WO2024040207A1 - Genetically engineered natural killer (nk) cells with chimeric receptor polypeptides in combination with trans metabolism molecules and therapeutic uses thereof - Google Patents
Genetically engineered natural killer (nk) cells with chimeric receptor polypeptides in combination with trans metabolism molecules and therapeutic uses thereof Download PDFInfo
- Publication number
- WO2024040207A1 WO2024040207A1 PCT/US2023/072444 US2023072444W WO2024040207A1 WO 2024040207 A1 WO2024040207 A1 WO 2024040207A1 US 2023072444 W US2023072444 W US 2023072444W WO 2024040207 A1 WO2024040207 A1 WO 2024040207A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- cells
- domain
- cell
- polypeptide
- genetically engineered
- Prior art date
Links
- 108090000765 processed proteins & peptides Proteins 0.000 title claims abstract description 589
- 102000004196 processed proteins & peptides Human genes 0.000 title claims abstract description 575
- 229920001184 polypeptide Polymers 0.000 title claims abstract description 570
- 230000004060 metabolic process Effects 0.000 title claims abstract description 166
- 108700010039 chimeric receptor Proteins 0.000 title claims abstract description 160
- 230000001225 therapeutic effect Effects 0.000 title description 14
- 210000000822 natural killer cell Anatomy 0.000 claims abstract description 369
- 210000004027 cell Anatomy 0.000 claims abstract description 196
- 108091007433 antigens Proteins 0.000 claims abstract description 184
- 102000036639 antigens Human genes 0.000 claims abstract description 184
- 239000000427 antigen Substances 0.000 claims abstract description 182
- 230000027455 binding Effects 0.000 claims abstract description 150
- 108010019670 Chimeric Antigen Receptors Proteins 0.000 claims abstract description 146
- 238000009739 binding Methods 0.000 claims abstract description 146
- 210000002865 immune cell Anatomy 0.000 claims abstract description 53
- 230000002401 inhibitory effect Effects 0.000 claims abstract description 14
- 230000011664 signaling Effects 0.000 claims description 177
- 206010028980 Neoplasm Diseases 0.000 claims description 104
- 238000000034 method Methods 0.000 claims description 89
- 230000001086 cytosolic effect Effects 0.000 claims description 73
- 101000914514 Homo sapiens T-cell-specific surface glycoprotein CD28 Proteins 0.000 claims description 70
- 102100027213 T-cell-specific surface glycoprotein CD28 Human genes 0.000 claims description 70
- 150000007523 nucleic acids Chemical class 0.000 claims description 67
- 102000039446 nucleic acids Human genes 0.000 claims description 66
- 108020004707 nucleic acids Proteins 0.000 claims description 66
- 239000013598 vector Substances 0.000 claims description 56
- 102100034193 Aspartate aminotransferase, mitochondrial Human genes 0.000 claims description 44
- 241000282414 Homo sapiens Species 0.000 claims description 44
- 101000799549 Homo sapiens Aspartate aminotransferase, mitochondrial Proteins 0.000 claims description 43
- 201000011510 cancer Diseases 0.000 claims description 42
- 101000851370 Homo sapiens Tumor necrosis factor receptor superfamily member 9 Proteins 0.000 claims description 40
- 102100036856 Tumor necrosis factor receptor superfamily member 9 Human genes 0.000 claims description 40
- -1 CD3ζ Proteins 0.000 claims description 39
- 230000004936 stimulating effect Effects 0.000 claims description 34
- 239000002773 nucleotide Substances 0.000 claims description 30
- 125000003729 nucleotide group Chemical group 0.000 claims description 30
- 239000008103 glucose Substances 0.000 claims description 29
- 102100022153 Tumor necrosis factor receptor superfamily member 4 Human genes 0.000 claims description 27
