WO2024052563A1 - Myeloid-derived growth factor for use in treating cardiogenic shock - Google Patents
Myeloid-derived growth factor for use in treating cardiogenic shock Download PDFInfo
- Publication number
- WO2024052563A1 WO2024052563A1 PCT/EP2023/074803 EP2023074803W WO2024052563A1 WO 2024052563 A1 WO2024052563 A1 WO 2024052563A1 EP 2023074803 W EP2023074803 W EP 2023074803W WO 2024052563 A1 WO2024052563 A1 WO 2024052563A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- mydgf
- protein
- variant
- cardiogenic shock
- seq
- Prior art date
Links
- 102100031789 Myeloid-derived growth factor Human genes 0.000 title claims abstract description 175
- 101710164766 Myeloid-derived growth factor Proteins 0.000 title claims abstract description 167
- 206010007625 cardiogenic shock Diseases 0.000 title claims abstract description 122
- 108090000623 proteins and genes Proteins 0.000 claims abstract description 101
- 102000004169 proteins and genes Human genes 0.000 claims abstract description 89
- 150000007523 nucleic acids Chemical class 0.000 claims abstract description 49
- 102000039446 nucleic acids Human genes 0.000 claims abstract description 43
- 108020004707 nucleic acids Proteins 0.000 claims abstract description 43
- 238000000034 method Methods 0.000 claims abstract description 42
- 239000008194 pharmaceutical composition Substances 0.000 claims abstract description 40
- 239000013598 vector Substances 0.000 claims abstract description 31
- 239000012634 fragment Substances 0.000 claims description 54
- 230000008827 biological function Effects 0.000 claims description 28
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 claims description 23
- 229910052760 oxygen Inorganic materials 0.000 claims description 21
- 239000001301 oxygen Substances 0.000 claims description 21
- 230000010410 reperfusion Effects 0.000 claims description 21
- 210000004351 coronary vessel Anatomy 0.000 claims description 20
- 241000124008 Mammalia Species 0.000 claims description 19
- 238000001802 infusion Methods 0.000 claims description 16
- 230000001747 exhibiting effect Effects 0.000 claims description 15
- 239000000546 pharmaceutical excipient Substances 0.000 claims description 15
- 238000007920 subcutaneous administration Methods 0.000 claims description 10
- 238000002347 injection Methods 0.000 claims description 9
- 239000007924 injection Substances 0.000 claims description 9
- 238000001990 intravenous administration Methods 0.000 claims description 9
- 241000283984 Rodentia Species 0.000 claims description 6
- 238000001361 intraarterial administration Methods 0.000 claims description 5
- 238000004519 manufacturing process Methods 0.000 claims description 5
- 238000007918 intramuscular administration Methods 0.000 claims description 4
- 125000003275 alpha amino acid group Chemical group 0.000 claims 5
- 241001465754 Metazoa Species 0.000 abstract description 19
- 238000010171 animal model Methods 0.000 abstract description 9
- 235000018102 proteins Nutrition 0.000 description 86
- 241000699670 Mus sp. Species 0.000 description 79
- 150000001413 amino acids Chemical group 0.000 description 70
- 235000001014 amino acid Nutrition 0.000 description 36
- 230000014509 gene expression Effects 0.000 description 35
- 108090000765 processed proteins & peptides Proteins 0.000 description 35
- 210000004027 cell Anatomy 0.000 description 34
- 229940024606 amino acid Drugs 0.000 description 33
- 230000002861 ventricular Effects 0.000 description 33
- 229920001184 polypeptide Polymers 0.000 description 30
- 102000004196 processed proteins & peptides Human genes 0.000 description 30
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 28
- 208000010125 myocardial infarction Diseases 0.000 description 28
- 239000011780 sodium chloride Substances 0.000 description 24
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 23
- 238000011282 treatment Methods 0.000 description 17
- -1 DPP4 inhibitors Substances 0.000 description 16
- 206010021143 Hypoxia Diseases 0.000 description 16
- 210000004369 blood Anatomy 0.000 description 16
- 239000008280 blood Substances 0.000 description 16
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 15
- 230000000747 cardiac effect Effects 0.000 description 15
- 230000033228 biological regulation Effects 0.000 description 14
- 210000001519 tissue Anatomy 0.000 description 14
- 210000002216 heart Anatomy 0.000 description 13
- 230000001105 regulatory effect Effects 0.000 description 13
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 12
- 201000010099 disease Diseases 0.000 description 12
- 239000002773 nucleotide Substances 0.000 description 12
- 125000003729 nucleotide group Chemical group 0.000 description 12
- 150000003839 salts Chemical class 0.000 description 12
- 239000000243 solution Substances 0.000 description 12
- 208000035475 disorder Diseases 0.000 description 11
- 210000005240 left ventricle Anatomy 0.000 description 11
- 239000004480 active ingredient Substances 0.000 description 10
- 238000004458 analytical method Methods 0.000 description 10
- 230000030833 cell death Effects 0.000 description 10
- 238000012217 deletion Methods 0.000 description 9
- 230000037430 deletion Effects 0.000 description 9
- 230000001965 increasing effect Effects 0.000 description 9
- 239000007788 liquid Substances 0.000 description 9
- 230000035939 shock Effects 0.000 description 9
- 101001128431 Homo sapiens Myeloid-derived growth factor Proteins 0.000 description 8
- 206010061216 Infarction Diseases 0.000 description 8
- 108010047956 Nucleosomes Proteins 0.000 description 8
- 230000001154 acute effect Effects 0.000 description 8
- 238000002474 experimental method Methods 0.000 description 8
- 230000036044 hypoxaemia Effects 0.000 description 8
- 230000007574 infarction Effects 0.000 description 8
- 210000001623 nucleosome Anatomy 0.000 description 8
- 229940124531 pharmaceutical excipient Drugs 0.000 description 8
- 108091033319 polynucleotide Proteins 0.000 description 8
- 102000040430 polynucleotide Human genes 0.000 description 8
- 239000002157 polynucleotide Substances 0.000 description 8
- 206010058558 Hypoperfusion Diseases 0.000 description 7
- 239000003814 drug Substances 0.000 description 7
- 238000002169 hydrotherapy Methods 0.000 description 7
- 230000001146 hypoxic effect Effects 0.000 description 7
- 238000002560 therapeutic procedure Methods 0.000 description 7
- 238000013518 transcription Methods 0.000 description 7
- 230000035897 transcription Effects 0.000 description 7
- 239000013603 viral vector Substances 0.000 description 7
- JRWZLRBJNMZMFE-UHFFFAOYSA-N Dobutamine Chemical compound C=1C=C(O)C(O)=CC=1CCNC(C)CCC1=CC=C(O)C=C1 JRWZLRBJNMZMFE-UHFFFAOYSA-N 0.000 description 6
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 6
- 241000699666 Mus <mouse, genus> Species 0.000 description 6
- 108091005804 Peptidases Proteins 0.000 description 6
- 206010000891 acute myocardial infarction Diseases 0.000 description 6
- 239000000969 carrier Substances 0.000 description 6
- 229960001089 dobutamine Drugs 0.000 description 6
- 239000003623 enhancer Substances 0.000 description 6
- 239000000203 mixture Substances 0.000 description 6
- 230000008488 polyadenylation Effects 0.000 description 6
- 230000028327 secretion Effects 0.000 description 6
- 239000000126 substance Substances 0.000 description 6
- 230000004083 survival effect Effects 0.000 description 6
- 230000001052 transient effect Effects 0.000 description 6
- 238000009423 ventilation Methods 0.000 description 6
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 description 6
- 102100036475 Alanine aminotransferase 1 Human genes 0.000 description 5
- 108010082126 Alanine transaminase Proteins 0.000 description 5
- 206010002091 Anaesthesia Diseases 0.000 description 5
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 5
- 206010019280 Heart failures Diseases 0.000 description 5
- PIWKPBJCKXDKJR-UHFFFAOYSA-N Isoflurane Chemical compound FC(F)OC(Cl)C(F)(F)F PIWKPBJCKXDKJR-UHFFFAOYSA-N 0.000 description 5
- 239000004365 Protease Substances 0.000 description 5
- 238000007792 addition Methods 0.000 description 5
- 238000001949 anaesthesia Methods 0.000 description 5
- 230000037005 anaesthesia Effects 0.000 description 5
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 5
- 230000017531 blood circulation Effects 0.000 description 5
- 210000004899 c-terminal region Anatomy 0.000 description 5
- 230000003111 delayed effect Effects 0.000 description 5
- 239000003937 drug carrier Substances 0.000 description 5
- 230000004217 heart function Effects 0.000 description 5
- 230000001771 impaired effect Effects 0.000 description 5
- 229960002725 isoflurane Drugs 0.000 description 5
- 239000011159 matrix material Substances 0.000 description 5
- 230000002265 prevention Effects 0.000 description 5
- 230000002829 reductive effect Effects 0.000 description 5
- 208000024891 symptom Diseases 0.000 description 5
- 230000000451 tissue damage Effects 0.000 description 5
- 231100000827 tissue damage Toxicity 0.000 description 5
- 238000013519 translation Methods 0.000 description 5
- VBICKXHEKHSIBG-UHFFFAOYSA-N 1-monostearoylglycerol Chemical compound CCCCCCCCCCCCCCCCCC(=O)OCC(O)CO VBICKXHEKHSIBG-UHFFFAOYSA-N 0.000 description 4
- 108020004705 Codon Proteins 0.000 description 4
- LYCAIKOWRPUZTN-UHFFFAOYSA-N Ethylene glycol Chemical compound OCCO LYCAIKOWRPUZTN-UHFFFAOYSA-N 0.000 description 4
- 208000001953 Hypotension Diseases 0.000 description 4
- 108700026244 Open Reading Frames Proteins 0.000 description 4
- 108010076504 Protein Sorting Signals Proteins 0.000 description 4
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 4
- 210000001715 carotid artery Anatomy 0.000 description 4
- 238000007385 chemical modification Methods 0.000 description 4
- 238000003776 cleavage reaction Methods 0.000 description 4
- 230000003205 diastolic effect Effects 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 230000002708 enhancing effect Effects 0.000 description 4
- 239000007789 gas Substances 0.000 description 4
- 102000056374 human MYDGF Human genes 0.000 description 4
- 238000001727 in vivo Methods 0.000 description 4
- 230000000670 limiting effect Effects 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 230000007310 pathophysiology Effects 0.000 description 4
- 238000011321 prophylaxis Methods 0.000 description 4
- 235000019419 proteases Nutrition 0.000 description 4
- 229920002477 rna polymer Polymers 0.000 description 4
- 230000007017 scission Effects 0.000 description 4
- 238000001356 surgical procedure Methods 0.000 description 4
- 230000000287 tissue oxygenation Effects 0.000 description 4
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 4
- QTBSBXVTEAMEQO-UHFFFAOYSA-N Acetic acid Chemical compound CC(O)=O QTBSBXVTEAMEQO-UHFFFAOYSA-N 0.000 description 3
- 229930003347 Atropine Natural products 0.000 description 3
- 238000002965 ELISA Methods 0.000 description 3
- 206010016654 Fibrosis Diseases 0.000 description 3
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 3
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 3
- RKUNBYITZUJHSG-UHFFFAOYSA-N Hyosciamin-hydrochlorid Natural products CN1C(C2)CCC1CC2OC(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-UHFFFAOYSA-N 0.000 description 3
- 206010020880 Hypertrophy Diseases 0.000 description 3
- 206010061218 Inflammation Diseases 0.000 description 3
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 3
- 108091028043 Nucleic acid sequence Proteins 0.000 description 3
- 208000006117 ST-elevation myocardial infarction Diseases 0.000 description 3
- 108091081024 Start codon Proteins 0.000 description 3
- 241000282887 Suidae Species 0.000 description 3
- ZMANZCXQSJIPKH-UHFFFAOYSA-N Triethylamine Chemical compound CCN(CC)CC ZMANZCXQSJIPKH-UHFFFAOYSA-N 0.000 description 3
- 102000004903 Troponin Human genes 0.000 description 3
- 108090001027 Troponin Proteins 0.000 description 3
- 206010052428 Wound Diseases 0.000 description 3
- 208000027418 Wounds and injury Diseases 0.000 description 3
- 239000002253 acid Substances 0.000 description 3
- 235000004279 alanine Nutrition 0.000 description 3
- 210000001367 artery Anatomy 0.000 description 3
- RKUNBYITZUJHSG-SPUOUPEWSA-N atropine Chemical compound O([C@H]1C[C@H]2CC[C@@H](C1)N2C)C(=O)C(CO)C1=CC=CC=C1 RKUNBYITZUJHSG-SPUOUPEWSA-N 0.000 description 3
- 229960000396 atropine Drugs 0.000 description 3
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid Chemical compound OC(=O)C1=CC=CC=C1 WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 3
- 230000000903 blocking effect Effects 0.000 description 3
- IFKLAQQSCNILHL-QHAWAJNXSA-N butorphanol Chemical compound N1([C@@H]2CC3=CC=C(C=C3[C@@]3([C@]2(CCCC3)O)CC1)O)CC1CCC1 IFKLAQQSCNILHL-QHAWAJNXSA-N 0.000 description 3
- 229960001113 butorphanol Drugs 0.000 description 3
- 230000008859 change Effects 0.000 description 3
- KRKNYBCHXYNGOX-UHFFFAOYSA-N citric acid Chemical compound OC(=O)CC(O)(C(O)=O)CC(O)=O KRKNYBCHXYNGOX-UHFFFAOYSA-N 0.000 description 3
- 150000001875 compounds Chemical class 0.000 description 3
- 230000000694 effects Effects 0.000 description 3
- 230000004761 fibrosis Effects 0.000 description 3
- 238000009472 formulation Methods 0.000 description 3
- 230000002068 genetic effect Effects 0.000 description 3
- 239000008103 glucose Substances 0.000 description 3
- 230000000004 hemodynamic effect Effects 0.000 description 3
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 3
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 3
- 230000036543 hypotension Effects 0.000 description 3
- 238000000338 in vitro Methods 0.000 description 3
- 230000004054 inflammatory process Effects 0.000 description 3
- 230000002401 inhibitory effect Effects 0.000 description 3
- 230000000977 initiatory effect Effects 0.000 description 3
- 238000007912 intraperitoneal administration Methods 0.000 description 3
- 210000004731 jugular vein Anatomy 0.000 description 3
- 108020004999 messenger RNA Proteins 0.000 description 3
- 239000000178 monomer Substances 0.000 description 3
- 210000004165 myocardium Anatomy 0.000 description 3
- 210000000056 organ Anatomy 0.000 description 3
- 230000036961 partial effect Effects 0.000 description 3
- 230000004962 physiological condition Effects 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 238000012545 processing Methods 0.000 description 3
- 230000000750 progressive effect Effects 0.000 description 3
- 230000022532 regulation of transcription, DNA-dependent Effects 0.000 description 3
- 238000006467 substitution reaction Methods 0.000 description 3
- 230000002459 sustained effect Effects 0.000 description 3
- 230000035488 systolic blood pressure Effects 0.000 description 3
- 238000012360 testing method Methods 0.000 description 3
- 230000001225 therapeutic effect Effects 0.000 description 3
- 230000003612 virological effect Effects 0.000 description 3
- PKDBCJSWQUOKDO-UHFFFAOYSA-M 2,3,5-triphenyltetrazolium chloride Chemical compound [Cl-].C1=CC=CC=C1C(N=[N+]1C=2C=CC=CC=2)=NN1C1=CC=CC=C1 PKDBCJSWQUOKDO-UHFFFAOYSA-M 0.000 description 2
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 2
- 208000010444 Acidosis Diseases 0.000 description 2
- GUBGYTABKSRVRQ-XLOQQCSPSA-N Alpha-Lactose Chemical compound O[C@@H]1[C@@H](O)[C@@H](O)[C@@H](CO)O[C@H]1O[C@@H]1[C@@H](CO)O[C@H](O)[C@H](O)[C@H]1O GUBGYTABKSRVRQ-XLOQQCSPSA-N 0.000 description 2
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 238000011814 C57BL/6N mouse Methods 0.000 description 2
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 2
- 102000004726 Connectin Human genes 0.000 description 2
- 108010002947 Connectin Proteins 0.000 description 2
- 102100031051 Cysteine and glycine-rich protein 1 Human genes 0.000 description 2
- 108020004414 DNA Proteins 0.000 description 2
- 102000053602 DNA Human genes 0.000 description 2
- 102100036912 Desmin Human genes 0.000 description 2
- 108010044052 Desmin Proteins 0.000 description 2
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 2
- 206010052337 Diastolic dysfunction Diseases 0.000 description 2
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102100039165 Heat shock protein beta-1 Human genes 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 2
- GUBGYTABKSRVRQ-QKKXKWKRSA-N Lactose Natural products OC[C@H]1O[C@@H](O[C@H]2[C@H](O)[C@@H](O)C(O)O[C@@H]2CO)[C@H](O)[C@@H](O)[C@H]1O GUBGYTABKSRVRQ-QKKXKWKRSA-N 0.000 description 2
- 208000009378 Low Cardiac Output Diseases 0.000 description 2
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical compound CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 2
- 102100038319 Myosin-6 Human genes 0.000 description 2
- GXCLVBGFBYZDAG-UHFFFAOYSA-N N-[2-(1H-indol-3-yl)ethyl]-N-methylprop-2-en-1-amine Chemical compound CN(CCC1=CNC2=C1C=CC=C2)CC=C GXCLVBGFBYZDAG-UHFFFAOYSA-N 0.000 description 2
- 229910002651 NO3 Inorganic materials 0.000 description 2
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 2
- 240000007594 Oryza sativa Species 0.000 description 2
- 235000007164 Oryza sativa Nutrition 0.000 description 2
- 229910019142 PO4 Inorganic materials 0.000 description 2
- 235000019483 Peanut oil Nutrition 0.000 description 2
- 102000035195 Peptidases Human genes 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- 108091036407 Polyadenylation Proteins 0.000 description 2
- 102100022807 Potassium voltage-gated channel subfamily H member 2 Human genes 0.000 description 2
- 102100021674 Protein scribble homolog Human genes 0.000 description 2
- 241000700159 Rattus Species 0.000 description 2
- 230000010799 Receptor Interactions Effects 0.000 description 2
- 108010042291 Serum Response Factor Proteins 0.000 description 2
- 102100022056 Serum response factor Human genes 0.000 description 2
- VYPSYNLAJGMNEJ-UHFFFAOYSA-N Silicium dioxide Chemical compound O=[Si]=O VYPSYNLAJGMNEJ-UHFFFAOYSA-N 0.000 description 2
- 229920002472 Starch Polymers 0.000 description 2
- 229930006000 Sucrose Natural products 0.000 description 2
- CZMRCDWAGMRECN-UGDNZRGBSA-N Sucrose Chemical compound O[C@H]1[C@H](O)[C@@H](CO)O[C@@]1(CO)O[C@@H]1[C@H](O)[C@@H](O)[C@H](O)[C@@H](CO)O1 CZMRCDWAGMRECN-UGDNZRGBSA-N 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 2
- QAOWNCQODCNURD-UHFFFAOYSA-N Sulfuric acid Chemical compound OS(O)(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-N 0.000 description 2
- 206010071436 Systolic dysfunction Diseases 0.000 description 2
- FEWJPZIEWOKRBE-UHFFFAOYSA-N Tartaric acid Natural products [H+].[H+].[O-]C(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-N 0.000 description 2
- 102100022012 Transcription intermediary factor 1-beta Human genes 0.000 description 2
- 102100036960 Xin actin-binding repeat-containing protein 1 Human genes 0.000 description 2
- 230000002378 acidificating effect Effects 0.000 description 2
- 238000000540 analysis of variance Methods 0.000 description 2
- 230000033115 angiogenesis Effects 0.000 description 2
- 239000007864 aqueous solution Substances 0.000 description 2
- 230000004872 arterial blood pressure Effects 0.000 description 2
- 125000003118 aryl group Chemical group 0.000 description 2
- 229910052791 calcium Inorganic materials 0.000 description 2
- 239000011575 calcium Substances 0.000 description 2
- MIOPJNTWMNEORI-UHFFFAOYSA-N camphorsulfonic acid Chemical compound C1CC2(CS(O)(=O)=O)C(=O)CC1C2(C)C MIOPJNTWMNEORI-UHFFFAOYSA-N 0.000 description 2
- 239000002775 capsule Substances 0.000 description 2
- 238000012512 characterization method Methods 0.000 description 2
- 125000003636 chemical group Chemical group 0.000 description 2
- 238000007796 conventional method Methods 0.000 description 2
- 230000006378 damage Effects 0.000 description 2
- 210000005045 desmin Anatomy 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 239000008121 dextrose Substances 0.000 description 2
- 238000003745 diagnosis Methods 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- MOTZDAYCYVMXPC-UHFFFAOYSA-N dodecyl hydrogen sulfate Chemical compound CCCCCCCCCCCCOS(O)(=O)=O MOTZDAYCYVMXPC-UHFFFAOYSA-N 0.000 description 2
- 229940043264 dodecyl sulfate Drugs 0.000 description 2
- 239000002552 dosage form Substances 0.000 description 2
- CCIVGXIOQKPBKL-UHFFFAOYSA-M ethanesulfonate Chemical compound CCS([O-])(=O)=O CCIVGXIOQKPBKL-UHFFFAOYSA-M 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 235000013312 flour Nutrition 0.000 description 2
- 235000013305 food Nutrition 0.000 description 2
- 229920000159 gelatin Polymers 0.000 description 2
- 235000019322 gelatine Nutrition 0.000 description 2
- YQEMORVAKMFKLG-UHFFFAOYSA-N glycerine monostearate Natural products CCCCCCCCCCCCCCCCCC(=O)OC(CO)CO YQEMORVAKMFKLG-UHFFFAOYSA-N 0.000 description 2
- SVUQHVRAGMNPLW-UHFFFAOYSA-N glycerol monostearate Natural products CCCCCCCCCCCCCCCCC(=O)OCC(O)CO SVUQHVRAGMNPLW-UHFFFAOYSA-N 0.000 description 2
- 230000013595 glycosylation Effects 0.000 description 2
- 238000006206 glycosylation reaction Methods 0.000 description 2
- 229960002897 heparin Drugs 0.000 description 2
- 229920000669 heparin Polymers 0.000 description 2
- 238000004896 high resolution mass spectrometry Methods 0.000 description 2
- 210000003917 human chromosome Anatomy 0.000 description 2
- XMBWDFGMSWQBCA-UHFFFAOYSA-N hydrogen iodide Chemical compound I XMBWDFGMSWQBCA-UHFFFAOYSA-N 0.000 description 2
- 230000002209 hydrophobic effect Effects 0.000 description 2
- WGCNASOHLSPBMP-UHFFFAOYSA-N hydroxyacetaldehyde Natural products OCC=O WGCNASOHLSPBMP-UHFFFAOYSA-N 0.000 description 2
- 238000003780 insertion Methods 0.000 description 2
- 230000037431 insertion Effects 0.000 description 2
- 238000011813 knockout mouse model Methods 0.000 description 2
- 239000008101 lactose Substances 0.000 description 2
- 210000004185 liver Anatomy 0.000 description 2
- PWPJGUXAGUPAHP-UHFFFAOYSA-N lufenuron Chemical compound C1=C(Cl)C(OC(F)(F)C(C(F)(F)F)F)=CC(Cl)=C1NC(=O)NC(=O)C1=C(F)C=CC=C1F PWPJGUXAGUPAHP-UHFFFAOYSA-N 0.000 description 2
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 2
- 238000013160 medical therapy Methods 0.000 description 2
- 235000010446 mineral oil Nutrition 0.000 description 2
- 239000002480 mineral oil Substances 0.000 description 2
- 238000012544 monitoring process Methods 0.000 description 2
- 238000010172 mouse model Methods 0.000 description 2
- 210000003205 muscle Anatomy 0.000 description 2
- 230000035772 mutation Effects 0.000 description 2
- 210000004940 nucleus Anatomy 0.000 description 2
- 239000003921 oil Substances 0.000 description 2
- 235000019198 oils Nutrition 0.000 description 2
- 239000000312 peanut oil Substances 0.000 description 2
- 238000013146 percutaneous coronary intervention Methods 0.000 description 2
- 230000002093 peripheral effect Effects 0.000 description 2
- 230000002085 persistent effect Effects 0.000 description 2
- 239000003208 petroleum Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000010452 phosphate Substances 0.000 description 2
- 230000036470 plasma concentration Effects 0.000 description 2
- 230000004481 post-translational protein modification Effects 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 230000035755 proliferation Effects 0.000 description 2
- QQONPFPTGQHPMA-UHFFFAOYSA-N propylene Natural products CC=C QQONPFPTGQHPMA-UHFFFAOYSA-N 0.000 description 2
- 125000004805 propylene group Chemical group [H]C([H])([H])C([H])([*:1])C([H])([H])[*:2] 0.000 description 2
- 108020001580 protein domains Proteins 0.000 description 2
- 230000006337 proteolytic cleavage Effects 0.000 description 2
- 230000009467 reduction Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000004044 response Effects 0.000 description 2
- 235000009566 rice Nutrition 0.000 description 2
- 210000005241 right ventricle Anatomy 0.000 description 2
- 210000002966 serum Anatomy 0.000 description 2
- 239000008159 sesame oil Substances 0.000 description 2
- 235000011803 sesame oil Nutrition 0.000 description 2
- 239000000741 silica gel Substances 0.000 description 2
- 229910002027 silica gel Inorganic materials 0.000 description 2
- 235000020183 skimmed milk Nutrition 0.000 description 2
- 229910052708 sodium Inorganic materials 0.000 description 2
- 239000011734 sodium Substances 0.000 description 2
- RYYKJJJTJZKILX-UHFFFAOYSA-M sodium octadecanoate Chemical compound [Na+].CCCCCCCCCCCCCCCCCC([O-])=O RYYKJJJTJZKILX-UHFFFAOYSA-M 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 239000003549 soybean oil Substances 0.000 description 2
- 235000012424 soybean oil Nutrition 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 230000000087 stabilizing effect Effects 0.000 description 2
- 238000011272 standard treatment Methods 0.000 description 2
- 239000008107 starch Substances 0.000 description 2
- 235000019698 starch Nutrition 0.000 description 2
- 239000005720 sucrose Substances 0.000 description 2
- 210000001258 synovial membrane Anatomy 0.000 description 2
- 239000000454 talc Substances 0.000 description 2
- 229910052623 talc Inorganic materials 0.000 description 2
- 235000002906 tartaric acid Nutrition 0.000 description 2
- 229940124597 therapeutic agent Drugs 0.000 description 2
- 238000002627 tracheal intubation Methods 0.000 description 2
- 210000002700 urine Anatomy 0.000 description 2
- 235000013311 vegetables Nutrition 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- LSPHULWDVZXLIL-UHFFFAOYSA-N (+/-)-Camphoric acid Chemical compound CC1(C)C(C(O)=O)CCC1(C)C(O)=O LSPHULWDVZXLIL-UHFFFAOYSA-N 0.000 description 1
- GHOKWGTUZJEAQD-ZETCQYMHSA-N (D)-(+)-Pantothenic acid Chemical compound OCC(C)(C)[C@@H](O)C(=O)NCCC(O)=O GHOKWGTUZJEAQD-ZETCQYMHSA-N 0.000 description 1
- MIJDSYMOBYNHOT-UHFFFAOYSA-N 2-(ethylamino)ethanol Chemical compound CCNCCO MIJDSYMOBYNHOT-UHFFFAOYSA-N 0.000 description 1
- 229940080296 2-naphthalenesulfonate Drugs 0.000 description 1
- FEWJPZIEWOKRBE-UHFFFAOYSA-M 3-carboxy-2,3-dihydroxypropanoate Chemical compound OC(=O)C(O)C(O)C([O-])=O FEWJPZIEWOKRBE-UHFFFAOYSA-M 0.000 description 1
- ALKYHXVLJMQRLQ-UHFFFAOYSA-M 3-carboxynaphthalen-2-olate Chemical compound C1=CC=C2C=C(C([O-])=O)C(O)=CC2=C1 ALKYHXVLJMQRLQ-UHFFFAOYSA-M 0.000 description 1
- ZRPLANDPDWYOMZ-UHFFFAOYSA-N 3-cyclopentylpropionic acid Chemical compound OC(=O)CCC1CCCC1 ZRPLANDPDWYOMZ-UHFFFAOYSA-N 0.000 description 1
- XMIIGOLPHOKFCH-UHFFFAOYSA-M 3-phenylpropionate Chemical compound [O-]C(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-M 0.000 description 1
- QQGYZOYWNCKGEK-UHFFFAOYSA-N 5-[(1,3-dioxo-2-benzofuran-5-yl)oxy]-2-benzofuran-1,3-dione Chemical compound C1=C2C(=O)OC(=O)C2=CC(OC=2C=C3C(=O)OC(C3=CC=2)=O)=C1 QQGYZOYWNCKGEK-UHFFFAOYSA-N 0.000 description 1
- FHVDTGUDJYJELY-UHFFFAOYSA-N 6-{[2-carboxy-4,5-dihydroxy-6-(phosphanyloxy)oxan-3-yl]oxy}-4,5-dihydroxy-3-phosphanyloxane-2-carboxylic acid Chemical compound O1C(C(O)=O)C(P)C(O)C(O)C1OC1C(C(O)=O)OC(OP)C(O)C1O FHVDTGUDJYJELY-UHFFFAOYSA-N 0.000 description 1
- 239000005541 ACE inhibitor Substances 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- 241000251468 Actinopterygii Species 0.000 description 1
- 241000271566 Aves Species 0.000 description 1
- 239000005711 Benzoic acid Substances 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- BTBUEUYNUDRHOZ-UHFFFAOYSA-N Borate Chemical compound [O-]B([O-])[O-] BTBUEUYNUDRHOZ-UHFFFAOYSA-N 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-M Bromide Chemical compound [Br-] CPELXLSAUQHCOX-UHFFFAOYSA-M 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-M Butyrate Chemical compound CCCC([O-])=O FERIUCNNQQJTOY-UHFFFAOYSA-M 0.000 description 1
- FERIUCNNQQJTOY-UHFFFAOYSA-N Butyric acid Natural products CCCC(O)=O FERIUCNNQQJTOY-UHFFFAOYSA-N 0.000 description 1
- COXVTLYNGOIATD-HVMBLDELSA-N CC1=C(C=CC(=C1)C1=CC(C)=C(C=C1)\N=N\C1=C(O)C2=C(N)C(=CC(=C2C=C1)S(O)(=O)=O)S(O)(=O)=O)\N=N\C1=CC=C2C(=CC(=C(N)C2=C1O)S(O)(=O)=O)S(O)(=O)=O Chemical compound CC1=C(C=CC(=C1)C1=CC(C)=C(C=C1)\N=N\C1=C(O)C2=C(N)C(=CC(=C2C=C1)S(O)(=O)=O)S(O)(=O)=O)\N=N\C1=CC=C2C(=CC(=C(N)C2=C1O)S(O)(=O)=O)S(O)(=O)=O COXVTLYNGOIATD-HVMBLDELSA-N 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- 241000700198 Cavia Species 0.000 description 1
- 241000282693 Cercopithecidae Species 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-M Chloride anion Chemical compound [Cl-] VEXZGXHMUGYJMC-UHFFFAOYSA-M 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- HZZVJAQRINQKSD-UHFFFAOYSA-N Clavulanic acid Natural products OC(=O)C1C(=CCO)OC2CC(=O)N21 HZZVJAQRINQKSD-UHFFFAOYSA-N 0.000 description 1
- 101710185487 Cysteine and glycine-rich protein 1 Proteins 0.000 description 1
- RGHNJXZEOKUKBD-SQOUGZDYSA-M D-gluconate Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C([O-])=O RGHNJXZEOKUKBD-SQOUGZDYSA-M 0.000 description 1
- HMFHBZSHGGEWLO-SOOFDHNKSA-N D-ribofuranose Chemical compound OC[C@H]1OC(O)[C@H](O)[C@@H]1O HMFHBZSHGGEWLO-SOOFDHNKSA-N 0.000 description 1
- 102100024395 DCC-interacting protein 13-alpha Human genes 0.000 description 1
- 101710205480 DCC-interacting protein 13-alpha Proteins 0.000 description 1
- 102000012688 DDA1 Human genes 0.000 description 1
- 102100035746 DET1- and DDB1-associated protein 1 Human genes 0.000 description 1
- 102000004163 DNA-directed RNA polymerases Human genes 0.000 description 1
- 108090000626 DNA-directed RNA polymerases Proteins 0.000 description 1
- 101710088194 Dehydrogenase Proteins 0.000 description 1
- 241000196324 Embryophyta Species 0.000 description 1
