, a light chain (LC) and a heavy chain (HC), or two pairs of these HC/LC
  • the structure consists of basic units.
  • different types of antibodies such as IgA, IgD, IgE, IgG, and IgM are produced. constitutes.
  • the heavy and light chains of antibodies are structurally divided into variable regions and constant regions depending on the variability of the amino acid sequence.
  • the constant region of the heavy chain consists of 3 or 4 heavy chain constant regions, including CH1, CH2, and CH3 (IgA, IgD, and IgG antibodies) and CH4 (IgE and IgM antibodies), depending on the type of antibody, and the light chain has one constant region. It is composed of CL.
  • the variable regions of the heavy chain and light chain each consist of one domain, the heavy chain variable region (VH) or the light chain variable region (VL).
  • the light and heavy chains have their respective variable and constant regions aligned side by side and connected by one shared disulfide bond, and the heavy chains of the two molecules bound to the light chain are connected through two shared disulfide bonds, forming the entire antibody. forms.
  • a whole antibody specifically binds to an antigen through the variable regions of the heavy and light chains. Since the whole antibody is composed of two pairs of heavy and light chains (HC/LC), one molecule of whole antibody has two variable regions. Through this, it has bivalent monospecificity that binds to the same two antigens.
  • the variable region of an antibody that binds to an antigen is called the antigen-binding site of the antibody, and the part on the surface of the antigen recognized by the antibody is called the epitope.
  • variable region of an antibody which contains the antigen-binding site, consists of a framework region (FR) with low sequence variability and a complementary determining region (hypervariable region) with high sequence variability. , CDR).
  • VH and VL each have three CDRs and four FRs arranged from the N-terminus to the C-terminus in the following order: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4.
  • the CDR which has the highest sequence variability, is the region that directly binds to the antigen and is most important for the antigen specificity of the antibody.
  • the antibody or antigen-binding fragment thereof according to the present invention preferably includes (i) a heavy chain complementarity determining region (CDR) 1 comprising the amino acid sequence represented by SEQ ID NO: 3, represented by SEQ ID NO: 4; A heavy chain variable region including a heavy chain CDR2 including the amino acid sequence and a heavy chain CDR3 including the amino acid sequence represented by SEQ ID NO: 5; And a light chain variable region comprising a light chain CDR1 containing the amino acid sequence shown in SEQ ID NO: 6, a light chain CDR2 containing the amino acid sequence shown in SEQ ID NO: 7, and a light chain CDR3 containing the amino acid sequence shown in SEQ ID NO: 8. It can be characterized as:
  • the antibody or antigen-binding fragment thereof according to the present invention preferably includes (i) a heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 9; and a light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 10.
  • the type of the antibody or antibody fragment according to the present invention as long as it has the composition of the above-mentioned CDR, VH and VL, or light and heavy chains, and the antibody may be in the form of IgG, IgA, IgM, IgE or IgD. there is. Preferably, it may be an IgG type antibody.
  • the antigen-binding fragment of an antibody refers to a fragment of an antibody that maintains specific binding ability to a SIRP ⁇ variant or a fragment thereof containing the amino acid sequence of SEQ ID NO: 2, specifically Fab, F(ab)2, It may be in the form of Fab', F(ab')2, Fv, diabody, scFv, etc.
  • Fab fragment antigen-binding
  • F(ab')2 is a fragment produced by hydrolyzing an antibody with pepsin, and consists of two Fabs connected by a disulfide bond at the heavy chain hinge.
  • F(ab') is a monomeric antibody fragment in which a heavy chain hinge is added to Fab obtained by reducing the disulfur bond of the F(ab')2 fragment.
  • Fv (variable fragment) is an antibody fragment composed only of the variable regions of each heavy chain and light chain.
  • scFv single chain variable fragment
  • a diabody refers to a fragment in which the VH and VL of an scFv are connected by a very short linker and cannot bind to each other, and form a dimer by combining with the VL and VH of another scFv of the same type, respectively.
  • the antibody according to the present invention may be a monoclonal antibody derived from a single B cell, or a polyclonal antibody derived from multiple B cells, and the amino acid sequences of the heavy and light chains of the antibody may be It is preferable that it is a monoclonal antibody, which is a group of substantially identical antibodies.
  • the antibody or antibody fragment according to the present invention may be derived from any animal, including mammals including humans, birds, etc., and may be a chimeric antibody or antibody fragment containing antibody sequences from different species. You can.
  • the antibody or fragment thereof of the present invention may be conjugated to an enzyme, a fluorescent substance, a radioactive substance, a protein, etc., but is not limited thereto.
  • the present invention also provides a polynucleotide encoding the antibody or antigen-binding fragment thereof.
  • 'polynucleotide' may be described as an oligonucleotide or nucleic acid, and may be used using DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), or nucleotide analogs. Generated analogs of the DNA or RNA (e.g., peptide nucleic acids and non-naturally occurring nucleotide analogs) and hybrids thereof are included.
  • the polynucleotide may be single-stranded or double-stranded. -Can be double stranded.
  • the polynucleotide is a CDR composition specific to a polypeptide containing the amino acid of SEQ ID NO: 2, or a base sequence encoding an antibody consisting of heavy and light chains having the composition of VH and VL.
  • the polynucleotide means that it consists of the base sequence of SEQ ID NO: 17 encoding the heavy chain variable region and the base sequence of SEQ ID NO: 18 encoding the light chain variable region.
  • Polynucleotides encoding the antibodies of the present invention or antigen-binding fragments thereof can be obtained by methods well known in the art. For example, based on the DNA sequence encoding part or all of the heavy and light chains of the antibody or the corresponding amino acid sequence, oligonucleotide synthesis techniques well known in the art, such as polymerase chain reaction (PCR), etc. It can be synthesized using PCR, etc.
  • the present invention also provides a vector containing the above polynucleotide.
  • the 'vector' of the present invention is used for the purpose of cloning or expressing the polynucleotide of the present invention for recombinant production of the antibody or antigen-binding fragment thereof of the present invention, and generally contains a signal sequence, origin of replication, and one or more markers. It includes one or more of a gene, an enhancer element, a promoter, and a transcription termination sequence.
  • the vector of the present invention may preferably be an expression vector, and more preferably may be a vector containing a control sequence, for example, a polynucleotide of the present invention operably linked to a promoter.
  • a plasmid refers to a linear or circular double-helix DNA molecule to which external polynucleotide fragments can be combined.
  • a viral vector e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses
  • additional DNA fragments are It can be introduced into the viral genome.
  • Certain vectors are capable of self-replication (e.g., bacterial vectors, including bacterial origin and episomal mammalian vectors) into which they are introduced. autonomous replication).
  • Other vectors e.g., non-episomal mammalian vectors
  • the 'vector' can be understood to have the same meaning as an 'expression vector', which is a type of vector capable of expressing the polynucleotide.
  • a polynucleotide sequence is “operably linked” to a regulatory sequence if the regulatory sequence affects expression (e.g., level, timing or location of expression) of the polynucleotide sequence.
  • the regulatory sequence is a sequence that affects the expression (e.g., level, timing or location of expression) of the nucleic acid to which it is operably linked.
  • the regulatory sequence may exert its influence, for example, directly on the regulated nucleic acid or through the action of one or more other molecules (e.g., polypeptides that bind the regulatory sequence and/or the nucleic acid). You can do it.
  • the regulatory sequences include promoters, enhancers and other expression control elements.
  • the vector of the present invention may preferably be pOptiVEC TM -TOPO and pcDNA TM 3.3-TOPO.
  • the present invention also provides cells transformed with the vector.
  • the type of cell of the present invention is not particularly limited as long as it can be used to express the polynucleotide encoding the antibody or fragment thereof contained in the expression vector of the present invention.
  • Cells (host cells) transformed with the expression vector according to the present invention include prokaryotes (e.g., Escherichia coli), eukaryotes (e.g., yeast or other fungi), and plant cells (e.g., tobacco or tomato plants). cells), animal cells (e.g., human cells, monkey cells, hamster cells, rat cells, mouse cells, insect cells, or hybridomas derived from these. Preferred. In other words, it may be a cell derived from a mammal, including humans.
  • Prokaryotes suitable for this purpose are Gram-negative or Gram-positive organisms, for example Enterobacteriaceae , for example Escherichia , for example E. E.coli , Enterobacter , Erwinia , Klebsiella, Proteus , Salmonella , such as Salmonella typhimurium , Serratia ( Serratia ), such as Serratia marcescans and Shigella , and Bacilli , such as B. B. subtilis and B. Includes B. licheniformis, Pseudomonas , such as P. aeruginosa and Streptomyces .
  • the cell of the present invention is not particularly limited as long as it is capable of expressing the vector of the present invention, but is preferably E. It could be coli.
  • the most commonly used eukaryotic cell as the cell of the present invention is Saccharomyces cerevisiae .
  • Saccharomyces cerevisiae many other genera, species and strains, including but not limited to Schizosaccharomyces pombe , Kluyveromyces hosts, such as K. Lactis ( K. lactis ), K. K. fragilis (ATCC 12,424), K. K. bulgaricus (ATCC 16,045), K. Wickeramii ( K. wickeramii ) (ATCC 24,178), K. K. waltii (ATCC 56,500), K. Drosophilarum ( K.drosophilarum ) (ATCC 36,906), K. Thermotolerans ( K. thermotolerans ) and K.
  • transformation refers to modification of the genotype of a host cell by introducing an exogenous polynucleotide, and refers to the introduction of the exogenous polynucleotide into the host cell regardless of the method used for the transformation.
  • the exogenous polynucleotide introduced into the host cell may be integrated into the genome of the host cell and may be maintained or may be maintained without integration, and the present invention includes both.
  • the recombinant expression vector may be used by methods known in the art, such as, but not limited to, transient transfection, microinjection, transduction, cell fusion, calcium phosphate precipitation, and liposome-mediated transformation.
  • Liposome-mediated transfection DEAE dextran-mediated transfection, polybrene-mediated transfection, electroporation, gene gun ) and can be transformed by introducing them into cells to produce antibodies or fragments thereof using known methods for introducing nucleic acids into cells.
  • the cell of the present invention is a cultured cell that can be transformed or transfected with the polynucleotide of the present invention or a vector containing it, and can be continuously expressed in the host cell.
  • Recombinant cells refer to cells that have been transformed or transfected with a polynucleotide to be expressed.
  • a cell of the invention may also be a cell that contains a polynucleotide of the invention but does not express it at the desired level unless regulatory sequences are introduced into the cell such that it is operably linked to the polynucleotide.
  • Cells of the present invention can be cultured in various media.
  • Commercially available media such as Ham's F1O (Sigma-Aldrich Co., St. Louis, MO), minimal essential medium (MEM, Sigma-Aldrich Co.), RPMI-1640 (Sigma-Aldrich Co.), and Dulbecco's modified Eagle's medium (DMEM, Sigma-Aldrich Co.) are suitable for culturing cells.
  • the medium may be supplemented with hormones and/or other growth factors, salts, buffers, nucleotides, antibiotics, trace elements and glucose or equivalent energy sources if necessary.
  • the present invention includes the steps of culturing the cells under conditions in which polynucleotides are expressed, producing polypeptides containing light chain and heavy chain variable regions, and recovering the polypeptides from the cells or the culture medium in which they were cultured. , provides a method for producing an antibody or antigen-binding fragment thereof that specifically binds to a SIRP ⁇ variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
  • the cells used in the production method of the present invention are as described above, and contain a polynucleotide encoding the antibody of the present invention.
  • the polypeptide of the above production method may be the antibody of the present invention or its fragment itself, or may be an additional amino acid sequence other than the antibody of the present invention or its fragment.
  • the production method of the present invention may additionally carry out the step of purifying the recovered polypeptide.
  • the culture medium composition and culture conditions may vary depending on the type of cell, which can be appropriately selected and adjusted by a person skilled in the art.
  • the antibody molecule may accumulate in the cytoplasm of the cell, be secreted from the cell, or be targeted to the periplasm or extracellular medium (supernatant) by an appropriate signal sequence, and may be targeted to the periplasm or extracellular medium. It is desirable. In addition, it is desirable to refold the produced antibody molecule using a method well known to those skilled in the art and give it a functional conformation. The recovery of the polypeptide may vary depending on the characteristics of the produced polypeptide and the characteristics of the cell, which can be appropriately selected and adjusted by those skilled in the art.
  • the polypeptide may be produced intracellularly, in the periplasmic space, or secreted directly into the medium. If the polypeptide is produced within a cell, the cell can be destroyed to release the protein as a first step. Particulate debris, host cells or dissolved fragments are removed, for example by centrifugation or ultrafiltration. When antibodies are secreted into the medium, supernatants from such expression systems are typically first concentrated using commercially available protein concentration filters, such as Amicon or Millipore Pellicon ultrafiltration units. Protease inhibitors, such as PMSF, may be included in any preceding step to inhibit proteolysis, and antibiotics may be included to prevent the growth of accidental contaminants. Antibodies prepared from cells can be purified using, for example, hydroxyapatite chromatography, gel electrophoresis, dialysis and affinity chromatography, and the antibodies of the present invention can preferably be purified using affinity chromatography. there is.
  • the present invention also provides a method for detecting SIRP ⁇ variants comprising the amino acid sequence of SEQ ID NO: 2 in a sample, comprising the following steps:
  • Binding of SIRPa variants and antibodies can be detected and/or quantified and/or determined by a variety of assays available to those skilled in the art. Although any suitable means of performing the assays are included within the scope of the present invention, specific mention may be made of fluorescence activated cell sorting (FACS), ELISA, Western blotting and immunohistochemistry (IHC). Preferred methods include IHC and FACS.
  • FACS fluorescence activated cell sorting
  • ELISA ELISA
  • IHC immunohistochemistry
  • the sample may be a biological sample.
  • a “biological sample” may be any sample that can be taken from an individual.
  • Preferred biological samples include samples such as blood samples, plasma samples, or lymph samples, if the cancer is a liquid tumor.
  • Preferred biological samples include samples such as biopsy samples or samples from surgical resection therapy, if the cancer is a solid tumor.
  • the biological sample is a biological liquid such as serum, whole blood cells, tissue sample or biopsy of human origin.
  • the sample may include, for example, biopsied tissue.
  • the antibody or antigen-binding fragment thereof according to the present invention has the effect of accurately confirming and quantifying the presence of the SIRP ⁇ variant during the process of expressing and purifying and studying the SIRP ⁇ variant containing the amino acid sequence of SEQ ID NO: 2.
  • Figure 1 shows the results of evaluating whether the two types of antibodies prepared in the examples of the present invention can detect SIRP ⁇ variants by ELISA assay.
  • Figure 2 shows the results of evaluating by Western blotting whether the two types of antibodies prepared in the examples of the present invention can detect SIRP ⁇ variants.
  • a monoclonal antibody specific for the SIRP ⁇ variant containing the amino acid sequence of SEQ ID NO: 2 was produced according to the following steps:
  • the antibody or antigen-binding fragment thereof according to the present invention has the effect of accurately confirming and quantifying the presence of the SIRP ⁇ variant during the process of expressing and purifying and studying the SIRP ⁇ variant containing the amino acid sequence of SEQ ID NO: 2, Industrial applicability is very high.