- 101710165473 Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 claims description 24
- 230000003612 virological effect Effects 0.000 claims description 23
- 108010076504 Protein Sorting Signals Proteins 0.000 claims description 22
- 210000003705 ribosome Anatomy 0.000 claims description 22
- 108010002350 Interleukin-2 Proteins 0.000 claims description 20
- 102000005962 receptors Human genes 0.000 claims description 20
- 108020003175 receptors Proteins 0.000 claims description 20
- 101100334515 Homo sapiens FCGR3A gene Proteins 0.000 claims description 19
- 102100029193 Low affinity immunoglobulin gamma Fc region receptor III-A Human genes 0.000 claims description 19
- 239000012634 fragment Substances 0.000 claims description 19
- 230000001717 pathogenic effect Effects 0.000 claims description 18
- 102100027207 CD27 antigen Human genes 0.000 claims description 17
- 101000914511 Homo sapiens CD27 antigen Proteins 0.000 claims description 17
- 101001109501 Homo sapiens NKG2-D type II integral membrane protein Proteins 0.000 claims description 17
- 101001117146 Homo sapiens [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial Proteins 0.000 claims description 17
- 102100022680 NKG2-D type II integral membrane protein Human genes 0.000 claims description 17
- 108010004217 Natural Cytotoxicity Triggering Receptor 1 Proteins 0.000 claims description 16
- 102100032870 Natural cytotoxicity triggering receptor 1 Human genes 0.000 claims description 16
- 239000008194 pharmaceutical composition Substances 0.000 claims description 16
- 101000589305 Homo sapiens Natural cytotoxicity triggering receptor 2 Proteins 0.000 claims description 15
- 102100032851 Natural cytotoxicity triggering receptor 2 Human genes 0.000 claims description 15
- 108010042215 OX40 Ligand Proteins 0.000 claims description 15
- 108091006296 SLC2A1 Proteins 0.000 claims description 15
- 101001117144 Saccharomyces cerevisiae (strain ATCC 204508 / S288c) [Pyruvate dehydrogenase (acetyl-transferring)] kinase 1, mitochondrial Proteins 0.000 claims description 15
- 102100024148 [Pyruvate dehydrogenase (acetyl-transferring)] kinase isozyme 1, mitochondrial Human genes 0.000 claims description 15
- 230000004913 activation Effects 0.000 claims description 15
- 239000002245 particle Substances 0.000 claims description 15
- 102100038077 CD226 antigen Human genes 0.000 claims description 14
- 108010045283 Cystathionine gamma-lyase Proteins 0.000 claims description 14
- 102100029360 Hematopoietic cell signal transducer Human genes 0.000 claims description 14
- 101000884298 Homo sapiens CD226 antigen Proteins 0.000 claims description 14
- 101000990188 Homo sapiens Hematopoietic cell signal transducer Proteins 0.000 claims description 14
- 101000809875 Homo sapiens TYRO protein tyrosine kinase-binding protein Proteins 0.000 claims description 13
- 108010052285 Membrane Proteins Proteins 0.000 claims description 13
- 102100038717 TYRO protein tyrosine kinase-binding protein Human genes 0.000 claims description 13
- 230000034659 glycolysis Effects 0.000 claims description 13
- 108090000608 Phosphoric Monoester Hydrolases Proteins 0.000 claims description 12
- 102000004160 Phosphoric Monoester Hydrolases Human genes 0.000 claims description 12
- 239000013603 viral vector Substances 0.000 claims description 12
- 102100034459 Hepatitis A virus cellular receptor 1 Human genes 0.000 claims description 11
- 101000934346 Homo sapiens T-cell surface antigen CD2 Proteins 0.000 claims description 11
- 101000801234 Homo sapiens Tumor necrosis factor receptor superfamily member 18 Proteins 0.000 claims description 11
- 108010004222 Natural Cytotoxicity Triggering Receptor 3 Proteins 0.000 claims description 11