- 108010059378 Endopeptidases Proteins 0.000 description 1
- 102000005593 Endopeptidases Human genes 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000701959 Escherichia virus Lambda Species 0.000 description 1
- 241000206602 Eukaryota Species 0.000 description 1
- 108010011459 Exenatide Proteins 0.000 description 1
- HTQBXNHDCUEHJF-XWLPCZSASA-N Exenatide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)NCC(=O)NCC(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(=O)N[C@@H](CO)C(=O)NCC(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CO)C(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCSC)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](CO)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)CNC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 HTQBXNHDCUEHJF-XWLPCZSASA-N 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- 241000724791 Filamentous phage Species 0.000 description 1
- BDAGIHXWWSANSR-UHFFFAOYSA-M Formate Chemical compound [O-]C=O BDAGIHXWWSANSR-UHFFFAOYSA-M 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 239000001828 Gelatine Substances 0.000 description 1
- 101800000224 Glucagon-like peptide 1 Proteins 0.000 description 1
- DTHNMHAUYICORS-KTKZVXAJSA-N Glucagon-like peptide 1 Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1N=CNC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 DTHNMHAUYICORS-KTKZVXAJSA-N 0.000 description 1
- 102400000322 Glucagon-like peptide 1 Human genes 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 108010045100 HSP27 Heat-Shock Proteins Proteins 0.000 description 1
- 101150096895 HSPB1 gene Proteins 0.000 description 1
- 241000175212 Herpesvirales Species 0.000 description 1
- 241001272567 Hominoidea Species 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000922020 Homo sapiens Cysteine and glycine-rich protein 1 Proteins 0.000 description 1
- 101000958741 Homo sapiens Myosin-6 Proteins 0.000 description 1
- 101001047090 Homo sapiens Potassium voltage-gated channel subfamily H member 2 Proteins 0.000 description 1
- 101001003584 Homo sapiens Prelamin-A/C Proteins 0.000 description 1
- 101000617017 Homo sapiens Protein scribble homolog Proteins 0.000 description 1
- 101000598783 Homo sapiens SCRIB overlapping open reading frame protein Proteins 0.000 description 1
- 101000753286 Homo sapiens Transcription intermediary factor 1-beta Proteins 0.000 description 1
- 101000851334 Homo sapiens Troponin I, cardiac muscle Proteins 0.000 description 1
- 101000804890 Homo sapiens Xin actin-binding repeat-containing protein 1 Proteins 0.000 description 1
- 241000701024 Human betaherpesvirus 5 Species 0.000 description 1
- CPELXLSAUQHCOX-UHFFFAOYSA-N Hydrogen bromide Chemical compound Br CPELXLSAUQHCOX-UHFFFAOYSA-N 0.000 description 1
- 206010020660 Hyperlactacidaemia Diseases 0.000 description 1
- 102000013691 Interleukin-17 Human genes 0.000 description 1
- 108050003558 Interleukin-17 Proteins 0.000 description 1
- 102000015696 Interleukins Human genes 0.000 description 1
- 108010063738 Interleukins Proteins 0.000 description 1
- CKLJMWTZIZZHCS-REOHCLBHSA-N L-aspartic acid Chemical compound OC(=O)[C@@H](N)CC(O)=O CKLJMWTZIZZHCS-REOHCLBHSA-N 0.000 description 1
- WHUUTDBJXJRKMK-VKHMYHEASA-N L-glutamic acid Chemical compound OC(=O)[C@@H](N)CCC(O)=O WHUUTDBJXJRKMK-VKHMYHEASA-N 0.000 description 1
- HNDVDQJCIGZPNO-YFKPBYRVSA-N L-histidine Chemical compound OC(=O)[C@@H](N)CC1=CN=CN1 HNDVDQJCIGZPNO-YFKPBYRVSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 1
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 108010019598 Liraglutide Proteins 0.000 description 1
- YSDQQAXHVYUZIW-QCIJIYAXSA-N Liraglutide Chemical compound C([C@@H](C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCC(O)=O)C(=O)NCC(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCCCNC(=O)CC[C@H](NC(=O)CCCCCCCCCCCCCCC)C(O)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(=O)N[C@@H](CCCNC(N)=N)C(=O)NCC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=C(O)C=C1 YSDQQAXHVYUZIW-QCIJIYAXSA-N 0.000 description 1
- 206010024648 Livedo reticularis Diseases 0.000 description 1
- 206010067125 Liver injury Diseases 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- 201000005505 Measles Diseases 0.000 description 1
- 206010027417 Metabolic acidosis Diseases 0.000 description 1
- 241001529936 Murinae Species 0.000 description 1
- 101001128432 Mus musculus Myeloid-derived growth factor Proteins 0.000 description 1
- 101710204027 Myosin-6 Proteins 0.000 description 1
- 206010028980 Neoplasm Diseases 0.000 description 1
- PVNIIMVLHYAWGP-UHFFFAOYSA-N Niacin Chemical compound OC(=O)C1=CC=CN=C1 PVNIIMVLHYAWGP-UHFFFAOYSA-N 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- 102100025875 Oxysterol-binding protein-related protein 11 Human genes 0.000 description 1
- 101710159720 Oxysterol-binding protein-related protein 11 Proteins 0.000 description 1
- 102100029181 PDZ and LIM domain protein 5 Human genes 0.000 description 1
- 101710121657 PDZ and LIM domain protein 5 Proteins 0.000 description 1
- 241000282579 Pan Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 1
- 101710163354 Potassium voltage-gated channel subfamily H member 2 Proteins 0.000 description 1
- 102100026531 Prelamin-A/C Human genes 0.000 description 1
- 239000004792 Prolene Substances 0.000 description 1
- 102000056251 Prolyl Oligopeptidases Human genes 0.000 description 1
- 108700015930 Prolyl Oligopeptidases Proteins 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Propanedioic acid Natural products OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 101710169810 Protein scribble homolog Proteins 0.000 description 1
- 206010037368 Pulmonary congestion Diseases 0.000 description 1
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 1
- 108020004412 RNA 3' Polyadenylation Signals Proteins 0.000 description 1
- 230000007022 RNA scission Effects 0.000 description 1
- 108020004511 Recombinant DNA Proteins 0.000 description 1
- 102100025999 Rho family-interacting cell polarization regulator 1 Human genes 0.000 description 1
- 101710162390 Rho family-interacting cell polarization regulator 1 Proteins 0.000 description 1
- PYMYPHUHKUWMLA-LMVFSUKVSA-N Ribose Natural products OC[C@@H](O)[C@@H](O)[C@@H](O)C=O PYMYPHUHKUWMLA-LMVFSUKVSA-N 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 102000040739 Secretory proteins Human genes 0.000 description 1
- 108091058545 Secretory proteins Proteins 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-N Succinic acid Natural products OC(=O)CCC(O)=O KDYFGRWQOYBRFD-UHFFFAOYSA-N 0.000 description 1
- 229920002253 Tannate Polymers 0.000 description 1
- 101710177718 Transcription intermediary factor 1-beta Proteins 0.000 description 1
- 102000013394 Troponin I Human genes 0.000 description 1
- 108010065729 Troponin I Proteins 0.000 description 1
- 102100036859 Troponin I, cardiac muscle Human genes 0.000 description 1
- 102000004987 Troponin T Human genes 0.000 description 1
- 108090001108 Troponin T Proteins 0.000 description 1
- 238000010162 Tukey test Methods 0.000 description 1
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 1
- 241000700605 Viruses Species 0.000 description 1
- 101710103843 Xin actin-binding repeat-containing protein 1 Proteins 0.000 description 1
- 235000011054 acetic acid Nutrition 0.000 description 1
- 230000007950 acidosis Effects 0.000 description 1
- 208000026545 acidosis disease Diseases 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- WNLRTRBMVRJNCN-UHFFFAOYSA-L adipate(2-) Chemical compound [O-]C(=O)CCCCC([O-])=O WNLRTRBMVRJNCN-UHFFFAOYSA-L 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- OGWAVGNOAMXIIM-UHFFFAOYSA-N albiglutide Chemical compound O=C(O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)C(NC(=O)CNC(=O)C(NC(=O)CNC(=O)C(N)CC=1(N=CNC=1))CCC(=O)O)C(O)C)CC2(=CC=CC=C2))C(O)C)CO)CC(=O)O)C(C)C)CO)CO)CC3(=CC=C(O)C=C3))CC(C)C)CCC(=O)O)CCC(=O)N)C)C)CCCCN)CCC(=O)O)CC4(=CC=CC=C4))C(CC)C)C)CC=6(C5(=C(C=CC=C5)NC=6)))CC(C)C)C(C)C)CCCCN)CCCNC(=N)N OGWAVGNOAMXIIM-UHFFFAOYSA-N 0.000 description 1
- 229960004733 albiglutide Drugs 0.000 description 1
- 229940072056 alginate Drugs 0.000 description 1
- 235000010443 alginic acid Nutrition 0.000 description 1
- 229920000615 alginic acid Polymers 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 150000008055 alkyl aryl sulfonates Chemical class 0.000 description 1
- 150000008052 alkyl sulfonates Chemical class 0.000 description 1
- HMFHBZSHGGEWLO-UHFFFAOYSA-N alpha-D-Furanose-Ribose Natural products OCC1OC(O)C(O)C1O HMFHBZSHGGEWLO-UHFFFAOYSA-N 0.000 description 1
- AWUCVROLDVIAJX-UHFFFAOYSA-N alpha-glycerophosphate Natural products OCC(O)COP(O)(O)=O AWUCVROLDVIAJX-UHFFFAOYSA-N 0.000 description 1
- 208000012759 altered mental status Diseases 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 150000001408 amides Chemical class 0.000 description 1
- 150000003862 amino acid derivatives Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- 229940044094 angiotensin-converting-enzyme inhibitor Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 229940124572 antihypotensive agent Drugs 0.000 description 1
- 210000000709 aorta Anatomy 0.000 description 1
- 230000001640 apoptogenic effect Effects 0.000 description 1
- 230000006907 apoptotic process Effects 0.000 description 1
- 206010003246 arthritis Diseases 0.000 description 1
- 229940072107 ascorbate Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 229940009098 aspartate Drugs 0.000 description 1
- OISFUZRUIGGTSD-LJTMIZJLSA-N azane;(2r,3r,4r,5s)-6-(methylamino)hexane-1,2,3,4,5-pentol Chemical compound N.CNC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO OISFUZRUIGGTSD-LJTMIZJLSA-N 0.000 description 1
- 230000001580 bacterial effect Effects 0.000 description 1
- 210000004666 bacterial spore Anatomy 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- 229940077388 benzenesulfonate Drugs 0.000 description 1
- SRSXLGNVWSONIS-UHFFFAOYSA-M benzenesulfonate Chemical compound [O-]S(=O)(=O)C1=CC=CC=C1 SRSXLGNVWSONIS-UHFFFAOYSA-M 0.000 description 1
- 229940050390 benzoate Drugs 0.000 description 1
- 235000010233 benzoic acid Nutrition 0.000 description 1
- 239000002876 beta blocker Substances 0.000 description 1
- 229940097320 beta blocking agent Drugs 0.000 description 1
- XMIIGOLPHOKFCH-UHFFFAOYSA-N beta-phenylpropanoic acid Natural products OC(=O)CCC1=CC=CC=C1 XMIIGOLPHOKFCH-UHFFFAOYSA-N 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 239000000090 biomarker Substances 0.000 description 1
- 210000001124 body fluid Anatomy 0.000 description 1
- 239000010839 body fluid Substances 0.000 description 1
- 210000001185 bone marrow Anatomy 0.000 description 1
- 210000002798 bone marrow cell Anatomy 0.000 description 1
- 108010006025 bovine growth hormone Proteins 0.000 description 1
- 210000004556 brain Anatomy 0.000 description 1
- 239000007853 buffer solution Substances 0.000 description 1
- KDYFGRWQOYBRFD-NUQCWPJISA-N butanedioic acid Chemical compound O[14C](=O)CC[14C](O)=O KDYFGRWQOYBRFD-NUQCWPJISA-N 0.000 description 1
- FATUQANACHZLRT-KMRXSBRUSA-L calcium glucoheptonate Chemical compound [Ca+2].OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O.OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)C(O)C([O-])=O FATUQANACHZLRT-KMRXSBRUSA-L 0.000 description 1
- 201000011510 cancer Diseases 0.000 description 1
- 229910052799 carbon Inorganic materials 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 125000003178 carboxy group Chemical group [H]OC(*)=O 0.000 description 1
- 150000007942 carboxylates Chemical class 0.000 description 1
- 230000003683 cardiac damage Effects 0.000 description 1
- 210000004413 cardiac myocyte Anatomy 0.000 description 1
- 230000001269 cardiogenic effect Effects 0.000 description 1
- 210000000748 cardiovascular system Anatomy 0.000 description 1
- 238000004113 cell culture Methods 0.000 description 1
- 238000006243 chemical reaction Methods 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 230000004087 circulation Effects 0.000 description 1
- 235000015165 citric acid Nutrition 0.000 description 1
- 229940090805 clavulanate Drugs 0.000 description 1
- HZZVJAQRINQKSD-PBFISZAISA-N clavulanic acid Chemical compound OC(=O)[C@H]1C(=C/CO)/O[C@@H]2CC(=O)N21 HZZVJAQRINQKSD-PBFISZAISA-N 0.000 description 1
- 208000035850 clinical syndrome Diseases 0.000 description 1
- 108090001092 clostripain Proteins 0.000 description 1
- 230000035071 co-translational protein modification Effects 0.000 description 1
- 230000000052 comparative effect Effects 0.000 description 1
- 230000009091 contractile dysfunction Effects 0.000 description 1
- 230000008602 contraction Effects 0.000 description 1
- 239000013601 cosmid vector Substances 0.000 description 1
- 230000008878 coupling Effects 0.000 description 1
- 238000010168 coupling process Methods 0.000 description 1
- 238000005859 coupling reaction Methods 0.000 description 1
- 239000013078 crystal Substances 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 238000007405 data analysis Methods 0.000 description 1
- 101150044395 dda1 gene Proteins 0.000 description 1
- 230000034994 death Effects 0.000 description 1
- 231100000517 death Toxicity 0.000 description 1
- 230000002950 deficient Effects 0.000 description 1
- 230000007850 degeneration Effects 0.000 description 1
- 230000006866 deterioration Effects 0.000 description 1
- 230000002542 deteriorative effect Effects 0.000 description 1
- ACYGYJFTZSAZKR-UHFFFAOYSA-J dicalcium;2-[2-[bis(carboxylatomethyl)amino]ethyl-(carboxylatomethyl)amino]acetate Chemical compound [Ca+2].[Ca+2].[O-]C(=O)CN(CC([O-])=O)CCN(CC([O-])=O)CC([O-])=O ACYGYJFTZSAZKR-UHFFFAOYSA-J 0.000 description 1
- SPCNPOWOBZQWJK-UHFFFAOYSA-N dimethoxy-(2-propan-2-ylsulfanylethylsulfanyl)-sulfanylidene-$l^{5}-phosphane Chemical compound COP(=S)(OC)SCCSC(C)C SPCNPOWOBZQWJK-UHFFFAOYSA-N 0.000 description 1
- 229940090124 dipeptidyl peptidase 4 (dpp-4) inhibitors for blood glucose lowering Drugs 0.000 description 1
- 239000001177 diphosphate Substances 0.000 description 1
- XPPKVPWEQAFLFU-UHFFFAOYSA-J diphosphate(4-) Chemical compound [O-]P([O-])(=O)OP([O-])([O-])=O XPPKVPWEQAFLFU-UHFFFAOYSA-J 0.000 description 1
- 235000011180 diphosphates Nutrition 0.000 description 1
- POULHZVOKOAJMA-UHFFFAOYSA-M dodecanoate Chemical compound CCCCCCCCCCCC([O-])=O POULHZVOKOAJMA-UHFFFAOYSA-M 0.000 description 1
- 230000004064 dysfunction Effects 0.000 description 1
- 229940009662 edetate Drugs 0.000 description 1
- 230000002526 effect on cardiovascular system Effects 0.000 description 1
- 229950005627 embonate Drugs 0.000 description 1
- 239000000839 emulsion Substances 0.000 description 1
- 229950000206 estolate Drugs 0.000 description 1
- 229960003699 evans blue Drugs 0.000 description 1
- 230000007717 exclusion Effects 0.000 description 1
- 229960001519 exenatide Drugs 0.000 description 1
- 238000011049 filling Methods 0.000 description 1
- 238000002637 fluid replacement therapy Methods 0.000 description 1
- 239000001530 fumaric acid Substances 0.000 description 1
- 230000006870 function Effects 0.000 description 1
- 230000002538 fungal effect Effects 0.000 description 1
- 238000004868 gas analysis Methods 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 229960001731 gluceptate Drugs 0.000 description 1
- KWMLJOLKUYYJFJ-VFUOTHLCSA-N glucoheptonic acid Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H](O)C(O)=O KWMLJOLKUYYJFJ-VFUOTHLCSA-N 0.000 description 1
- 229940050410 gluconate Drugs 0.000 description 1
- 229930195712 glutamate Natural products 0.000 description 1
- 150000002333 glycines Chemical class 0.000 description 1
- 230000012010 growth Effects 0.000 description 1
- 239000001963 growth medium Substances 0.000 description 1
- 150000004820 halides Chemical class 0.000 description 1
- 230000035876 healing Effects 0.000 description 1
- 208000019622 heart disease Diseases 0.000 description 1
- 238000010438 heat treatment Methods 0.000 description 1
- 208000011316 hemodynamic instability Diseases 0.000 description 1
- 231100000234 hepatic damage Toxicity 0.000 description 1
- MNWFXJYAOYHMED-UHFFFAOYSA-N heptanoic acid Chemical compound CCCCCCC(O)=O MNWFXJYAOYHMED-UHFFFAOYSA-N 0.000 description 1
- IPCSVZSSVZVIGE-UHFFFAOYSA-M hexadecanoate Chemical compound CCCCCCCCCCCCCCCC([O-])=O IPCSVZSSVZVIGE-UHFFFAOYSA-M 0.000 description 1
- FUZZWVXGSFPDMH-UHFFFAOYSA-N hexanoic acid Chemical compound CCCCCC(O)=O FUZZWVXGSFPDMH-UHFFFAOYSA-N 0.000 description 1
- HNDVDQJCIGZPNO-UHFFFAOYSA-N histidine Natural products OC(=O)C(N)CC1=CN=CN1 HNDVDQJCIGZPNO-UHFFFAOYSA-N 0.000 description 1
- XGIHQYAWBCFNPY-AZOCGYLKSA-N hydrabamine Chemical compound C([C@@H]12)CC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC[C@@]1(C)CNCCNC[C@@]1(C)[C@@H]2CCC3=CC(C(C)C)=CC=C3[C@@]2(C)CCC1 XGIHQYAWBCFNPY-AZOCGYLKSA-N 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-M hydrogensulfate Chemical compound OS([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-M 0.000 description 1
- XLYOFNOQVPJJNP-UHFFFAOYSA-M hydroxide Chemical compound [OH-] XLYOFNOQVPJJNP-UHFFFAOYSA-M 0.000 description 1
- 150000004679 hydroxides Chemical class 0.000 description 1
- 230000007954 hypoxia Effects 0.000 description 1
- 230000008105 immune reaction Effects 0.000 description 1
- 230000028993 immune response Effects 0.000 description 1
- 230000006872 improvement Effects 0.000 description 1
- MGXWVYUBJRZYPE-YUGYIWNOSA-N incretin Chemical class C([C@@H](C(=O)N[C@@H](CO)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CCSC)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C)C(=O)N[C@@H](CCC(N)=O)C(=O)N[C@@H](CCCCN)C(=O)NCC(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CC(O)=O)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CCCCN)C(=O)N[C@@H](CC=1NC=NC=1)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CCC(N)=O)C(O)=O)NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](C)NC(=O)[C@@H](N)CC=1C=CC(O)=CC=1)[C@@H](C)O)[C@@H](C)CC)C1=CC=C(O)C=C1 MGXWVYUBJRZYPE-YUGYIWNOSA-N 0.000 description 1
- 239000000859 incretin Substances 0.000 description 1
- 208000027866 inflammatory disease Diseases 0.000 description 1
- 239000004615 ingredient Substances 0.000 description 1
- 239000003112 inhibitor Substances 0.000 description 1
- 230000003834 intracellular effect Effects 0.000 description 1
- 229940065638 intron a Drugs 0.000 description 1
- 208000028867 ischemia Diseases 0.000 description 1
- 230000000302 ischemic effect Effects 0.000 description 1
- SUMDYPCJJOFFON-UHFFFAOYSA-N isethionic acid Chemical compound OCCS(O)(=O)=O SUMDYPCJJOFFON-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- JJWLVOIRVHMVIS-UHFFFAOYSA-N isopropylamine Chemical compound CC(C)N JJWLVOIRVHMVIS-UHFFFAOYSA-N 0.000 description 1
- 210000003734 kidney Anatomy 0.000 description 1
- 229940001447 lactate Drugs 0.000 description 1
- 229940099584 lactobionate Drugs 0.000 description 1
- JYTUSYBCFIZPBE-AMTLMPIISA-N lactobionic acid Chemical compound OC(=O)[C@H](O)[C@@H](O)[C@@H]([C@H](O)CO)O[C@@H]1O[C@H](CO)[C@H](O)[C@H](O)[C@H]1O JYTUSYBCFIZPBE-AMTLMPIISA-N 0.000 description 1
- 229940070765 laurate Drugs 0.000 description 1
- 229960002701 liraglutide Drugs 0.000 description 1
- 230000008818 liver damage Effects 0.000 description 1
- 210000002751 lymph Anatomy 0.000 description 1
- 229920002521 macromolecule Polymers 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 229940049920 malate Drugs 0.000 description 1
- 239000011976 maleic acid Substances 0.000 description 1
- BJEPYKJPYRNKOW-UHFFFAOYSA-N malic acid Chemical compound OC(=O)C(O)CC(O)=O BJEPYKJPYRNKOW-UHFFFAOYSA-N 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-M mandelate Chemical compound [O-]C(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-M 0.000 description 1
- 238000013507 mapping Methods 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 238000004949 mass spectrometry Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 238000005399 mechanical ventilation Methods 0.000 description 1
- 229930182817 methionine Natural products 0.000 description 1
- JZMJDSHXVKJFKW-UHFFFAOYSA-M methyl sulfate(1-) Chemical compound COS([O-])(=O)=O JZMJDSHXVKJFKW-UHFFFAOYSA-M 0.000 description 1
- 238000002156 mixing Methods 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000010369 molecular cloning Methods 0.000 description 1
- 230000009456 molecular mechanism Effects 0.000 description 1
- 210000001616 monocyte Anatomy 0.000 description 1
- 210000004400 mucous membrane Anatomy 0.000 description 1
- 230000002107 myocardial effect Effects 0.000 description 1
- 208000037891 myocardial injury Diseases 0.000 description 1
- KVBGVZZKJNLNJU-UHFFFAOYSA-M naphthalene-2-sulfonate Chemical compound C1=CC=CC2=CC(S(=O)(=O)[O-])=CC=C21 KVBGVZZKJNLNJU-UHFFFAOYSA-M 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 235000001968 nicotinic acid Nutrition 0.000 description 1
- 239000011664 nicotinic acid Substances 0.000 description 1
- QIQXTHQIDYTFRH-UHFFFAOYSA-N octadecanoic acid Chemical compound CCCCCCCCCCCCCCCCCC(O)=O QIQXTHQIDYTFRH-UHFFFAOYSA-N 0.000 description 1
- 229940049964 oleate Drugs 0.000 description 1
- ZQPPMHVWECSIRJ-KTKRTIGZSA-N oleic acid Chemical compound CCCCCCCC\C=C/CCCCCCCC(O)=O ZQPPMHVWECSIRJ-KTKRTIGZSA-N 0.000 description 1
- 239000013110 organic ligand Substances 0.000 description 1
- 230000008520 organization Effects 0.000 description 1
- 238000006213 oxygenation reaction Methods 0.000 description 1
- 229940014662 pantothenate Drugs 0.000 description 1
- 235000019161 pantothenic acid Nutrition 0.000 description 1
- 239000011713 pantothenic acid Substances 0.000 description 1
- 238000007911 parenteral administration Methods 0.000 description 1
- 239000002245 particle Substances 0.000 description 1
- 230000037361 pathway Effects 0.000 description 1
- 230000006320 pegylation Effects 0.000 description 1
- 230000010412 perfusion Effects 0.000 description 1
- JRKICGRDRMAZLK-UHFFFAOYSA-L peroxydisulfate Chemical compound [O-]S(=O)(=O)OOS([O-])(=O)=O JRKICGRDRMAZLK-UHFFFAOYSA-L 0.000 description 1
- 125000002467 phosphate group Chemical group [H]OP(=O)(O[H])O[*] 0.000 description 1
- 229940075930 picrate Drugs 0.000 description 1
- OXNIZHLAWKMVMX-UHFFFAOYSA-M picrate anion Chemical compound [O-]C1=C([N+]([O-])=O)C=C([N+]([O-])=O)C=C1[N+]([O-])=O OXNIZHLAWKMVMX-UHFFFAOYSA-M 0.000 description 1
- 229950010765 pivalate Drugs 0.000 description 1
- IUGYQRQAERSCNH-UHFFFAOYSA-N pivalic acid Chemical compound CC(C)(C)C(O)=O IUGYQRQAERSCNH-UHFFFAOYSA-N 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000013600 plasmid vector Substances 0.000 description 1
- 238000010837 poor prognosis Methods 0.000 description 1
- 238000010149 post-hoc-test Methods 0.000 description 1
- 230000001323 posttranslational effect Effects 0.000 description 1
- 229910052700 potassium Inorganic materials 0.000 description 1
- 239000011591 potassium Substances 0.000 description 1
- 159000000001 potassium salts Chemical class 0.000 description 1
- 238000000513 principal component analysis Methods 0.000 description 1
- MFDFERRIHVXMIY-UHFFFAOYSA-N procaine Chemical compound CCN(CC)CCOC(=O)C1=CC=C(N)C=C1 MFDFERRIHVXMIY-UHFFFAOYSA-N 0.000 description 1
- 229960004919 procaine Drugs 0.000 description 1
- 210000001236 prokaryotic cell Anatomy 0.000 description 1
- 235000019833 protease Nutrition 0.000 description 1
- 230000001681 protective effect Effects 0.000 description 1
- 230000012846 protein folding Effects 0.000 description 1
- 210000001147 pulmonary artery Anatomy 0.000 description 1
- 125000001453 quaternary ammonium group Chemical group 0.000 description 1
- 108700027806 rGLP-1 Proteins 0.000 description 1
- 230000008929 regeneration Effects 0.000 description 1
- 238000011069 regeneration method Methods 0.000 description 1
- 230000014493 regulation of gene expression Effects 0.000 description 1
- 230000008439 repair process Effects 0.000 description 1
- 230000001177 retroviral effect Effects 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- YGSDEFSMJLZEOE-UHFFFAOYSA-M salicylate Chemical compound OC1=CC=CC=C1C([O-])=O YGSDEFSMJLZEOE-UHFFFAOYSA-M 0.000 description 1
- 229960001860 salicylate Drugs 0.000 description 1
- 231100000241 scar Toxicity 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 238000002864 sequence alignment Methods 0.000 description 1
- 230000011664 signaling Effects 0.000 description 1
- 150000003384 small molecules Chemical class 0.000 description 1
- AWUCVROLDVIAJX-GSVOUGTGSA-N sn-glycerol 3-phosphate Chemical compound OC[C@@H](O)COP(O)(O)=O AWUCVROLDVIAJX-GSVOUGTGSA-N 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000011301 standard therapy Methods 0.000 description 1
- 238000007619 statistical method Methods 0.000 description 1
- 208000003265 stomatitis Diseases 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- CCEKAJIANROZEO-UHFFFAOYSA-N sulfluramid Chemical group CCNS(=O)(=O)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)C(F)(F)F CCEKAJIANROZEO-UHFFFAOYSA-N 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 210000002437 synoviocyte Anatomy 0.000 description 1
- 230000008685 targeting Effects 0.000 description 1
- 239000011975 tartaric acid Substances 0.000 description 1
- 229940095064 tartrate Drugs 0.000 description 1
- 108010048573 taspoglutide Proteins 0.000 description 1
- WRGVLTAWMNZWGT-VQSPYGJZSA-N taspoglutide Chemical compound C([C@@H](C(=O)N[C@@H]([C@@H](C)CC)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C2=CC=CC=C2NC=1)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CCCCN)C(=O)NC(C)(C)C(=O)N[C@@H](CCCNC(N)=N)C(N)=O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCCN)NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CCC(N)=O)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CC=1C=CC(O)=CC=1)NC(=O)[C@H](CO)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC(O)=O)NC(=O)[C@H](CO)NC(=O)[C@@H](NC(=O)[C@H](CC=1C=CC=CC=1)NC(=O)[C@@H](NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)C(C)(C)NC(=O)[C@@H](N)CC=1NC=NC=1)[C@@H](C)O)[C@@H](C)O)C(C)C)C1=CC=CC=C1 WRGVLTAWMNZWGT-VQSPYGJZSA-N 0.000 description 1
- 229950007151 taspoglutide Drugs 0.000 description 1
- 229950002757 teoclate Drugs 0.000 description 1
- 108700020534 tetracycline resistance-encoding transposon repressor Proteins 0.000 description 1
- 150000003573 thiols Chemical class 0.000 description 1
- 230000017423 tissue regeneration Effects 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 238000011269 treatment regimen Methods 0.000 description 1
- ZDPHROOEEOARMN-UHFFFAOYSA-N undecanoic acid Chemical compound CCCCCCCCCCC(O)=O ZDPHROOEEOARMN-UHFFFAOYSA-N 0.000 description 1
- 229940070710 valerate Drugs 0.000 description 1
- NQPDZGIKBAWPEJ-UHFFFAOYSA-N valeric acid Chemical compound CCCCC(O)=O NQPDZGIKBAWPEJ-UHFFFAOYSA-N 0.000 description 1
- 239000004474 valine Substances 0.000 description 1
- 239000005526 vasoconstrictor agent Substances 0.000 description 1
- 208000005925 vesicular stomatitis Diseases 0.000 description 1
- 238000011179 visual inspection Methods 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K38/00—Medicinal preparations containing peptides
- A61K38/16—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof
- A61K38/17—Peptides having more than 20 amino acids; Gastrins; Somatostatins; Melanotropins; Derivatives thereof from animals; from humans
- A61K38/18—Growth factors; Growth regulators
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K67/00—Rearing or breeding animals, not otherwise provided for; New or modified breeds of animals
- A01K67/027—New or modified breeds of vertebrates
- A01K67/0275—Genetically modified vertebrates, e.g. transgenic
- A01K67/0276—Knock-out vertebrates
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/02—Non-specific cardiovascular stimulants, e.g. drugs for syncope, antihypotensives
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P9/00—Drugs for disorders of the cardiovascular system
- A61P9/04—Inotropic agents, i.e. stimulants of cardiac contraction; Drugs for heart failure
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2207/00—Modified animals
- A01K2207/30—Animals modified by surgical methods
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2207/00—Modified animals
- A01K2207/35—Animals modified by environmental factors, e.g. temperature, O2
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2217/00—Genetically modified animals
- A01K2217/07—Animals genetically altered by homologous recombination
- A01K2217/075—Animals genetically altered by homologous recombination inducing loss of function, i.e. knock out
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2227/00—Animals characterised by species
- A01K2227/10—Mammal
- A01K2227/105—Murine
-
- A—HUMAN NECESSITIES
- A01—AGRICULTURE; FORESTRY; ANIMAL HUSBANDRY; HUNTING; TRAPPING; FISHING
- A01K—ANIMAL HUSBANDRY; AVICULTURE; APICULTURE; PISCICULTURE; FISHING; REARING OR BREEDING ANIMALS, NOT OTHERWISE PROVIDED FOR; NEW BREEDS OF ANIMALS
- A01K2267/00—Animals characterised by purpose
- A01K2267/03—Animal model, e.g. for test or diseases
- A01K2267/035—Animal model for multifactorial diseases
- A01K2267/0375—Animal model for cardiovascular diseases
Definitions
- the present invention relates to the protein myeloid-derived growth factor (MYDGF) for use in treating and/or preventing cardiogenic shock.