Landscapes

  • Health & Medical Sciences (AREA)
  • Life Sciences & Earth Sciences (AREA)
  • Chemical & Material Sciences (AREA)
  • Immunology (AREA)
  • Engineering & Computer Science (AREA)
  • Molecular Biology (AREA)
  • General Health & Medical Sciences (AREA)
  • Hematology (AREA)
  • Medicinal Chemistry (AREA)
  • Urology & Nephrology (AREA)
  • Proteomics, Peptides & Aminoacids (AREA)
  • Organic Chemistry (AREA)
  • Biochemistry (AREA)
  • Biomedical Technology (AREA)
  • Cell Biology (AREA)
  • Genetics & Genomics (AREA)
  • Biotechnology (AREA)
  • Microbiology (AREA)
  • Biophysics (AREA)
  • Food Science & Technology (AREA)
  • Physics & Mathematics (AREA)
  • Analytical Chemistry (AREA)
  • General Physics & Mathematics (AREA)
  • Pathology (AREA)
  • Peptides Or Proteins (AREA)

Abstract

The present invention relates to an antibody that specifically binds to a SIRPα variant and, more specifically, to: an antibody or antigen-binding fragment thereof that specifically binds to a SIRPα variant or fragment thereof comprising the amino acid sequence of SEQ ID NO: 2; and a method for detecting a SIRPα variant in a sample using same.