- 102100032852 Natural cytotoxicity triggering receptor 3 Human genes 0.000 claims description 11
- 102100025237 T-cell surface antigen CD2 Human genes 0.000 claims description 11
- 102100028785 Tumor necrosis factor receptor superfamily member 14 Human genes 0.000 claims description 11
- 102100033728 Tumor necrosis factor receptor superfamily member 18 Human genes 0.000 claims description 11
- 230000001177 retroviral effect Effects 0.000 claims description 11
- 108020004684 Internal Ribosome Entry Sites Proteins 0.000 claims description 10
- 108010061593 Member 14 Tumor Necrosis Factor Receptors Proteins 0.000 claims description 10
- 101001068136 Homo sapiens Hepatitis A virus cellular receptor 1 Proteins 0.000 claims description 9
- 210000003819 peripheral blood mononuclear cell Anatomy 0.000 claims description 9
- 101000831286 Homo sapiens Protein timeless homolog Proteins 0.000 claims description 8
- 101000752245 Homo sapiens Rho guanine nucleotide exchange factor 5 Proteins 0.000 claims description 8
- 101100341510 Mus musculus Itgal gene Proteins 0.000 claims description 8
- 108010003723 Single-Domain Antibodies Proteins 0.000 claims description 8
- 238000001727 in vivo Methods 0.000 claims description 8
- 108090000172 Interleukin-15 Proteins 0.000 claims description 7
- 102000003812 Interleukin-15 Human genes 0.000 claims description 7
- 102100032101 Tumor necrosis factor ligand superfamily member 9 Human genes 0.000 claims description 7
- 102100033177 Vascular endothelial growth factor receptor 2 Human genes 0.000 claims description 7
- 102000018697 Membrane Proteins Human genes 0.000 claims description 6
- 210000003719 b-lymphocyte Anatomy 0.000 claims description 6
- 230000001580 bacterial effect Effects 0.000 claims description 6
- 210000004263 induced pluripotent stem cell Anatomy 0.000 claims description 6
- 108010082808 4-1BB Ligand Proteins 0.000 claims description 5
- 206010029260 Neuroblastoma Diseases 0.000 claims description 5
- 210000004700 fetal blood Anatomy 0.000 claims description 5
- 230000002538 fungal effect Effects 0.000 claims description 5
- 102100031573 Hematopoietic progenitor cell antigen CD34 Human genes 0.000 claims description 4
- 102100022132 High affinity immunoglobulin epsilon receptor subunit gamma Human genes 0.000 claims description 4
- 108091010847 High affinity immunoglobulin epsilon receptor subunit gamma Proteins 0.000 claims description 4
- 102100026122 High affinity immunoglobulin gamma Fc receptor I Human genes 0.000 claims description 4
- 101000777663 Homo sapiens Hematopoietic progenitor cell antigen CD34 Proteins 0.000 claims description 4
- 101000913074 Homo sapiens High affinity immunoglobulin gamma Fc receptor I Proteins 0.000 claims description 4
- 101000917826 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-a Proteins 0.000 claims description 4
- 101000917824 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor II-b Proteins 0.000 claims description 4
- 101000851007 Homo sapiens Vascular endothelial growth factor receptor 2 Proteins 0.000 claims description 4
- 102000013462 Interleukin-12 Human genes 0.000 claims description 4
- 108010065805 Interleukin-12 Proteins 0.000 claims description 4
- 102100030704 Interleukin-21 Human genes 0.000 claims description 4
- 102100029204 Low affinity immunoglobulin gamma Fc region receptor II-a Human genes 0.000 claims description 4
- 206010025323 Lymphomas Diseases 0.000 claims description 4
- 210000003958 hematopoietic stem cell Anatomy 0.000 claims description 4
- 108010074108 interleukin-21 Proteins 0.000 claims description 4
- 230000002147 killing effect Effects 0.000 claims description 4
- 210000000130 stem cell Anatomy 0.000 claims description 4