- MYDGF protein myeloid-derived growth factor
- the present invention also relates to a novel animal model of cardiogenic shock.
- Myeloid-derived growth factor also known as Factor 1
- MYDGF Myeloid-derived growth factor
- FLS- cells fibroblast-like synoviocytes
- a correlation between the secretion of the protein and inflammatory diseases of the joint has been supposed without any experimental or statistical evidence (Weiler et al., Arthritis Research and Therapy 2007, The identification and characterization of a novel protein, cl9orfl0, in the synovium).
- a corresponding patent application claims the protein as therapeutic agent for the treatment of joint and for the diagnosis of a tissue undergoing altered growth as well as monitoring changes in a tissue (US 2008/0004232 Al, Characterization of cl9orfl0, a novel synovial protein).
- Another scientific publication describes an enhanced expression of the protein in hepatocellular carcinoma cells (Sunagozaka et al., International Journal of Cancer, 2010, Identification of a secretory protein cl9orfl0 activated in hepatocellular carcinoma). Recombinant produced protein showed a proliferation enhancing effect on cultured hepatocellular carcinoma cells.
- C190rflO has also been referred to as IL-25, IL-27 and IL-27W as it was originally considered an interleukin.
- IL-25 and “IL-27” have been used inconsistently in the art and have been used to designate a variety of different proteins.
- US 2004/0185049 refers to a protein as IL-27 and discloses its use in modulating the immune response.
- This protein is structurally distinct from Factor 1 (compare Factor 1 amino acid sequence according to SEQ ID NO: 1 to the amino acid sequence of “IL-27” according to UniProt: Q8NEV9).
- EP 2 130 547 Al refers to a protein as IL-25 and discloses its use in treating inflammation.
- This protein has also been referred to in the art as IL-17E and is structurally distinct from Factor 1 (compare the amino acid sequence of Factor 1 according to SEQ ID NO: 1 to the amino acid sequence of “IL-25” according to UniProt: Q9H293).
- WO 2014/111458 discloses Factor 1 for use in enhancing proliferation and inhibiting apoptosis of non-transformed tissue or non-transformed cells, in particular for use in treating acute myocardial infarction. Further disclosed are inhibitors of Factor 1 for medical use, in particular for use in treating or preventing a disease in which angiogenesis contributes to disease development or progression.
- Korf-Klingebiel et al. report C190rflO to be secreted by bone marrow cells after myocardial infarction, which protein promotes cardiac myocyte survival and angiogenesis.
- the authors show that bone marrow-derived monocytes and macrophages produce this protein endogenously to protect and repair the heart after myocardial infarction, and propose the name myeloid-derived growth factor (MYDGF).
- MYDGF myeloid-derived growth factor
- treatment with recombinant mouse Mydgf is reported to reduce scar size and contractile dysfunction after myocardial infarction.
- WO 2021/148411 discloses MYDGF for use in treating or preventing fibrosis, hypertrophy or heart failure.
- Heart failure is a clinical syndrome with a poor prognosis that may develop in response to persistent hemodynamic overload, myocardial injury, or genetic mutations.
- Cardiogenic shock is a life-threatening, acute low cardiac output state resulting from severe systolic and/or diastolic myocardial dysfunction and leading to arterial hypotension, pulmonary congestion, critical end-organ hypoperfusion, and impaired tissue oxygenation.
- CS is associated with insufficient blood flow to the extremities and vital organs, including the heart itself, the liver, kidneys, and the brain.
- Critical end-organ hypoperfusion and impaired tissue oxygenation lead to an increase in blood lactate concentration, which is used for diagnosis and monitoring of patients with CS.
- Clinical criteria for defining CS are summarized e.g. in the review article of Vahdatpour et al. (Journal of the American Heart Association, Vol 8(8), 2019, eOl 1991). Hypoperfusion and impaired oxygenation of the heart itself lead to a progressive worsening of cardiac performance in CS thereby triggering a downward spiral of increasing hemodynamic instability associated with very high mortality.
- CS myocardial infarction
- the pathophysiologies of an uncomplicated myocardial infarction (without cardiogenic shock) and a (typically large) myocardial infarction with cardiogenic shock are largely different.
- Patients with an uncomplicated myocardial infarction do not present with critical end-organ hypoperfusion and impaired tissue oxygenation, they do not have an acute and progressive worsening of cardiac function (downward spiral), and they do not have the very high acute mortality observed in patients with CS.
- patients with heart failure, fibrosis and hypertrophy of the heart do not acutely present with critical end-organ hypoperfusion and impaired tissue oxygenation, they do not have an acute progressive worsening of cardiac function (downward spiral), and they do not have the very high acute mortality observed in patients with CS.
- cardiogenic shock there is an urgent need for means and methods for treating and/or preventing cardiogenic shock.
- suitable animal models of cardiogenic shock to further elucidate the underlying pathophysiology and to define novel therapies for this condition.
- the invention provides in a first aspect myeloid-derived growth factor (MYDGF) or a fragment or a variant thereof exhibiting the biological function of MYDGF, for use in treating and/or preventing cardiogenic shock.
- MYDGF myeloid-derived growth factor
- the MYDGF protein comprises SEQ ID NO: 1.
- the MYDGF protein comprises a fragment or variant of SEQ ID NO: 1, which exhibits the biological function of MYDGF, and which comprises an amino acid sequence having at least 85% amino acid sequence identity to SEQ ID NO: 1.
- the MYDGF protein consists of SEQ ID NO: 1 or SEQ ID NO: 3.
- the present invention provides a nucleic acid encoding MYDGF or the fragment or variant thereof exhibiting the biological function of MYDGF, for use in treating and/or preventing cardiogenic shock.
- the nucleic acid encodes an amino acid sequence having at least 85% sequence identity to SEQ ID NO: 1.
- the present invention provides a vector comprising the nucleic acid of the present invention for use in treating and/or preventing cardiogenic shock.
- the present invention provides a host cell comprising the nucleic acid of the present invention or the vector of the present invention for use in treating and/or preventing cardiogenic shock.
- the host cell expresses the nucleic acid.
- the present invention provides a pharmaceutical composition
- a pharmaceutical composition comprising the MYDGF protein, the nucleic acid, the vector or the host cell of the present invention and optionally a suitable pharmaceutical excipient and/or carrier, for use in treating and/or preventing cardiogenic shock.
- the pharmaceutical composition for use is administered through the oral, intravenous, subcutaneous, intramucosal, intraarterial, intramuscular or intracoronary route.
- the administration is preferably through one or more bolus injection(s) and/or infusion(s).
- the present invention provides a method of treating and/or preventing cardiogenic shock comprising administering to a patient in need thereof a therapeutically effective amount of myeloid-derived growth factor (MYDGF) protein.
- MYDGF myeloid-derived growth factor
- the MYDGF protein comprises a fragment or variant of SEQ ID NO: 1, which exhibits the biological function of MYDGF, and which comprises an amino acid sequence having at least 85% amino acid sequence identity to SEQ ID NO: 1.
- the MYDGF or fragment or variant thereof is administered through one or more bolus injection(s) and/or infusion(s), preferably in a pharmaceutically accepted carrier and/or excipient.
- the present invention provides a method of treating and/or preventing cardiogenic shock comprising administering to a patient in need thereof a therapeutically effective amount of a pharmaceutical composition comprising myeloid- derived growth factor (MYDGF) protein or a fragment or variant thereof.
- MYDGF myeloid- derived growth factor
- the MYDGF protein comprises a fragment or variant of SEQ ID NO: 1, which exhibits the biological function of MYDGF, and which comprises an amino acid sequence having at least 85% amino acid sequence identity to SEQ ID NO: 1.
- the pharmaceutical composition comprises a suitable pharmaceutical excipient.
- the pharmaceutical composition is administered through one or more bolus injection(s) and/or infusion(s).
- the present invention provides a method for producing a non-human mammalian model of cardiogenic shock, the method comprising (i) transiently ligating a coronary artery of the mammal, (ii) establishing reperfusion, and (iii) ventilating the mammal with a fraction of inhaled oxygen of about 0.18 or less.
- the non-human mammal is a rodent, more preferably a mouse.
- the coronary artery is ligated for about 30 minutes to about 90 minutes before reperfusion is established.
- the mammal is ventilated with a fraction of inhaled oxygen of about 0.16.
- FIG. 1 A: Schematic illustration of the process scheme for preparing the cardiogenic shock animal model.
- MI Myocardial infarction
- mice were subcutaneously pretreated with 2 mg/kg butorphanol and with 0.02 mg/kg atropine to reduce bronchial secretions.
- Anaesthesia was induced with 3-4% isoflurane. After intubation, mice were mechanically ventilated and anaesthesia was maintained with 1-2% isoflurane.
- a micromanometer-tipped conductance catheter was inserted via the right carotid artery to continuously record left ventricular (LV) pressure-volume (PV) loops.
- LV left ventricular
- PV pressure-volume
- mice were ventilated for 120 min with a fraction of inspired oxygen (FiCE) concentration of 0.33 or 0.16.
- an FiCE of 0.33 was associated with normoxaemia [nx; arterial oxygen partial pressure (PaCE), 144 ⁇ 16 mmHg; arterial oxygen saturation (SaCE), 99 ⁇ 1%]
- an FiCE of 0.16 resulted in mild hypoxaemia (hx; Pat , 75 ⁇ 16 mmHg; SaCE, 89 ⁇ 3%) (4-6 mice per group).
- infarcted and sham-operated mice were randomly ventilated with either FiCE and followed for 120 min, as described in Wang et al. Cardiovasc Res. 2021;117:2414-2415.
- B left ventricular pressure volume loops sampled at 120 minutes of sham operated mice (sham) (dotted lines) and mice with induced myocardial infarction (MI) (uninterrupted lines) ventilated under normoxic (nx) and hypoxic (hx) conditions.
- MI myocardial infarction
- FIG. 2 Left ventricular end-systolic pressure (LVESP) in mmHg (Fig. 2A), cardiac output in mL/min (Fig. 2B), and arterial lactate concentration in mmol/L (Fig. 2C) of sham operated mice (sham) (open circles) and mice with induced myocardial infarction (MI) (filled circles) at 120 min, all ventilated under normoxic (nx) or hypoxic (hx) conditions, respectively.
- MI mice ventilated with an FiCL of 0.16 (Ml-hx) progressively developed CS as defined by the clinical hallmarks of CS, i.e. hypotension (reduced LVESP), reduced cardiac output, and increased lactate concentration.
- MI mice ventilated with an FiCL of 0.33 (Ml-nx) remained hemodynamically stable.
- FIG. 3 Starting 60 min after the initiation of hypoxic ventilation, Ml-hx mice were treated with an intravenous dobutamine infusion (5 to 7.5 ng/g/min via left jugular vein, titrated to a LVESP of 70 mmHg) (Ml-hx, dobutamine). Saline-infused Ml-hx mice served as controls (Ml-hx, saline). Dobutamine improved LVESP (Fig. 3A) and cardiac output (Fig. 3B) in Ml-hx mice. Similar hemodynamic improvements are typically observed in patients with CS treated with dobutamine.
- Figure 4 Phosphoproteome analysis using high-resolution mass spectrometry with unsupervised principal component analysis (6 mice per group) in the non-infarcted left ventricular myocardium.
- Sham-nx sham operated mice normoxaemia
- Sham-hx sham operated mice hypoxaemia
- Ml-nx infarcted mice normoxaemia
- Ml-hx infarcted mice hypoxaemia.
- FIG. 5 Volcano plot illustrating differentially regulated phosphosites in the non- infarcted left ventricular myocardium of mice with myocardial infarction-induced CS (Ml- hx) versus mice with myocardial infarction only (Ml-nx).
- Ml-nx infarcted mice normoxaemia
- Ml-hx infarcted mice hypoxaemia.
- Abbreviations denote proteins, amino acid positions indicated in brackets show the respective phosphorylated residue in each protein.
- RIPR1 Rho family-interacting cell polarization regulator 1.
- DDA1 DET1- and DDB 1 -associated protein 1.
- OSB11 oxysterol-binding protein-related protein 11.
- ODPA pyruvate dehydrogenase El component subunit alpha.
- SCRIB Protein scribble homolog.
- SRF serum response factor.
- KCNH2 potassium voltage-gated channel subfamily H member 2.
- CSRP1 cysteine and glycine-rich protein 1.
- MYH6 myosin-6.
- DP13A DCC- interacting protein 13 -alpha.
- PDLI5 PDZ and LIM domain protein 5.
- TITIN titin.
- HSPB1 heat shock protein beta-1.
- DESMIN desmin.
- LMNA prelamin- A/C.
- XIRP1 Xin actin-binding repeat-containing protein 1.
- TNNI3 troponin I.
- TIF1B transcription intermediary factor 1-beta.
- Figure 6 Kaplan-Meier survival curve showing mortality over 120 minutes in cardiogenic shock (Ml-hx) mice treated with MYDGF or with saline.
- Figure 7 Bar graphs showing results from PV loop recordings at the end of the 120 minutes observation period.
- Heart rate (Fig. 7A), left ventricular end-systolic volume (LVESV) (Fig. 7B), left ventricular end-diastolic volume (LVEDV) (Fig. 7C), cardiac output (Fig. 7D), stroke volume (Fig. 7E) and stroke work (Fig. 7F) of cardiogenic shock (Ml-hx) mice treated with MYDGF or with saline.
- LVESV left ventricular end-systolic volume
- LVEDV left ventricular end-diastolic volume
- Fig. 7C cardiac output
- stroke volume (Fig. 7E)
- stroke work (Fig. 7F) of cardiogenic shock (Ml-hx) mice treated with MYDGF or with saline.
- FIG. 8 Bar graphs showing results from PV loop recordings at the end of the 120 minutes observation period.
- Left ventricular end-systolic pressure (LVESP) (Fig. 8A), left ventricular end-diastolic pressure (LVEDP) (Fig. 8B), left ventricular ejection fraction (LVEF) (Fig. 8C), maximal rate of pressure change in the left ventricle (dP/dtmax) (Fig. 8D), minimal rate of pressure change in the left ventricle pressure (dP/dtmin) (Fig. 8E), and left ventricular diastolic time constant (Tau) (Fig. 8F) of cardiogenic shock (Ml-hx) mice treated with MYDGF or with saline. **P ⁇ 0.01, ***P ⁇ 0.001.
- Figure 9 Bar graphs showing results from blood gas analysis at the end of the 120 minutes observation period. pH (Fig. 9A), arterial blood oxygen partial pressure (Pat in mmHg) (Fig. 9B), arterial oxygen saturation (SaCL in %) (Fig. 9C), and lactate concentration (in mmol/L) (Fig. 9D) of cardiogenic shock (Ml-hx) mice treated with MYDGF or with saline. *P ⁇ 0.05.
- Figure 10 Results from continuous PV loop recordings during the 120 minutes observation period in the CS model. Cardiac output (in mL/min) (Fig. 10A) and left ventricular end-systolic pressure (LVESP) (in mmHg) (Fig. 10B) of saline-treated Ml-hx mice (CS saline) versus MYDGF-treated Ml-hx mice (CS MYDGF).
- Cardiac output in mL/min
- LVESP left ventricular end-systolic pressure
- Figure 11 Area at risk and infarct size of the left ventricle determined at the end of the 120 min observation period in the CS model.
- Saline-treated Ml-hx mice Saline
- MYDGF-treated Ml-hx mice MYDGF
- Area at risk / total LV area (in %) (Fig. 11 A)
- infarct size / area at risk (in %) (Fig. 1 IB).
- FIG. 12 Plasma concentration of high-sensitivity cardiac troponin T (cTnT) and the liver damage marker alanine aminotransaminase (ALT) at the end of the 120 minutes observation period in the CS model. Left ventricular soluble nucleosome concentration at the end of the 120 minutes observation period in the CS model.
- cTnT in ng/mL
- alanine aminotransaminase Log2ALT in U/L
- FIG. 12B in saline-treated Ml-hx mice (Saline) versus MYDGF-treated Ml-hx mice (MYDGF).
- FIG. 12C Soluble nucleosome concentrations measured in the infarcted (I) versus non-infarcted (NI) regions of the left ventricle were determined by ELISA. The I/NI ratio serves as an indicator for cell death (Fig. 12C).
- Figure 13 Schematic illustration of the treatment regimen used on the cardiogenic shock animal model in the previous examples ( Figures 6, 7, 8, 9, 10, 11, and 12). Abbreviations shown in figure are as defined for Fig. 1.
- FIG. 14 Kaplan-Meier survival curve showing mortality over 120 minutes of cardiogenic shock of wild-type mice (WT) and Mydgf gene-deficient (knock-out) mice (MYDGF KO).
- Figure 15 Aggravation of left ventricular tissue damage caused by cardiogenic shock.
- Fig. 15A shows the experimental set-up.
- Fig. 15B shows the results of the experiment, indicating that cardiogenic shock further aggravates left ventricular tissue damage sustained during acute myocardial infarction.
- FIG. 16 Delayed treatment of cardiogenic shock.
- Fig. 16A shows the experimental set-up.
- Fig. 16B shows the results of the experiment, indicating that cardiogenic shock can be treated by administering MYDGF at a time point after reperfusion has been established.
- Nucleic acid molecules also termed nucleic acids are understood as polymeric macromolecules made from nucleotide monomers. Nucleotide monomers are composed of a nucleobase, a five-carbon sugar (such as but not limited to ribose or 2'-deoxyribose), and one to three phosphate groups. Typically, a polynucleotide is formed through phosphodiester bonds between the individual nucleotide monomers. In the context of the present invention referred to nucleic acid molecules include but are not limited to ribonucleic acid (RNA) and deoxyribonucleic acid (DNA). The terms “polynucleotide” and “nucleic acid” are used interchangeably herein.
- ORF open reading frame
- ORF refers to a sequence of nucleotides, that can be translated into amino acids.
- such an ORF contains a start codon, a subsequent region usually having a length which is a multiple of 3 nucleotides, but does not contain a stop codon (TAG, TAA, TGA, UAG, UAA, or UGA) in the given reading frame.
- stop codon TAG, TAA, TGA, UAG, UAA, or UGA
- ORFs occur naturally or are constructed artificially, i.e. by gene-technological means.
- An ORF codes for a protein where the amino acids into which it can be translated form a peptide- linked chain.
- protein and “polypeptide” are used interchangeably herein and refer to any peptide-bond-linked chain of amino acids, regardless of length or post-translational modification.
- Proteins usable in the present invention can be further modified by chemical modification.
- This means such a chemically modified polypeptide comprises other chemical groups than the 20 naturally occurring amino acids. Examples of such other chemical groups include without limitation glycosylated amino acids and phosphorylated amino acids.
- Chemical modifications of a polypeptide may provide advantageous properties as compared to the parent polypeptide, e.g. one or more of enhanced stability, increased biological half-life, or increased water solubility.
- Chemical modifications applicable to the variants usable in the present invention include without limitation: PEGylation, glycosylation of non-glycosylated parent polypeptides, covalent coupling to therapeutic small molecules, like glucagon-like peptide 1 agonists, including exenatide, albiglutide, taspoglutide, DPP4 inhibitors, incretin and liraglutide, or the modification of the glycosylation pattern present in the parent polypeptide.
- Such chemical modifications applicable to the variants usable in the present invention may occur co- or post-translational.
- amino acid encompasses naturally occurring amino acids as well as amino acid derivatives.
- a hydrophobic non-aromatic amino acid in the context of the present invention is preferably any amino acid which has a Kyte-Doolittle hydropathy index of higher than 0.5, more preferably of higher than 1.0, even more preferably of higher than 1.5 and is not aromatic.
- a hydrophobic non-aromatic amino acid in the context of the present invention is selected from the group consisting of the amino acids alanine (Kyte Doolittle hydropathy index 1.8), methionine (Kyte Doolittle hydropathy index 1.9), isoleucine (Kyte Doolittle hydropathy index 4.5), leucine Kyte Doolittle hydropathy index 3.8), and valine (Kyte Doolittle hydropathy index 4.2), or derivatives thereof having a Kyte Doolittle hydropathy index as defined above.
- variant is used herein to refer to a polypeptide which differs in comparison to the polypeptide or fragment thereof from which it is derived by one or more changes in the amino acid sequence.
- the polypeptide from which a protein variant is derived is also known as the parent polypeptide.
- the fragment from which a protein fragment variant is derived from is known as the parent fragment.
- a variant is constructed artificially, preferably by gene-technological means.
- the parent polypeptide is a wild-type protein or wild-type protein domain.
- variants usable in the present invention may also be derived from homologs, orthologs, or paralogs of the parent polypeptide or from artificially constructed variant, provided that the variant exhibits at least one biological activity of the parent polypeptide.
- the changes in the amino acid sequence may be amino acid exchanges, insertions, deletions, N-terminal truncations, or C-terminal truncations, or any combination of these changes, which may occur at one or several sites.