Description

SIRPα 변이체에 특이적으로 결합하는 항체Antibodies that specifically bind to SIRPα variants
본 출원은 2022년 9월 7일에 출원된 대한민국 특허출원 제10-2022-0113704호를 우선권으로 주장하고, 상기 명세서 전체는 본 출원의 참고문헌이다.This application claims priority to Republic of Korea Patent Application No. 10-2022-0113704, filed on September 7, 2022, and the entire specification is a reference to this application.
본 발명은 SIRPα 변이체에 특이적으로 결합하는 항체에 관한 것으로, 보다 상세하게는 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편, 이를 이용한 시료 내 SIRPα 변이체 검출 방법에 관한 것이다.The present invention relates to an antibody that specifically binds to a SIRPα variant, and more specifically to an antibody or antigen-binding fragment thereof that specifically binds to a SIRPα variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2, and a sample using the same. This is about my SIRPα variant detection method.
SIRPα(Signal-regulatory protein alpha)는, 매크로파지, 수상 세포, 호중구 등의 미엘로이드 세포, 및 글리아 세포에 존재하는 Ig 슈퍼패밀리의 1회 막관통형 분자이다. 세포외 영역은 1개의 IgV 도메인과 2개의 IgC 도메인으로 이루어지고, CD47과의 결합 부위인 IgV 도메인에 대해서는, 인간에서는 10 종류의 변이체가 보고되어 있다. 한편, 세포내 영역은 immunoreceptor tyrosine-based inhibition motifs (ITIM)를 포함하고, CD47과의 결합에 의해 티로신 탈인산화 효소인 SHP-1, 및 SHP-2에 대한 결합이 유도되고 억제성의 시그널이 전달된다.SIRPα (Signal-regulatory protein alpha) is a single-transmembrane molecule of the Ig superfamily that exists in myeloid cells such as macrophages, dendritic cells, and neutrophils, and glial cells. The extracellular region consists of one IgV domain and two IgC domains, and 10 types of variants of the IgV domain, which is the binding site for CD47, have been reported in humans. Meanwhile, the intracellular region contains immunoreceptor tyrosine-based inhibition motifs (ITIM), and binding to CD47 induces binding to tyrosine dephosphorylation enzymes SHP-1 and SHP-2, and an inhibitory signal is transmitted. .
SIRPα-CD47 상호 작용에 의한 생리 현상으로는, 매크로파지 상의 SIRPα에 적혈구 상의 CD47 이 결합하고 "Don't eat me" 시그널을 전달함으로써, 적혈구의 불필요한 탐식을 회피하는 것이 개시되어 있다. 한편, 종양 미소 환경하에 있어서도, 매크로파지나 수상 세포 상의 SIRPα에 종양 세포에 고발현하는 CD47이 결합함으로써, 종양 세포에 대한 탐식능을 억제하는 것이 시사되어 있다. 탐식능의 억제는, 그 후의 T 세포에 대한 종양 항원 제시의 억제, 나아가서는 종양 면역 응답의 억제로 이어지는 것이 예상된다. As a physiological phenomenon caused by SIRPα-CD47 interaction, CD47 on red blood cells binds to SIRPα on macrophages and transmits a “Don’t eat me” signal, thereby avoiding unnecessary phagocytosis of red blood cells. On the other hand, it has been suggested that even in the tumor microenvironment, CD47, which is highly expressed on tumor cells, binds to SIRPα on macrophages and dendritic cells, thereby suppressing the phagocytic ability for tumor cells. Suppression of phagocytosis is expected to lead to subsequent suppression of tumor antigen presentation to T cells and further suppression of tumor immune response.
지금까지, SIRPα의 리간드인 CD47에 대한 항체로 SIRPα-CD47 상호 작용을 저해함으로써, 종양 세포에 대한 탐식능을 증강시키는 것이 보고되어 있고, 이것은 항-SIRPα 항체를 사용한 경우에도, 종양 세포를 면역 세포에 끌어들이는 이펙터 활성을 가지는 항암 항체 병용 조건하에서는 동일한 현상이 나타나고 있다. 또, 항-CD47 항체를 사용한 동종 마우스 담암 모델에서는, 항종양 효과뿐만 아니라, 종양 면역을 유도하는 시사된 바 있다. So far, it has been reported that inhibiting the SIRPα-CD47 interaction with an antibody against CD47, the ligand of SIRPα, enhances the phagocytosis of tumor cells, which prevents tumor cells from being attacked by immune cells even when anti-SIRPα antibodies are used. The same phenomenon appears under the conditions of combined use of anticancer antibodies with attracting effector activity. Additionally, in an allogeneic mouse tumor model using an anti-CD47 antibody, it has been suggested that it not only has an antitumor effect but also induces tumor immunity.
한편, 종양 세포 상에서 높은 CD47 발현이 급성 골수성 백혈병(AML) 및 몇몇 고형 암에서, 생존을 위한 음성 예후 인자로 작용함이 발견된 이후, CD47와 SIRPα 간 상호작용을 파괴하는데 집중하는 전략, 예컨대 CD47 또는 SIRPα를 차폐하는 작용제의 투여가 잠재적인 항암 요법으로 검토되었다.On the other hand, since it was discovered that high CD47 expression on tumor cells acts as a negative prognostic factor for survival in acute myeloid leukemia (AML) and several solid cancers, strategies focusing on disrupting the interaction between CD47 and SIRPα, such as CD47 Alternatively, administration of agents that mask SIRPα has been examined as a potential anticancer therapy.
이러한 요법의 일환으로 야생형의 SIRPα과 비교하여 CD47에 대한 친화도가 현저히 향상된 다양한 SIRPα 변이체들이 개발되어, CD47-SIRPα 결합에 대한 경쟁적 길항제로서 그 효과가 확인되고 있다. As part of this therapy, various SIRPα variants with significantly improved affinity for CD47 compared to wild-type SIRPα have been developed, and their effectiveness as competitive antagonists for CD47-SIRPα binding has been confirmed.
따라서, SIRPα 변이체들을 발현하여 정제하고 이를 연구하는 과정 중 SIRPα 변이체의 존재 여부를 정확하게 확인하고 정량할 수 있는 수단으로서 SIRPα 변이체 특이적인 항체에 대한 요구가 증가하고 있다.Therefore, there is an increasing demand for SIRPα variant-specific antibodies as a means to accurately confirm and quantify the presence of SIRPα variants during the process of expressing, purifying, and studying SIRPα variants.
이에, 본 발명자는 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체를 개발하기 위하여 연구를 거듭하였고, 특정 CDR(상보성 결정부위) 서열을 갖는 항체들이 SIRPα 변이체에 매우 높은 결합특이성(specificity) 및 결합친화력(affinity)를 나타내어 그 활용도가 매우 높음을 발견하고 본 발명을 완성하였다.Accordingly, the present inventors conducted repeated studies to develop antibodies that specifically bind to SIRPα variants or fragments thereof containing the amino acid sequence of SEQ ID NO: 2, and antibodies with specific CDR (complementarity determining region) sequences bind to SIRPα variants. The present invention was completed after discovering that it exhibits very high binding specificity and binding affinity and thus has very high utility.
따라서, 본 발명의 목적은 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 제공하는 것이다. Therefore, the purpose of the present invention is to provide an antibody or antigen-binding fragment thereof that specifically binds to a SIRPα variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
본 발명의 다른 목적은 상기 항체 또는 이의 항원 결합 단편을 암호화하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터 및 상기 벡터로 형질전환된 세포를 제공하는 것이다. Another object of the present invention is to provide a polynucleotide encoding the antibody or antigen-binding fragment thereof, a vector containing the polynucleotide, and a cell transformed with the vector.
본 발명의 다른 목적은 상기 세포를 폴리뉴클레오티드가 발현되는 조건하에서 배양하여, 경쇄 및 중쇄가변영역을 포함하는 폴리펩타이드를 생산하는 단계 및 상기 세포 또는 이를 배양한 배양 배지로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는, 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편 생산방법을 제공하는 것이다. Another object of the present invention is to produce a polypeptide containing a light chain and a heavy chain variable region by culturing the cell under conditions in which the polynucleotide is expressed, and recovering the polypeptide from the cell or the culture medium in which it was cultured. To provide a method for producing an antibody or antigen-binding fragment thereof that specifically binds to a SIRPα variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2, including.
본 발명의 다른 목적은 하기 단계를 포함하는, 시료 내에서 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체를 검출하는 방법을 제공하는 것이다:Another object of the present invention is to provide a method for detecting SIRPα variants comprising the amino acid sequence of SEQ ID NO: 2 in a sample, comprising the following steps:
(a) 상기 시료를 본 발명의 항체 또는 이의 항원 결합 단편과 접촉시키는 단계; 및(a) contacting the sample with an antibody or antigen-binding fragment thereof of the present invention; and
(b) 상기 시료와 상기 항체 또는 이의 항원 결합 단편의 결합을 검출하는 단계.(b) detecting the binding of the sample to the antibody or antigen-binding fragment thereof.
전술한 본 발명의 목적을 달성하기 위하여 본 발명은 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 제공한다. In order to achieve the above-described object of the present invention, the present invention provides an antibody or antigen-binding fragment thereof that specifically binds to a SIRPα variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
본 발명의 다른 목적을 달성하기 위하여, 본 발명은 상기 항체 또는 이의 항원 결합 단편을 암호화하는 폴리뉴클레오티드, 상기 폴리뉴클레오티드를 포함하는 벡터 및 상기 벡터로 형질전환된 세포를 제공한다.In order to achieve another object of the present invention, the present invention provides a polynucleotide encoding the antibody or antigen-binding fragment thereof, a vector containing the polynucleotide, and a cell transformed with the vector.
본 발명의 다른 목적을 달성하기 위하여, 본 발명은 상기 세포를 폴리뉴클레오티드가 발현되는 조건하에서 배양하여, 경쇄 및 중쇄가변영역을 포함하는 폴리펩타이드를 생산하는 단계 및 상기 세포 또는 이를 배양한 배양 배지로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는, 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편 생산방법을 제공한다.In order to achieve another object of the present invention, the present invention includes the steps of culturing the cells under conditions in which polynucleotides are expressed, producing polypeptides containing light chain and heavy chain variable regions, and producing polypeptides containing light chain and heavy chain variable regions from the cells or the culture medium in which they were cultured. Provided is a method for producing an antibody or antigen-binding fragment thereof that specifically binds to a SIRPα variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2, including the step of recovering the polypeptide.
본 발명의 다른 목적을 달성하기 위하여, 본 발명은 하기 단계를 포함하는, 시료 내에서 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체를 검출하는 방법을 제공한다:In order to achieve another object of the present invention, the present invention provides a method for detecting a SIRPα variant comprising the amino acid sequence of SEQ ID NO: 2 in a sample, comprising the following steps:
(a) 상기 시료를 본 발명의 항체 또는 이의 항원 결합 단편과 접촉시키는 단계; 및(a) contacting the sample with an antibody or antigen-binding fragment thereof of the present invention; and
(b) 상기 시료와 상기 항체 또는 이의 항원 결합 단편의 결합을 검출하는 단계.(b) detecting the binding of the sample to the antibody or antigen-binding fragment thereof.
이하, 본 발명에 대해 상세히 설명한다. Hereinafter, the present invention will be described in detail.
본 발명은 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편을 제공한다. The present invention provides an antibody or antigen-binding fragment thereof that specifically binds to a SIRPα variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
본 발명에서 상기 SIRPa(혹은 SIRP-알파, SIRPα, CD172a 또는 SHPS-1로도 칭함)는 단핵구, 조직 대식세포의 대부분의 하위 집단, 과립구, 림프 조직의 DC 하위 집합, 일부의 골수 전구 세포에서 발현되고 뉴런에도 다양한 수준으로 발현되는 단백질로서, 서열번호 1의 아미노산 서열을 포함한다. 서열번호 1의 아미노산 서열을 포함하는 야생형 SIRPα의 아미노산 서열은 NCBI accession No. AAH33092, NP_001317657, NP_001035112, NP_001035111, NP_542970, XP_024307604, XP_005260727, XP_047295872, XP_047295871, XP_011527475 등으로 공지되어 있으며, 이에 제한되지 않는다.In the present invention, SIRPa (also referred to as SIRP-alpha, SIRPα, CD172a or SHPS-1) is expressed in monocytes, most subpopulations of tissue macrophages, granulocytes, DC subsets of lymphoid tissues, and some myeloid progenitor cells. It is a protein expressed at various levels in neurons and contains the amino acid sequence of SEQ ID NO: 1. The amino acid sequence of wild-type SIRPα, including the amino acid sequence of SEQ ID NO: 1, is NCBI accession No. Known as AAH33092, NP_001317657, NP_001035112, NP_001035111, NP_542970, XP_024307604, XP_005260727, XP_047295872, XP_047295871, XP_011527475, etc., limited thereto. It doesn't work.
본 발명이 제공하는 상기 항체는 SIRPα 변이체, 보다 구체적으로는 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체로서, 상기 서열번호 1의 아미노산 서열을 포함하는 야생형 SIRPα 또는 이의 단편에는 결합하지 않고, 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 높은 결합 특이도를 나타내는 것을 특징으로 할 수 있다. The antibody provided by the present invention is an antibody that specifically binds to a SIRPα variant, more specifically, a SIRPα variant containing the amino acid sequence of SEQ ID NO: 2, or a fragment thereof, and is a wild-type SIRPα containing the amino acid sequence of SEQ ID NO: 1. Alternatively, it may be characterized as not binding to fragments thereof and showing high binding specificity to SIRPα variants or fragments thereof containing the amino acid sequence of SEQ ID NO: 2.
본 발명에서 상기 "SIRPα 변이체"란 상기 reference number에 따른 야생형 SIRPα의 아미노산 서열에서 상기 서열번호 1의 아미노산 서열을 제외한 나머지 아미노산 서열이 상기 서열번호 2의 C-말단에 연결된 단백질을 의미하는 것일 수 있다. In the present invention, the "SIRPα variant" may refer to a protein in which the amino acid sequence of wild-type SIRPα according to the reference number, excluding the amino acid sequence of SEQ ID NO: 1, is linked to the C-terminus of SEQ ID NO: 2. .
본 발명에서 상기 "단편"이란 상기 서열번호 2의 아미노산 서열 및 상기 reference number에 따른 야생형 SIRPα의 아미노산 서열에서 상기 서열번호 1의 아미노산 서열을 제외한 나머지 아미노산 서열 중 일부가 상기 서열번호 2의 C-말단에 연결된 단백질을 의미하는 것일 수 있다.In the present invention, the "fragment" refers to the amino acid sequence of SEQ ID NO: 2 and the amino acid sequence of wild-type SIRPα according to the reference number, in which some of the remaining amino acid sequences excluding the amino acid sequence of SEQ ID NO: 1 are located at the C-terminus of SEQ ID NO: 2. It may mean a protein linked to .