- 102100022089 Acyl-[acyl-carrier-protein] hydrolase Human genes 0.000 claims description 3
- 101000964894 Bos taurus 14-3-3 protein zeta/delta Proteins 0.000 claims description 3
- 206010006187 Breast cancer Diseases 0.000 claims description 3
- 208000026310 Breast neoplasm Diseases 0.000 claims description 3
- 206010009944 Colon cancer Diseases 0.000 claims description 3
- 208000032612 Glial tumor Diseases 0.000 claims description 3
- 206010018338 Glioma Diseases 0.000 claims description 3
- 101000824278 Homo sapiens Acyl-[acyl-carrier-protein] hydrolase Proteins 0.000 claims description 3
- 101000946860 Homo sapiens T-cell surface glycoprotein CD3 epsilon chain Proteins 0.000 claims description 3
- 101000716102 Homo sapiens T-cell surface glycoprotein CD4 Proteins 0.000 claims description 3
- 101000611023 Homo sapiens Tumor necrosis factor receptor superfamily member 6 Proteins 0.000 claims description 3
- 206010058467 Lung neoplasm malignant Diseases 0.000 claims description 3
- 206010027406 Mesothelioma Diseases 0.000 claims description 3
- 206010033128 Ovarian cancer Diseases 0.000 claims description 3
- 206010061535 Ovarian neoplasm Diseases 0.000 claims description 3
- 206010061902 Pancreatic neoplasm Diseases 0.000 claims description 3
- 206010060862 Prostate cancer Diseases 0.000 claims description 3
- 208000000236 Prostatic Neoplasms Diseases 0.000 claims description 3
- 208000006265 Renal cell carcinoma Diseases 0.000 claims description 3
- 201000000582 Retinoblastoma Diseases 0.000 claims description 3
- 208000000453 Skin Neoplasms Diseases 0.000 claims description 3
- 208000005718 Stomach Neoplasms Diseases 0.000 claims description 3
- 102100035794 T-cell surface glycoprotein CD3 epsilon chain Human genes 0.000 claims description 3
- 102100036011 T-cell surface glycoprotein CD4 Human genes 0.000 claims description 3
- 208000024770 Thyroid neoplasm Diseases 0.000 claims description 3
- 230000000735 allogeneic effect Effects 0.000 claims description 3
- 206010017758 gastric cancer Diseases 0.000 claims description 3
- 208000005017 glioblastoma Diseases 0.000 claims description 3
- 201000010536 head and neck cancer Diseases 0.000 claims description 3
- 208000014829 head and neck neoplasm Diseases 0.000 claims description 3
- 208000014018 liver neoplasm Diseases 0.000 claims description 3
- 201000005202 lung cancer Diseases 0.000 claims description 3
- 208000020816 lung neoplasm Diseases 0.000 claims description 3
- 208000015486 malignant pancreatic neoplasm Diseases 0.000 claims description 3
- 201000008968 osteosarcoma Diseases 0.000 claims description 3
- 201000002528 pancreatic cancer Diseases 0.000 claims description 3
- 208000008443 pancreatic carcinoma Diseases 0.000 claims description 3
- 201000009410 rhabdomyosarcoma Diseases 0.000 claims description 3
- 201000000849 skin cancer Diseases 0.000 claims description 3
- 201000011549 stomach cancer Diseases 0.000 claims description 3
- 201000002510 thyroid cancer Diseases 0.000 claims description 3
- 201000009030 Carcinoma Diseases 0.000 claims description 2
- 102100021762 Phosphoserine phosphatase Human genes 0.000 claims description 2
- 206010039491 Sarcoma Diseases 0.000 claims description 2
- 230000006907 apoptotic process Effects 0.000 claims description 2
- 201000000053 blastoma Diseases 0.000 claims description 2
- 208000029742 colonic neoplasm Diseases 0.000 claims description 2
- 201000008184 embryoma Diseases 0.000 claims description 2
- 201000007270 liver cancer Diseases 0.000 claims description 2
- 108010076573 phosphoserine phosphatase Proteins 0.000 claims description 2
- 230000002483 superagonistic effect Effects 0.000 claims description 2
- 102000004473 OX40 Ligand Human genes 0.000 claims 4