- a variant usable in the present invention exhibits a total number of up to 23 (up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23) changes in the amino acid sequence (i.e.
- SEQ ID NO: 1 A particularly preferred variant of SEQ ID NO: 1 is shown in SEQ ID NO: 3, which exhibits one additional amino acid (glycine) at its N-terminus (+G variant).
- the amino acid exchanges may be conservative, and/or semi-conservative, and/or nonconservative.
- a variant usable in the present invention differs from the protein or domain from which it is derived by up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 amino acid exchanges, preferably conservative amino acid changes.
- Typical substitutions are among the aliphatic amino acids, among the amino acids having aliphatic hydroxyl side chain, among the amino acids having acidic residues, among the amide derivatives, among the amino acids with basic residues, or the amino acids having aromatic residues.
- Typical semi-conservative and conservative substitutions are:
- a "variant" as used herein can be characterized by a certain degree of sequence identity to the parent polypeptide or parent polynucleotide from which it is derived. More precisely, a protein variant in the context of the present invention exhibits at least 85% sequence identity to its parent polypeptide.
- the term “at least 85% sequence identity” is used throughout the specification with regards to polypeptide and polynucleotide sequence comparisons.
- This expression preferably refers to a sequence identity of at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% to the respective reference polypeptide or to the respective reference polynucleotide.
- Fragments of proteins comprise deletions of amino acids, which may be N-terminal truncations, C-terminal truncations or internal deletions or any combination of these. Such proteins comprising N-terminal truncations, C-terminal truncations and/or internal deletions are referred to as "fragments" in the context of the present application.
- a fragment may be naturally occurring (e.g. splice variants) or it may be constructed artificially, preferably by gene-technological means.
- a fragment has a deletion of up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 amino acids at its N-terminus and/or at its C-terminus and/or internally as compared to the parent polypeptide, preferably at its N-terminus, at its N- and C-terminus, or at its C-terminus.
- Ebenhoch R. et al., 2019 suggest that the receptor interaction is more likely to take place in the front/protruding part of the top face of MYDGF and indicates that Tyr73 may be the key residue for receptor interaction.
- sequence identity is to be calculated with reference to the longer of the two sequences to be compared, if not specifically indicated otherwise.
- sequence alignments can be carried out with several art-known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER package, http://hmmer.wustl.edu/) or with the CLUSTAL algorithm (Thompson, J. D., Higgins, D. G. & Gibson, T. J. (1994) Nucleic Acids Res.
- sequence matching may be calculated using e.g. BLAST, BLAT or BlastZ (or BlastX).
- BLASTN and BLASTP programs of Altschul et al. (1990) J. Mol. Biol. 215: 403-410.
- Gapped BLAST is utilized as described in Altschul et al. (1997) Nucleic Acids Res. 25: 3389-3402.
- Sequence matching analysis may be supplemented by established homology mapping techniques like Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1 :154-162) or Markov random fields.
- Shuffle-LAGAN Brudno M., Bioinformatics 2003b, 19 Suppl 1 :154-162
- Markov random fields Markov random fields.
- host cell refers to a cell that harbours a nucleic acid of the invention (e.g. in form of a plasmid or virus).
- host cell may either be a prokaryotic (e.g. a bacterial cell) or a eukaryotic cell (e.g. a fungal, plant or animal cell).
- the cell can be transformed or non-transformed.
- the cell can be an isolated cell for example in a cell culture or part of a tissue, which itself can be isolated or part of a more complex organization structure such as an organ or an individual.
- MYDGF myeloid-derived growth factor
- Factor 1 myeloid-derived growth factor
- MYDGF polypeptide or protein or “Factor 1 polypeptide or protein” are used interchangeably and refer to the protein indicated in NCBI reference sequence NM 019107.3 (human homologue) as well as to its mammalian homologues, in particular from mouse or rat.
- the amino acid sequence of the human homologue is encoded in open reading frame 10 on human chromosome 19 (C190rflO).
- MYDGF and Factor 1 protein refer to a protein, which comprises, essentially consists or consists of a core segment of human Factor 1 having an amino acid sequence according to SEQ ID NO: 1.
- MYDGF and Factor 1 protein refer to a protein, which comprises SEQ ID NO: 3.
- MYDGF refers to a protein, which essentially consists of SEQ ID NO: 3.
- MYDGF refers to a protein, which consists of SEQ ID NO: 3.
- MYDGF as defined herein and fragments and variants thereof include pharmaceutically acceptable salts thereof.
- a protein, variant or fragment exhibits the biological function of MYDGF can be determined by any one of the tests described in the examples below.
- a peptide or protein exhibits the biological function of MYDGF if the results obtained with such peptide or protein compared to the results obtained with the MYDGF protein of the present invention shown in at least one of the examples presented herein below achieve at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or 100% of the effect reported for MYDGF over the indicated controls.
- MYDGF myeloid-derived growth factor
- cardiogenic shock describes a state of end-organ hypoperfusion due to cardiac failure and the inability of the cardiovascular system to provide adequate blood flow to the extremities and vital organs.
- Patients with cardiogenic shock manifest persistent hypotension (systolic blood pressure less than 80 to 90 mm Hg, or a mean arterial pressure 30 mm Hg below baseline, or vasopressor or inotropes support to maintain SBP >90 mm Hg, or mean arterial blood pressure ⁇ 70 mm Hg, or systolic blood pressure ⁇ 100 mm Hg despite adequate fluid resuscitation), with evidence of end-organ damage (as evidenced for example by urine output ⁇ 30 mL/h, or urine output ⁇ 0.5 mL/kg for 1 h, or cool extremities, or mottled skin, or serum lactate >2 mmol/L, or metabolic acidosis, or altered mental status), with a severe reduction in cardiac index (less than 2.2 L/min per m 2 ) in the presence of adequate or elevated filling
- treat means accomplishing one or more of the following: (a) reducing the severity of the disorder; (b) limiting or preventing development of symptoms characteristic of the disorder(s) being treated; (c) inhibiting worsening of symptoms characteristic of the disorder(s) being treated; (d) limiting or preventing recurrence of the disorder(s) in an individual that have previously had the disorder(s); (e) limiting or preventing recurrence of symptoms in individuals that were previously symptomatic for the disorder(s); (f) reduction of mortality after occurrence of a disease or a disorder; (g) healing; and (h) prophylaxis of a disease.
- the term “ameliorating” is also encompassed by the term “treating”. In line therewith, the term “treating and/or preventing” a condition or disease as mentioned herein means that the condition or disease is treated or prevented, or both.
- stroke volume describes the volume of blood ejected by the right/left ventricle in a single contraction. It is the difference between the end-diastolic volume (EDV) and the end-systolic volume (ESV).
- stroke work describes the work performed by the left or right ventricle to eject the stroke volume into the aorta or pulmonary artery, respectively.
- cardiac output describes the amount of blood pumped by the ventricle in unit time.
- dP/dtmin and “dP/dtmax” describe the minimum and maximum rate of pressure change in the ventricle, respectively. Peak dP/dt is used as an index of ventricular performance.
- isovolumic relaxation constant or “Tau” describes the exponential decay of the ventricular pressure during isovolumic relaxation. It is also referred to as the ventricular diastolic time constant.
- fraction of inhaled oxygen or “FiCh” describes the molar or volumetric fraction of oxygen in the inhaled gas. Natural air includes 21% oxygen, which is equivalent to FiO 2 of 0.21.
- subject refers to an individual, such as a human, a non-human primate (e.g. chimpanzees and other apes and monkey species); farm animals, such as birds, fish, cattle, sheep, pigs, goats and horses; domestic mammals, such as dogs and cats; laboratory animals including rodents, such as mice, rats and guinea pigs.
- the term does not denote a particular age or sex.
- the subject is a mammal.
- the subject is a human.
- the subject can be a healthy subject or a subject suffering from or suspected of having one or more diseases.
- a subject suffering from or suspected of having one or more diseases is also referred to as a patient.
- SEQ ID NO: 1 amino acid sequence of human Factor 1 (MYDGF), lacking the 31 aa N-terminal signal peptide):
- SEQ ID NO: 2 amino acid sequence of MYDGF, including the N-terminal signal peptide (shown in bold and underlined); UniProtKB - Q969H8):
- SEQ ID NO: 4 shows the nucleic acid sequence of human Factor 1 encoding MYDGF of SEQ ID NO: 3 (NCBI Gene ID: 56005).
- the present disclosure shows for the first time anti-cardiogenic shock effects for MYDGF.
- the disclosure particularly shows that administration of MYDGF in a mouse model of cardiogenic shock attenuates symptoms associated with cardiogenic shock.
- the disclosure shows that treatment of mice of an animal model of cardiogenic shock with MYDGF increases cardiac output, stroke work, stroke volume, ventricular end-systolic pressure and ventricular ejection fraction compared to control mice treated with saline.
- MYDGF successfully treats cardiogenic shock and increases overall survival (cf. examples below).
- the invention provides the protein myeloid-derived growth factor (MYDGF) or a fragment or a variant thereof for use in treating and/or preventing cardiogenic shock.
- MYDGF protein myeloid-derived growth factor
- the fragment or variant of MYDGF exhibits the biological function of MYDGF.
- the cardiogenic shock to be treated or prevented is in the course of (acute) myocardial infarction (AMI, MI), preferably ST elevation myocardial infarction (STEMI), even more preferably a cardiogenic shock in the course of a MI or STEMI in the course of reperfusion following Percutaneous Coronary Intervention (PCI).
- AMI acute myocardial infarction
- STEMI ST elevation myocardial infarction
- PCI Percutaneous Coronary Intervention
- the protein comprises the amino acid sequence SEQ ID NO: 1 or a fragment thereof.
- the protein has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 1.
- the protein comprises the amino acid sequence SEQ ID NO: 1, a fragment or a variant thereof which has at least 85% sequence identity to SEQ ID NO: 1.
- the fragment or variant of MYDGF exhibits the biological function of MYDGF.
- the MYDGF protein comprises, essentially consists or consists of the amino acid sequence SEQ ID NO: 1 or 3, or a fragment or variant thereof.
- the fragment or variant of MYDGF exhibits the biological function of MYDGF.
- the protein has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: 1.
- N-terminal deletion variants are also encompassed, which may for example lack one or more amino acids from amino acid position 1 to 24 (based on SEQ ID NO: 1), i.e. from the N-terminally conserved region.
- C-terminal deletion variants are also encompassed, which may for example lack one or more amino acids from amino acid position 114 to 142 (based on SEQ ID NO: 1).
- amino acids can be added to the MYDGF protein.
- Such additions include additions at the N-terminus, at the C-terminus, within the amino acid sequence or combinations thereof.
- the protein of the first aspect of the present invention may thus further comprise additional amino acid sequences, e.g. for stabilizing or purifying the resulting protein.
- additional amino acid sequences e.g. for stabilizing or purifying the resulting protein.
- amino acids are 6xHis-tags, myc-tags, or FLAG-tags, which are well known in the art, and which may be present at any position in the protein, preferably at the N-terminus or the C-terminus.
- a particularly preferred additional sequence is a 6xHis-tag.
- said 6xHis-tag is present on the C-terminus of the MYDGF protein.
- one or more residual amino acids may remain on the N-terminus and/or the C-terminus of the protein. It is emphasized that in the MYDGF protein and Mydgf protein according to the present invention such artefacts may be present, as in shown e.g. in Ebenhoch R. et al., Nat Commun. 2019 Nov 26;10(l):5379, and Polten F. et al., Anal Chem. 2019 Jan 15;91(2):1302-1308.
- protease cleavage sites within the MYDGF protein of the first aspect of the present invention it is preferred to mutate protease cleavage sites within the MYDGF protein of the first aspect of the present invention to stabilize the protein (see Segers et al. Circulation 2007, 2011).
- the skilled person knows how to determine potential proteolytic cleavage sites within a protein.
- protein sequences can be submitted to websites providing such analysis as, e.g. http://web.expasy.org/peptide_cutter/ or http://pmap.burnham.org/proteases. If the protein sequence according to SEQ ID NO: 1 is submitted to http://web.expasy.org/peptide_cutter/ the following cleavage sites with lower frequency (less than 10) are determined:
- These sites may be altered to remove the recognition/cleavage sequence of the respectively identified protease to increase the serum half-life of the protein.
- the MYDGF protein may further comprise additional amino acid sequences, e.g. for stabilizing or purifying the resulting protein. For example, it is preferred to mutate protease cleavage sites within the MYDGF protein to stabilize the protein. Suitable proteolytic cleavage sites can be identified as described above.
- the MYDGF protein or compositions comprising the protein can administered in vivo, ex vivo or in vitro, preferably in vivo.
- Nucleic acid sequences can be optimized in an effort to enhance expression in a host cell. Parameters to be considered include C:G content, preferred codons, and the avoidance of inhibitory secondary structure. These Factors can be combined in different ways in an attempt to obtain nucleic acid sequences having enhanced expression in a particular host (cf. e.g. Donnelly et al., International Publication Number WO 97/47358). The ability of a particular sequence to have enhanced expression in a particular host involves some empirical experimentation. Such experimentation involves measuring expression of a prospective nucleic acid sequence and, if needed, altering the sequence.
- nucleic acid encodes an amino acid sequence having at least 85% sequence identity to SEQ ID NO: 1.
- the nucleic acid for use according to the present invention may further comprise a transcriptional control element or expression control sequences positioned to control expression of the protein.
- a transcriptional control element or expression control sequences positioned to control expression of the protein.
- Such a nucleic acid together with control elements is often termed as an expression system.
- expression system refers to a system designed to produce one or more gene products of interest. Typically, such system is designed “artificially”, i.e. by gene-technological means usable to produce the gene product of interest in vivo, in vitro or ex vivo.
- expression system further encompasses the expression of the gene product of interest comprising the transcription of the polynucleotides, mRNA splicing, translation into a polypeptide, co- and post-translational modification of a polypeptide or protein as well as the targeting of the protein to one or more compartments inside of the cell, the secretion from the cell and the uptake of the protein in the same or another cell.
- This general description refers to expression systems for the use in eukaryotic cells, tissues or organisms. Expression systems for prokaryotic systems may differ, wherein it is well known in the art, how an expression system for prokaryotic cells is constructed.
- Regulatory elements present in a gene expression cassette generally include: (a) a promoter transcriptionally coupled to a nucleotide sequence encoding the polypeptide, (b) a 5' ribosome binding site functionally coupled to the nucleotide sequence, (c) a terminator joined to the 3' end of the nucleotide sequence, and (d) a 3' polyadenylation signal functionally coupled to the nucleotide sequence.
- Additional regulatory elements useful for enhancing or regulating gene expression or polypeptide processing may also be present. Promoters are genetic elements that are recognized by an RNA polymerase and mediate transcription of downstream regions. Preferred promoters are strong promoters that provide for increased levels of transcription.
- promoters examples include the immediate early human cytomegalovirus promoter (CMV), and CMV with intron A (Chapman et al, Nucl. Acids Res. 19:3979-3986, 1991). Additional examples of promoters include naturally occurring promoters such as the EFl alpha promoter, the murine CMV promoter, Rous sarcoma virus promoter, and SV40 early/late promoters and the [beta]-actin promoter; and artificial promoters such as a synthetic muscle specific promoter and a chimeric muscle-specific/CMV promoter (Li et al., Nat. Biotechnol. 17:241-245, 1999 , Hagstrom et al., Blood 95:2536-2542, 2000).
- CMV immediate early human cytomegalovirus promoter
- CMV with intron A Chapman et al, Nucl. Acids Res. 19:3979-3986, 1991.
- Additional examples of promoters include naturally occurring promoter
- the ribosome binding site is located at or near the initiation codon. Examples of preferred ribosome binding sites include CCACCAUGG, CCGCCAUGG, and ACCAUGG, where AUG is the initiation codon (Kozak, Cell 44:283-292, 1986).
- the polyadenylation signal is responsible for cleaving the transcribed RNA and the addition of a poly (A) tail to the RNA.
- the polyadenylation signal in higher eukaryotes contains an AAUAAA sequence about 11-30 nucleotides from the polyadenylation addition site. The AAUAAA sequence is involved in signaling RNA cleavage (Lewin, Genes IV, Oxford University Press, NY, 1990).
- the poly (A) tail is important for the processing, export from the nucleus, translation and stability of the mRNA.
- Polyadenylation signals that can be used as part of a gene expression cassette include the minimal rabbit [beta] -globin polyadenylation signal and the bovine growth hormone polyadenylation (BGH) (Xu et al., Gene 272: 149-156, 2001 , Post et al., U.S. Patent U. S. 5,122,458).
- BGH bovine growth hormone polyadenylation
- Examples of additional regulatory elements useful for enhancing or regulating gene expression or polypeptide processing that may be present include an enhancer, a leader sequence and an operator.
- An enhancer region increases transcription. Examples of enhancer regions include the CMV enhancer and the SV40 enhancer (Hitt et al., Methods in Molecular Genetics 7: 13-30, 1995 , Xu, et al., Gene 272: 149-156, 2001).
- An enhancer region can be associated with a promoter.
- the expression of the MYDGF protein or of the variant thereof according to the present invention may be regulated. Such regulation can be accomplished in many steps of the gene expression. Possible regulation steps are, for example but not limited to, initiation of transcription, promoter clearance, elongation of transcription, splicing, export from the nucleus, mRNA stability, initiation of translation, translational efficiency, elongation of translation and protein folding. Other regulation steps, which influence the concentration of a MYDGF polypeptide inside a cell affect the half-life of the protein. Such a regulation step is, for example, the regulated degeneration of proteins. As the proteins of the invention comprise secreted proteins, the protein can be directed to a secretory pathway of the host cell.
- Outside of the cell can refer to, for example but not limited to, a culture medium, a tissue, intracellular matrix or space or a body fluid such as blood or lymph.
- control of the regulatory steps mentioned above can be, for example, cell-type or tissue-type independent or cell-type or tissue-type specific.
- the control of the regulatory steps is cell-type or tissue-type specific.
- Such a cell-type or tissue-type specific regulation is preferably accomplished through the regulation steps referring to the transcription of a nucleic acid.
- This transcriptional regulation can be accomplished through the use of cell-type or tissue-type specific promoter sequences.
- the result of this cell-type or tissue-type specific regulation can have different grades of specificity. This means, that the expression of a respective polypeptide is enhanced in the respective cell or tissue in comparison to other cell- or tissue-type or that the expression is limited to the respective cell- or tissue-type.
- Cell- or tissue-type specific promoter sequences are well known in the art and available for a broad range of cell- or tissue-types.
- the expression is not necessarily cell-type or tissue-type specific but may depend from physiological conditions. Such conditions are for example an inflammation or a wound. Such a physiological condition-specific expression can also be accomplished through regulation at all above mentioned regulation steps.
- the preferred way of regulation for a physiological condition-specific expression is the transcriptional regulation.
- a wound or inflammation specific promoter can be used.
- Respective promoters are, for example, natural occurring sequences, which can be, for example, derived from genes, which are specifically expressed during an immune reaction and/or the regeneration of wounded tissue.
- artificial promoter sequences which are, for example constructed through combination of two or more naturally occurring sequences.
- the regulation can be cell-type or tissue-type specific and physiological conditionspecific.
- the expression can be a heart specific expression.
- the expression is heart specific and/or wound specific.
- a regulation of expression of the MYDGF protein or variant thereof according to the present invention is the conditional regulation of the gene expression.
- an operator sequence can be used.
- the Tet operator sequence can be used to repress gene expression.
- the conditional regulation of gene expression by means of the Tet operator together with a Tet repressor is well known in the art and many respective systems have been established for a broad range of prokaryotic and eukaryotic organisms. A person of skill in the art knows how to choose a suitable system and adapt it to the special needs of the respective application.
- the use of a nucleic acid according to the invention comprises the application to an individual or patient, preferably an individual or patient suffering from cardiogenic shock.
- the present invention provides vectors comprising the nucleic acid or the expression system described herein for use in treating and/or preventing cardiogenic shock.
- vector refers to a protein or a polynucleotide or a mixture thereof which is capable of being introduced or of introducing the proteins and/or nucleic acid comprised therein into a cell.
- genes of interest encoded by the introduced polynucleotide are expressed within the host cell upon introduction of the vector or the vectors.
- suitable vectors include but are not limited to plasmid vectors, cosmid vectors, phage vectors such as lambda phage, filamentous phage vectors, viral vectors, viral like particles, and bacterial spores.
- the vector is a viral vector.
- Suitable viral vectors include but are not limited to adenoviral vectors, adeno-associated viral (AAV) vectors, alphaviral vectors, herpes viral vectors, measles viral vectors, pox viral vectors, vesicular stomatitis viral vectors, retroviral vector and lentiviral vectors.
- AAV adeno-associated viral
- the vector is an adenoviral or an adeno-associated viral (AAV) vector.
- Nucleic acids encoding one or more MYDGF proteins or variants thereof according to the invention can be introduced into a host cell, a tissue or an individual using vectors suitable for therapeutic administration. Suitable vectors can preferably deliver nucleic acids into a target cell without causing an unacceptable side effect.
- a vector according to the invention comprises the application to an individual in need thereof.
- Vectors comprising nucleic acids encoding the MYDGF protein or fragments or variants thereof preferably exhibiting the biological function of MYDGF described above are preferably for use in treating and/or preventing cardiogenic shock.
- the present invention provides a host cell comprising the vector as described herein and expressing the nucleic acid encoding the MYDGF protein or a fragment or a variant thereof for use in treating and/or preventing cardiogenic shock.
- the fragment or variant of MYDGF exhibits the biological function of MYDGF.
- the present invention provides pharmaceutical compositions comprising the MYDGF protein or a fragment or a variant thereof and optionally a suitable pharmaceutical excipient, for use in treating and/or preventing cardiogenic shock.
- the fragment or variant of MYDGF exhibits the biological function of MYDGF.
- suitable pharmaceutical excipient refers to a pharmacologically inactive substance such as but not limited to a diluent, excipient, surfactants, stabilizers, physiological buffer solutions or vehicles with which the therapeutically active ingredient is administered.
- “Pharmaceutical excipients” are also called “pharmaceutical carriers” and can be liquid or solid. Liquid carriers include but are not limited to sterile liquids, such as saline solutions in water and oils, including but not limited to those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like.
- saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
- a saline solution is a preferred carrier when the pharmaceutical composition is administered intravenously.
- suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin.
- the carrier is a suitable pharmaceutical excipient. Suitable pharmaceutical excipients comprise starch, glucose, lactose, sucrose, gelatine, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like.
- Such suitable pharmaceutical excipients are preferably pharmaceutically acceptable.
- pharmaceutical pharmaceutically acceptable
- medium a substance and/or a combination of substances being used for the identification, prevention and/or treatment of a tissue status or disease.
- “Pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans.
- the term "pharmaceutically acceptable salt” refers to a salt of the protein or peptide of the present invention. Suitable pharmaceutically acceptable salts include acid addition salts which may, for example, be formed by mixing a solution of the peptide of the present invention with a solution of a pharmaceutically acceptable acid such as hydrochloric acid, sulfuric acid, fumaric acid, maleic acid, succinic acid, acetic acid, benzoic acid, citric acid, tartaric acid, carbonic acid or phosphoric acid.
- a pharmaceutically acceptable acid such as hydrochloric acid, sulfuric acid, fumaric acid, maleic acid, succinic acid, acetic acid, benzoic acid, citric acid, tartaric acid, carbonic acid or phosphoric acid.
- suitable pharmaceutically acceptable salts thereof may include alkali metal salts (e.g., sodium or potassium salts); alkaline earth metal salts (e.g., calcium or magnesium salts); and salts formed with suitable organic ligands (e.g., ammonium, quaternary ammonium and amine cations formed using counteranions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, alkyl sulfonate and aryl sulfonate).
- alkali metal salts e.g., sodium or potassium salts
- alkaline earth metal salts e.g., calcium or magnesium salts
- suitable organic ligands e.g., ammonium, quaternary ammonium and amine cations formed using counteranions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, alkyl sulfonate and aryl sul
- compositions include, but are not limited to, acetate, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bicarbonate, bisulfate, bitartrate, borate, bromide, butyrate, calcium edetate, camphorate, camphorsulfonate, camsylate, carbonate, chloride, citrate, clavulanate, cyclopentanepropionate, digluconate, dihydrochloride, dodecyl sulfate, edetate, edisylate, estolate, esylate, ethanesulfonate, formate, fumarate, gluceptate, glucoheptonate, gluconate, glutamate, glycerophosphate, glycolylarsanilate, hemisulfate, heptanoate, hexanoate, hexylresorc
- active ingredient refers to the substance in a pharmaceutical composition or formulation that is biologically active, i.e. that provides pharmaceutical value.
- a pharmaceutical composition may comprise one or more active ingredients which may act in conjunction with or independently of each other.
- the active ingredient can be formulated as neutral or salt forms.
- Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as but not limited to those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2- ethylamino ethanol, histidine, procaine, and the like.
- composition intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it.
- carrier refers to a pharmacologically inactive substance such as but not limited to a diluent, excipient, or vehicle with which the therapeutically active ingredient is administered.
- Such pharmaceutical carriers can be liquid or solid.
- Liquid carriers include but are not limited to sterile liquids, such as saline solutions in water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions.
- a saline solution is a preferred carrier when the pharmaceutical composition is administered intravenously. Examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin.
- composition is preferably intended to include the formulation of the active compound with e.g. encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with the active compound.
- the active ingredient is administered to a cell, a tissue or an individual in a therapeutically effective amount.
- a “therapeutically effective amount” is an amount of an active ingredient sufficient to achieve the intended purpose.
- the active ingredient may be a therapeutic agent.
- the effective amount of a given active ingredient will vary with parameters such as the nature of the ingredient, the route of administration, the size and species of the individual to receive the active ingredient, and the purpose of the administration. The effective amount in each individual case may be determined empirically by a skilled artisan according to established methods in the art.
- administering includes in vivo administration to an individual as well as administration directly to cells or tissue in vitro or ex vivo.
- the pharmaceutical composition is customized for the treatment of a disorder and specifically for the treatment of cardiogenic shock.
- the pharmaceutical composition is customized for the prevention of a disorder and specifically for the prevention of cardiogenic shock.
- the pharmaceutical composition is customized for the prevention and treatment of cardiogenic shock.
- treatment with a pharmaceutical composition according to the invention comprises the treatment of an individual in need of such treatment and/or the prevention of cardiogenic shock in an individual in need thereof.
- the pharmaceutical composition contemplated by the present invention may be formulated in various ways well known to one of skill in the art.
- the pharmaceutical composition of the present invention may be in liquid form such as in the form of solutions, emulsions, or suspensions.
- the pharmaceutical composition of the present invention is formulated for parenteral administration, preferably for intravenous, intra-arterial, intramuscular, subcutaneous, transdermal, intrapulmonary, intraperitoneal intracoronary, intra-cardiac administration, or administration via mucous membranes, preferably for intravenous, subcutaneous, or intraperitoneal administration.
- a preparation for oral or anal administration is also possible.
- the pharmaceutical composition of the present invention is in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood.
- the aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9, more preferably to a pH of from 5 to 7), if necessary.
- the pharmaceutical composition is preferably in unit dosage form. In such form the pharmaceutical composition is subdivided into unit doses containing appropriate quantities of the active component.
- the unit dosage form can be a packaged preparation, the package containing discrete quantities of pharmaceutical composition such as vials or ampoules.
- the pharmaceutical composition is preferably administered through the intravenous, intra-arterial, intramusculuar, subcutaneous, transdermal, intrapulmonary, intraperitoneal, intracoronary or intra-cardiac route, wherein other routes of administration known in the art are also comprised.
- the use of the pharmaceutical composition can replace the standard treatment or prophylaxis for the respective disease or condition or can be administered additionally to the standard treatment.
- the pharmaceutical composition can be administered before, simultaneously or after a standard therapy and/or prophylaxis.
- the pharmaceutical composition is administered once or more than once. This comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45 or 50 times.
- the time span for the administration of the pharmaceutical is not limited. Preferably, the administration does not exceed 1, 2, 3, 4, 5, 6, 7 or 8 weeks.
- a single dose of the pharmaceutical composition can independently form the overall amount of administered doses, or the respective time span of administration can include administration as one or more bolus injection(s) and/or infusion(s).
- the present invention provides a method of treating and/or preventing cardiogenic shock, comprising administering to a patient in need thereof a therapeutically effective amount of MYDGF or fragment or variant thereof.
- Suitable MYDGF proteins, fragments, or variants thereof include those described for the first aspect.
- the fragment or variant of MYDGF exhibits the biological function of MYDGF.