본 발명에서 "항체(antibody)"는 면역글로불린(immunoglobulin, Ig)이라고도 불리며, 항원에 선택적으로 작용하여 생체 면역에 관여하는 단백질의 총칭이다. 자연에서 발견되는 전체 항체(whole antibody)는 일반적으로 여러 도메인으로 이루어진 폴리펩티드인 경쇄(light chain, LC) 및 중쇄(heavy chain, HC)의 2개 쌍으로 이루어지거나, 이들 HC/LC의 2개의 쌍으로 된 구조를 기본 단위로 구성된다. 포유류의 항체를 구성하는 중쇄의 종류는 그리스 문자 α, δ, ε, γ 및 μ로 표시되는 5가지 유형이 있으며, 중쇄의 종류에 따라 각각 IgA, IgD, IgE, IgG 및 IgM 등 다른 종류의 항체를 구성하게 된다. 포유류의 항체를 구성하는 경쇄의 종류는 λ 및 κ로 표시되는 2가지 종류가 존재한다.In the present invention, “antibody” is also called immunoglobulin (Ig), and is a general term for proteins that selectively act on antigens and participate in biological immunity. Whole antibodies found in nature generally consist of two pairs of polypeptides consisting of multiple domains, a light chain (LC) and a heavy chain (HC), or two pairs of these HC/LC The structure consists of basic units. There are five types of heavy chains that make up mammalian antibodies, represented by the Greek letters α, δ, ε, γ, and μ. Depending on the type of heavy chain, different types of antibodies such as IgA, IgD, IgE, IgG, and IgM are produced. constitutes. There are two types of light chains that make up mammalian antibodies, denoted by λ and κ.
항체의 중쇄와 경쇄는 구조적으로 아미노산 서열의 가변성에 따라 가변영역과 불변영역으로 구분된다. 중쇄의 불변영역은 항체의 종류에 따라 CH1, CH2 및 CH3(IgA, IgD 및 IgG 항체) 및 CH4(IgE 및 IgM 항체) 등 3 또는 4개의 중쇄불변영역으로 구성되어 있으며, 경쇄는 1개의 불변영역인 CL으로 구성되어 있다. 중쇄와 경쇄의 가변영역은 각각 중쇄가변영역(VH) 또는 경쇄가변영역(VL)의 하나의 도메인으로 이루어져 있다. 경쇄와 중쇄는 각각의 가변영역과 불변영역이 나란히 정렬되어 1개의 공유 이황결합(disulfide bond)에 의해 연결되고, 경쇄와 결합한 두 분자의 중쇄는 2개의 공유 이황결합을 통해 연결되어 전체 항체의 형태를 형성한다. 전체 항체는 중쇄 및 경쇄의 가변영역을 통해 항원에 특이적으로 결합하며, 전체 항체는 2개의 중쇄 및 경쇄의 쌍(HC/LC)으로 구성되어 있으므로, 한 분자의 전체 항체는 두 개의 가변영역을 통해 동일한 두 개의 항원에 결합하는 2가의 단일특이성을 갖게 된다. 항원에 결합하는 항체 가변영역을 항체의 항원결합부위(antigen-binding site)라고 하고, 항원의 표면에서 항체에 의해 인식되는 부분을 항원결정부(epitope)라고 한다.The heavy and light chains of antibodies are structurally divided into variable regions and constant regions depending on the variability of the amino acid sequence. The constant region of the heavy chain consists of 3 or 4 heavy chain constant regions, including CH1, CH2, and CH3 (IgA, IgD, and IgG antibodies) and CH4 (IgE and IgM antibodies), depending on the type of antibody, and the light chain has one constant region. It is composed of CL. The variable regions of the heavy chain and light chain each consist of one domain, the heavy chain variable region (VH) or the light chain variable region (VL). The light and heavy chains have their respective variable and constant regions aligned side by side and connected by one shared disulfide bond, and the heavy chains of the two molecules bound to the light chain are connected through two shared disulfide bonds, forming the entire antibody. forms. A whole antibody specifically binds to an antigen through the variable regions of the heavy and light chains. Since the whole antibody is composed of two pairs of heavy and light chains (HC/LC), one molecule of whole antibody has two variable regions. Through this, it has bivalent monospecificity that binds to the same two antigens. The variable region of an antibody that binds to an antigen is called the antigen-binding site of the antibody, and the part on the surface of the antigen recognized by the antibody is called the epitope.
항원결합부위(antigen-binding site)를 포함하고 있는 항체의 가변영역은 서열 가변성이 적은 골격 부위(framework region, FR)와 서열 가변성이 높은 과가변성 부위(hypervariable region)인 상보성 결정부위(complementary determining region, CDR)로 세분된다. VH와 VL은 각각 3개의 CDR 및 4개의 FR이 N-말단부터 C-말단의 방향으로 FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4의 순서로 배열되어 있다. 항체의 가변영역 안에서도 서열 가변성이 가장 높은 CDR이 항원과 직접 결합하는 부위로, 항체의 항원특이성에 가장 중요하다.The variable region of an antibody, which contains the antigen-binding site, consists of a framework region (FR) with low sequence variability and a complementary determining region (hypervariable region) with high sequence variability. , CDR). VH and VL each have three CDRs and four FRs arranged from the N-terminus to the C-terminus in the following order: FR1-CDR1-FR2-CDR2-FR3-CDR3-FR4. Even within the variable region of an antibody, the CDR, which has the highest sequence variability, is the region that directly binds to the antigen and is most important for the antigen specificity of the antibody.
본 발명의 일 양태에서, 본 발명에 따른 항체 또는 이의 항원 결합 단편은 바람직하게는 (i) 서열번호 3으로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위(CDR)1, 서열번호 4로 표시되는 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 CDR3을 포함하는 중쇄가변영역; 및 서열번호 6으로 표시되는 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 8로 표시되는 아미노산 서열을 포함하는 경쇄 CDR3을 포함하는 경쇄가변영역을 포함하는 것을 특징으로 할 수 있다. In one aspect of the present invention, the antibody or antigen-binding fragment thereof according to the present invention preferably includes (i) a heavy chain complementarity determining region (CDR) 1 comprising the amino acid sequence represented by SEQ ID NO: 3, represented by SEQ ID NO: 4; A heavy chain variable region including a heavy chain CDR2 including the amino acid sequence and a heavy chain CDR3 including the amino acid sequence represented by SEQ ID NO: 5; And a light chain variable region comprising a light chain CDR1 containing the amino acid sequence shown in SEQ ID NO: 6, a light chain CDR2 containing the amino acid sequence shown in SEQ ID NO: 7, and a light chain CDR3 containing the amino acid sequence shown in SEQ ID NO: 8. It can be characterized as:
본 발명의 다른 일 양태에서, 본 발명에 따른 항체 또는 이의 항원 결합 단편은 바람직하게는 (i) 서열번호 9로 표시되는 아미노산 서열을 포함하는 중쇄가변영역; 및 서열번호 10으로 표시되는 아미노산 서열을 포함하는 경쇄가변영역을 포함하는 것을 특징으로 할 수 있다. In another aspect of the present invention, the antibody or antigen-binding fragment thereof according to the present invention preferably includes (i) a heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 9; and a light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 10.
본 발명에 따른 항체 또는 항체의 단편은 상기한 CDR, VH와 VL, 또는 경쇄와 중쇄의 구성을 갖는 것이라면 그 종류에 제한이 없으며, 항체는 IgG, IgA, IgM, IgE 또는 IgD 형태의 항체일 수 있다. 바람직하게는 IgG 형태의 항체일 수 있다.There is no limitation on the type of the antibody or antibody fragment according to the present invention as long as it has the composition of the above-mentioned CDR, VH and VL, or light and heavy chains, and the antibody may be in the form of IgG, IgA, IgM, IgE or IgD. there is. Preferably, it may be an IgG type antibody.
또한 본 발명에서 항체의 항원 결합 단편은 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적인 결합력을 유지하고 있는 항체의 단편을 의미하며, 구체적으로는 Fab, F(ab)2, Fab', F(ab')2, Fv, 디아바디(diabody), scFv 등의 형태일 수 있다. Fab(fragment antigen-binding)는 항체의 항원 결합 단편으로, 중쇄와 경쇄 각각의 하나의 가변영역과 불변영역으로 구성되어 있다. F(ab')2는 항체를 펩신으로 가수분해시켜서 생성되는 단편으로, 두 개의 Fab가 중쇄 경첩(hinge)에서 이황결합(disulfide bond)으로 연결된 형태를 하고 있다. F(ab')는 F(ab')2 단편의 이황결합을 환원하여 분리시킨 Fab에 중쇄 경첩이 부가된 형태의 단량체 항체 단편이다. Fv(variable fragment)는 중쇄와 경쇄 각각의 가변영역으로만 구성된 항체 단편이다. scFv(single chain variable fragment)는 VH와 VL이 유연한 펩티드 링커로 연결되어 있는 재조합 항체 단편이다. 디아바디(diabody)는 scFv의 VH와 VL가 매우 짧은 링커로 연결되어 서로 결합하지 못하고, 동일한 형태의 다른 scFv의 VL와 VH와 각각 결합하여 이량체를 형성하고 있는 형태의 단편을 의미한다.In addition, in the present invention, the antigen-binding fragment of an antibody refers to a fragment of an antibody that maintains specific binding ability to a SIRPα variant or a fragment thereof containing the amino acid sequence of SEQ ID NO: 2, specifically Fab, F(ab)2, It may be in the form of Fab', F(ab')2, Fv, diabody, scFv, etc. Fab (fragment antigen-binding) is an antigen-binding fragment of an antibody, consisting of one variable region and one constant region of each heavy and light chain. F(ab')2 is a fragment produced by hydrolyzing an antibody with pepsin, and consists of two Fabs connected by a disulfide bond at the heavy chain hinge. F(ab') is a monomeric antibody fragment in which a heavy chain hinge is added to Fab obtained by reducing the disulfur bond of the F(ab')2 fragment. Fv (variable fragment) is an antibody fragment composed only of the variable regions of each heavy chain and light chain. scFv (single chain variable fragment) is a recombinant antibody fragment in which VH and VL are connected by a flexible peptide linker. A diabody refers to a fragment in which the VH and VL of an scFv are connected by a very short linker and cannot bind to each other, and form a dimer by combining with the VL and VH of another scFv of the same type, respectively.
또한 본 발명에 따른 항체는 단일한 B 세포에서 유래하는 단일클론(monoclonal) 항체일 수도 있고, 복수의 B 세포에서 유래하는 다클론(polyclonal) 항체일 수도 있으며, 항체의 중쇄와 경쇄의 아미노산 서열이 실질적으로 동일한 항체의 집단인 단일클론 항체인 것이 바람직하다. 본 발명에 따른 항체 또는 항체의 단편은 인간을 포함하는 포유동물, 조류 등을 포함한 임의의 동물에서 유래한 것일 수 있으며, 상이한 종의 항체 서열을 함께 가지고 있는 키메라(chimera) 항체 또는 항체의 단편일 수 있다. 본 발명의 항체 또는 그 단편은 효소, 형광 물질, 방사선 물질 및 단백질 등과 접합된 것일 수 있으나, 이에 한정되지는 않는다.In addition, the antibody according to the present invention may be a monoclonal antibody derived from a single B cell, or a polyclonal antibody derived from multiple B cells, and the amino acid sequences of the heavy and light chains of the antibody may be It is preferable that it is a monoclonal antibody, which is a group of substantially identical antibodies. The antibody or antibody fragment according to the present invention may be derived from any animal, including mammals including humans, birds, etc., and may be a chimeric antibody or antibody fragment containing antibody sequences from different species. You can. The antibody or fragment thereof of the present invention may be conjugated to an enzyme, a fluorescent substance, a radioactive substance, a protein, etc., but is not limited thereto.
본 발명은 또한 상기 항체 또는 이의 항원 결합 단편을 암호화하는 폴리뉴클레오티드를 제공한다. The present invention also provides a polynucleotide encoding the antibody or antigen-binding fragment thereof.
본 발명에서 '폴리뉴클레오티드'는 올리고뉴클레오티드 또는 핵산으로 기재될 수도 있으며, DNA분자들(예를들어, cDNA 또는 유전체(genomic DNA), RNA 분자들(예를 들어, mRNA), 뉴클레오티드 유사체들을 사용하여 생성된 상기 DNA 또는 RNA의 유사체들(예를 들어, 펩티드 핵산들 및 비-자연적으로 발생하는 뉴클레오티드 유사체들) 및 이들의 하이브리드들이 포함된다. 상기 폴리뉴클레오티드는 단일-가닥(single-stranded) 또는 이중-가닥(doublestranded)이 될 수 있다. 상기 폴리뉴클레오티드는 상기한 서열번호 2의 아미노산을 포함하는 폴리펩티드에 특이적인 CDR구성, 또는 VH와 VL의 구성을 갖는 중쇄 및 경쇄로 이루어지는 항체를 암호화하는 염기서열을 의미한다. 구체적으로는 상기 폴리뉴클레오티드는 중쇄가변영역을 암호화하는 서열번호 17의 염기서열 및 경쇄가변영역을 암호화하는 서열번호 18의 염기서열로 이루어진 것을 의미한다.In the present invention, 'polynucleotide' may be described as an oligonucleotide or nucleic acid, and may be used using DNA molecules (e.g., cDNA or genomic DNA), RNA molecules (e.g., mRNA), or nucleotide analogs. Generated analogs of the DNA or RNA (e.g., peptide nucleic acids and non-naturally occurring nucleotide analogs) and hybrids thereof are included.The polynucleotide may be single-stranded or double-stranded. -Can be double stranded. The polynucleotide is a CDR composition specific to a polypeptide containing the amino acid of SEQ ID NO: 2, or a base sequence encoding an antibody consisting of heavy and light chains having the composition of VH and VL. Specifically, the polynucleotide means that it consists of the base sequence of SEQ ID NO: 17 encoding the heavy chain variable region and the base sequence of SEQ ID NO: 18 encoding the light chain variable region.
본 발명의 항체 또는 이의 항원 결합 단편을 암호화하는 폴리뉴클레오티드는 당 업계에 잘 알려진 방법에 의하여 얻어질 수 있다. 예를 들어, 상기 항체의 중쇄 및 경쇄의 일부분 또는 전부를 코딩하는 DNA 서열 또는 해당 아미노산 서열에 근거하여, 당 분야에 잘 알려진 올리고뉴클레오타이드 합성기법, 예를 들어 중합효소 연쇄 반응(PCR)법 등을 사용하여 합성할 수 있다.Polynucleotides encoding the antibodies of the present invention or antigen-binding fragments thereof can be obtained by methods well known in the art. For example, based on the DNA sequence encoding part or all of the heavy and light chains of the antibody or the corresponding amino acid sequence, oligonucleotide synthesis techniques well known in the art, such as polymerase chain reaction (PCR), etc. It can be synthesized using
본 발명은 또한 상기 폴리뉴클레오티드를 포함하는 벡터를 제공한다. The present invention also provides a vector containing the above polynucleotide.
본 발명의 '벡터(vector)'는 본 발명의 항체 또는 이의 항원 결합 단편의 재조합 생산을 위하여 본 발명의 폴리뉴클레오티드의 복제 또는 발현의 목적으로 이용되며, 일반적으로 시그날 서열, 복제 기원, 하나 이상의 마커 유전자, 인핸서 요소, 프로모터 및 전사 종결 서열 중 하나 이상을 포함한다. 본 발명의 벡터는 바람직하게는 발현벡터일 수 있으며, 더욱 바람직하게는 조절시퀀스, 예를 들어 프로모터에 작동 가능하게 연결된 본 발명의 폴리뉴클레오티드를 포함하는 벡터일 수 있다.The 'vector' of the present invention is used for the purpose of cloning or expressing the polynucleotide of the present invention for recombinant production of the antibody or antigen-binding fragment thereof of the present invention, and generally contains a signal sequence, origin of replication, and one or more markers. It includes one or more of a gene, an enhancer element, a promoter, and a transcription termination sequence. The vector of the present invention may preferably be an expression vector, and more preferably may be a vector containing a control sequence, for example, a polynucleotide of the present invention operably linked to a promoter.