- 102100020999 Argininosuccinate synthase Human genes 0.000 claims 2
- 101710161967 Argininosuccinate synthase 1 Proteins 0.000 claims 2
- 102100034671 L-lactate dehydrogenase A chain Human genes 0.000 claims 2
- 108010088350 Lactate Dehydrogenase 5 Proteins 0.000 claims 2
- 102000020018 Cystathionine gamma-Lyase Human genes 0.000 claims 1
- 208000017604 Hodgkin disease Diseases 0.000 claims 1
- 208000021519 Hodgkin lymphoma Diseases 0.000 claims 1
- 208000010747 Hodgkins lymphoma Diseases 0.000 claims 1
- 208000015914 Non-Hodgkin lymphomas Diseases 0.000 claims 1
- 108091008874 T cell receptors Proteins 0.000 abstract description 11
- 102000016266 T-Cell Antigen Receptors Human genes 0.000 abstract description 11
- 108090000623 proteins and genes Proteins 0.000 description 76
- 102000004169 proteins and genes Human genes 0.000 description 56
- 235000018102 proteins Nutrition 0.000 description 53
- 235000001014 amino acid Nutrition 0.000 description 50
- 229940024606 amino acid Drugs 0.000 description 46
- 150000001413 amino acids Chemical class 0.000 description 45
- 239000003814 drug Substances 0.000 description 45
- 230000014509 gene expression Effects 0.000 description 43
- 229940124597 therapeutic agent Drugs 0.000 description 42
- 108700019146 Transgenes Proteins 0.000 description 32
- 125000003275 alpha amino acid group Chemical group 0.000 description 32
- 230000000694 effects Effects 0.000 description 30
- 238000011282 treatment Methods 0.000 description 28
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 27
- 101800001494 Protease 2A Proteins 0.000 description 25
- 101800001066 Protein 2A Proteins 0.000 description 25
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 24
- 239000000203 mixture Substances 0.000 description 24
- JVTAAEKCZFNVCJ-UHFFFAOYSA-M Lactate Chemical compound CC(O)C([O-])=O JVTAAEKCZFNVCJ-UHFFFAOYSA-M 0.000 description 23
- 238000006243 chemical reaction Methods 0.000 description 22
- 108010087819 Fc receptors Proteins 0.000 description 21
- 102000009109 Fc receptors Human genes 0.000 description 21
- 230000006870 function Effects 0.000 description 21
- 238000009169 immunotherapy Methods 0.000 description 21
- 102220354910 c.4C>G Human genes 0.000 description 20
- 230000001965 increasing effect Effects 0.000 description 20
- 238000010361 transduction Methods 0.000 description 20
- 102000000588 Interleukin-2 Human genes 0.000 description 19
- 230000003915 cell function Effects 0.000 description 19
- 230000016396 cytokine production Effects 0.000 description 19
- 230000026683 transduction Effects 0.000 description 19
- 125000000539 amino acid group Chemical group 0.000 description 17
- 201000010099 disease Diseases 0.000 description 17
- 230000035772 mutation Effects 0.000 description 17
- 108091032973 (ribonucleotides)n+m Proteins 0.000 description 16
- 210000001744 T-lymphocyte Anatomy 0.000 description 16
- 101710203173 L-lactate dehydrogenase A Proteins 0.000 description 15
- 241000700605 Viruses Species 0.000 description 15
- 230000004190 glucose uptake Effects 0.000 description 15
- 230000002503 metabolic effect Effects 0.000 description 15
- 230000035755 proliferation Effects 0.000 description 15
- 239000003795 chemical substances by application Substances 0.000 description 14
- 238000002474 experimental method Methods 0.000 description 14
- 102100035429 Cystathionine gamma-lyase Human genes 0.000 description 13
- 108060003951 Immunoglobulin Proteins 0.000 description 13
- 230000002708 enhancing effect Effects 0.000 description 13
- 102000018358 immunoglobulin Human genes 0.000 description 13
- 210000001519 tissue Anatomy 0.000 description 13
- 102000053640 Argininosuccinate synthases Human genes 0.000 description 12