- the MYDGF preferably comprises SEQ ID NO: 1, or a fragment or variant thereof exhibiting the biological function of MYDGF of SEQ ID NO: 1.
- the fragment or variant preferably comprises an amino acid sequence with at least 85% amino acid sequence identity to SEQ ID NO: 1.
- Administering may be carried out, for example, as described for the first aspect.
- the MYDGF protein or fragment or variant thereof is administered through one or more bolus injection(s) and/or infusion(s), preferably in a pharmaceutically accepted carrier and/or excipient.
- the present invention provides a method for producing a non-human mammalian model of cardiogenic shock, the method comprising (i) transiently ligating a coronary artery of the mammal, (ii) establishing reperfusion, and (iii) ventilating the mammal with a fraction of inhaled oxygen (FiCE) of about 0.18 or less.
- Transient ligation can be performed by any method known to the skilled person as being suitable for blocking or significantly reducing blood flow.
- ligation is performed by placing and tightening a surgical thread or surgical wire around a coronary artery, thereby blocking or essentially blocking blood flow through the artery.
- Reperfusion is preferably established by reestablishing blood flow, e.g. by opening the surgical thread or surgical wire, allowing blood to flow through the artery. Ventilation of the mammal is performed by standard means known in the art, e.g. mechanical ventilation commonly used in surgery of mammals.
- Cardiogenic shock is characterized for example by a lowered ventricular end-systolic pressure (VESP) and reduced cardiac output as well as a raised arterial lactate concentration compared to a healthy subject or compared to the subject before the method has been carried out.
- VESP ventricular end-systolic pressure
- the novel non-human mammalian model of cardiogenic shock has the advantage that small animals such as rodents can be used, that are established in laboratory practice. There is no necessity for using larger animals such as pigs, which involve higher costs for food, shelter and animal husbandry, and which are more complicated to investigate.
- the new model allows e.g. genetically modified mice to be investigated, for example to explore molecular mechanisms of cardiogenic shock. Genetically modified mice can be easily generated, or are already available in the research community, or can be commercially obtained e.g. from The Jackson Laboratory. In contrast, genetically modified larger animals such as pigs are extremely difficult to generate and only few genetically modified large animals are available.
- the non-human mammal is a rodent.
- the non-human animal is a mouse.
- the coronary artery is the proximal left anterior descending coronary artery.
- any other major coronary heart artery can be used which transient ligation eventually results in reduced ventricular end-systolic pressure (VESP) and increased arterial lactate concentration.
- VESP ventricular end-systolic pressure
- the coronary artery is ligated for about 30 minutes to about 90 minutes before reperfusion is established.
- the coronary artery is ligated for a time selected from a range having a lower value of about 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, or 85 minutes and an upper value of about 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, or 90 minutes, or in any combination thereof. More preferably, the coronary artery is ligated for about 45 to 70 minutes, and most preferably for about 60 minutes.
- the mammal is ventilated with a fraction of inhaled oxygen (FiCh) of between about 0.18 and about 0.12.
- FiCh fraction of inhaled oxygen
- the mammal is ventilated with a fraction of inhaled oxygen of an amount selected from a range having a lower value of about 0.12, 0.13, 0.14, 0.15, 0.16, or 0.17 and an upper value of about 0.13, 0.14, 0.15, 0.16, 0.17, or 0.18, and in any combination thereof. More preferably, the mammal is ventilated with a fraction of inhaled oxygen of between about 0.17 and about 0.14, most preferably of about 0.16.
- the present invention also provides model animals obtained by performing the method for producing a non-human mammalian model of cardiogenic shock.
- the N-terminal V residue in position +1 of the mature human MYDGF is preceded by a G residue.
- the variant has the sequence as denoted in SEQ ID NO: 3 and was manufactured as described in Polten, F. et al. (2019), Anal Chem, 91, 1302-1308 on page 1303, 1 st column and Figure SI, and in Ebenhoch, R. et al. (2019), Nat Commun 10, 5379 on page 8, left column.
- mice were housed in individually ventilated cages on a 12-hour light/dark cycle in the central animal facility of Hannover Medical School. Food and water were provided ad libitum. During surgery, mice were placed on a heating pad connected to a temperature controller (Fbhr Medical Instruments) to keep rectal temperature at 37°C. Statistical analyses.
- MI Myocardial infarction
- EH7405 slipknot to induce ischemia, which was removed 1 h later to induce reperfusion.
- the ligature around the LAD was not tied.
- a micromanometer-tipped conductance catheter was inserted via the right carotid artery to record left ventricular (LV) pressure-volume loops.
- LV left ventricular
- LVESP LV end- systolic pressure
- CS cardiogenic shock
- Ml-hx mice gradually declined in Ml-hx mice (MI with CS) but remained stable in Ml-nx mice (MI without CS).
- Heart rate was not affected (475 ⁇ 16 vs 486 ⁇ 8 min' 1 ).
- Intravenous dobutamine infusion an established symptomatic therapy for patients with CS (Vahdatpour et al. Journal of the American Heart Association, Vol 8(8), 2019, eOl 1991), increased LVESP (Fig. 3A) and cardiac output (Fig. 3B), and lowered arterial lactate (5.6 ⁇ 0.6 vs 11.1 ⁇ 0.7 mmol/L, P ⁇ 0.001, 4-6 mice per group) in Ml-hx mice.
- the MYDGF protein (human Factor 1; C19orfl0) was identified as detailed in
- WO 2014/111458 The nucleic acid sequence encoding human Factor 1 is available under NCBI Gene ID: 56005 (SEQ ID NO: 4).
- the amino acid sequence of human Factor 1 including the N-terminal signal peptide is detailed in SEQ ID NO: 2.
- the human [+G] MYDGF variant according to SEQ ID NO: 3 without the signal peptide was used and expressed as detailed in Ebenhoch R. et al., Crystal structure and receptor-interacting residues of MYDGF - a protein mediating ischemic tissue repair (Nat Commun. 2019 Nov 26;10(l):5379 and Polten et al.
- Acute myocardial infarction was induced in C57BL6/N mice, pretreated with butorphanol (2 mg/kg, subcutaneously (s.c.)) and atropine (0.02 mg/kg, s.c.) to reduce bronchial secretions, by transient left anterior descending coronary artery ligation for 60 minutes.
- Human MYDGF (10 pg in 100 pL) or saline (control) were bolus-injected into the left ventricular cavity at the time of reperfusion. After reperfusion, a micromanometer-tipped conductance catheter was inserted via the right carotid artery to continuously record left ventricular pressure-volume (PV) loops.
- PV left ventricular pressure-volume
- CS cardiogenic shock
- s.c. subcutaneous administration
- i.v. intravenous administration
- MYDGF significantly improved the survival rate of cardiogenic shock mice as shown in Figure 6.
- MYDGF further reverses acidosis and lowers lactate concentrations, i.e. two defining features of cardiogenic shock (blood gas analyses in Fig. 9).
- MYDGF is also shown to prevent declines in cardiac output and LVESP, i.e. two further defining features of cardiogenic shock (continuous PV loop recordings in Figs. 10A and B).
- Figs. 12 A and B The impact of MYDGF treatment on plasma troponin levels and alanine transaminase (ALT) concentration determined at the end of the 120 minutes observation period is shown in Figs. 12 A and B.
- Plasma troponin is an indicator of cardiac damage and ALT reflects end-organ (liver) damage.
- MYDGF treatment of CS mice reduces both, plasma troponin and alanine transaminase levels.
- the impact of MYDGF on cell death in the infarct region was determined at the end of the 120 minutes observation period by measuring soluble nucleosomes that are released as a result of cell death. Measurements were performed using the commercially available Cell Death Detection ELISA from Roche. Fig.
- 12C displays the ratio of soluble nucleosomes in the infarcted region (I) over the non-infarcted region (NI) as an indicator of cell death, and shows that MYDGF significantly reduced the amount of soluble nucleosomes and thus cell death in the infarct region.
- MYDGF knock-out mice were obtained as described in Korf-Klingebiel et al. (Nature Medicine, 2015, Vol. 21(2): 140-149). Cardiogenic shock (CS) was induced in wild-type (WT) and MYDGF knock-out (KO) mice as described in Example 1. Mortality rates of WT and MYDGF knock-out mice were compared during the 120 minutes observation period. As shown in Fig. 14, mortality was significantly higher in KO mice, showing that endogenous MYDGF has a protective effect in cardiogenic shock.
- heart function is continuously deteriorating during cardiogenic shock. It was assumed that this deterioration is caused by a continued aggravation of left ventricular tissue damage during cardiogenic shock.
- acute MI was induced by transient left anterior descending coronary artery ligation for 60 min.
- CS was induced by hypoxic ventilation (FiCL 0.16; Ml/with shock).
- Infarcted control mice were normoxically ventilated (FiCL 0.33; Ml/no shock).
- a scheme of the experimental set-up is shown in Fig. 15 A.
- cardiogenic shock further aggravates left ventricular tissue damage sustained during acute myocardial infarction. It was therefore tested if a delayed MYDGF therapy is capable of alleviating the symptoms of cardiogenic shock and of improving heart function.
- acute myocardial infarction was induced in mice by transient left anterior descending coronary artery ligation for 60 min. After reperfusion, a micromanometer-tipped conductance catheter was inserted via the right carotid artery to continuously record left ventricular pressure-volume (PV) loops. Thereafter, cardiogenic shock was induced by hypoxic ventilation (FiCE 0.16).
- mice received a continuous intra-left jugular vein infusion of either (i) human MYDGF (5 pg/h, infusion rate: 2 pL/min) or (ii) saline (control), until the end of the experiment when blood (anti coagulated with heparin) was drawn from the left ventricle and used for immediate blood gas and lactate analysis.
- human MYDGF 5 pg/h, infusion rate: 2 pL/min
- saline control
- Results are shown in Fig. 16B.
- heart function e.g. left ventricular ejection fraction, LVEF
- peripheral tissue perfusion e.g. lactate concentration
- MYDGF Myeloid-derived growth factor
- Item 1 Myeloid-derived growth factor (MYDGF) or a fragment or a variant thereof exhibiting the biological function of MYDGF, for use in treating and/or preventing cardiogenic shock.
- Item 2. The MYDGF for use according to item 1, wherein the MYDGF comprises:
- Item 3 The MYDGF for use according to item 1, wherein the MYDGF protein consists of SEQ ID NO: 1 or SEQ ID NO: 3.
- Item 4 A nucleic acid encoding MYDGF or a fragment or a variant thereof exhibiting the biological function of MYDGF, for use in treating cardiogenic shock.
- nucleic acid for use according to item 4, wherein the nucleic acid encodes an amino acid sequence having at least 85% sequence identity to SEQ ID NO: 1.
- Item 6 A vector comprising the nucleic acid of item 5, for use in treating and/or preventing cardiogenic shock.
- Item 7 A host cell comprising the nucleic acid of item 5 or the vector according to item 6 and preferably expressing the nucleic acid, for use in treating and/or preventing cardiogenic shock.
- Item 8 A pharmaceutical composition comprising the MYDGF protein or a fragment or a variant thereof exhibiting the biological function of MYDGF according to any one of items 1 to 3, the nucleic acid according to any one of items 4 or 5, the vector according to item 6, or the host cell according to item 7 for use in treating and/or preventing cardiogenic shock.
- Item 9 The pharmaceutical composition for use according to item 8, wherein said pharmaceutical composition is administered through the oral, intravenous, subcutaneous, intramucosal, intraarterial, intramuscular or intracoronary route.
- Item 10 The pharmaceutical composition for use of item 9, wherein the administration is through one or more bolus injection(s) and/or infusion(s).
- Item 11 A method of treating and/or preventing cardiogenic shock, comprising administering to a patient in need thereof a therapeutically effective amount of MYDGF or a fragment or variant thereof exhibiting the biological function of MYDGF.
- Item 12 A method of treating and/or preventing cardiogenic shock comprising administering to a patient in need thereof a therapeutically effective amount of a pharmaceutical composition comprising myeloid-derived growth factor (MYDGF) protein.
- MYDGF myeloid-derived growth factor
- SEQ ID NO: 1 SEQ ID NO: 1; or (ii) a fragment or variant of SEQ ID NO: 1 exhibiting the biological function of MYDGF, wherein the variant comprises an amino acid sequence with at least 85% amino acid sequence identity to SEQ ID NO: 1.
- Item 14 The method according to any one of items 11 to 13, wherein the MYDGF or fragment or variant thereof is administered through one or more bolus injection(s) and/or infusion(s), preferably in a pharmaceutically accepted carrier and/or excipient.
- Item 15 A method for producing a non-human mammalian model of cardiogenic shock, the method comprising:
- Item 16 The method of item 15, wherein the non-human mammal is a rodent, preferably wherein the non-human mammal is a mouse.
- Item 17 The method of item 15 or 16, wherein the coronary artery is ligated for about 30 minutes to about 90 minutes before reperfusion is established.
- Item 18 The method according to any one of items 15 to 17, wherein the mammal is ventilated with a fraction of inhaled oxygen of about 0.16.
Landscapes
- Health & Medical Sciences (AREA)
- Life Sciences & Earth Sciences (AREA)
- Engineering & Computer Science (AREA)
- Animal Behavior & Ethology (AREA)
- Bioinformatics & Cheminformatics (AREA)
- Environmental Sciences (AREA)
- Veterinary Medicine (AREA)
- Cardiology (AREA)
- General Health & Medical Sciences (AREA)
- Chemical & Material Sciences (AREA)
- Medicinal Chemistry (AREA)
- Pharmacology & Pharmacy (AREA)
- Heart & Thoracic Surgery (AREA)
- Zoology (AREA)
- Public Health (AREA)
- Nuclear Medicine, Radiotherapy & Molecular Imaging (AREA)
- Organic Chemistry (AREA)
- Biodiversity & Conservation Biology (AREA)
- Animal Husbandry (AREA)
- Chemical Kinetics & Catalysis (AREA)
- General Chemical & Material Sciences (AREA)
- Immunology (AREA)
- Epidemiology (AREA)
- Proteomics, Peptides & Aminoacids (AREA)
- Hospice & Palliative Care (AREA)
- Gastroenterology & Hepatology (AREA)
- Biotechnology (AREA)
- Peptides Or Proteins (AREA)
- Medicines That Contain Protein Lipid Enzymes And Other Medicines (AREA)
- Micro-Organisms Or Cultivation Processes Thereof (AREA)
Abstract
The present invention relates to the protein myeloid-derived growth factor (MYDGF) or nucleic acids encoding said protein for use in treating and/or preventing cardiogenic shock. The present invention also relates to vectors comprising the nucleic acid, host cells expressing the nucleic acid, pharmaceutical compositions comprising said protein, nucleic acid, vector or host cell for use in treating and/or preventing cardiogenic shock, and to methods for treating and/or preventing cardiogenic shock. The present invention further relates to a method of preparing an animal model of cardiogenic shock, and to animals obtained by said method.
Description
MYELOID-DERIVED GROWTH FACTOR FOR USE IN TREATING CARDIOGENIC
SHOCK
SEQUENCE LISTING
The instant application contains a sequence listing which has been submitted electronically in xml format and is hereby incorporated by reference in its entirety.
TECHNICAL FIELD OF THE INVENTION
The present invention relates to the protein myeloid-derived growth factor (MYDGF) for use in treating and/or preventing cardiogenic shock. The present invention also relates to a novel animal model of cardiogenic shock.
BACKGROUND OF THE INVENTION
Myeloid-derived growth factor (MYDGF), also known as Factor 1, is a protein encoded in open reading frame 10 on human chromosome 19 (C190rflO). The Protein was described in 2007 in a proteome-analysis of the so called fibroblast-like synoviocytes (FLS- cells) as a new secreted Factor in the synovium. A correlation between the secretion of the protein and inflammatory diseases of the joint has been supposed without any experimental or statistical evidence (Weiler et al., Arthritis Research and Therapy 2007, The identification and characterization of a novel protein, cl9orfl0, in the synovium). A corresponding patent application claims the protein as therapeutic agent for the treatment of joint and for the diagnosis of a tissue undergoing altered growth as well as monitoring changes in a tissue (US 2008/0004232 Al, Characterization of cl9orfl0, a novel synovial protein). Another scientific publication describes an enhanced expression of the protein in hepatocellular carcinoma cells (Sunagozaka et al., International Journal of Cancer, 2010, Identification of a secretory protein cl9orfl0 activated in hepatocellular carcinoma). Recombinant produced protein showed a proliferation enhancing effect on cultured hepatocellular carcinoma cells. It is noted that C190rflO has also been referred to as IL-25, IL-27 and IL-27W as it was originally considered an interleukin. However, the terms “IL-25” and “IL-27” have been used inconsistently in the art and have been used to designate a variety of different proteins. For example, US 2004/0185049 refers to a protein as IL-27 and discloses its use in modulating the immune response. This protein is structurally distinct from Factor 1 (compare Factor 1 amino acid sequence according to SEQ ID NO: 1 to the amino acid sequence of “IL-27” according to
UniProt: Q8NEV9). Similarly, EP 2 130 547 Al refers to a protein as IL-25 and discloses its use in treating inflammation. This protein has also been referred to in the art as IL-17E and is structurally distinct from Factor 1 (compare the amino acid sequence of Factor 1 according to SEQ ID NO: 1 to the amino acid sequence of “IL-25” according to UniProt: Q9H293).
WO 2014/111458 discloses Factor 1 for use in enhancing proliferation and inhibiting apoptosis of non-transformed tissue or non-transformed cells, in particular for use in treating acute myocardial infarction. Further disclosed are inhibitors of Factor 1 for medical use, in particular for use in treating or preventing a disease in which angiogenesis contributes to disease development or progression.
Korf-Klingebiel et al. (Nature Medicine, 2015, Vol. 21(2): 140-149) report C190rflO to be secreted by bone marrow cells after myocardial infarction, which protein promotes cardiac myocyte survival and angiogenesis. The authors show that bone marrow-derived monocytes and macrophages produce this protein endogenously to protect and repair the heart after myocardial infarction, and propose the name myeloid-derived growth factor (MYDGF). In particular, treatment with recombinant mouse Mydgf is reported to reduce scar size and contractile dysfunction after myocardial infarction.
WO 2021/148411 discloses MYDGF for use in treating or preventing fibrosis, hypertrophy or heart failure. Heart failure is a clinical syndrome with a poor prognosis that may develop in response to persistent hemodynamic overload, myocardial injury, or genetic mutations.
Cardiogenic shock (CS) is a life-threatening, acute low cardiac output state resulting from severe systolic and/or diastolic myocardial dysfunction and leading to arterial hypotension, pulmonary congestion, critical end-organ hypoperfusion, and impaired tissue oxygenation. CS is associated with insufficient blood flow to the extremities and vital organs, including the heart itself, the liver, kidneys, and the brain. Critical end-organ hypoperfusion and impaired tissue oxygenation lead to an increase in blood lactate concentration, which is used for diagnosis and monitoring of patients with CS. Clinical criteria for defining CS are summarized e.g. in the review article of Vahdatpour et al. (Journal of the American Heart Association, Vol 8(8), 2019, eOl 1991). Hypoperfusion and impaired oxygenation of the heart itself lead to a progressive worsening of cardiac performance in CS thereby triggering a downward spiral of increasing hemodynamic instability associated with very high mortality.
Although CS may develop as a complication of myocardial infarction, the pathophysiologies of an uncomplicated myocardial infarction (without cardiogenic shock) and a (typically large) myocardial infarction with cardiogenic shock are largely different. Patients
with an uncomplicated myocardial infarction do not present with critical end-organ hypoperfusion and impaired tissue oxygenation, they do not have an acute and progressive worsening of cardiac function (downward spiral), and they do not have the very high acute mortality observed in patients with CS.
Likewise, patients with heart failure, fibrosis and hypertrophy of the heart do not acutely present with critical end-organ hypoperfusion and impaired tissue oxygenation, they do not have an acute progressive worsening of cardiac function (downward spiral), and they do not have the very high acute mortality observed in patients with CS.
Exemplifying the distinct pathophysiologies of these conditions, medical therapies known to improve outcome in patients with uncomplicated myocardial infarction and in patients with heart failure, fibrosis and hypertrophy of the heart (e.g. angiotensin-converting enzyme inhibitors and beta-blockers) are not useful and even contraindicated in CS. In fact, so far, no medical therapies have been identified that can improve the survival of patients in CS.
Thus, there is an urgent need for means and methods for treating and/or preventing cardiogenic shock. There is also a need for suitable animal models of cardiogenic shock to further elucidate the underlying pathophysiology and to define novel therapies for this condition.
SUMMARY OF THE INVENTION
The invention provides in a first aspect myeloid-derived growth factor (MYDGF) or a fragment or a variant thereof exhibiting the biological function of MYDGF, for use in treating and/or preventing cardiogenic shock.
According to a preferred embodiment, the MYDGF protein comprises SEQ ID NO: 1. According to one embodiment, the MYDGF protein comprises a fragment or variant of SEQ ID NO: 1, which exhibits the biological function of MYDGF, and which comprises an amino acid sequence having at least 85% amino acid sequence identity to SEQ ID NO: 1.
According to a particular preferred embodiment, the MYDGF protein consists of SEQ ID NO: 1 or SEQ ID NO: 3.
According to a further aspect, the present invention provides a nucleic acid encoding MYDGF or the fragment or variant thereof exhibiting the biological function of MYDGF, for use in treating and/or preventing cardiogenic shock.
According to one embodiment, the nucleic acid encodes an amino acid sequence having at least 85% sequence identity to SEQ ID NO: 1.
According to a further aspect, the present invention provides a vector comprising the nucleic acid of the present invention for use in treating and/or preventing cardiogenic shock.
According to a further aspect, the present invention provides a host cell comprising the nucleic acid of the present invention or the vector of the present invention for use in treating and/or preventing cardiogenic shock. Preferably, the host cell expresses the nucleic acid.
According to yet another aspect, the present invention provides a pharmaceutical composition comprising the MYDGF protein, the nucleic acid, the vector or the host cell of the present invention and optionally a suitable pharmaceutical excipient and/or carrier, for use in treating and/or preventing cardiogenic shock.
According to a preferred embodiment, the pharmaceutical composition for use is administered through the oral, intravenous, subcutaneous, intramucosal, intraarterial, intramuscular or intracoronary route. The administration is preferably through one or more bolus injection(s) and/or infusion(s).
According to a further aspect, the present invention provides a method of treating and/or preventing cardiogenic shock comprising administering to a patient in need thereof a therapeutically effective amount of myeloid-derived growth factor (MYDGF) protein.
According to one embodiment, the MYDGF protein comprises a fragment or variant of SEQ ID NO: 1, which exhibits the biological function of MYDGF, and which comprises an amino acid sequence having at least 85% amino acid sequence identity to SEQ ID NO: 1.
According to yet another embodiment, the MYDGF or fragment or variant thereof is administered through one or more bolus injection(s) and/or infusion(s), preferably in a pharmaceutically accepted carrier and/or excipient.
According to a further aspect, the present invention provides a method of treating and/or preventing cardiogenic shock comprising administering to a patient in need thereof a therapeutically effective amount of a pharmaceutical composition comprising myeloid- derived growth factor (MYDGF) protein or a fragment or variant thereof. According to one embodiment, the MYDGF protein comprises a fragment or variant of SEQ ID NO: 1, which exhibits the biological function of MYDGF, and which comprises an amino acid sequence having at least 85% amino acid sequence identity to SEQ ID NO: 1.
According to one preferred embodiment, the pharmaceutical composition comprises a suitable pharmaceutical excipient.
According to another embodiment, the pharmaceutical composition is administered through one or more bolus injection(s) and/or infusion(s).
According to a further aspect, the present invention provides a method for producing a non-human mammalian model of cardiogenic shock, the method comprising (i) transiently ligating a coronary artery of the mammal, (ii) establishing reperfusion, and (iii) ventilating the mammal with a fraction of inhaled oxygen of about 0.18 or less.
According to a preferred embodiment, the non-human mammal is a rodent, more preferably a mouse.
According to a preferred embodiment, the coronary artery is ligated for about 30 minutes to about 90 minutes before reperfusion is established.
According to a preferred embodiment, the mammal is ventilated with a fraction of inhaled oxygen of about 0.16.
BRIEF DESCRIPTION OF THE DRAWINGS
Figure 1 : A: Schematic illustration of the process scheme for preparing the cardiogenic shock animal model. Myocardial infarction (MI) was induced in 8- to 10-week- old male C57BL/6N mice by proximal left anterior descending coronary artery ligation for 60 min. Animals were subcutaneously pretreated with 2 mg/kg butorphanol and with 0.02 mg/kg atropine to reduce bronchial secretions. Anaesthesia was induced with 3-4% isoflurane. After intubation, mice were mechanically ventilated and anaesthesia was maintained with 1-2% isoflurane. After reperfusion, a micromanometer-tipped conductance catheter was inserted via the right carotid artery to continuously record left ventricular (LV) pressure-volume (PV) loops. Subsequently, mice were ventilated for 120 min with a fraction of inspired oxygen (FiCE) concentration of 0.33 or 0.16. As shown in pilot experiments, an FiCE of 0.33 was associated with normoxaemia [nx; arterial oxygen partial pressure (PaCE), 144 ± 16 mmHg; arterial oxygen saturation (SaCE), 99 ± 1%], whereas an FiCE of 0.16 resulted in mild hypoxaemia (hx; Pat , 75 ± 16 mmHg; SaCE, 89 ± 3%) (4-6 mice per group). Subsequently, infarcted and sham-operated mice were randomly ventilated with either FiCE and followed for 120 min, as described in Wang et al. Cardiovasc Res. 2021;117:2414-2415. B: left ventricular pressure volume loops sampled at 120 minutes of sham operated mice (sham) (dotted lines) and mice with induced myocardial infarction (MI) (uninterrupted lines) ventilated under normoxic (nx) and hypoxic (hx) conditions.
Figure 2: Left ventricular end-systolic pressure (LVESP) in mmHg (Fig. 2A), cardiac output in mL/min (Fig. 2B), and arterial lactate concentration in mmol/L (Fig. 2C) of sham operated mice (sham) (open circles) and mice with induced myocardial infarction (MI) (filled circles) at 120 min, all ventilated under normoxic (nx) or hypoxic (hx) conditions,
respectively. MI mice ventilated with an FiCL of 0.16 (Ml-hx) progressively developed CS as defined by the clinical hallmarks of CS, i.e. hypotension (reduced LVESP), reduced cardiac output, and increased lactate concentration. MI mice ventilated with an FiCL of 0.33 (Ml-nx) remained hemodynamically stable.
Figure 3: Starting 60 min after the initiation of hypoxic ventilation, Ml-hx mice were treated with an intravenous dobutamine infusion (5 to 7.5 ng/g/min via left jugular vein, titrated to a LVESP of 70 mmHg) (Ml-hx, dobutamine). Saline-infused Ml-hx mice served as controls (Ml-hx, saline). Dobutamine improved LVESP (Fig. 3A) and cardiac output (Fig. 3B) in Ml-hx mice. Similar hemodynamic improvements are typically observed in patients with CS treated with dobutamine.
Figure 4: Phosphoproteome analysis using high-resolution mass spectrometry with unsupervised principal component analysis (6 mice per group) in the non-infarcted left ventricular myocardium. Four experimental groups were associated with distinct phosphoproteome signatures: Sham-nx = sham operated mice normoxaemia; Sham-hx = sham operated mice hypoxaemia; Ml-nx = infarcted mice normoxaemia; Ml-hx = infarcted mice hypoxaemia.
Figure 5: Volcano plot illustrating differentially regulated phosphosites in the non- infarcted left ventricular myocardium of mice with myocardial infarction-induced CS (Ml- hx) versus mice with myocardial infarction only (Ml-nx). The top 10 down- or upregulated [P<0.05] phosphosites are shown in black. Ml-nx = infarcted mice normoxaemia; Ml-hx = infarcted mice hypoxaemia. Abbreviations denote proteins, amino acid positions indicated in brackets show the respective phosphorylated residue in each protein. RIPR1 = Rho family-interacting cell polarization regulator 1. DDA1 = DET1- and DDB 1 -associated protein 1. OSB11 = oxysterol-binding protein-related protein 11. ODPA = pyruvate dehydrogenase El component subunit alpha. SCRIB = Protein scribble homolog. SRF = serum response factor. KCNH2 = potassium voltage-gated channel subfamily H member 2. CSRP1 = cysteine and glycine-rich protein 1. MYH6 = myosin-6. DP13A = DCC- interacting protein 13 -alpha. PDLI5 = PDZ and LIM domain protein 5. TITIN = titin. HSPB1 = heat shock protein beta-1. DESMIN = desmin. LMNA = prelamin- A/C. XIRP1 = Xin actin-binding repeat-containing protein 1. TNNI3 = troponin I. TIF1B = transcription intermediary factor 1-beta.