벡터의 일종인 플라스미드(plasmid)는 외부의 폴리뉴클레오티드 단편들이 결합될 수 있는 선형 또는 원형의 이중 나선의 DNA 분자를 의미한다. 벡터의 다른 형태는 바이러스성 벡터(viral vector; 예를 들어, 복제-결핍 레트로바이러스(replication defective retroviruses), 아데노바이러스들 및 아데노-연관 바이러스들 (adenoassociated viruses))이며, 여기에서 부가의 DNA 단편들은 상기 바이러스성 게놈(viral genome) 내로 도입될 수 있다. 특정의 벡터들은 그 안으로 이들이 도입되는 숙주세포(예를 들어, 박테리아 유래(bacterial origin) 및 에피좀의 포유류 벡터(episomal mammalian vectors)를 포함하는 박테리아성 벡터들(bacterialvectors)) 내에서의 자가복제(autonomous replication)를 할 수 있다. 다른 벡터들(예를 들어, 비-에피좀의 포유동물 벡터들(non-episomal mammalian vectors))이 숙주세포 내로의 도입에 의한 숙주세포의 게놈내로 통합(integrated)되고 그리고 그에 의하여 상기 숙주 게놈과 함께 복제된다.A plasmid, a type of vector, refers to a linear or circular double-helix DNA molecule to which external polynucleotide fragments can be combined. Another type of vector is a viral vector (e.g., replication defective retroviruses, adenoviruses and adeno-associated viruses), in which additional DNA fragments are It can be introduced into the viral genome. Certain vectors are capable of self-replication (e.g., bacterial vectors, including bacterial origin and episomal mammalian vectors) into which they are introduced. autonomous replication). Other vectors (e.g., non-episomal mammalian vectors) are integrated into the genome of a host cell by introduction into the host cell and thereby interact with the host genome. replicated together.
본 발명에서 상기 '벡터'는 '발현벡터(expression vector)'와 동일한 의미로 이해될 수 있으며, 이는 상기 폴리뉴클레오티드의 발현할 수 있는 벡터의 한 형태이다. 하나의 폴리뉴클레오티드 시퀀스는, 조절 시퀀스가 상기 폴리뉴클레오티드 시퀀스의 발현(예를 들어, 수준, 타이밍 또는 발현의 위치)에 영향을 주는 경우, 상기 조절 시퀀스(regulatory sequence)에 "작동가능하게 연결"된다. 상기 조절 시퀀스는 그것이 작동가능하게 연결되는 핵산의 발현(예를 들어, 수준, 타이밍 또는 발현의 위치)에 영향을 주는 서열이다. 상기 조절 시퀀스는, 예를 들어, 조절된 핵산에 직접적으로 또는 하나 또는 그 이상의 다른 분자들(예를 들어, 상기 조절 시퀀스 및/또는 상기 핵산에 결합하는 폴리펩티드들)의 작용을 통하여 그의 영향이 미치도록 할 수 있다. 상기 조절 시퀀스에는 프로모터(promoters), 인핸서(enhancers) 및 다른 발현 조절 요소들이 포함된다. 본 발명의 벡터는 바람직하게는 pOptiVECTM-TOPO 및 pcDNATM3.3-TOPO일 수 있다.In the present invention, the 'vector' can be understood to have the same meaning as an 'expression vector', which is a type of vector capable of expressing the polynucleotide. A polynucleotide sequence is “operably linked” to a regulatory sequence if the regulatory sequence affects expression (e.g., level, timing or location of expression) of the polynucleotide sequence. . The regulatory sequence is a sequence that affects the expression (e.g., level, timing or location of expression) of the nucleic acid to which it is operably linked. The regulatory sequence may exert its influence, for example, directly on the regulated nucleic acid or through the action of one or more other molecules (e.g., polypeptides that bind the regulatory sequence and/or the nucleic acid). You can do it. The regulatory sequences include promoters, enhancers and other expression control elements. The vector of the present invention may preferably be pOptiVEC -TOPO and pcDNA 3.3-TOPO.
본 발명은 또한 상기 벡터로 형질 전환된 세포를 제공한다.The present invention also provides cells transformed with the vector.
본 발명의 세포는 본 발명의 발현 벡터에 포함된 항체 또는 그 단편을 암호화하는 폴리뉴클레오티드를 발현하는데 사용될 수 있는 세포라면 그 종류는 특별히 제한되지 아니한다. 본 발명에 따른 발현 벡터로 형질 전환된 세포(숙주세포)는 원핵생물(예를 들어, 대장균), 진핵생물(예를 들어, 효모 또는 다른 균류), 식물 세포(예를 들어, 담배 또는 토마토 식물 세포), 동물 세포(예를 들어, 인간 세포, 원숭이 세포, 햄스터(hamster) 세포, 랫 세포(rat cell), 마우스 세포(mouse cell), 곤충 세포 또는 이들에서 유래한 하이브리도마일 수도 있다. 바람직하게는 인간을 포함하는 포유류에서 유래한 세포일 수 있다.The type of cell of the present invention is not particularly limited as long as it can be used to express the polynucleotide encoding the antibody or fragment thereof contained in the expression vector of the present invention. Cells (host cells) transformed with the expression vector according to the present invention include prokaryotes (e.g., Escherichia coli), eukaryotes (e.g., yeast or other fungi), and plant cells (e.g., tobacco or tomato plants). cells), animal cells (e.g., human cells, monkey cells, hamster cells, rat cells, mouse cells, insect cells, or hybridomas derived from these. Preferred. In other words, it may be a cell derived from a mammal, including humans.
본 목적에 적합한 원핵생물은 그람 음성 또는 그람 양성 유기체, 예를 들어 엔테로박테리아새(Enterobacteriaceae), 예를 들어 에스케리치아(Escherichia), 예를 들어 이. 콜라이(E.coli), 엔테로박터(Enterobacter), 에르위니아(Erwinia), 클렙시엘라(Klebsiella), 프로테우스(Proteus), 살모넬라(Salmonella), 예를 들어, 살모넬라 티피무륨(Salmonella typhimurium), 세라티아(Serratia), 예를 들어, 세라티아 마르세스칸스(Serratia marcescans) 및 시겔라(Shigella), 및 바실리(Bacilli), 예를 들어, 비. 섭틸리스(B. subtilis) 및 비. 리케니포르미스(B. licheniformis), 슈도모나스(Pseudomonas), 예를 들어 피.애루기노사(P.aeruginosa) 및 스트렙토마이세스(Streptomyces)를 포함한다. 본 발명의 세포는 본 발명의 벡터를 발현 가능한 것이면, 특별히 제한되지 아니하나, 바람직하게는 이. 콜라이일 수 있다.Prokaryotes suitable for this purpose are Gram-negative or Gram-positive organisms, for example Enterobacteriaceae , for example Escherichia , for example E. E.coli , Enterobacter , Erwinia , Klebsiella, Proteus , Salmonella , such as Salmonella typhimurium , Serratia ( Serratia ), such as Serratia marcescans and Shigella , and Bacilli , such as B. B. subtilis and B. Includes B. licheniformis, Pseudomonas , such as P. aeruginosa and Streptomyces . The cell of the present invention is not particularly limited as long as it is capable of expressing the vector of the present invention, but is preferably E. It could be coli.
본 발명의 세포로서 진핵생물은 사카로마이세스 세레비지아에(Saccharomyces cerevisiae)가 가장 흔히 사용된다. 그러나, 많은 다른 속, 종 및 균주, 이에 한정되지 아니하나, 예를 들어 쉬조사카로마이세스폼베(Schizosaccharomyces pombe), 클루이베로마이세스 숙주, 예를 들어 케이. 락티스(K.lactis), 케이. 프라길리스(K. fragilis)(ATCC 12,424), 케이. 불가리쿠스(K. bulgaricus)(ATCC 16,045), 케이. 위커라미(K.wickeramii)(ATCC 24,178), 케이. 왈티(K. waltii)(ATCC 56,500), 케이. 드로소필라룸(K.drosophilarum)(ATCC 36,906), 케이. 테르모톨레란스(K. thermotolerans) 및 케이. 마르시아누스(K.marxianus); 야로위아(yarrowia)(EP 402,226); 피키아 파스토리스(Pichia pastoris)(EP 183,070); 칸디다(Candida); 트리코데르마 레에시아(Trichoderma reesei(EP 244,234)); 뉴로스포라 크라사(Neurospora crassa);쉬바니오마이세스(Schwanniomyces), 예를 들어 쉬바니오마이세스 옥시덴탈리스(occidentalis); 및 필라멘트성진균, 예를 들어 뉴로스포라, 페니실리움(Penicillium), 톨리포클라디움(Tolypocladium) 및 아스퍼질러스(Aspergillus) 숙주, 예를 들어 에이. 니둘란스(A. nidulans) 및 에이. 니거(A. niger)가 사용가능하다.The most commonly used eukaryotic cell as the cell of the present invention is Saccharomyces cerevisiae . However, many other genera, species and strains, including but not limited to Schizosaccharomyces pombe , Kluyveromyces hosts, such as K. Lactis ( K. lactis ), K. K. fragilis (ATCC 12,424), K. K. bulgaricus (ATCC 16,045), K. Wickeramii ( K. wickeramii ) (ATCC 24,178), K. K. waltii (ATCC 56,500), K. Drosophilarum ( K.drosophilarum ) (ATCC 36,906), K. Thermotolerans ( K. thermotolerans ) and K. Marcianus ( K.marxianus ); Yarrowia (EP 402,226); Pichia pastoris (EP 183,070); Candida ; Trichoderma reesei (EP 244,234); Neurospora crassa ; Schwanniomyces , for example occidentalis ; and filamentous fungi, such as Neurospora, Penicillium , Tolypocladium and Aspergillus hosts, such as A. nidulans ( A. nidulans ) and A. Niger ( A. niger ) is available.
상기 "형질전환(transformation)"은 외래성 폴리뉴클레오티드가 도입됨에 의한 숙주 세포의 유전자형의 변형을 의미하며, 그 형질전환에 사용된 방법과 상관없이 외래성 폴리뉴클레오티드가 숙주 세포 내로 도입된 것을 의미한다. 숙주 세포 내로 도입된 외래성 폴리뉴클레오티드는 숙주 세포의 게놈 내로 통합되어 유지되거나 통합되지 않고 유지될 수 있는데, 본 발명은 양자 모두 포함한다.The term “transformation” refers to modification of the genotype of a host cell by introducing an exogenous polynucleotide, and refers to the introduction of the exogenous polynucleotide into the host cell regardless of the method used for the transformation. The exogenous polynucleotide introduced into the host cell may be integrated into the genome of the host cell and may be maintained or may be maintained without integration, and the present invention includes both.
상기 재조합 발현 벡터는 당업계에 공지된 방법, 예를 들어 이에 한정되지는 않으나, 일시적 형질감염(transient transfection), 미세주사, 형질도입(transduction), 세포융합, 칼슘 포스페이트 침전법, 리포좀 매개된 형질감염(liposome-mediated transfection), DEAE 덱스트란-매개된 형질감염(DEAE dextran- mediated transfection), 폴리브렌-매개된 형질감염(polybrene-mediated transfection), 전기천공법(electroporation), 유전자 총(gene gun) 및 세포 내로 핵산을 유입시키기 위한 공지의 방법에 의해 항체 또는 그 단편을 생산하기 위한 세포 내부로 도입하여 형질 전환할 수 있다The recombinant expression vector may be used by methods known in the art, such as, but not limited to, transient transfection, microinjection, transduction, cell fusion, calcium phosphate precipitation, and liposome-mediated transformation. Liposome-mediated transfection, DEAE dextran-mediated transfection, polybrene-mediated transfection, electroporation, gene gun ) and can be transformed by introducing them into cells to produce antibodies or fragments thereof using known methods for introducing nucleic acids into cells.
또한, 본 발명의 상기 세포는 본 발명의 상기 폴리뉴클레오티드 또는 이를 포함하는 벡터로 형질전환되거나 또는 형질감염(transfected)될 수 있는 배양된 세포이고, 이는 계속해서 상기 숙주세포 내에서 발현될 수 있다. 재조합 세포는 발현되어야 할 폴리뉴클레오티드로 형질전환되거나 또는 형질감염된 세포를 말한다. 본 발명의 세포는 또한 본 발명의 폴리뉴클레오티드를 포함하나, 조절 시퀀스가 상기 폴리뉴클레오티드에 작동 가능하게 연결되도록 상기 세포 내로 도입되지 않는 한 이를 원하는 수준으로 발현하지 않는 세포가 될 수 있다.In addition, the cell of the present invention is a cultured cell that can be transformed or transfected with the polynucleotide of the present invention or a vector containing it, and can be continuously expressed in the host cell. Recombinant cells refer to cells that have been transformed or transfected with a polynucleotide to be expressed. A cell of the invention may also be a cell that contains a polynucleotide of the invention but does not express it at the desired level unless regulatory sequences are introduced into the cell such that it is operably linked to the polynucleotide.
본 발명의 세포는 다양한 배지에서 배양될 수 있다. 상업적으로 이용가능한 배지, 예컨대 햄(Ham's) F1O(Sigma-Aldrich Co., St. Louis, MO), 최소 필수 배지(MEM, Sigma-Aldrich Co.), RPMI-1640(Sigma-Aldrich Co.), 및 둘베코(Dulbecco's) 개질 이글(Eagle's) 배지(DMEM, Sigma-Aldrich Co.)가 세포를 배양하기에 적합하다. 상기 배지는 필요하다면 호르몬 및/또는 다른 성장 인자, 염, 완충액, 뉴클레오티드, 항생제, 미량 원소 및 글루코스 또는 동등 에너지원이 추가될 수 있다.Cells of the present invention can be cultured in various media. Commercially available media such as Ham's F1O (Sigma-Aldrich Co., St. Louis, MO), minimal essential medium (MEM, Sigma-Aldrich Co.), RPMI-1640 (Sigma-Aldrich Co.), and Dulbecco's modified Eagle's medium (DMEM, Sigma-Aldrich Co.) are suitable for culturing cells. The medium may be supplemented with hormones and/or other growth factors, salts, buffers, nucleotides, antibiotics, trace elements and glucose or equivalent energy sources if necessary.
본 발명은 상기 세포를 폴리뉴클레오티드가 발현되는 조건하에서 배양하여, 경쇄 및 중쇄가변영역을 포함하는 폴리펩타이드를 생산하는 단계 및 상기 세포 또는 이를 배양한 배양 배지로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는, 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편 생산방법을 제공한다.The present invention includes the steps of culturing the cells under conditions in which polynucleotides are expressed, producing polypeptides containing light chain and heavy chain variable regions, and recovering the polypeptides from the cells or the culture medium in which they were cultured. , provides a method for producing an antibody or antigen-binding fragment thereof that specifically binds to a SIRPα variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
본 발명에서 생산방법의 세포에 대하여는 상기 기술한 바와 같으며, 본 발명의 항체를 암호화하는 폴리뉴클레오티드를 포함하고 있다. 상기 생산방법의 폴리펩타이드는 본 발명의 항체 또는 그 단편 그 자체일 수 있으며, 본 발명의 항체 또는 그 단편 외 다른 아미노산서열이 추가로 결합된 것일 수 있다.The cells used in the production method of the present invention are as described above, and contain a polynucleotide encoding the antibody of the present invention. The polypeptide of the above production method may be the antibody of the present invention or its fragment itself, or may be an additional amino acid sequence other than the antibody of the present invention or its fragment.
또한 본 발명의 생산방법은 상기 회수된 폴리펩타이드를 정제하는 단계를 추가로 수행할 수 있다. Additionally, the production method of the present invention may additionally carry out the step of purifying the recovered polypeptide.
이 경우 본 기술분야의 통상의 기술자에게 잘 알려져 있는 방법을 이용하여 본 발명의 항체 또는 그 단편으로부터 제거할 수 있다. 상기 배양은 상기 세포의 종류에 따라 배지 조성 및 배양 조건이 달라질 수 있으며, 이는 본 기술분야의 통상의 기술자가 적절히 선택 및 조절할 수 있다.In this case, it can be removed from the antibody or fragment thereof of the present invention using methods well known to those skilled in the art. The culture medium composition and culture conditions may vary depending on the type of cell, which can be appropriately selected and adjusted by a person skilled in the art.