- 108700024106 Argininosuccinate synthases Proteins 0.000 description 12
- 101100508818 Mus musculus Inpp5k gene Proteins 0.000 description 12
- 101100366438 Rattus norvegicus Sphkap gene Proteins 0.000 description 12
- 102100026890 Tumor necrosis factor ligand superfamily member 4 Human genes 0.000 description 12
- 230000004663 cell proliferation Effects 0.000 description 12
- 238000004519 manufacturing process Methods 0.000 description 12
- 238000002560 therapeutic procedure Methods 0.000 description 12
- 210000004881 tumor cell Anatomy 0.000 description 12
- 102100029185 Low affinity immunoglobulin gamma Fc region receptor III-B Human genes 0.000 description 11
- 230000010056 antibody-dependent cellular cytotoxicity Effects 0.000 description 11
- 239000003112 inhibitor Substances 0.000 description 11
- 239000012528 membrane Substances 0.000 description 11
- 238000006467 substitution reaction Methods 0.000 description 11
- 102000004190 Enzymes Human genes 0.000 description 10
- 108090000790 Enzymes Proteins 0.000 description 10
- 101000917839 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-B Proteins 0.000 description 10
- 206010021143 Hypoxia Diseases 0.000 description 10
- 238000003556 assay Methods 0.000 description 10
- 210000004369 blood Anatomy 0.000 description 10
- 239000008280 blood Substances 0.000 description 10
- 208000035475 disorder Diseases 0.000 description 10
- 229940088598 enzyme Drugs 0.000 description 10
- 239000013604 expression vector Substances 0.000 description 10
- 150000002303 glucose derivatives Chemical class 0.000 description 10
- 230000001146 hypoxic effect Effects 0.000 description 10
- 230000003834 intracellular effect Effects 0.000 description 10
- 108020001756 ligand binding domains Proteins 0.000 description 10
- 239000006228 supernatant Substances 0.000 description 10
- 238000003786 synthesis reaction Methods 0.000 description 10
- 241000124008 Mammalia Species 0.000 description 9
- 230000000890 antigenic effect Effects 0.000 description 9
- 230000015572 biosynthetic process Effects 0.000 description 9
- 239000012636 effector Substances 0.000 description 9
- 238000003119 immunoblot Methods 0.000 description 9
- 238000011144 upstream manufacturing Methods 0.000 description 9
- YBJHBAHKTGYVGT-ZKWXMUAHSA-N (+)-Biotin Chemical compound N1C(=O)N[C@@H]2[C@H](CCCCC(=O)O)SC[C@@H]21 YBJHBAHKTGYVGT-ZKWXMUAHSA-N 0.000 description 8
- 102000004127 Cytokines Human genes 0.000 description 8
- 108090000695 Cytokines Proteins 0.000 description 8
- 101000917858 Homo sapiens Low affinity immunoglobulin gamma Fc region receptor III-A Proteins 0.000 description 8
- LCTONWCANYUPML-UHFFFAOYSA-M Pyruvate Chemical compound CC(=O)C([O-])=O LCTONWCANYUPML-UHFFFAOYSA-M 0.000 description 8
- RJURFGZVJUQBHK-UHFFFAOYSA-N actinomycin D Natural products CC1OC(=O)C(C(C)C)N(C)C(=O)CN(C)C(=O)C2CCCN2C(=O)C(C(C)C)NC(=O)C1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)NC4C(=O)NC(C(N5CCCC5C(=O)N(C)CC(=O)N(C)C(C(C)C)C(=O)OC4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-UHFFFAOYSA-N 0.000 description 8
- 230000000259 anti-tumor effect Effects 0.000 description 8
- 229940049595 antibody-drug conjugate Drugs 0.000 description 8
- 108020004999 messenger RNA Proteins 0.000 description 8
- 238000013519 translation Methods 0.000 description 8
- 230000004102 tricarboxylic acid cycle Effects 0.000 description 8
- 241000699666 Mus <mouse, genus> Species 0.000 description 7
- 230000003013 cytotoxicity Effects 0.000 description 7
- 231100000135 cytotoxicity Toxicity 0.000 description 7
- 238000004520 electroporation Methods 0.000 description 7
- 230000001939 inductive effect Effects 0.000 description 7
- 239000003446 ligand Substances 0.000 description 7