Figure 6: Kaplan-Meier survival curve showing mortality over 120 minutes in cardiogenic shock (Ml-hx) mice treated with MYDGF or with saline.
Figure 7: Bar graphs showing results from PV loop recordings at the end of the 120
minutes observation period. Heart rate (Fig. 7A), left ventricular end-systolic volume (LVESV) (Fig. 7B), left ventricular end-diastolic volume (LVEDV) (Fig. 7C), cardiac output (Fig. 7D), stroke volume (Fig. 7E) and stroke work (Fig. 7F) of cardiogenic shock (Ml-hx) mice treated with MYDGF or with saline. *P<0.05, **P<0.01, ***P<0.001.
Figure 8: Bar graphs showing results from PV loop recordings at the end of the 120 minutes observation period. Left ventricular end-systolic pressure (LVESP) (Fig. 8A), left ventricular end-diastolic pressure (LVEDP) (Fig. 8B), left ventricular ejection fraction (LVEF) (Fig. 8C), maximal rate of pressure change in the left ventricle (dP/dtmax) (Fig. 8D), minimal rate of pressure change in the left ventricle pressure (dP/dtmin) (Fig. 8E), and left ventricular diastolic time constant (Tau) (Fig. 8F) of cardiogenic shock (Ml-hx) mice treated with MYDGF or with saline. **P<0.01, ***P<0.001.
Figure 9: Bar graphs showing results from blood gas analysis at the end of the 120 minutes observation period. pH (Fig. 9A), arterial blood oxygen partial pressure (Pat in mmHg) (Fig. 9B), arterial oxygen saturation (SaCL in %) (Fig. 9C), and lactate concentration (in mmol/L) (Fig. 9D) of cardiogenic shock (Ml-hx) mice treated with MYDGF or with saline. *P<0.05.
Figure 10: Results from continuous PV loop recordings during the 120 minutes observation period in the CS model. Cardiac output (in mL/min) (Fig. 10A) and left ventricular end-systolic pressure (LVESP) (in mmHg) (Fig. 10B) of saline-treated Ml-hx mice (CS saline) versus MYDGF-treated Ml-hx mice (CS MYDGF).
Figure 11 : Area at risk and infarct size of the left ventricle determined at the end of the 120 min observation period in the CS model. Saline-treated Ml-hx mice (Saline) versus MYDGF-treated Ml-hx mice (MYDGF). Area at risk / total LV area (in %) (Fig. 11 A) and infarct size / area at risk (in %) (Fig. 1 IB).
Figure 12: Plasma concentration of high-sensitivity cardiac troponin T (cTnT) and the liver damage marker alanine aminotransaminase (ALT) at the end of the 120 minutes observation period in the CS model. Left ventricular soluble nucleosome concentration at the end of the 120 minutes observation period in the CS model. cTnT (in ng/mL) (Fig. 12A) and alanine aminotransaminase (Log2ALT in U/L) (Fig. 12B) in saline-treated Ml-hx mice (Saline) versus MYDGF-treated Ml-hx mice (MYDGF). Soluble nucleosome concentrations measured in the infarcted (I) versus non-infarcted (NI) regions of the left ventricle were determined by ELISA. The I/NI ratio serves as an indicator for cell death (Fig. 12C).
Figure 13: Schematic illustration of the treatment regimen used on the cardiogenic shock animal model in the previous examples (Figures 6, 7, 8, 9, 10, 11, and 12). Abbreviations shown in figure are as defined for Fig. 1.
Figure 14: Kaplan-Meier survival curve showing mortality over 120 minutes of cardiogenic shock of wild-type mice (WT) and Mydgf gene-deficient (knock-out) mice (MYDGF KO).
Figure 15: Aggravation of left ventricular tissue damage caused by cardiogenic shock. Fig. 15A shows the experimental set-up. Fig. 15B shows the results of the experiment, indicating that cardiogenic shock further aggravates left ventricular tissue damage sustained during acute myocardial infarction.
Figure 16: Delayed treatment of cardiogenic shock. Fig. 16A shows the experimental set-up. Fig. 16B shows the results of the experiment, indicating that cardiogenic shock can be treated by administering MYDGF at a time point after reperfusion has been established.
DETAILED DESCRIPTION OF THE INVENTION
Before the present invention is described in detail below, it is to be understood that this invention is not limited to the particular methodology, protocols and reagents described herein as these may vary. It is also to be understood that the terminology used herein is for the purpose of describing particular embodiments only, and is not intended to limit the scope of the present invention which will be limited only by the appended claims. Unless defined otherwise, all technical and scientific terms used herein have the same meanings as commonly understood by one of ordinary skill in the art.
Definitions
Preferably, the terms used herein are defined as described in "A multilingual glossary of biotechnological terms: (IUPAC Recommendations)", H.G.W. Leuenberger, B. Nagel, and H. Kolbl, Eds., Helvetica Chimica Acta, CH-4010 Basel, Switzerland, (1995).
To practice the present invention, unless otherwise indicated, conventional methods of chemistry, biochemistry, cell biology, and recombinant DNA techniques are employed which are explained in the literature in the field (cf., e.g., Molecular Cloning: A Laboratory Manual, 2nd Edition, J. Sambrook et al. eds., Cold Spring Harbor Laboratory Press, Cold Spring Harbor 1989). Furthermore, conventional methods of clinical cardiology are employed which are also explained in the literature in the field (cf., e.g., Braunwald’s Heart Disease. A
Textbook of Cardiovascular Medicine, 9th Edition, P. Libby et al. eds., Saunders Elsevier Philadelphia, 2011).
Throughout this specification and the claims which follow, unless the context requires otherwise, the word "comprise", and variations such as "comprises" and "comprising", will be understood to imply the inclusion of a stated integer or step or group of integers or steps but not the exclusion of any other integer or step or group of integers or steps. As used in this specification and the appended claims, the singular forms "a", "an", and "the" include plural referents, unless the content clearly dictates otherwise.
The term "about" when used in connection with a numerical value is meant to encompass numerical values within a range having a lower limit that is 5% smaller than the indicated numerical value and having an upper limit that is 5% larger than the indicated numerical value.
As used herein, the term “and/or” means that it refers to either one or both/all of the options cited in the context of this term.
Nucleic acid molecules also termed nucleic acids are understood as polymeric macromolecules made from nucleotide monomers. Nucleotide monomers are composed of a nucleobase, a five-carbon sugar (such as but not limited to ribose or 2'-deoxyribose), and one to three phosphate groups. Typically, a polynucleotide is formed through phosphodiester bonds between the individual nucleotide monomers. In the context of the present invention referred to nucleic acid molecules include but are not limited to ribonucleic acid (RNA) and deoxyribonucleic acid (DNA). The terms “polynucleotide” and “nucleic acid” are used interchangeably herein.
The term "open reading frame" (ORF) refers to a sequence of nucleotides, that can be translated into amino acids. Typically, such an ORF contains a start codon, a subsequent region usually having a length which is a multiple of 3 nucleotides, but does not contain a stop codon (TAG, TAA, TGA, UAG, UAA, or UGA) in the given reading frame. Typically, ORFs occur naturally or are constructed artificially, i.e. by gene-technological means. An ORF codes for a protein where the amino acids into which it can be translated form a peptide- linked chain.
The terms "protein" and "polypeptide" are used interchangeably herein and refer to any peptide-bond-linked chain of amino acids, regardless of length or post-translational modification. Proteins usable in the present invention (including protein derivatives, protein variants, protein fragments, protein segments, protein epitopes and protein domains) can be further modified by chemical modification. This means such a chemically modified
polypeptide comprises other chemical groups than the 20 naturally occurring amino acids. Examples of such other chemical groups include without limitation glycosylated amino acids and phosphorylated amino acids. Chemical modifications of a polypeptide may provide advantageous properties as compared to the parent polypeptide, e.g. one or more of enhanced stability, increased biological half-life, or increased water solubility. Chemical modifications applicable to the variants usable in the present invention include without limitation: PEGylation, glycosylation of non-glycosylated parent polypeptides, covalent coupling to therapeutic small molecules, like glucagon-like peptide 1 agonists, including exenatide, albiglutide, taspoglutide, DPP4 inhibitors, incretin and liraglutide, or the modification of the glycosylation pattern present in the parent polypeptide. Such chemical modifications applicable to the variants usable in the present invention may occur co- or post-translational.
The term "amino acid" encompasses naturally occurring amino acids as well as amino acid derivatives. A hydrophobic non-aromatic amino acid in the context of the present invention, is preferably any amino acid which has a Kyte-Doolittle hydropathy index of higher than 0.5, more preferably of higher than 1.0, even more preferably of higher than 1.5 and is not aromatic. Preferably, a hydrophobic non-aromatic amino acid in the context of the present invention, is selected from the group consisting of the amino acids alanine (Kyte Doolittle hydropathy index 1.8), methionine (Kyte Doolittle hydropathy index 1.9), isoleucine (Kyte Doolittle hydropathy index 4.5), leucine Kyte Doolittle hydropathy index 3.8), and valine (Kyte Doolittle hydropathy index 4.2), or derivatives thereof having a Kyte Doolittle hydropathy index as defined above.
The term "variant" is used herein to refer to a polypeptide which differs in comparison to the polypeptide or fragment thereof from which it is derived by one or more changes in the amino acid sequence. The polypeptide from which a protein variant is derived is also known as the parent polypeptide. Likewise, the fragment from which a protein fragment variant is derived from is known as the parent fragment. Typically, a variant is constructed artificially, preferably by gene-technological means. Typically, the parent polypeptide is a wild-type protein or wild-type protein domain. Further, the variants usable in the present invention may also be derived from homologs, orthologs, or paralogs of the parent polypeptide or from artificially constructed variant, provided that the variant exhibits at least one biological activity of the parent polypeptide. The changes in the amino acid sequence may be amino acid exchanges, insertions, deletions, N-terminal truncations, or C-terminal truncations, or any combination of these changes, which may occur at one or several sites. In preferred embodiments, a variant usable in the present invention exhibits a total number of up to 23 (up
to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23) changes in the amino acid sequence (i.e. exchanges, insertions, deletions, N-terminal truncations, and/or C-terminal truncations). A particularly preferred variant of SEQ ID NO: 1 is shown in SEQ ID NO: 3, which exhibits one additional amino acid (glycine) at its N-terminus (+G variant). The amino acid exchanges may be conservative, and/or semi-conservative, and/or nonconservative. In preferred embodiments, a variant usable in the present invention differs from the protein or domain from which it is derived by up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 amino acid exchanges, preferably conservative amino acid changes. Typical substitutions are among the aliphatic amino acids, among the amino acids having aliphatic hydroxyl side chain, among the amino acids having acidic residues, among the amide derivatives, among the amino acids with basic residues, or the amino acids having aromatic residues. Typical semi-conservative and conservative substitutions are:
Changing from A, F, H, I, L, M, P, V, W or Y to C is semi-conservative if the new cysteine remains as a free thiol. Furthermore, the skilled person will appreciate that glycines
at sterically demanding positions should not be substituted and that P should not be introduced into parts of the protein which have an alpha-helical or a beta-sheet structure.
Alternatively or additionally, a "variant" as used herein, can be characterized by a certain degree of sequence identity to the parent polypeptide or parent polynucleotide from which it is derived. More precisely, a protein variant in the context of the present invention exhibits at least 85% sequence identity to its parent polypeptide. The term “at least 85% sequence identity” is used throughout the specification with regards to polypeptide and polynucleotide sequence comparisons. This expression preferably refers to a sequence identity of at least 85%, at least 86%, at least 87%, at least 88%, at least 89%, at least 90%, at least 91%, at least 92%, at least 93%, at least 94%, at least 95%, at least 96%, at least 97%, at least 98%, or at least 99% to the respective reference polypeptide or to the respective reference polynucleotide.
Fragments of proteins comprise deletions of amino acids, which may be N-terminal truncations, C-terminal truncations or internal deletions or any combination of these. Such proteins comprising N-terminal truncations, C-terminal truncations and/or internal deletions are referred to as "fragments" in the context of the present application. A fragment may be naturally occurring (e.g. splice variants) or it may be constructed artificially, preferably by gene-technological means. Preferably, a fragment (or deletion variant) has a deletion of up to 1, 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, or 23 amino acids at its N-terminus and/or at its C-terminus and/or internally as compared to the parent polypeptide, preferably at its N-terminus, at its N- and C-terminus, or at its C-terminus. Ebenhoch R. et al., 2019 suggest that the receptor interaction is more likely to take place in the front/protruding part of the top face of MYDGF and indicates that Tyr73 may be the key residue for receptor interaction.
In case where two sequences are compared and the reference sequence is not specified in comparison to which the sequence identity percentage is to be calculated, the sequence identity is to be calculated with reference to the longer of the two sequences to be compared, if not specifically indicated otherwise.
The similarity of nucleotide and amino acid sequences, i.e. the percentage of sequence identity, can be determined via sequence alignments. Such alignments can be carried out with several art-known algorithms, preferably with the mathematical algorithm of Karlin and Altschul (Karlin & Altschul (1993) Proc. Natl. Acad. Sci. USA 90: 5873-5877), with hmmalign (HMMER package, http://hmmer.wustl.edu/) or with the CLUSTAL algorithm (Thompson, J. D., Higgins, D. G. & Gibson, T. J. (1994) Nucleic Acids Res. 22, 4673-80) or
the CLUSTALW2 algorithm (Larkin MA, Blackshields G, Brown NP, Chenna R, McGettigan PA, McWilliam H, Valentin F, Wallace IM, Wilm A, Lopez R, Thompson JD, Gibson TJ, Higgins DG. (2007). Clustal W and Clustal X version 2.0. Bioinformatics, 23, 2947-2948.) which are available e.g. on http://npsa-pbil.ibcp.fr/cgi- bin/npsa_automat.pl?page=/NPSA/npsa_clustalw.html or on http://www.ebi.ac.uk/Tools/clustalw2/index.html. Preferably, the CLUSTALW2 algorithm on http://www.ebi.ac.uk/Tools/clustalw2/index.html is used wherein the parameters used are the default parameters as they are set on http://www.ebi.ac.uk/Tools/clustalw2/index.html: Alignment type = Slow, protein weight matrix = Gonnet, gap open = 10, gap extension = 0,1 for slow pairwise alignment options and protein weight matrix = Gonnet, gap open = 10, gap extension = 0,20, gap distances = 5, No end gaps = no, Output options: format = Ain w/numbers, Order = aligned.
The grade of sequence identity (sequence matching) may be calculated using e.g. BLAST, BLAT or BlastZ (or BlastX). A similar algorithm is incorporated into the BLASTN and BLASTP programs of Altschul et al. (1990) J. Mol. Biol. 215: 403-410. BLAST protein searches are performed with the BLASTP program available e.g. on http://blast.ncbi. nlm.nih.gov/Blast.cgi?PROGRAM=blastp&BLAST_PROGRAMS=blastp&P AGE_TYPE=BlastSearch&SHOW_DEFAULTS=on&LINK_LOC=blasthome. Preferred algorithm parameters used are the default parameters as they are set on http://blast.ncbi. nlm.nih.gov/Blast.cgi?PROGRAM=blastp&BLAST_PROGRAMS=blastp&P AGE_TYPE=BlastSearch&SHOW_DEFAULTS=on&LINK_LOC=blasthome: Expect threshold = 10, word size = 3, max matches in a query range = 0, matrix = BLOSUM62, gap costs = Existence: 11 Extension: 1, compositional adjustments = conditional compositional score matrix adjustment together with the database of non-redundant protein sequences (nr) to obtain amino acid sequences homologous to the Factor 1 and Factor 2 polypeptides.
To obtain gapped alignments for comparative purposes, Gapped BLAST is utilized as described in Altschul et al. (1997) Nucleic Acids Res. 25: 3389-3402. When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs are used. Sequence matching analysis may be supplemented by established homology mapping techniques like Shuffle-LAGAN (Brudno M., Bioinformatics 2003b, 19 Suppl 1 :154-162) or Markov random fields. When percentages of sequence identity are referred to in the present application, these percentages are calculated in relation to the full length of the longer sequence, if not specifically indicated otherwise.
The term "host cell" as used herein refers to a cell that harbours a nucleic acid of the invention (e.g. in form of a plasmid or virus). Such host cell may either be a prokaryotic (e.g. a bacterial cell) or a eukaryotic cell (e.g. a fungal, plant or animal cell). The cell can be transformed or non-transformed. The cell can be an isolated cell for example in a cell culture or part of a tissue, which itself can be isolated or part of a more complex organization structure such as an organ or an individual.
The terms "myeloid-derived growth factor", "MYDGF", "Factor 1", "MYDGF polypeptide or protein" or "Factor 1 polypeptide or protein" are used interchangeably and refer to the protein indicated in NCBI reference sequence NM 019107.3 (human homologue) as well as to its mammalian homologues, in particular from mouse or rat. The amino acid sequence of the human homologue is encoded in open reading frame 10 on human chromosome 19 (C190rflO). Preferably, MYDGF and Factor 1 protein refer to a protein, which comprises, essentially consists or consists of a core segment of human Factor 1 having an amino acid sequence according to SEQ ID NO: 1.
According to a further preferred embodiment, MYDGF and Factor 1 protein, respectively, refer to a protein, which comprises SEQ ID NO: 3. In a further preferred embodiment, MYDGF refers to a protein, which essentially consists of SEQ ID NO: 3. In a further preferred embodiment, MYDGF refers to a protein, which consists of SEQ ID NO: 3.
As used herein, MYDGF as defined herein and fragments and variants thereof include pharmaceutically acceptable salts thereof.
Whether or not a protein, variant or fragment exhibits the biological function of MYDGF can be determined by any one of the tests described in the examples below. According to the present invention, a peptide or protein exhibits the biological function of MYDGF if the results obtained with such peptide or protein compared to the results obtained with the MYDGF protein of the present invention shown in at least one of the examples presented herein below achieve at least 50%, at least 60%, at least 70%, at least 80%, at least 90%, at least 95% or 100% of the effect reported for MYDGF over the indicated controls.
As used herein, the terms "MYDGF" and "Mydgf1 both denote myeloid-derived growth factor.
The term "cardiogenic shock" describes a state of end-organ hypoperfusion due to cardiac failure and the inability of the cardiovascular system to provide adequate blood flow to the extremities and vital organs. Patients with cardiogenic shock manifest persistent hypotension (systolic blood pressure less than 80 to 90 mm Hg, or a mean arterial pressure 30 mm Hg below baseline, or vasopressor or inotropes support to maintain SBP >90 mm Hg, or
mean arterial blood pressure <70 mm Hg, or systolic blood pressure <100 mm Hg despite adequate fluid resuscitation), with evidence of end-organ damage (as evidenced for example by urine output <30 mL/h, or urine output <0.5 mL/kg for 1 h, or cool extremities, or mottled skin, or serum lactate >2 mmol/L, or metabolic acidosis, or altered mental status), with a severe reduction in cardiac index (less than 2.2 L/min per m2) in the presence of adequate or elevated filling pressure (left ventricular [LV] end-diastolic pressure above 15 mm Hg or right ventricular (RV) end-diastolic pressure above 10 to 15 mm Hg) (Vahdatpour et al., Journal of the American Heart Association, Vol 8(8), 2019, eOl 1991).
As used herein, "treat", "treating" or "treatment" of a disease or disorder means accomplishing one or more of the following: (a) reducing the severity of the disorder; (b) limiting or preventing development of symptoms characteristic of the disorder(s) being treated; (c) inhibiting worsening of symptoms characteristic of the disorder(s) being treated; (d) limiting or preventing recurrence of the disorder(s) in an individual that have previously had the disorder(s); (e) limiting or preventing recurrence of symptoms in individuals that were previously symptomatic for the disorder(s); (f) reduction of mortality after occurrence of a disease or a disorder; (g) healing; and (h) prophylaxis of a disease. The term "ameliorating" is also encompassed by the term "treating". In line therewith, the term "treating and/or preventing" a condition or disease as mentioned herein means that the condition or disease is treated or prevented, or both.
The term "stroke volume" describes the volume of blood ejected by the right/left ventricle in a single contraction. It is the difference between the end-diastolic volume (EDV) and the end-systolic volume (ESV).
The term "stroke work" describes the work performed by the left or right ventricle to eject the stroke volume into the aorta or pulmonary artery, respectively.
The term "cardiac output" describes the amount of blood pumped by the ventricle in unit time.
The terms "dP/dtmin" and "dP/dtmax" describe the minimum and maximum rate of pressure change in the ventricle, respectively. Peak dP/dt is used as an index of ventricular performance.
The term "isovolumic relaxation constant" or "Tau" describes the exponential decay of the ventricular pressure during isovolumic relaxation. It is also referred to as the ventricular diastolic time constant.
The term "fraction of inhaled oxygen" or "FiCh" describes the molar or volumetric fraction of oxygen in the inhaled gas. Natural air includes 21% oxygen, which is equivalent to FiO2 of 0.21.
The terms "subject", "individual" and "patient" are used herein interchangeable and refer to an individual, such as a human, a non-human primate (e.g. chimpanzees and other apes and monkey species); farm animals, such as birds, fish, cattle, sheep, pigs, goats and horses; domestic mammals, such as dogs and cats; laboratory animals including rodents, such as mice, rats and guinea pigs. The term does not denote a particular age or sex. In a particular meaning, the subject is a mammal. In a preferred meaning, the subject is a human. The subject can be a healthy subject or a subject suffering from or suspected of having one or more diseases. A subject suffering from or suspected of having one or more diseases is also referred to as a patient.
These descriptions and definitions are valid for the whole application unless it is otherwise stated.
Sequences
Sequences used in the present invention are listed below.
SEQ ID NO: 1 (amino acid sequence of human Factor 1 (MYDGF), lacking the 31 aa N-terminal signal peptide):
VSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLG TSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVP LKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
SEQ ID NO: 2 (amino acid sequence of MYDGF, including the N-terminal signal peptide (shown in bold and underlined); UniProtKB - Q969H8):
MAAPSGGWNGVGASLWAALLLGAVALRPAEAVSEPTTVAFDVRPGGVVH SFSHNVGPGDKYTCMFTYASQGGTNEQWQMSLGTSEDHQHFTCTIWRPQGK SYLYFTQFKAEVRGAEIEYAMAYSKAAFERESDVPLKTEEFEVTKTAVAHRPG AFKAELSKLVIVAKASRTEL
SEQ ID NO: 3 (amino acid sequence of the [+G] MYDGF variant, in which the N- terminal V residue in position +1 of the mature human MYDGF is preceded by an G residue):
GVSEPTTVAFDVRPGGVVHSFSHNVGPGDKYTCMFTYASQGGTNEQWQMSL GTSEDHQHFTCTIWRPQGKSYLYFTQFKAEVRGAEIEYAMAYSKAAFERESD VPLKTEEFEVTKTAVAHRPGAFKAELSKLVIVAKASRTEL
SEQ ID NO: 4 shows the nucleic acid sequence of human Factor 1 encoding MYDGF of SEQ ID NO: 3 (NCBI Gene ID: 56005).
Embodiments
In the following, the elements of the present invention will be described. These elements are listed with specific embodiments, however, it should be understood that they may be combined in any manner and in any number to create additional embodiments. The variously described examples and preferred embodiments should not be construed to limit the present invention to only the explicitly described embodiments. This description should be understood to support and encompass embodiments which combine the explicitly described embodiments with any number of the disclosed and/or preferred elements. Furthermore, any permutations and combinations of all described elements in this application should be considered disclosed by the description of the present application unless the context indicates otherwise.
The present disclosure shows for the first time anti-cardiogenic shock effects for MYDGF. The disclosure particularly shows that administration of MYDGF in a mouse model of cardiogenic shock attenuates symptoms associated with cardiogenic shock. Specifically, the disclosure shows that treatment of mice of an animal model of cardiogenic shock with MYDGF increases cardiac output, stroke work, stroke volume, ventricular end-systolic pressure and ventricular ejection fraction compared to control mice treated with saline. The disclosure further shows that MYDGF successfully treats cardiogenic shock and increases overall survival (cf. examples below).
Therefore, in a first aspect, the invention provides the protein myeloid-derived growth factor (MYDGF) or a fragment or a variant thereof for use in treating and/or preventing cardiogenic shock. According to a preferred embodiment, the fragment or variant of MYDGF exhibits the biological function of MYDGF.
According to a preferred embodiment, the cardiogenic shock to be treated or prevented is in the course of (acute) myocardial infarction (AMI, MI), preferably ST elevation myocardial infarction (STEMI), even more preferably a cardiogenic shock in the course of a MI or STEMI in the course of reperfusion following Percutaneous Coronary Intervention (PCI).
In a particularly preferred embodiment of the invention, the protein comprises the amino acid sequence SEQ ID NO: 1 or a fragment thereof. Preferably, the protein has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% identity to SEQ ID NO: 1.
In a preferred embodiment of this aspect of the invention, the protein comprises the amino acid sequence SEQ ID NO: 1, a fragment or a variant thereof which has at least 85% sequence identity to SEQ ID NO: 1. According to a preferred embodiment, the fragment or variant of MYDGF exhibits the biological function of MYDGF. A person skilled in the art is able to decide without undue burden, which positions in the parental polypeptide can be mutated to which extent and which positions have to be maintained to preserve the functionality of the polypeptide. Such information can, for example, be gained from homologues sequences which can be identified, aligned and analyzed by bioinformatic methods well known in the art. Such analyses are exemplarily described in example 7 and Figures 6 and 7 of WO 2014/111458. Mutations are preferably introduced in those regions of the protein, which are not fully conserved between species, preferably mammals. In a particularly preferred embodiment of the invention, the MYDGF protein comprises, essentially consists or consists of the amino acid sequence SEQ ID NO: 1 or 3, or a fragment or variant thereof. According to a preferred embodiment, the fragment or variant of MYDGF exhibits the biological function of MYDGF. Preferably, the protein has at least 85%, 86%, 87%, 88%, 89%, 90%, 91%, 92%, 93%, 94%, 95%, 96%, 97%, 98%, or 99% sequence identity to SEQ ID NO: 1.
N-terminal deletion variants are also encompassed, which may for example lack one or more amino acids from amino acid position 1 to 24 (based on SEQ ID NO: 1), i.e. from the N-terminally conserved region.
C-terminal deletion variants are also encompassed, which may for example lack one or more amino acids from amino acid position 114 to 142 (based on SEQ ID NO: 1).
On the other hand, amino acids can be added to the MYDGF protein. Such additions include additions at the N-terminus, at the C-terminus, within the amino acid sequence or combinations thereof. The protein of the first aspect of the present invention may thus further
comprise additional amino acid sequences, e.g. for stabilizing or purifying the resulting protein. Examples of such amino acids are 6xHis-tags, myc-tags, or FLAG-tags, which are well known in the art, and which may be present at any position in the protein, preferably at the N-terminus or the C-terminus. A particularly preferred additional sequence is a 6xHis-tag. Preferably, said 6xHis-tag is present on the C-terminus of the MYDGF protein. Depending on the expression system used and, if present, an additional amino acid such as a tag described above, one or more residual amino acids may remain on the N-terminus and/or the C-terminus of the protein. It is emphasized that in the MYDGF protein and Mydgf protein according to the present invention such artefacts may be present, as in shown e.g. in Ebenhoch R. et al., Nat Commun. 2019 Nov 26;10(l):5379, and Polten F. et al., Anal Chem. 2019 Jan 15;91(2):1302-1308.
In some cases it is preferred to mutate protease cleavage sites within the MYDGF protein of the first aspect of the present invention to stabilize the protein (see Segers et al. Circulation 2007, 2011). The skilled person knows how to determine potential proteolytic cleavage sites within a protein. For example, protein sequences can be submitted to websites providing such analysis as, e.g. http://web.expasy.org/peptide_cutter/ or http://pmap.burnham.org/proteases. If the protein sequence according to SEQ ID NO: 1 is submitted to http://web.expasy.org/peptide_cutter/ the following cleavage sites with lower frequency (less than 10) are determined:
Table 1
Protease Frequency Position (with reference to SEQ ID NO: 1)
Arg-C proteinase 6 12 65 82 99 120 139
Asp-N endopeptidase 4 9 27 54 101
Clostripain 6 12 65 82 99 120 139
LysN 9 28 68 77 93 105 113 124 129 135
Proline-endopeptidase 3 13 66 121
These sites may be altered to remove the recognition/cleavage sequence of the respectively identified protease to increase the serum half-life of the protein.