상기 항체 분자는 세포의 세포질 내에 축적되거나, 세포로부터 분비되거나, 적절한 신호 서열에 의하여 페리플라즘 또는 세포외 배지(supernatant)로 표적화(targeted)될 수 있으며, 페리플라즘 또는 세포외 배지로 표적화되는 것이 바람직하다. 또한, 생산된 항체 분자를 본 기술분야의 통상의 기술자에게 잘 알려져 있는 방법을 이용하여 리폴딩(refolding)시키고 기능적 형태(conformation)를 갖도록 하는 것이 바람직하다. 상기 폴리펩타이드의 회수는 생산된 폴리펩타이드의 특성 및 세포의 특성에 따라 달라질 수 있으며, 이는 본 기술분야의 통상의 지식을 가진자가 적절히 선택 및 조절할 수 있다.The antibody molecule may accumulate in the cytoplasm of the cell, be secreted from the cell, or be targeted to the periplasm or extracellular medium (supernatant) by an appropriate signal sequence, and may be targeted to the periplasm or extracellular medium. It is desirable. In addition, it is desirable to refold the produced antibody molecule using a method well known to those skilled in the art and give it a functional conformation. The recovery of the polypeptide may vary depending on the characteristics of the produced polypeptide and the characteristics of the cell, which can be appropriately selected and adjusted by those skilled in the art.
상기 폴리펩타이드는 세포내, 주변 세포질 공간에 생산되거나 배지 내로 직접 분비될 수 있다. 만약 폴리펩타이드가 세포 내에서 생산되면, 이 세포는 제1단계로서 단백질을 방출하기 위하여 파괴될 수 있다. 입자형 파편, 숙주 세포 또는 용해된 단편은 예를 들어 원심분리 또는 한외여과에 의해 제거된다. 항체가 배지 내로 분비되는 경우, 이러한 발현 시스템으로부터의 상등액을 일반적으로 먼저 상업적으로 이용가능한 단백질 농축 필터, 예를 들어 Amicon 또는 Millipore Pellicon 한외여과 유닛을 사용하여 농축시킨다. 단백분해를 억제하기 위하여 프로테아제 억제제, 예를 들어 PMSF가 임의의 선행 단계에 포함될 수 있고, 우발적인 오염물의 성장을 방지하기 위하여 항생제가 포함될 수 있다. 세포로부터 제조된 항체는 예를 들어 하이드록시아파타이트 크로마토그래피, 겔 전기영동, 투석 및 친화도 크로마토그래피를 사용하여 정제될 수 있고, 본 발명의 항체는 바람직하게는 친화도 크로마토그래피를 통하여 정제할 수 있다.The polypeptide may be produced intracellularly, in the periplasmic space, or secreted directly into the medium. If the polypeptide is produced within a cell, the cell can be destroyed to release the protein as a first step. Particulate debris, host cells or dissolved fragments are removed, for example by centrifugation or ultrafiltration. When antibodies are secreted into the medium, supernatants from such expression systems are typically first concentrated using commercially available protein concentration filters, such as Amicon or Millipore Pellicon ultrafiltration units. Protease inhibitors, such as PMSF, may be included in any preceding step to inhibit proteolysis, and antibiotics may be included to prevent the growth of accidental contaminants. Antibodies prepared from cells can be purified using, for example, hydroxyapatite chromatography, gel electrophoresis, dialysis and affinity chromatography, and the antibodies of the present invention can preferably be purified using affinity chromatography. there is.
본 발명은 또한 하기 단계를 포함하는, 시료 내에서 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체를 검출하는 방법을 제공한다:The present invention also provides a method for detecting SIRPα variants comprising the amino acid sequence of SEQ ID NO: 2 in a sample, comprising the following steps:
(a) 상기 시료를 본 발명의 항체 또는 이의 항원 결합 단편과 접촉시키는 단계; 및(a) contacting the sample with an antibody or antigen-binding fragment thereof of the present invention; and
(b) 상기 시료와 상기 항체 또는 이의 항원 결합 단편의 결합을 검출하는 단계.(b) detecting the binding of the sample to the antibody or antigen-binding fragment thereof.
SIRPα 변이체 및 항체의 결합은 당업자라면 입수가능한 다양한 검정법들에 의해 검출되고/거나 정량되고/거나 결정될 수 있다. 검정법들을 수행하는 임의의 적합한 수단들이 본 발명의 범주 내에 포함되기는 하지만, 상세하게 형광 활성화 세포 선별법 (FACS), 엘라이자, 웨스턴 블럿팅 및 면역조직화학법 (IHC)이 언급될 수 있다. 바람직한 방법들로는 IHC 및 FACS를 포함한다.Binding of SIRPa variants and antibodies can be detected and/or quantified and/or determined by a variety of assays available to those skilled in the art. Although any suitable means of performing the assays are included within the scope of the present invention, specific mention may be made of fluorescence activated cell sorting (FACS), ELISA, Western blotting and immunohistochemistry (IHC). Preferred methods include IHC and FACS.
본 발명에서 상기 시료는 생물학적 시료일 수 있다. "생물학적 시료"는 개체로부터 채취할 수 있는 임의의 시료일 수 있다. In the present invention, the sample may be a biological sample. A “biological sample” may be any sample that can be taken from an individual.
바람직한 생물학적 시료들은 암이 액체 종양인 경우라면, 혈액 시료, 혈장 시료 또는 림프 시료와 같은 시료들을 포함한다.Preferred biological samples include samples such as blood samples, plasma samples, or lymph samples, if the cancer is a liquid tumor.
바람직한 생물학적 시료들은 암이 고체 종양인 경우라면, 생검 시료 또는 수술적 절제 요법으로부터 채취한 시료와 같은 시료들을 포함한다.Preferred biological samples include samples such as biopsy samples or samples from surgical resection therapy, if the cancer is a solid tumor.
바람직하게, 생물학적 시료는 인간 기원의 혈청, 전혈 세포들, 조직 시료 또는 생검과 같은 생물학적 액체이다. 시료는 예를 들면 생검된 조직을 포함할 수 있다. Preferably, the biological sample is a biological liquid such as serum, whole blood cells, tissue sample or biopsy of human origin. The sample may include, for example, biopsied tissue.
본 발명에 따른 항체 또는 이의 항원 결합 단편은 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체를 발현하여 정제하고 이를 연구하는 과정 중 SIRPα 변이체의 존재 여부를 정확하게 확인하고 정량할 수 있는 효과를 나타낸다. The antibody or antigen-binding fragment thereof according to the present invention has the effect of accurately confirming and quantifying the presence of the SIRPα variant during the process of expressing and purifying and studying the SIRPα variant containing the amino acid sequence of SEQ ID NO: 2.
도 1은 본 발명의 실시예에서 제조한 2종 항체가 SIRPα 변이체를 검출할 수 있는지 여부를 ELISA assay로 평가한 결과이다. Figure 1 shows the results of evaluating whether the two types of antibodies prepared in the examples of the present invention can detect SIRPα variants by ELISA assay.
도 2는 본 발명의 실시예에서 제조한 2종 항체가 SIRPα 변이체를 검출할 수 있는지 여부를 웨스턴 블로팅으로 평가한 결과이다. Figure 2 shows the results of evaluating by Western blotting whether the two types of antibodies prepared in the examples of the present invention can detect SIRPα variants.
이하, 본 발명을 하기 실시예에 의해 상세히 설명한다. 단, 하기 실시예는 본 발명을 예시하기 위한 것일 뿐, 본 발명이 이들에 의해 제한되는 것은 아니다.Hereinafter, the present invention will be explained in detail by the following examples. However, the following examples are only for illustrating the present invention, and the present invention is not limited thereto.
1. SIRPα 변이체 (vSIRPα) 특이적인 단일클론 항체의 제작1. Construction of SIRPα variant (vSIRPα) specific monoclonal antibody
서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체에 특이적인 단일클론 항체를 다음과 같은 단계에 따라 제작하였다:A monoclonal antibody specific for the SIRPα variant containing the amino acid sequence of SEQ ID NO: 2 was produced according to the following steps:
- 서열번호 2의 단백질을 Balb/c mice에 접종 후 splenocyte fusion을 통해 hybridoma 제작- Inoculate the protein of SEQ ID NO: 2 into Balb/c mice and produce hybridoma through splenocyte fusion.
- Subcloning 통해 monoclonality 확보 - Securing monoclonality through subcloning
상기 방법에 따라 2종의 항체를 선별하였다. Two types of antibodies were selected according to the above method.
2. 항- vSIRPα 항체를 이용한 indirect ELISA assay2. Indirect ELISA assay using anti-vSIRPα antibody
상기 방법에 따라 제작된 2종의 항체를 이용해 서열번호 2에 따른 vSIRPα를 검출할 수 있는지를 indirect ELISA assay로 확인하였다. It was confirmed by indirect ELISA assay whether vSIRPα according to SEQ ID NO: 2 could be detected using the two types of antibodies produced according to the above method.
실험 조건은 다음과 같다:The experimental conditions were as follows:
- Coating: 1.0 ug/ml, 100 ul vSIRPα antigen (서열번호 2) in PBS- Coating: 1.0 ug/ml, 100 ul vSIRPα antigen (SEQ ID NO: 2) in PBS
- 1차 항체: 개발한 항체 2종- Primary antibodies: 2 types of developed antibodies
- 2차 항체: Peroxidase-AffiniPure Goat Anti-Mouse IgG, Fcγ Fragment Specific (min X Hu,Bov,Hrs Sr Prot)- Secondary antibody: Peroxidase-AffiniPure Goat Anti-Mouse IgG, Fcγ Fragment Specific (min
이에 대한 결과를 도 1에 나타내었다. 도 1에 나타낸 바와 같이, 제작된 2종 항체는 서열번호 2의 아미노산 서열을 포함하는 vSIRPα를 검출하는 것으로 확인되었다. The results are shown in Figure 1. As shown in Figure 1, the two types of antibodies produced were confirmed to detect vSIRPα containing the amino acid sequence of SEQ ID NO: 2.
3. 항체 서열 분석3. Antibody sequence analysis
상기 제작된 2종 항체의 서열을 확인한 결과 parental clone을 공유하는 2개 항체가 동일한 항체로 확인되어, 1종류의 항체인 것으로 확인되었다. 이에 대한 서열 정보를 아래 표 1에 나타내었다. As a result of checking the sequences of the two types of antibodies produced above, the two antibodies sharing a parental clone were confirmed to be the same antibody, confirming that they are one type of antibody. The sequence information for this is shown in Table 1 below.
12G6A2C2 (12G6A2F11) 항체12G6A2C2 (12G6A2F11) antibody
Amino acid sequenceAmino acid sequence DNA sequenceDNA sequence
VHVH CDR-H1CDR-H1 GYYMH
(서열번호 3)
GYYMH
(SEQ ID NO: 3)
GGCTACTATATGCAC
(서열번호 11)
GGCTACTATATGCAC
(SEQ ID NO: 11)
CDR-H2CDR-H2 RINPYNGATNYNQNFKD
(서열번호 4)
RINPYNGATNYNQNFKD
(SEQ ID NO: 4)
CGTATTAATCCTTACAATGGTGCTACTAATTACAACCAGAATTTCAAGGAC (서열번호 12)CGTATTAATCCTTACAATGTGCTACTAATTACAACCAGAATTTCAAGGAC (SEQ ID NO: 12)
CDR-H3CDR-H3 NDGYYWYFDV
(서열번호 5)
NDGYYWYFDV
(SEQ ID NO: 5)
AATGATGGTTATTACTGGTACTTCGATGTC (서열번호 13)AATGATGGTTATTACTGGTACTTCGATGTC (SEQ ID NO: 13)
Full
(amino acid)
Full
(amino acid)
EVQLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSHVKSLEWIGRINPYNGATNYNQNFKDKASLTLDKSSSTAYVELHSLTSEDSAVYYCTRNDGYYWYFDVWGAGTTVTVSS (서열번호 9)EVQLQQSGPELVKPGASVKISCKASGYSFTGYYMHWVKQSHVKSLEWIGRINPYNGATNYNQNFKDKASLTLDKSSSTAYVELHSLTSEDSAVYYCTRNDGYYWYFDVWGAGTTVTVSS (SEQ ID NO: 9)
Full
(nucleotide)
Full
(nucleotide)
GAGGTCCAGCTGCAACAGTCTGGACCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAGATATCCTGCAAGGCTTCTGGTTACTCATTCACTGGCTACTATATGCACTGGGTGAAACAAAGCCATGTTAAGAGCCTTGAGTGGATTGGTCGTATTAATCCTTACAATGGTGCTACTAATTACAACCAGAATTTCAAGGACAAGGCCAGTTTGACTTTAGATAAGTCCTCCAGCACAGCCTACGTGGAGCTCCACAGCCTGACATCTGAGGACTCTGCAGTCTATTACTGTACAAGAAATGATGGTTATTACTGGTACTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCA (서열번호 17)GAGGTCCAGCTGCAACAGTCTGGACCTGAGCTGGTGAAGCCTGGGGCTTCAGTGAAGATATCCTGCAAGGCTTCTGGTTACTCATTCACTGGCTACTATATGCACTGGTGAAACAAAGCCATGTTAAGAGCCTTGAGTGGATTGGTCGTATTAATCCTTACAATGGTGCTACTAATTACAACCAGAATTTCAAGGACAAGGCCAGTTTGACTTTAGATAAGTCCTCCAGCACAGCCTACGTGGAGCTCCACAGCCTGACATCT GAGGACTCTGCAGTCTATTACTGTACAAGAAATGATGGTTATTACTGGTACTTCGATGTCTGGGGCGCAGGGACCACGGTCACCGTCTCCTCA (SEQ ID NO: 17)
VLV.L. CDR-L1CDR-L1 RASQSVDYIGASYMH
(서열번호 6)
RASQSVDYIGASYMH
(SEQ ID NO: 6)
AGAGCCAGCCAGAGTGTCGATTATATTGGAGCTAGTTATATGCAC
(서열번호 14)
AGAGCCAGCCAGAGTGTCGATTATATTGGAGCTAGTTATATGCAC
(SEQ ID NO: 14)
CDR-L2CDR-L2 TASNLES
(서열번호 7)
TASNLES
(SEQ ID NO: 7)
ACTGCATCCAACCTAGAATCT
(서열번호 15)
ACTGCATCCAACCTAGAATCT
(SEQ ID NO: 15)
CDR-L3CDR-L3 QQSIEDPCT
(서열번호 8)
QQSIEDPCT
(SEQ ID NO: 8)
CAGCAAAGTATTGAGGATCCGTGCACG (서열번호 16)CAGCAAAGTATTGAGGATCCGTGCACG (SEQ ID NO: 16)
Full
(amino acid)
Full
(amino acid)
DIVLTQSPASLAVSLGQRATIFCRASQSVDYIGASYMHWFQQKPGQPPKLLIYTASNLESGIPARFSGSGSGTDFTLSIHPVEEEDAATYYCQQSIEDPCTFGGGTKLEIK (서열번호 10)DIVLTQSPASLAVSLGQRATIFCRASQSVDYIGASYMHWFQQKPGQPPKLLIYTASNLESGIPARFSGSGSGTDFTLSIHPVEEEDAATYYCQQSIEDPCTFGGGTKLEIK (SEQ ID NO: 10)
Full
(nucleotide)
Full
(nucleotide)
GACATTGTGCTGACCCAATCTCCAGCTTCTTTGGCTGTGTCTCTAGGACAGAGAGCCACAATCTTCTGCAGAGCCAGCCAGAGTGTCGATTATATTGGAGCTAGTTATATGCACTGGTTCCAACAGAAACCAGGACAGCCACCCAAACTCCTCATCTATACTGCATCCAACCTAGAATCTGGGATCCCTGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGATTTCACCCTCAGCATCCATCCTGTGGAGGAGGAAGATGCTGCAACCTATTACTGTCAGCAAAGTATTGAGGATCCGTGCACGTTCGGAGGGGGGACCAAGCTGGAGATAAAA
(서열번호 18)
GACATTGTGCTGACCCAATCTCCAGCTTCTTTGGCTGTGTCTCTAGGACAGAGAGCCACAATCTTCTGCAGAGCCAGCCAGAGTGTCGATTATATTGGAGCTAGTTATATGCACTGGTTCCAACAGAAACCAGGACAGCCACCCAAACTCCTCATCTATACTGCATCCAACCTAGAATCTGGGATCCCTGCCAGGTTCAGTGGCAGTGGGTCTGGGACAGATTTCACCCTCAGCATCCATCCTGTGGAGGAGGAAGATGCTGCAA CCTATTACTGTCAGCAAAGTATTGAGGATCCGTGCACGTTCGGAGGGGGGACCAAGCTGGAGATAAAA
(SEQ ID NO: 18)
4. 항- vSIRPα항체를 이용한 웨스턴 블로팅4. Western blotting using anti-vSIRPα antibody
본 발명에서 제작한 상기 2종 항체가 서열번호 2의 아미노산 서열을 포함하는 vSIRPα를 특이적으로 검출할 수 있는지를 웨스턴 블로팅으로 확인하였다. 야생형의 SIRPα에 대한 항체를 비교군으로 사용하였다. It was confirmed by Western blotting whether the two antibodies produced in the present invention could specifically detect vSIRPα containing the amino acid sequence of SEQ ID NO: 2. An antibody against wild-type SIRPα was used as a comparison group.
이에 대한 결과를 도 2에 나타내었다. The results are shown in Figure 2.
도 2에 나타낸 바와 같이, 2종 항체 모두 서열번호 2의 아미노산 서열을 포함하는 vSIRPα 잘 검출하지만 야생형의 SIRPα(wtSIRPα)는 검출하지 못하는 것을 확인하였다.As shown in Figure 2, it was confirmed that both types of antibodies well detected vSIRPα containing the amino acid sequence of SEQ ID NO: 2, but failed to detect wild type SIRPα (wtSIRPα).
본 발명에 따른 항체 또는 이의 항원 결합 단편은 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체를 발현하여 정제하고 이를 연구하는 과정 중 SIRPα 변이체의 존재 여부를 정확하게 확인하고 정량할 수 있는 효과를 나타내므로, 산업상 이용가능성이 매우 높다.The antibody or antigen-binding fragment thereof according to the present invention has the effect of accurately confirming and quantifying the presence of the SIRPα variant during the process of expressing and purifying and studying the SIRPα variant containing the amino acid sequence of SEQ ID NO: 2, Industrial applicability is very high.