- 230000037361 pathway Effects 0.000 description 7
- 230000004083 survival effect Effects 0.000 description 7
- 241001663880 Gammaretrovirus Species 0.000 description 6
- 102100037850 Interferon gamma Human genes 0.000 description 6
- 108010074328 Interferon-gamma Proteins 0.000 description 6
- 101710173438 Late L2 mu core protein Proteins 0.000 description 6
- 239000000232 Lipid Bilayer Substances 0.000 description 6
- 241000283973 Oryctolagus cuniculus Species 0.000 description 6
- 101710188315 Protein X Proteins 0.000 description 6
- 102000006601 Thymidine Kinase Human genes 0.000 description 6
- 108020004440 Thymidine kinase Proteins 0.000 description 6
- 102100040245 Tumor necrosis factor receptor superfamily member 5 Human genes 0.000 description 6
- 238000013459 approach Methods 0.000 description 6
- 238000001516 cell proliferation assay Methods 0.000 description 6
- 238000003501 co-culture Methods 0.000 description 6
- 150000001875 compounds Chemical class 0.000 description 6
- 125000000151 cysteine group Chemical group N[C@@H](CS)C(=O)* 0.000 description 6
- 230000003247 decreasing effect Effects 0.000 description 6
- 230000012010 growth Effects 0.000 description 6
- 208000015181 infectious disease Diseases 0.000 description 6
- 239000000047 product Substances 0.000 description 6
- 102220080600 rs797046116 Human genes 0.000 description 6
- 230000000638 stimulation Effects 0.000 description 6
- 230000001052 transient effect Effects 0.000 description 6
- 210000003171 tumor-infiltrating lymphocyte Anatomy 0.000 description 6
- 101150013553 CD40 gene Proteins 0.000 description 5
- 102100032937 CD40 ligand Human genes 0.000 description 5
- 108091026890 Coding region Proteins 0.000 description 5
- 108010092160 Dactinomycin Proteins 0.000 description 5
- 102000003886 Glycoproteins Human genes 0.000 description 5
- 108090000288 Glycoproteins Proteins 0.000 description 5
- 241000713666 Lentivirus Species 0.000 description 5
- 230000003213 activating effect Effects 0.000 description 5
- 239000000872 buffer Substances 0.000 description 5
- 210000000170 cell membrane Anatomy 0.000 description 5
- 230000008859 change Effects 0.000 description 5
- 230000001684 chronic effect Effects 0.000 description 5
- 238000000684 flow cytometry Methods 0.000 description 5
- 230000004907 flux Effects 0.000 description 5
- 230000002209 hydrophobic effect Effects 0.000 description 5
- 229940072221 immunoglobulins Drugs 0.000 description 5
- 210000005008 immunosuppressive cell Anatomy 0.000 description 5
- 238000000338 in vitro Methods 0.000 description 5
- 230000006698 induction Effects 0.000 description 5
- 238000001802 infusion Methods 0.000 description 5
- 238000001990 intravenous administration Methods 0.000 description 5
- 208000032839 leukemia Diseases 0.000 description 5
- 238000005259 measurement Methods 0.000 description 5
- 230000001404 mediated effect Effects 0.000 description 5
- 230000002018 overexpression Effects 0.000 description 5
- 230000019491 signal transduction Effects 0.000 description 5
- 230000001988 toxicity Effects 0.000 description 5
- 231100000419 toxicity Toxicity 0.000 description 5
- 238000013518 transcription Methods 0.000 description 5
- 230000035897 transcription Effects 0.000 description 5
- 238000001890 transfection Methods 0.000 description 5
- IJGRMHOSHXDMSA-UHFFFAOYSA-N Atomic nitrogen Chemical compound N#N IJGRMHOSHXDMSA-UHFFFAOYSA-N 0.000 description 4
- 241000282693 Cercopithecidae Species 0.000 description 4
- 208000035473 Communicable disease Diseases 0.000 description 4
- CMSMOCZEIVJLDB-UHFFFAOYSA-N Cyclophosphamide Chemical compound ClCCN(CCCl)P1(=O)NCCCO1 CMSMOCZEIVJLDB-UHFFFAOYSA-N 0.000 description 4