The MYDGF protein may further comprise additional amino acid sequences, e.g. for stabilizing or purifying the resulting protein. For example, it is preferred to mutate protease cleavage sites within the MYDGF protein to stabilize the protein. Suitable proteolytic cleavage sites can be identified as described above.
The MYDGF protein or compositions comprising the protein can administered in vivo, ex vivo or in vitro, preferably in vivo.
Nucleic acid sequences can be optimized in an effort to enhance expression in a host cell. Parameters to be considered include C:G content, preferred codons, and the avoidance of inhibitory secondary structure. These Factors can be combined in different ways in an attempt to obtain nucleic acid sequences having enhanced expression in a particular host (cf. e.g. Donnelly et al., International Publication Number WO 97/47358). The ability of a particular sequence to have enhanced expression in a particular host involves some empirical experimentation. Such experimentation involves measuring expression of a prospective nucleic acid sequence and, if needed, altering the sequence. Starting with a particular amino acid sequence and the known degeneracy of the genetic code, a large number of different encoding nucleic acid sequences can be obtained. The degeneracy of the genetic code arises because almost all amino acids are encoded by different combinations of nucleotide triplets or "codons". The translation of a particular codon into a particular amino acid is well known in the art (see, e.g., Lewin GENES IV, p. 119, Oxford University Press, 1990). The present invention thus also provides a nucleic acid encoding the MYDGF or the fragment or variant thereof, for use in treating and/or preventing cardiogenic shock. According to a preferred embodiment, the fragment or variant of MYDGF exhibits the biological function of MYDGF. According to a further preferred embodiment, the nucleic acid encodes an amino acid sequence having at least 85% sequence identity to SEQ ID NO: 1.
The nucleic acid for use according to the present invention may further comprise a transcriptional control element or expression control sequences positioned to control expression of the protein. Such a nucleic acid together with control elements is often termed as an expression system. The term “expression system” as used herein refers to a system designed to produce one or more gene products of interest. Typically, such system is designed “artificially”, i.e. by gene-technological means usable to produce the gene product of interest in vivo, in vitro or ex vivo. The term “expression system” further encompasses the expression of the gene product of interest comprising the transcription of the polynucleotides, mRNA splicing, translation into a polypeptide, co- and post-translational modification of a polypeptide or protein as well as the targeting of the protein to one or more compartments inside of the cell, the secretion from the cell and the uptake of the protein in the same or another cell. This general description refers to expression systems for the use in eukaryotic cells, tissues or organisms. Expression systems for prokaryotic systems may differ, wherein it is well known in the art, how an expression system for prokaryotic cells is constructed.
Regulatory elements present in a gene expression cassette generally include: (a) a promoter transcriptionally coupled to a nucleotide sequence encoding the polypeptide, (b) a 5' ribosome binding site functionally coupled to the nucleotide sequence, (c) a terminator joined to the 3' end of the nucleotide sequence, and (d) a 3' polyadenylation signal functionally coupled to the nucleotide sequence. Additional regulatory elements useful for enhancing or regulating gene expression or polypeptide processing may also be present. Promoters are genetic elements that are recognized by an RNA polymerase and mediate transcription of downstream regions. Preferred promoters are strong promoters that provide for increased levels of transcription. Examples of strong promoters are the immediate early human cytomegalovirus promoter (CMV), and CMV with intron A (Chapman et al, Nucl. Acids Res. 19:3979-3986, 1991). Additional examples of promoters include naturally occurring promoters such as the EFl alpha promoter, the murine CMV promoter, Rous sarcoma virus promoter, and SV40 early/late promoters and the [beta]-actin promoter; and artificial promoters such as a synthetic muscle specific promoter and a chimeric muscle-specific/CMV promoter (Li et al., Nat. Biotechnol. 17:241-245, 1999 , Hagstrom et al., Blood 95:2536-2542, 2000).
The ribosome binding site is located at or near the initiation codon. Examples of preferred ribosome binding sites include CCACCAUGG, CCGCCAUGG, and ACCAUGG, where AUG is the initiation codon (Kozak, Cell 44:283-292, 1986). The polyadenylation signal is responsible for cleaving the transcribed RNA and the addition of a poly (A) tail to the RNA. The polyadenylation signal in higher eukaryotes contains an AAUAAA sequence about 11-30 nucleotides from the polyadenylation addition site. The AAUAAA sequence is involved in signaling RNA cleavage (Lewin, Genes IV, Oxford University Press, NY, 1990). The poly (A) tail is important for the processing, export from the nucleus, translation and stability of the mRNA.
Polyadenylation signals that can be used as part of a gene expression cassette include the minimal rabbit [beta] -globin polyadenylation signal and the bovine growth hormone polyadenylation (BGH) (Xu et al., Gene 272: 149-156, 2001 , Post et al., U.S. Patent U. S. 5,122,458).
Examples of additional regulatory elements useful for enhancing or regulating gene expression or polypeptide processing that may be present include an enhancer, a leader sequence and an operator. An enhancer region increases transcription. Examples of enhancer regions include the CMV enhancer and the SV40 enhancer (Hitt et al., Methods in Molecular
Genetics 7: 13-30, 1995 , Xu, et al., Gene 272: 149-156, 2001). An enhancer region can be associated with a promoter.
The expression of the MYDGF protein or of the variant thereof according to the present invention may be regulated. Such regulation can be accomplished in many steps of the gene expression. Possible regulation steps are, for example but not limited to, initiation of transcription, promoter clearance, elongation of transcription, splicing, export from the nucleus, mRNA stability, initiation of translation, translational efficiency, elongation of translation and protein folding. Other regulation steps, which influence the concentration of a MYDGF polypeptide inside a cell affect the half-life of the protein. Such a regulation step is, for example, the regulated degeneration of proteins. As the proteins of the invention comprise secreted proteins, the protein can be directed to a secretory pathway of the host cell. The efficiency of secretion regulates together with the regulatory steps referring to the expression and protein stability the concentration of the respective protein outside of the cell. Outside of the cell can refer to, for example but not limited to, a culture medium, a tissue, intracellular matrix or space or a body fluid such as blood or lymph.
The control of the regulatory steps mentioned above can be, for example, cell-type or tissue-type independent or cell-type or tissue-type specific. In a particularly preferred embodiment of the invention, the control of the regulatory steps is cell-type or tissue-type specific. Such a cell-type or tissue-type specific regulation is preferably accomplished through the regulation steps referring to the transcription of a nucleic acid. This transcriptional regulation can be accomplished through the use of cell-type or tissue-type specific promoter sequences. The result of this cell-type or tissue-type specific regulation can have different grades of specificity. This means, that the expression of a respective polypeptide is enhanced in the respective cell or tissue in comparison to other cell- or tissue-type or that the expression is limited to the respective cell- or tissue-type. Cell- or tissue-type specific promoter sequences are well known in the art and available for a broad range of cell- or tissue-types.
The expression is not necessarily cell-type or tissue-type specific but may depend from physiological conditions. Such conditions are for example an inflammation or a wound. Such a physiological condition-specific expression can also be accomplished through regulation at all above mentioned regulation steps. The preferred way of regulation for a physiological condition-specific expression is the transcriptional regulation. For this purpose a wound or inflammation specific promoter can be used. Respective promoters are, for example, natural occurring sequences, which can be, for example, derived from genes, which are specifically expressed during an immune reaction and/or the regeneration of wounded tissue. Another
possibility is the use of artificial promoter sequences, which are, for example constructed through combination of two or more naturally occurring sequences.
The regulation can be cell-type or tissue-type specific and physiological conditionspecific. Particularly, the expression can be a heart specific expression. Preferably, the expression is heart specific and/or wound specific.
Another possibility for a regulation of expression of the MYDGF protein or variant thereof according to the present invention is the conditional regulation of the gene expression. To accomplish conditional regulation, an operator sequence can be used. For example, the Tet operator sequence can be used to repress gene expression. The conditional regulation of gene expression by means of the Tet operator together with a Tet repressor is well known in the art and many respective systems have been established for a broad range of prokaryotic and eukaryotic organisms. A person of skill in the art knows how to choose a suitable system and adapt it to the special needs of the respective application.
In a particularly preferred embodiment, the use of a nucleic acid according to the invention comprises the application to an individual or patient, preferably an individual or patient suffering from cardiogenic shock.
According to a further aspect, the present invention provides vectors comprising the nucleic acid or the expression system described herein for use in treating and/or preventing cardiogenic shock.
As used herein, the term "vector" refers to a protein or a polynucleotide or a mixture thereof which is capable of being introduced or of introducing the proteins and/or nucleic acid comprised therein into a cell. In the context of the present invention it is preferred that the genes of interest encoded by the introduced polynucleotide are expressed within the host cell upon introduction of the vector or the vectors. Examples of suitable vectors include but are not limited to plasmid vectors, cosmid vectors, phage vectors such as lambda phage, filamentous phage vectors, viral vectors, viral like particles, and bacterial spores.
In a preferred embodiment of the invention, the vector is a viral vector. Suitable viral vectors include but are not limited to adenoviral vectors, adeno-associated viral (AAV) vectors, alphaviral vectors, herpes viral vectors, measles viral vectors, pox viral vectors, vesicular stomatitis viral vectors, retroviral vector and lentiviral vectors.
In a particularly preferred embodiment of the invention, the vector is an adenoviral or an adeno-associated viral (AAV) vector.
Nucleic acids encoding one or more MYDGF proteins or variants thereof according to the invention can be introduced into a host cell, a tissue or an individual using vectors suitable
for therapeutic administration. Suitable vectors can preferably deliver nucleic acids into a target cell without causing an unacceptable side effect.
In a particularly preferred embodiment the use of a vector according to the invention, comprises the application to an individual in need thereof.
Vectors comprising nucleic acids encoding the MYDGF protein or fragments or variants thereof preferably exhibiting the biological function of MYDGF described above are preferably for use in treating and/or preventing cardiogenic shock.
According to a further aspect, the present invention provides a host cell comprising the vector as described herein and expressing the nucleic acid encoding the MYDGF protein or a fragment or a variant thereof for use in treating and/or preventing cardiogenic shock. According to a preferred embodiment, the fragment or variant of MYDGF exhibits the biological function of MYDGF.
According to a further aspect, the present invention provides pharmaceutical compositions comprising the MYDGF protein or a fragment or a variant thereof and optionally a suitable pharmaceutical excipient, for use in treating and/or preventing cardiogenic shock. According to a preferred embodiment, the fragment or variant of MYDGF exhibits the biological function of MYDGF.
The term "suitable pharmaceutical excipient", as used herein, refers to a pharmacologically inactive substance such as but not limited to a diluent, excipient, surfactants, stabilizers, physiological buffer solutions or vehicles with which the therapeutically active ingredient is administered. "Pharmaceutical excipients" are also called “pharmaceutical carriers” and can be liquid or solid. Liquid carriers include but are not limited to sterile liquids, such as saline solutions in water and oils, including but not limited to those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. A saline solution is a preferred carrier when the pharmaceutical composition is administered intravenously. Examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin. In a preferred embodiment of the invention, the carrier is a suitable pharmaceutical excipient. Suitable pharmaceutical excipients comprise starch, glucose, lactose, sucrose, gelatine, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. Such suitable pharmaceutical excipients are preferably pharmaceutically acceptable.
The terms "pharmaceutical", "medicament" and "drug" are used interchangeably herein referring to a substance and/or a combination of substances being used for the identification, prevention and/or treatment of a tissue status or disease.
"Pharmaceutically acceptable" means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in animals, and more particularly in humans. The term "pharmaceutically acceptable salt" refers to a salt of the protein or peptide of the present invention. Suitable pharmaceutically acceptable salts include acid addition salts which may, for example, be formed by mixing a solution of the peptide of the present invention with a solution of a pharmaceutically acceptable acid such as hydrochloric acid, sulfuric acid, fumaric acid, maleic acid, succinic acid, acetic acid, benzoic acid, citric acid, tartaric acid, carbonic acid or phosphoric acid. Furthermore, where the peptide carries an acidic moiety, suitable pharmaceutically acceptable salts thereof may include alkali metal salts (e.g., sodium or potassium salts); alkaline earth metal salts (e.g., calcium or magnesium salts); and salts formed with suitable organic ligands (e.g., ammonium, quaternary ammonium and amine cations formed using counteranions such as halide, hydroxide, carboxylate, sulfate, phosphate, nitrate, alkyl sulfonate and aryl sulfonate). Illustrative examples of pharmaceutically acceptable salts include, but are not limited to, acetate, adipate, alginate, ascorbate, aspartate, benzenesulfonate, benzoate, bicarbonate, bisulfate, bitartrate, borate, bromide, butyrate, calcium edetate, camphorate, camphorsulfonate, camsylate, carbonate, chloride, citrate, clavulanate, cyclopentanepropionate, digluconate, dihydrochloride, dodecyl sulfate, edetate, edisylate, estolate, esylate, ethanesulfonate, formate, fumarate, gluceptate, glucoheptonate, gluconate, glutamate, glycerophosphate, glycolylarsanilate, hemisulfate, heptanoate, hexanoate, hexylresorcinate, hydrabamine, hydrobromide, hydrochloride, hydroiodide, 2-hydroxy-ethanesulfonate, hydroxynaphthoate, iodide, isothionate, lactate, lactobionate, laurate, lauryl sulfate, malate, maleate, malonate, mandelate, mesylate, methanesulfonate, methyl sulfate, mucate, 2-naphthalenesulfonate, napsylate, nicotinate, nitrate, N-methylglucamine ammonium salt, oleate, oxalate, pamoate (embonate), palmitate, pantothenate, pectinate, persulfate, 3 -phenylpropionate, phosphate/diphosphate, picrate, pivalate, polygalacturonate, propionate, salicylate, stearate, sulfate, subacetate, succinate, tannate, tartrate, teoclate, tosylate, triethiodide, undecanoate, valerate, and the like (see, for example, S. M. Berge et al., "Pharmaceutical Salts", J. Pharm. Sci., 66, pp. 1-19 (1977)).
The term "active ingredient" refers to the substance in a pharmaceutical composition or formulation that is biologically active, i.e. that provides pharmaceutical value. A pharmaceutical composition may comprise one or more active ingredients which may act in conjunction with or independently of each other. The active ingredient can be formulated as neutral or salt forms. Pharmaceutically acceptable salts include those formed with free amino groups such as those derived from hydrochloric, phosphoric, acetic, oxalic, tartaric acids, etc., and those formed with free carboxyl groups such as but not limited to those derived from sodium, potassium, ammonium, calcium, ferric hydroxides, isopropylamine, triethylamine, 2- ethylamino ethanol, histidine, procaine, and the like.
The terms "preparation" and "composition" are intended to include the formulation of the active compound with encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with it.
The term "carrier", as used herein, refers to a pharmacologically inactive substance such as but not limited to a diluent, excipient, or vehicle with which the therapeutically active ingredient is administered. Such pharmaceutical carriers can be liquid or solid. Liquid carriers include but are not limited to sterile liquids, such as saline solutions in water and oils, including those of petroleum, animal, vegetable or synthetic origin, such as peanut oil, soybean oil, mineral oil, sesame oil and the like. Saline solutions and aqueous dextrose and glycerol solutions can also be employed as liquid carriers, particularly for injectable solutions. A saline solution is a preferred carrier when the pharmaceutical composition is administered intravenously. Examples of suitable pharmaceutical carriers are described in "Remington's Pharmaceutical Sciences" by E. W. Martin.
Suitable pharmaceutical "excipients" include starch, glucose, lactose, sucrose, gelatin, malt, rice, flour, chalk, silica gel, sodium stearate, glycerol monostearate, talc, sodium chloride, dried skim milk, glycerol, propylene, glycol, water, ethanol and the like. The term "composition" is preferably intended to include the formulation of the active compound with e.g. encapsulating material as a carrier providing a capsule in which the active component with or without other carriers, is surrounded by a carrier, which is thus in association with the active compound.
According to one embodiment, the active ingredient is administered to a cell, a tissue or an individual in a therapeutically effective amount. A "therapeutically effective amount" is an amount of an active ingredient sufficient to achieve the intended purpose. The active ingredient may be a therapeutic agent. The effective amount of a given active ingredient will
vary with parameters such as the nature of the ingredient, the route of administration, the size and species of the individual to receive the active ingredient, and the purpose of the administration. The effective amount in each individual case may be determined empirically by a skilled artisan according to established methods in the art. As used in the context of the invention, "administering" includes in vivo administration to an individual as well as administration directly to cells or tissue in vitro or ex vivo.
In a preferred embodiment of the invention, the pharmaceutical composition is customized for the treatment of a disorder and specifically for the treatment of cardiogenic shock. In a further preferred embodiment of the invention, the pharmaceutical composition is customized for the prevention of a disorder and specifically for the prevention of cardiogenic shock. According to a particularly preferred embodiment, the pharmaceutical composition is customized for the prevention and treatment of cardiogenic shock. In a particularly preferred embodiment of the invention, treatment with a pharmaceutical composition according to the invention comprises the treatment of an individual in need of such treatment and/or the prevention of cardiogenic shock in an individual in need thereof.
The pharmaceutical composition contemplated by the present invention may be formulated in various ways well known to one of skill in the art. For example, the pharmaceutical composition of the present invention may be in liquid form such as in the form of solutions, emulsions, or suspensions. Preferably, the pharmaceutical composition of the present invention is formulated for parenteral administration, preferably for intravenous, intra-arterial, intramuscular, subcutaneous, transdermal, intrapulmonary, intraperitoneal intracoronary, intra-cardiac administration, or administration via mucous membranes, preferably for intravenous, subcutaneous, or intraperitoneal administration. A preparation for oral or anal administration is also possible. Preferably, the pharmaceutical composition of the present invention is in the form of a sterile aqueous solution which may contain other substances, for example, enough salts or glucose to make the solution isotonic with blood. The aqueous solutions should be suitably buffered (preferably to a pH of from 3 to 9, more preferably to a pH of from 5 to 7), if necessary. The pharmaceutical composition is preferably in unit dosage form. In such form the pharmaceutical composition is subdivided into unit doses containing appropriate quantities of the active component. The unit dosage form can be a packaged preparation, the package containing discrete quantities of pharmaceutical composition such as vials or ampoules.
The pharmaceutical composition is preferably administered through the intravenous, intra-arterial, intramusculuar, subcutaneous, transdermal, intrapulmonary, intraperitoneal,
intracoronary or intra-cardiac route, wherein other routes of administration known in the art are also comprised.
If the pharmaceutical composition is used as a treatment for an individual or in the prophylaxis of a disease or disorder, the use of the pharmaceutical composition can replace the standard treatment or prophylaxis for the respective disease or condition or can be administered additionally to the standard treatment. In the case of an additional use of the pharmaceutical composition, the pharmaceutical composition can be administered before, simultaneously or after a standard therapy and/or prophylaxis.
It is further preferred that the pharmaceutical composition is administered once or more than once. This comprises 2, 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 25, 30, 35, 40, 45 or 50 times. The time span for the administration of the pharmaceutical is not limited. Preferably, the administration does not exceed 1, 2, 3, 4, 5, 6, 7 or 8 weeks.
A single dose of the pharmaceutical composition, can independently form the overall amount of administered doses, or the respective time span of administration can include administration as one or more bolus injection(s) and/or infusion(s).
According to a further aspect, the present invention provides a method of treating and/or preventing cardiogenic shock, comprising administering to a patient in need thereof a therapeutically effective amount of MYDGF or fragment or variant thereof. Suitable MYDGF proteins, fragments, or variants thereof include those described for the first aspect. According to a preferred embodiment, the fragment or variant of MYDGF exhibits the biological function of MYDGF. In said method, the MYDGF preferably comprises SEQ ID NO: 1, or a fragment or variant thereof exhibiting the biological function of MYDGF of SEQ ID NO: 1. In this respect, the fragment or variant preferably comprises an amino acid sequence with at least 85% amino acid sequence identity to SEQ ID NO: 1.
Administering may be carried out, for example, as described for the first aspect. According to a preferred embodiment of this method of the present invention, the MYDGF protein or fragment or variant thereof is administered through one or more bolus injection(s) and/or infusion(s), preferably in a pharmaceutically accepted carrier and/or excipient.
According to a further aspect, the present invention provides a method for producing a non-human mammalian model of cardiogenic shock, the method comprising (i) transiently ligating a coronary artery of the mammal, (ii) establishing reperfusion, and (iii) ventilating the mammal with a fraction of inhaled oxygen (FiCE) of about 0.18 or less. Transient ligation can be performed by any method known to the skilled person as being suitable for blocking or significantly reducing blood flow. According to a preferred embodiment, ligation is
performed by placing and tightening a surgical thread or surgical wire around a coronary artery, thereby blocking or essentially blocking blood flow through the artery. Reperfusion is preferably established by reestablishing blood flow, e.g. by opening the surgical thread or surgical wire, allowing blood to flow through the artery. Ventilation of the mammal is performed by standard means known in the art, e.g. mechanical ventilation commonly used in surgery of mammals.
This method specifically does not provide a treatment to the animal but rather induces a condition that resembles cardiogenic shock. Cardiogenic shock is characterized for example by a lowered ventricular end-systolic pressure (VESP) and reduced cardiac output as well as a raised arterial lactate concentration compared to a healthy subject or compared to the subject before the method has been carried out. The novel non-human mammalian model of cardiogenic shock has the advantage that small animals such as rodents can be used, that are established in laboratory practice. There is no necessity for using larger animals such as pigs, which involve higher costs for food, shelter and animal husbandry, and which are more complicated to investigate. The new model allows e.g. genetically modified mice to be investigated, for example to explore molecular mechanisms of cardiogenic shock. Genetically modified mice can be easily generated, or are already available in the research community, or can be commercially obtained e.g. from The Jackson Laboratory. In contrast, genetically modified larger animals such as pigs are extremely difficult to generate and only few genetically modified large animals are available.
Therefore, according to a preferred embodiment, the non-human mammal is a rodent. According to a particularly preferred embodiment, the non-human animal is a mouse.
According to a preferred embodiment, the coronary artery is the proximal left anterior descending coronary artery. Alternatively, any other major coronary heart artery can be used which transient ligation eventually results in reduced ventricular end-systolic pressure (VESP) and increased arterial lactate concentration.
According to a further preferred embodiment, the coronary artery is ligated for about 30 minutes to about 90 minutes before reperfusion is established. According to a further preferred embodiment, the coronary artery is ligated for a time selected from a range having a lower value of about 30, 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, or 85 minutes and an upper value of about 35, 40, 45, 50, 55, 60, 65, 70, 75, 80, 85, or 90 minutes, or in any combination thereof. More preferably, the coronary artery is ligated for about 45 to 70 minutes, and most preferably for about 60 minutes.
According to a further preferred embodiment, the mammal is ventilated with a fraction of inhaled oxygen (FiCh) of between about 0.18 and about 0.12. According to a further preferred embodiment, the mammal is ventilated with a fraction of inhaled oxygen of an amount selected from a range having a lower value of about 0.12, 0.13, 0.14, 0.15, 0.16, or 0.17 and an upper value of about 0.13, 0.14, 0.15, 0.16, 0.17, or 0.18, and in any combination thereof. More preferably, the mammal is ventilated with a fraction of inhaled oxygen of between about 0.17 and about 0.14, most preferably of about 0.16.
The present invention also provides model animals obtained by performing the method for producing a non-human mammalian model of cardiogenic shock.
EXAMPLES
The Examples are designed to further illustrate the present invention and serve a better understanding. They are not to be construed as limiting the scope of the invention in any way.
Materials and methods used in the Examples:
Unless stated otherwise, the following materials and methods were used in the examples.
Recombinant MYDGF.
In the [+G] MYDGF variant (HEK) used in the examples, the N-terminal V residue in position +1 of the mature human MYDGF is preceded by a G residue. The variant has the sequence as denoted in SEQ ID NO: 3 and was manufactured as described in Polten, F. et al. (2019), Anal Chem, 91, 1302-1308 on page 1303, 1st column and Figure SI, and in Ebenhoch, R. et al. (2019), Nat Commun 10, 5379 on page 8, left column.
Mouse Surgery and Functional Assessment.
All surgical procedures were approved by the authorities in Hannover, Germany (Niedersachsisches Landesamt fur Verbraucherschutz und Lebensmittelsicherheit). All animal procedures conformed to the guidelines from the EU directive 2010/63 on the protection of animals used for scientific purposes. Mice were housed in individually ventilated cages on a 12-hour light/dark cycle in the central animal facility of Hannover Medical School. Food and water were provided ad libitum. During surgery, mice were placed on a heating pad connected to a temperature controller (Fbhr Medical Instruments) to keep rectal temperature at 37°C.
Statistical analyses.
Mouse littermates were randomly allocated to the different experimental groups. Based on visual inspection, data were normally distributed with similar variances in the different groups. Data are presented as mean ± s.e.m.. The 2-independent-sample / test was used to compare 2 groups. For comparisons among more than 2 groups, 1-way ANOVA was used if there was one independent variable and 2-way ANOVA if there were two independent variables. Dunnett’s post hoc test was used for multiple comparisons with a single control group. Tukey’s post hoc test was used to adjust for multiple comparisons. A 2-tailed P value less than 0.05 was considered to indicate statistical significance. K.C.W. had full access to all data in the study and takes responsibility for the integrity of the data and the data analysis.
Example 1:
Establishing an animal model of cardiogenic shock. Myocardial infarction (MI) was induced in 8 to 10-week-old male C57BL/6N mice by transient proximal left anterior descending coronary artery ligation for 60 min. Animals were subcutaneously pretreated with 2 mg/kg butorphanol and with 0.02 mg/kg atropine to reduce bronchial secretions. Anaesthesia was induced with 3 to 4% isoflurane. After intubation, mice were mechanically ventilated and anaesthesia was maintained with 1 to 2% isoflurane. After a left thoracotomy, the left anterior descending coronary artery (LAD) was ligated with a 7-0 prolene (Ethicon, cat no. EH7405) slipknot to induce ischemia, which was removed 1 h later to induce reperfusion. In sham-operated mice, the ligature around the LAD was not tied. After coronary reperfusion, a micromanometer-tipped conductance catheter was inserted via the right carotid artery to record left ventricular (LV) pressure-volume loops. At the end of the protocol, an arterial blood sample was drawn from the left ventricle.
In pilot experiments, coronary artery ligation alone only slightly lowered LV end- systolic pressure (LVESP) and did not raise arterial lactate concentration, a biomarker of peripheral hypoperfusion and tissue hypoxia in cardiogenic shock (CS). Based on the premise that MI combined with hypoxic ventilation might induce CS, different fractions of inspired oxygen (FiCL) were compared for ventilating mice after reperfusion (medical O2 was mixed with medical N2). During ongoing isoflurane anaesthesia, infarcted and sham operated mice were randomly ventilated with an FiCL of 0.33 associated with normoxaemia (nx; arterial oxygen partial pressure [PaCL], 144 ± 16 mm Hg; arterial oxygen saturation [SaCL], 99 ± 1%), or an FiCL of 0.16 resulting in mild hypoxaemia (hx; PaCL, 75 ± 16 mmHg; SaCL, 89 ± 3%; 4 to 6 mice per group) (Fig. 1 A).
Exemplary pressure volume loops recorded after 120 min are presented (Fig. IB). During the 120 min time period, LVESP (Fig. 2A) and cardiac output (Fig. 2B) gradually declined in Ml-hx mice (MI with CS) but remained stable in Ml-nx mice (MI without CS). At 120 min, Ml-hx mice had developed arterial hyperlactataemia (Fig. 2C) and displayed more severe systolic and diastolic dysfunction than Ml-nx mice (LV ejection fraction, 18 ± 2 vs 33 ± 2%, P<0.001; LV end-diastolic pressure, 14 ± 1 vs 9 ± 1 mmHg, P=0.005). Heart rate was not affected (475 ± 16 vs 486 ± 8 min'1). Mortality was higher in Ml-hx mice (11 of 23 mice died; all deaths were related to CS) than in Ml-nx mice (1 of 12 mice died, P=0.031).
Intravenous dobutamine infusion, an established symptomatic therapy for patients with CS (Vahdatpour et al. Journal of the American Heart Association, Vol 8(8), 2019, eOl 1991), increased LVESP (Fig. 3A) and cardiac output (Fig. 3B), and lowered arterial lactate (5.6 ± 0.6 vs 11.1 ± 0.7 mmol/L, P<0.001, 4-6 mice per group) in Ml-hx mice.