Claims (15)

  1. 서열번호 2의 아미노산 서열을 포함하는 SIRPα(Signal-regulatory protein alpha) 변이체 또는 이의 단편에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편.An antibody or antigen-binding fragment thereof that specifically binds to a SIRPα (Signal-regulatory protein alpha) variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
  2. 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은 (i) 서열번호 3으로 표시되는 아미노산 서열을 포함하는 중쇄 상보성 결정부위(CDR)1, 서열번호 4로 표시되는 아미노산 서열을 포함하는 중쇄 CDR2 및 서열번호 5로 표시되는 아미노산 서열을 포함하는 중쇄 CDR3을 포함하는 중쇄가변영역; 및 (ii) 서열번호 6으로 표시되는 아미노산 서열을 포함하는 경쇄 CDR1, 서열번호 7로 표시되는 아미노산 서열을 포함하는 경쇄 CDR2 및 서열번호 8로 표시되는 아미노산 서열을 포함하는 경쇄 CDR3을 포함하는 경쇄가변영역을 포함하는 것을 특징으로 하는 항체 또는 이의 항원 결합 단편.The method of claim 1, wherein the antibody or antigen-binding fragment thereof comprises (i) a heavy chain complementarity determining region (CDR) 1 comprising the amino acid sequence shown in SEQ ID NO: 3, a heavy chain CDR2 containing the amino acid sequence shown in SEQ ID NO: 4; and a heavy chain variable region comprising a heavy chain CDR3 comprising the amino acid sequence represented by SEQ ID NO: 5; and (ii) a light chain variable comprising a light chain CDR1 containing the amino acid sequence shown in SEQ ID NO: 6, a light chain CDR2 containing the amino acid sequence shown in SEQ ID NO: 7, and a light chain CDR3 containing the amino acid sequence shown in SEQ ID NO: 8. An antibody or antigen-binding fragment thereof characterized by comprising a region.
  3. 제1항에 있어서, 상기 항체 또는 이의 항원 결합 단편은 서열번호 9로 표시되는 아미노산 서열을 포함하는 중쇄가변영역; 및 서열번호 10으로 표시되는 아미노산 서열을 포함하는 경쇄가변영역을 포함하는 것을 특징으로 하는 항체 또는 이의 항원 결합 단편.The method of claim 1, wherein the antibody or antigen-binding fragment thereof includes a heavy chain variable region comprising the amino acid sequence represented by SEQ ID NO: 9; And an antibody or antigen-binding fragment thereof comprising a light chain variable region comprising the amino acid sequence represented by SEQ ID NO: 10.
  4. 제1항에 있어서, 상기 항체는 단일클론 항체인 것을 특징으로 하는 항체 또는 이의 항원 결합 단편.The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody is a monoclonal antibody.
  5. 제1항에 있어서, 상기 항체는 IgG, IgA, IgM, IgE 및 IgD로 이루어진 군에서 선택되는 것을 특징으로 하는 항체 또는 이의 항원 결합 단편.The antibody or antigen-binding fragment thereof according to claim 1, wherein the antibody is selected from the group consisting of IgG, IgA, IgM, IgE, and IgD.
  6. 제1항에 있어서, 상기 항체의 단편은 디아바디, Fab, Fab', F(ab)2, F(ab')2, Fv 및 scFv로 이루어진 군에서 선택되는 것을 특징으로 하는 항체 또는 이의 항원 결합 단편.The antibody or antigen-binding antibody of claim 1, wherein the fragment of the antibody is selected from the group consisting of diabody, Fab, Fab', F(ab)2, F(ab')2, Fv, and scFv. snippet.
  7. 제1항 내지 제6항 중 어느 한 항의 항체 또는 이의 항원 결합 단편을 암호화하는 폴리뉴클레오티드.A polynucleotide encoding the antibody or antigen-binding fragment thereof of any one of claims 1 to 6.
  8. 제7항에 있어서, 상기 폴리뉴클레오티드는 중쇄가변영역을 암호화하는 서열번호 17의 염기서열 및 경쇄가변영역을 암호화하는 서열번호 18의 염기서열로 이루어진 것을 특징으로 하는 폴리뉴클레오티드. The polynucleotide according to claim 7, wherein the polynucleotide consists of the base sequence of SEQ ID NO: 17 encoding the heavy chain variable region and the base sequence of SEQ ID NO: 18 encoding the light chain variable region.
  9. 제7항의 폴리뉴클레오티드를 포함하는 벡터.A vector containing the polynucleotide of claim 7.
  10. 제9항의 벡터로 형질 전환된 세포.Cells transformed with the vector of claim 9.
  11. 제10항에 있어서, 상기 세포는 원핵생물, 진핵생물, 식물 세포 또는 동물 세포인 것을 특징으로 하는 세포. The cell according to claim 10, wherein the cell is a prokaryotic cell, a eukaryotic cell, a plant cell, or an animal cell.
  12. 제10항의 세포를 폴리뉴클레오티드가 발현되는 조건하에서 배양하여, 경쇄 및 중쇄가변영역을 포함하는 폴리펩타이드를 생산하는 단계 및 상기 세포 또는 이를 배양한 배양 배지로부터 상기 폴리펩타이드를 회수하는 단계를 포함하는, 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체 또는 이의 단편에 특이적으로 결합하는 항체 또는 이의 항원 결합 단편 생산방법.Culturing the cell of claim 10 under conditions in which the polynucleotide is expressed, producing a polypeptide containing light chain and heavy chain variable regions, and recovering the polypeptide from the cell or the culture medium in which it was cultured, A method for producing an antibody or antigen-binding fragment thereof that specifically binds to a SIRPα variant or fragment thereof containing the amino acid sequence of SEQ ID NO: 2.
  13. 제12항에 있어서, 상기 회수된 폴리펩타이드를 정제하는 단계를 추가로 수행하는 것을 특징으로 하는 생산방법. The production method according to claim 12, further comprising purifying the recovered polypeptide.
  14. 하기 단계를 포함하는, 시료 내에서 서열번호 2의 아미노산 서열을 포함하는 SIRPα 변이체를 검출하는 방법:A method for detecting a SIRPα variant comprising the amino acid sequence of SEQ ID NO: 2 in a sample, comprising the following steps:
    (a) 상기 시료를 청구항 제1항 내지 제6항 중 어느 한 항에 따른 항체 또는 이의 항원 결합 단편과 접촉시키는 단계; 및(a) contacting the sample with the antibody or antigen-binding fragment thereof according to any one of claims 1 to 6; and
    (b) 상기 시료와 상기 항체 또는 이의 항원 결합 단편의 결합을 검출하는 단계.(b) detecting the binding of the sample to the antibody or antigen-binding fragment thereof.
  15. 제14항에 있어서, 상기 시료는 생물학적 시료인 것을 특징으로 하는 방법.The method of claim 14, wherein the sample is a biological sample.
PCT/KR2022/018507 2022-09-07 2022-11-22 ANTIBODY THAT SPECIFICALLY BINDS TO SIRPα VARIANT WO2024053788A1 (en)