As a use case for the model, high-resolution mass spectrometry was employed to define phosphoproteome signatures in the non-infarcted LV myocardium at 120 min. Among 1,264 different proteins, 9,004 phosphosites were detected. Principle component analysis indicated that the four groups (Sham-nx = sham operated mice normoxaemia; Sham-hx = sham operated mice hypoxaemia; Ml-nx = infarcted mice normoxaemia; Ml-hx = infarcted mice hypoxaemia) were associated with distinct phosphoproteome signatures (Figure 4). Reflecting the observation that hypoxaemia, in itself, did not alter cardiac performance (Figures 2A and 2B), the phosphoproteome signatures of sham-hx and sham-nx mice overlapped (Figure 4). Conversely, Ml-hx and Ml-nx mice displayed vastly different phosphoproteome signatures (Figure 4) with 72 differentially regulated phosphosites (Figure 5), thus indicating potential therapeutic entry points.
A further detailed description is provided in Wang Y, Polten F, Jackie F, Korf- Klingebiel M, Kempf T, Bauersachs J, Freitag-Wolf S, Lichtinghagen R, Pich A, Wollert KC. A mouse model of cardiogenic shock. Cardiovasc Res. 2021;117:2414-2415, incorporated herein by reference in its entirety. The animal model of the present invention being the first of its kind, replicates key features of CS in patients, including severe systolic and diastolic dysfunction, low cardiac output and hypotension, increased arterial lactate concentration, hemodynamic response to dobutamine, and high mortality. The model provides a platform to explore molecular pathophysiology and develop desperately needed therapies for CS.
Example 2:
The MYDGF protein (human Factor 1; C19orfl0) was identified as detailed in
WO 2014/111458. The nucleic acid sequence encoding human Factor 1 is available under
NCBI Gene ID: 56005 (SEQ ID NO: 4). The amino acid sequence of human Factor 1 including the N-terminal signal peptide is detailed in SEQ ID NO: 2. In the examples, the human [+G] MYDGF variant according to SEQ ID NO: 3 without the signal peptide was used and expressed as detailed in Ebenhoch R. et al., Crystal structure and receptor-interacting residues of MYDGF - a protein mediating ischemic tissue repair (Nat Commun. 2019 Nov 26;10(l):5379 and Polten et al. Plasma Concentrations of Myeloid-Derived Growth Factor in Healthy Individuals and Patients with Acute Myocardial Infarction as Assessed by Multiple Reaction Monitoring-Mass Spectrometry. Anal Chem. 2019 Jan 15;91(2): 1302-1308).
Example 3:
Acute myocardial infarction was induced in C57BL6/N mice, pretreated with butorphanol (2 mg/kg, subcutaneously (s.c.)) and atropine (0.02 mg/kg, s.c.) to reduce bronchial secretions, by transient left anterior descending coronary artery ligation for 60 minutes. Human MYDGF (10 pg in 100 pL) or saline (control) were bolus-injected into the left ventricular cavity at the time of reperfusion. After reperfusion, a micromanometer-tipped conductance catheter was inserted via the right carotid artery to continuously record left ventricular pressure-volume (PV) loops. Thereafter, cardiogenic shock (CS) was induced by hypoxic ventilation (FiCE 0.16) and mice received a continuous intra-left jugular vein infusion of either MYDGF (5 pg/h, infusion rate: 2 pL/min) or saline (control) for 120 minutes. After 120 min, an arterial blood sample (anti coagulated with heparin) was drawn from the left ventricle and used for immediate blood gas and lactate analysis. Another blood sample was withdrawn, treated with EDTA, and centrifuged at 3,500 g for 10 min at 4 °C to obtain plasma which was stored at -80 °C until further analysis. Figure 13 schematically illustrates this process (abbreviations in Fig. 13 as defined for Fig. 1; s.c. = subcutaneous administration; i.v. = intravenous administration).
Results are shown in Figures 6 to 12.
MYDGF significantly improved the survival rate of cardiogenic shock mice as shown in Figure 6.
The Experiments further show that administration of MYDGF improves left ventricular systolic and diastolic functions (PV loop recordings in Figs. 7A to 7F, and 8A to 8F).
MYDGF further reverses acidosis and lowers lactate concentrations, i.e. two defining features of cardiogenic shock (blood gas analyses in Fig. 9).
MYDGF is also shown to prevent declines in cardiac output and LVESP, i.e. two further defining features of cardiogenic shock (continuous PV loop recordings in Figs. 10A
and B).
The experiments also show that treatment with MYDGF reduces infarct size (Figs. 11A and B). For this purpose, at the end of the observation period, the left ventricle was removed and the area at risk and infarct size were measured by Evans blue and 2,3,5- triphenyltetrazolium chloride (TTC) staining (methods as described in Korf-Klingebiel et al. Nat Med. 2015;21 : 140-149).
The impact of MYDGF treatment on plasma troponin levels and alanine transaminase (ALT) concentration determined at the end of the 120 minutes observation period is shown in Figs. 12 A and B. Plasma troponin is an indicator of cardiac damage and ALT reflects end-organ (liver) damage. MYDGF treatment of CS mice reduces both, plasma troponin and alanine transaminase levels. The impact of MYDGF on cell death in the infarct region was determined at the end of the 120 minutes observation period by measuring soluble nucleosomes that are released as a result of cell death. Measurements were performed using the commercially available Cell Death Detection ELISA from Roche. Fig. 12C displays the ratio of soluble nucleosomes in the infarcted region (I) over the non-infarcted region (NI) as an indicator of cell death, and shows that MYDGF significantly reduced the amount of soluble nucleosomes and thus cell death in the infarct region.
Example 4:
MYDGF knock-out mice were obtained as described in Korf-Klingebiel et al. (Nature Medicine, 2015, Vol. 21(2): 140-149). Cardiogenic shock (CS) was induced in wild-type (WT) and MYDGF knock-out (KO) mice as described in Example 1. Mortality rates of WT and MYDGF knock-out mice were compared during the 120 minutes observation period. As shown in Fig. 14, mortality was significantly higher in KO mice, showing that endogenous MYDGF has a protective effect in cardiogenic shock.
Example 5:
As shown e.g. in Fig. 10, heart function is continuously deteriorating during cardiogenic shock. It was assumed that this deterioration is caused by a continued aggravation of left ventricular tissue damage during cardiogenic shock. In order to test this hypothesis, acute MI was induced by transient left anterior descending coronary artery ligation for 60 min. After reperfusion, CS was induced by hypoxic ventilation (FiCL 0.16; Ml/with shock). Infarcted control mice were normoxically ventilated (FiCL 0.33; Ml/no shock). A scheme of the experimental set-up is shown in Fig. 15 A.
60 minutes after reperfusion and at the end of the experiment, the left ventricles were
removed (5 Ml/no shock and 5 Ml/with shock mice at each time point), and cell death (soluble nucleosomes) was measured in the infarct region (I) and the non-infarcted remote region (NI) using the cell death detection ELISA from Roche. The I/NI ratio is reported as a measure of cell death. Results are shown in Fig. 15B. Soluble nucleosome concentrations in the infarct area increased during the observation period in both groups ([apoptotic] cell death needs time to develop). The rise in soluble nucleosome concentration was significantly more pronounced in Ml/with shock mice than in Ml/no shock mice, indicating that CS further aggravates left ventricular tissue damage sustained during acute MI.
Example 6:
As shown in Example 5, cardiogenic shock further aggravates left ventricular tissue damage sustained during acute myocardial infarction. It was therefore tested if a delayed MYDGF therapy is capable of alleviating the symptoms of cardiogenic shock and of improving heart function. To this end, acute myocardial infarction was induced in mice by transient left anterior descending coronary artery ligation for 60 min. After reperfusion, a micromanometer-tipped conductance catheter was inserted via the right carotid artery to continuously record left ventricular pressure-volume (PV) loops. Thereafter, cardiogenic shock was induced by hypoxic ventilation (FiCE 0.16). Starting 60 min after reperfusion, mice received a continuous intra-left jugular vein infusion of either (i) human MYDGF (5 pg/h, infusion rate: 2 pL/min) or (ii) saline (control), until the end of the experiment when blood (anti coagulated with heparin) was drawn from the left ventricle and used for immediate blood gas and lactate analysis. Three Ml/with shock mice received delayed MYDGF therapy, and three Ml/with shock mice received a delayed saline infusion. A scheme of the experimental set-up is shown in Fig. 16 A.
Results are shown in Fig. 16B. One of the saline-treated control mice died. In the surviving animals, heart function (e.g. left ventricular ejection fraction, LVEF) and peripheral tissue perfusion (e.g. lactate concentration) were better in MYDGF-treated mice than in saline-treated control mice. These data indicate that delayed MYDGF therapy still promotes beneficial effects in cardiogenic shock.
ITEMS
Items of the invention pertain to the following:
Item 1. Myeloid-derived growth factor (MYDGF) or a fragment or a variant thereof exhibiting the biological function of MYDGF, for use in treating and/or preventing cardiogenic shock.
Item 2. The MYDGF for use according to item 1, wherein the MYDGF comprises:
(i) SEQ ID NO: 1; or
(ii) a fragment or variant of SEQ ID NO: 1 exhibiting the biological function of MYDGF, wherein the variant comprises an amino acid sequence with at least 85% amino acid sequence identity to SEQ ID NO: 1.
Item 3. The MYDGF for use according to item 1, wherein the MYDGF protein consists of SEQ ID NO: 1 or SEQ ID NO: 3.
Item 4. A nucleic acid encoding MYDGF or a fragment or a variant thereof exhibiting the biological function of MYDGF, for use in treating cardiogenic shock.
Item 5. The nucleic acid for use according to item 4, wherein the nucleic acid encodes an amino acid sequence having at least 85% sequence identity to SEQ ID NO: 1.
Item 6. A vector comprising the nucleic acid of item 5, for use in treating and/or preventing cardiogenic shock.
Item 7. A host cell comprising the nucleic acid of item 5 or the vector according to item 6 and preferably expressing the nucleic acid, for use in treating and/or preventing cardiogenic shock.
Item 8. A pharmaceutical composition comprising the MYDGF protein or a fragment or a variant thereof exhibiting the biological function of MYDGF according to any one of items 1 to 3, the nucleic acid according to any one of items 4 or 5, the vector according to item 6, or the host cell according to item 7 for use in treating and/or preventing cardiogenic shock.
Item 9. The pharmaceutical composition for use according to item 8, wherein said pharmaceutical composition is administered through the oral, intravenous, subcutaneous, intramucosal, intraarterial, intramuscular or intracoronary route.
Item 10. The pharmaceutical composition for use of item 9, wherein the administration is through one or more bolus injection(s) and/or infusion(s).
Item 11. A method of treating and/or preventing cardiogenic shock, comprising administering to a patient in need thereof a therapeutically effective amount of MYDGF or a fragment or variant thereof exhibiting the biological function of MYDGF.
Item 12. A method of treating and/or preventing cardiogenic shock comprising administering to a patient in need thereof a therapeutically effective amount of a pharmaceutical composition comprising myeloid-derived growth factor (MYDGF) protein.
Item 13. The method according to item 11 or 12, wherein the MYDGF comprises:
(i) SEQ ID NO: 1; or
(ii) a fragment or variant of SEQ ID NO: 1 exhibiting the biological function of MYDGF, wherein the variant comprises an amino acid sequence with at least 85% amino acid sequence identity to SEQ ID NO: 1.
Item 14. The method according to any one of items 11 to 13, wherein the MYDGF or fragment or variant thereof is administered through one or more bolus injection(s) and/or infusion(s), preferably in a pharmaceutically accepted carrier and/or excipient.
Item 15. A method for producing a non-human mammalian model of cardiogenic shock, the method comprising:
(i) transiently ligating a coronary artery of the mammal,
(ii) establishing reperfusion, and
(iii) ventilating the mammal with a fraction of inhaled oxygen of about 0.18 or less.
Item 16. The method of item 15, wherein the non-human mammal is a rodent, preferably wherein the non-human mammal is a mouse.
Item 17. The method of item 15 or 16, wherein the coronary artery is ligated for about 30 minutes to about 90 minutes before reperfusion is established.
Item 18. The method according to any one of items 15 to 17, wherein the mammal is ventilated with a fraction of inhaled oxygen of about 0.16.
Claims
1. Myeloid-derived growth factor (MYDGF) or a fragment or a variant thereof exhibiting the biological function of MYDGF, for use in treating and/or preventing cardiogenic shock.
2. The MYDGF for use according to claim 1, wherein the MYDGF comprises:
(i) SEQ ID NO: 1; or
(ii) a fragment or variant of SEQ ID NO: 1 exhibiting the biological function of MYDGF, wherein the variant comprises an amino acid sequence with at least 85% amino acid sequence identity to SEQ ID NO: 1.
3. The MYDGF for use according to claim 1, wherein the MYDGF protein consists of SEQ ID NO: 1 or SEQ ID NO: 3.
4. A nucleic acid encoding MYDGF or a fragment or a variant thereof exhibiting the biological function of MYDGF, for use in treating and/or preventing cardiogenic shock.
5. The nucleic acid for use according to claim 4, wherein the nucleic acid encodes an amino acid sequence having at least 85% sequence identity to SEQ ID NO: 1.
6. A vector comprising the nucleic acid of claim 5, for use in treating and/or preventing cardiogenic shock.
7. A host cell comprising the nucleic acid of claim 5 or the vector according to claim 6 and preferably expressing the nucleic acid, for use in treating and/or preventing cardiogenic shock.
8. A pharmaceutical composition comprising the MYDGF protein or a fragment or a variant thereof exhibiting the biological function of MYDGF according to any one of claims 1 to 3, the nucleic acid according to any one of claims 4 or 5, the vector according to claim 6, or the host cell according to claim 7 for use in treating and/or preventing cardiogenic shock.
9. The pharmaceutical composition for use according to claim 8, wherein said pharmaceutical composition is administered through the oral, intravenous, subcutaneous, intramucosal, intraarterial, intramuscular or intracoronary route.
10. The pharmaceutical composition for use of claim 9, wherein the administration is through one or more bolus injection(s) and/or infusion(s).
11. A method of treating and/or preventing cardiogenic shock, comprising administering to a patient in need thereof a therapeutically effective amount of MYDGF or fragment or variant thereof exhibiting the biological function of MYDGF.
12. A method of treating and/or preventing cardiogenic shock comprising administering to a patient in need thereof a therapeutically effective amount of a pharmaceutical composition comprising myeloid-derived growth factor (MYDGF) protein or a fragment or a variant thereof.
13. The method according to claim 11 or 12, wherein the MYDGF comprises:
(i) SEQ ID NO: 1; or
(ii) wherein the fragment or variant is a fragment or variant of SEQ ID NO: 1 and exhibits the biological function of MYDGF, wherein the variant comprises an amino acid sequence with at least 85% amino acid sequence identity to SEQ ID NO: 1.
14. The method according to any one of claims 11 to 13, wherein the MYDGF or fragment or variant thereof is administered through one or more bolus injection(s) and/or infusion(s), preferably in a pharmaceutically accepted carrier and/or excipient.
15. A method for producing a non-human mammalian model of cardiogenic shock, the method comprising:
(i) transiently ligating a coronary artery of the mammal,
(ii) establishing reperfusion, and
(iii) ventilating the mammal with a fraction of inhaled oxygen of about 0.18 or less.
16. The method of claim 15, wherein the non-human mammal is a rodent, preferably wherein the non-human mammal is a mouse.
17. The method of claim 15 or 16, wherein the coronary artery is ligated for about 30 minutes to about 90 minutes before reperfusion is established.
18. The method according to any one of claims 15 to 17, wherein the mammal is ventilated with a fraction of inhaled oxygen of about 0.16.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202263374942P | 2022-09-08 | 2022-09-08 | |
US63/374,942 | 2022-09-08 |
Publications (2)
Publication Number | Publication Date |
---|---|
WO2024052563A1 true WO2024052563A1 (en) | 2024-03-14 |
WO2024052563A4 WO2024052563A4 (en) | 2024-04-25 |
Family
ID=88092856
Family Applications (2)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2023/074803 WO2024052563A1 (en) | 2022-09-08 | 2023-09-08 | Myeloid-derived growth factor for use in treating cardiogenic shock |
PCT/EP2023/074804 WO2024052564A1 (en) | 2022-09-08 | 2023-09-08 | Myeloid-derived growth factor for use in treating cardiogenic shock |
Family Applications After (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/EP2023/074804 WO2024052564A1 (en) | 2022-09-08 | 2023-09-08 | Myeloid-derived growth factor for use in treating cardiogenic shock |
Country Status (1)
Country | Link |
---|---|
WO (2) | WO2024052563A1 (en) |
Citations (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5122458A (en) | 1984-08-24 | 1992-06-16 | The Upjohn Company | Use of a bgh gdna polyadenylation signal in expression of non-bgh polypeptides in higher eukaryotic cells |
WO1997047358A1 (en) | 1996-06-11 | 1997-12-18 | Merck & Co., Inc. | Synthetic hepatitis c genes |
US20040185049A1 (en) | 2003-01-31 | 2004-09-23 | Christopher Hunter | Methods for modulating an inflammatory response |
US20080004232A1 (en) | 2006-05-09 | 2008-01-03 | John Wilkins | Characterization of c19orf10, a Novel Synovial Protein |
EP2130547A1 (en) | 2008-06-06 | 2009-12-09 | Giuliani International Limited | IL-25 for use in the treatment of inflammatory diseases |
WO2014111458A2 (en) | 2013-01-17 | 2014-07-24 | Medizinische Hochschule Hannover | Factor 1 protein, factor 2 protein and inhibitors thereof for use in treating or preventing diseases |
WO2021148411A1 (en) | 2020-01-21 | 2021-07-29 | Boehringer Ingelheim International Gmbh | Myeloid-derived growth factor for use in treating or preventing fibrosis, hypertrophy or heart failure |
WO2021189053A1 (en) * | 2020-03-20 | 2021-09-23 | Yale University | Rapid extracellular antibody profiling (reap) for the discovery and use of said antibodies |
CN114470163A (en) * | 2022-02-08 | 2022-05-13 | 西安交通大学医学院第一附属医院 | Application of recombinant human medullary growth factor in treating renal ischemia reperfusion injury |
-
2023
- 2023-09-08 WO PCT/EP2023/074803 patent/WO2024052563A1/en unknown
- 2023-09-08 WO PCT/EP2023/074804 patent/WO2024052564A1/en unknown
Patent Citations (9)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US5122458A (en) | 1984-08-24 | 1992-06-16 | The Upjohn Company | Use of a bgh gdna polyadenylation signal in expression of non-bgh polypeptides in higher eukaryotic cells |
WO1997047358A1 (en) | 1996-06-11 | 1997-12-18 | Merck & Co., Inc. | Synthetic hepatitis c genes |
US20040185049A1 (en) | 2003-01-31 | 2004-09-23 | Christopher Hunter | Methods for modulating an inflammatory response |
US20080004232A1 (en) | 2006-05-09 | 2008-01-03 | John Wilkins | Characterization of c19orf10, a Novel Synovial Protein |
EP2130547A1 (en) | 2008-06-06 | 2009-12-09 | Giuliani International Limited | IL-25 for use in the treatment of inflammatory diseases |
WO2014111458A2 (en) | 2013-01-17 | 2014-07-24 | Medizinische Hochschule Hannover | Factor 1 protein, factor 2 protein and inhibitors thereof for use in treating or preventing diseases |
WO2021148411A1 (en) | 2020-01-21 | 2021-07-29 | Boehringer Ingelheim International Gmbh | Myeloid-derived growth factor for use in treating or preventing fibrosis, hypertrophy or heart failure |
WO2021189053A1 (en) * | 2020-03-20 | 2021-09-23 | Yale University | Rapid extracellular antibody profiling (reap) for the discovery and use of said antibodies |
CN114470163A (en) * | 2022-02-08 | 2022-05-13 | 西安交通大学医学院第一附属医院 | Application of recombinant human medullary growth factor in treating renal ischemia reperfusion injury |
Non-Patent Citations (34)
Title |
---|
"Cold Spring Harbor", 1989, COLD SPRING HARBOR LABORATORY PRESS, article "Molecular Cloning: A Laboratory Manual," |
"Textbook of Cardiovascular Medicine", 2011, SAUNDERS ELSEVIER PHILADELPHIA |
ALTSCHUL ET AL., J. MOL. BIOL., vol. 215, 1990, pages 403 - 410 |
ALTSCHUL ET AL., NUCLEIC ACIDS RES., vol. 25, 1997, pages 3389 - 3402 |
BRUDNO M., BIOINFORMATICS, vol. 1, 2003, pages 154 - 162 |
CHAPMAN ET AL., NUCL. ACIDS RES, vol. 19, 1991, pages 3979 - 3986 |
EBENHOCH R. ET AL., NAT COMMUN., vol. 10, no. 1, 26 November 2019 (2019-11-26), pages 5379 |
EBENHOCH R. ET AL.: "Crystal structure and receptor-interacting residues of MYDGF - a protein mediating ischemic tissue repair", NAT COMMUN, vol. 10, no. 1, 26 November 2019 (2019-11-26), pages 5379 |
EBENHOCH, R. ET AL., NAT COMMUN, vol. 10, 2019, pages 8 |
HAGSTROM ET AL., BLOOD, vol. 95, pages 2536 - 2542 |
HITT, GENETICS, vol. 7, 1995, pages 13 - 30 |
KARLIN & ALTSCHUL, PROC. NATL. ACAD. SCI. USA, vol. 90, 1993, pages 5873 - 5877 |
KORF-KLINGEBIEL ET AL., NAT MED., vol. 21, 2015, pages 140 - 149 |
KORF-KLINGEBIEL ET AL., NATURE MEDICINE, vol. 21, no. 2, 2015, pages 140 - 149 |
KORF-KLINGEBIEL MORTIMER ET AL: "Myeloid-Derived Growth Factor Protects Against Pressure Overload-Induced Heart Failure by Preserving Sarco/Endoplasmic Reticulum Ca 2+ -ATPase Expression in Cardiomyocytes", CIRCULATION, vol. 144, no. 15, 12 October 2021 (2021-10-12), US, pages 1227 - 1240, XP093109763, ISSN: 0009-7322, DOI: 10.1161/CIRCULATIONAHA.120.053365 * |
KOZAK, CELL, vol. 44, 1986, pages 283 - 292 |
L ET AL., NAT. BIOTECHNOL., vol. 17, 1999, pages 241 - 245 |
LARKIN MABLACKSHIELDS GBROWN NPCHENNA RMCGETTIGAN PAMCWILLIAM HVALENTIN FWALLACE IMWILM ALOPEZ R: "Clustal W and Clustal X version 2.0.", BIOINFORMATICS, vol. 23, 2007, pages 2947 - 2948 |
LEWIN, GENES IV, OXFORD UNIVERSITY PRESS, NY, 1990 |
MORTIMER KORF-KLINGEBIEL ET AL: "Myeloid-derived growth factor (C19orf10) mediates cardiac repair following myocardial infarction", NATURE MEDICINE, vol. 21, no. 2, 1 February 2015 (2015-02-01), New York, pages 140 - 149, XP055686303, ISSN: 1078-8956, DOI: 10.1038/nm.3778 * |
OLARTE NEAL ET AL: "Evolving Presentation of Cardiogenic Shock: A Review of the Medical Literature and Current Practices", CARDIOLOGY AND THERAPY, vol. 11, no. 3, 7 August 2022 (2022-08-07), pages 369 - 384, XP093109243, ISSN: 2193-8261, Retrieved from the Internet <URL:https://link.springer.com/article/10.1007/s40119-022-00274-6/fulltext.html> DOI: 10.1007/s40119-022-00274-6 * |
OXFORD UNIVERSITY PRESS, LEWIN GENES IV, 1990, pages 119 |
POLTEN F. ET AL.: "Plasma Concentrations of Myeloid-Derived Growth Factor in Healthy Individuals and Patients with Acute Myocardial Infarction as Assessed by Multiple Reaction Monitoring-Mass Spectrometry.", ANAL CHEM., vol. 91, no. 2, 15 January 2019 (2019-01-15), pages 1302 - 1308, XP055686424, DOI: 10.1021/acs.analchem.8b03041 |
POLTEN, F., ANAL CHEM, vol. 91, 2019, pages 1302 - 1308 |
S. M. BERGEPHARMACEUTICAL SALTS ET AL., J. PHARM. SCI., vol. 66, 1977, pages 1 - 19 |
SUNAGOZAKA ET AL., INTERNATIONAL JOURNAL OF CANCER, 2010 |
THIELE HOLGER ET AL: "Management of cardiogenic shock", EUROINTERVENTION, vol. 17, no. 6, 1 August 2021 (2021-08-01), FR, pages 451 - 465, XP093109208, ISSN: 1774-024X, Retrieved from the Internet <URL:https://www.ncbi.nlm.nih.gov/pmc/articles/PMC9724885/pdf/EIJ-D-20-01296_Thiele.pdf> DOI: 10.4244/EIJ-D-20-01296 * |
THOMPSON, J. D.HIGGINS, D. G. & GIBSON, T. J., NUCLEIC ACIDS RES., vol. 22, 1994, pages 4673 - 80 |
UDESEN NANNA L.J. ET AL: "Biventricular Compared to Left Ventricular Impella and Norepinephrine Support in a Porcine Model of Severe Cardiogenic Shock", ASAIO JOURNAL., vol. 68, no. 9, 28 December 2021 (2021-12-28), US, pages 1141 - 1148, XP093109252, ISSN: 1058-2916, DOI: 10.1097/MAT.0000000000001636 * |
VAHDATPOUR ET AL., JOURNAL OF THE AMERICAN HEART ASSOCIATION, vol. 8, no. 8, 2019, pages e011991 |
WANG YONG ET AL: "A mouse model of cardiogenic shock", CARDIOVASCULAR RESEARCH, vol. 117, no. 12, 9 September 2021 (2021-09-09), GB, pages 2414 - 2415, XP093109705, ISSN: 0008-6363, Retrieved from the Internet <URL:https://academic.oup.com/cardiovascres/article-pdf/117/12/2414/41281897/cvab290.pdf> DOI: 10.1093/cvr/cvab290 * |
WANG YPOLTEN FJACKLE FKORF-KLINGEBIEL MKEMPF TBAUERSACHS JFREITAG-WOLF SLICHTINGHAGEN RPICH AWOLLERT KC: "A mouse model of cardiogenic shock.", CARDIOVASC RES, vol. 117, 2021, pages 2414 - 2415 |
WEILER ET AL., ARTHRITIS RESEARCH AND THERAPY, 2007 |
XU ET AL., GENE, vol. 272, 2001, pages 149 - 156 |
Also Published As
Publication number | Publication date |
---|---|
WO2024052564A1 (en) | 2024-03-14 |
WO2024052563A4 (en) | 2024-04-25 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11702642B2 (en) | Soluble fibroblast growth factor receptor 3 (FGR3) polypeptide for use in the prevention or treatment of skeletal growth retardation disorders | |
US10369198B2 (en) | Factor 1 protein, factor 2 protein and inhibitors thereof for use in treating or preventing diseases | |
US9096687B2 (en) | Inhibition of inflammation using antagonists of MUC1 | |
US20230059560A1 (en) | Myeloid-derived growth factor for use in treating or preventing fibrosis, hypertrophy or heart failure | |
US20140322332A1 (en) | Antagonists of muc1 | |
US20200062811A1 (en) | Yap protein inhibiting polypeptide and application thereof | |
US20190111154A1 (en) | Treatment of neuropathy with dna construct expressing hgf isoforms with reduced interference from gabapentinoids | |
WO2024052563A1 (en) | Myeloid-derived growth factor for use in treating cardiogenic shock | |
TW201442722A (en) | Use of peptides to treat cardiovascular indications | |
CN107629114B (en) | Polypeptide, derivative thereof and application thereof in preparation of anti-pulmonary fibrosis drugs | |
TW201200151A (en) | Methods and compositions related to reduced MET phosphorylation by leukocyte cell-derived chemotaxin 2 in tumor cells | |
US20080119404A1 (en) | Antiobesity Drug | |
KR20080021588A (en) | Mechano growth factor peptides and their use | |
EP3256146B1 (en) | Dermatopontin as a therapeutic for metabolic disorders | |
JP2020015733A (en) | Soluble fibroblast growth factor receptor 3 (fgr3) polypeptide for use in prevention or treatment of skeletal growth retardation disorders | |
JP5786266B2 (en) | Apoptosis inducer | |
EP4093427A1 (en) | Treatment of cardiac remodelling | |
KR20230005314A (en) | Homing peptide derived decorin conjugate for use in the treatment of epidermolysis bullosa | |
NZ790135A (en) | Soluble fibroblast growth factor receptor 3 (SFGFR3) polypeptides and uses thereof |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23772127 Country of ref document: EP Kind code of ref document: A1 |