Applications Claiming Priority (2)

Application Number Priority Date Filing Date Title
KR10-2022-0113704 2022-09-07
KR1020220113704A KR20240034954A (en) 2022-09-07 2022-09-07 Antibody specifically binding to SIRPα variant

Publications (1)

Publication Number Publication Date
WO2024053788A1 true WO2024053788A1 (en) 2024-03-14

Family

ID=90191441

Family Applications (1)

Application Number Title Priority Date Filing Date
PCT/KR2022/018507 WO2024053788A1 (en) 2022-09-07 2022-11-22 ANTIBODY THAT SPECIFICALLY BINDS TO SIRPα VARIANT

Country Status (2)

Country Link
KR (1) KR20240034954A (en)
WO (1) WO2024053788A1 (en)

Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
KR20180028548A (en) * 2015-08-07 2018-03-16 알렉소 테라퓨틱스 인크. SIRP-alpha domain or a variant thereof
KR102355240B1 (en) * 2016-04-14 2022-01-25 오제 이뮈노테라프틱스 Novel anti-SIRPa antibodies and methods of their therapeutic application
JP2022036957A (en) * 2015-05-18 2022-03-08 エービー イニチオ バイオセラピューティクス,インク. Sirp polypeptide compositions and methods of use

Patent Citations (3)

* Cited by examiner, † Cited by third party
Publication number Priority date Publication date Assignee Title
JP2022036957A (en) * 2015-05-18 2022-03-08 エービー イニチオ バイオセラピューティクス,インク. Sirp polypeptide compositions and methods of use
KR20180028548A (en) * 2015-08-07 2018-03-16 알렉소 테라퓨틱스 인크. SIRP-alpha domain or a variant thereof
KR102355240B1 (en) * 2016-04-14 2022-01-25 오제 이뮈노테라프틱스 Novel anti-SIRPa antibodies and methods of their therapeutic application

Non-Patent Citations (2)

* Cited by examiner, † Cited by third party
Title
DATABASE Protein 20 February 2018 (2018-02-20), ANONYMOUS : "immunoglobulin light chain, partial [Mus musculus]", XP093148503, retrieved from NCBI Database accession no. AVD98694.1 *
DATABASE Protein 31 August 2014 (2014-08-31), ANONYMOUS : "immunoglobulin heavy chain variable region, partial [Mus musculus]", XP093148510, retrieved from NCBI Database accession no. AGN91320.1 *

Also Published As

Publication number Publication date
KR20240034954A (en) 2024-03-15

Similar Documents

Publication Publication Date Title
US11180554B2 (en) Anti-human CD73 antibody
WO2019098682A1 (en) Anti-her2 antibody or antigen-binding fragment thereof, and chimeric antigen receptor comprising same
WO2020107715A1 (en) Anti-pd-l1/anti-4-1bb bispecific antibodies and uses thereof
WO2014119969A1 (en) C5 antibody and method for preventing and treating complement-related diseases
JP2021097705A (en) Antibodies that bind to human programmed death ligand 1 (PD-L1)
AU2010335950B2 (en) Method for decreasing immunogenicity
EP3172233B1 (en) Anti-cd74 antibodies, compositions comprising anti-cd74 antibodies and methods of using anti-cd74 antibodies
JP5414271B2 (en) Anti-IL2 antibody
WO2017164678A2 (en) Antibody that binds to envelope glycoprotein of severe fever with thrombocytopenia syndrome virus, and use for same
EP2328930B1 (en) Antibodies directed against pyroglutamate monocyte chemoattractant protein-1 (mcp-1 n1pe)
EA031447B1 (en) Antibodies that bind with sdr proteins and methods of use thereof
CN114729038A (en) High affinity antibodies to CD39 and uses thereof
WO2014115430A1 (en) Humanized anti-hmgb1 antibody or antigen-binding fragment thereof
KR102667026B1 (en) Anti-CLDN-5 antibody and medicine containing the antibody
WO2024053788A1 (en) ANTIBODY THAT SPECIFICALLY BINDS TO SIRPα VARIANT
WO2022216014A1 (en) Anti-cntn4 antibody and use thereof
AU2007320657B2 (en) Antibody recognizing C-domain of midkine
WO2019216675A1 (en) Epitope of regulatory t cell surface antigen and antibody specifically binding thereto
WO2017074013A1 (en) Antibody to be cross-linked to human and mouse sema3a, and use thereof
WO2020009482A1 (en) Anti-alpha-synuclein antibody and use thereof
WO2022154288A1 (en) Monoclonal antibody specifically binding to protein kinase a catalytic subunit alpha, and use thereof for cancer diagnosis
WO2022131889A1 (en) Use of taci protein
WO2022231032A1 (en) Anti-cntn4-specific antibodies and use thereof
WO2019078591A1 (en) Multimeric protein display system utilizing cell membrane fluidity
WO2022178255A2 (en) Single domain antibodies that neutralize sars-cov-2

Legal Events

Date Code Title Description
121 Ep: the epo has been informed by wipo that ep was designated in this application

Ref document number: 22958242

Country of ref document: EP

Kind code of ref document: A1