- 101001103039 Homo sapiens Inactive tyrosine-protein kinase transmembrane receptor ROR1 Proteins 0.000 description 4
- 101001103036 Homo sapiens Nuclear receptor ROR-alpha Proteins 0.000 description 4
- 102100039615 Inactive tyrosine-protein kinase transmembrane receptor ROR1 Human genes 0.000 description 4
- 241000829100 Macaca mulatta polyomavirus 1 Species 0.000 description 4
- 102100036922 Tumor necrosis factor ligand superfamily member 13B Human genes 0.000 description 4
- RJURFGZVJUQBHK-IIXSONLDSA-N actinomycin D Chemical compound C[C@H]1OC(=O)[C@H](C(C)C)N(C)C(=O)CN(C)C(=O)[C@@H]2CCCN2C(=O)[C@@H](C(C)C)NC(=O)[C@H]1NC(=O)C1=C(N)C(=O)C(C)=C2OC(C(C)=CC=C3C(=O)N[C@@H]4C(=O)N[C@@H](C(N5CCC[C@H]5C(=O)N(C)CC(=O)N(C)[C@@H](C(C)C)C(=O)O[C@@H]4C)=O)C(C)C)=C3N=C21 RJURFGZVJUQBHK-IIXSONLDSA-N 0.000 description 4
- 230000008901 benefit Effects 0.000 description 4
- 229960002685 biotin Drugs 0.000 description 4
- 235000020958 biotin Nutrition 0.000 description 4
- 239000011616 biotin Substances 0.000 description 4
- 230000000903 blocking effect Effects 0.000 description 4
- 238000004113 cell culture Methods 0.000 description 4
- 230000010261 cell growth Effects 0.000 description 4
- 238000002659 cell therapy Methods 0.000 description 4
- 230000004186 co-expression Effects 0.000 description 4
- 108091008034 costimulatory receptors Proteins 0.000 description 4
- 229960000640 dactinomycin Drugs 0.000 description 4
- 230000001419 dependent effect Effects 0.000 description 4
- 238000010790 dilution Methods 0.000 description 4
- 239000012895 dilution Substances 0.000 description 4
- 229940079593 drug Drugs 0.000 description 4
- 238000001415 gene therapy Methods 0.000 description 4
- 230000013595 glycosylation Effects 0.000 description 4
- 238000006206 glycosylation reaction Methods 0.000 description 4
- 230000028993 immune response Effects 0.000 description 4
- 230000003993 interaction Effects 0.000 description 4
- 230000002829 reductive effect Effects 0.000 description 4
- 241000894007 species Species 0.000 description 4
- 239000000758 substrate Substances 0.000 description 4
- 208000024891 symptom Diseases 0.000 description 4
- 230000032258 transport Effects 0.000 description 4
- 230000001960 triggered effect Effects 0.000 description 4
- MTCFGRXMJLQNBG-REOHCLBHSA-N (2S)-2-Amino-3-hydroxypropansäure Chemical compound OC[C@H](N)C(O)=O MTCFGRXMJLQNBG-REOHCLBHSA-N 0.000 description 3
- STQGQHZAVUOBTE-UHFFFAOYSA-N 7-Cyan-hept-2t-en-4,6-diinsaeure Natural products C1=2C(O)=C3C(=O)C=4C(OC)=CC=CC=4C(=O)C3=C(O)C=2CC(O)(C(C)=O)CC1OC1CC(N)C(O)C(C)O1 STQGQHZAVUOBTE-UHFFFAOYSA-N 0.000 description 3
- 102100024222 B-lymphocyte antigen CD19 Human genes 0.000 description 3
- 102100025221 CD70 antigen Human genes 0.000 description 3
- 108010076667 Caspases Proteins 0.000 description 3
- 102000011727 Caspases Human genes 0.000 description 3
- 241000701022 Cytomegalovirus Species 0.000 description 3
- 102100039498 Cytotoxic T-lymphocyte protein 4 Human genes 0.000 description 3
- 108020004414 DNA Proteins 0.000 description 3
- 101710088194 Dehydrogenase Proteins 0.000 description 3
- 102100032530 Glypican-3 Human genes 0.000 description 3
- 208000009329 Graft vs Host Disease Diseases 0.000 description 3
- 101710154606 Hemagglutinin Proteins 0.000 description 3
- 101100056990 Homo sapiens ASS1 gene Proteins 0.000 description 3
- 101000980825 Homo sapiens B-lymphocyte antigen CD19 Proteins 0.000 description 3
- 101000868215 Homo sapiens CD40 ligand Proteins 0.000 description 3
- 101000651314 Homo sapiens Fructose-2,6-bisphosphatase TIGAR Proteins 0.000 description 3
- 101100489865 Homo sapiens GOT2 gene Proteins 0.000 description 3
- 101001014668 Homo sapiens Glypican-3 Proteins 0.000 description 3
- 101001012157 Homo sapiens Receptor tyrosine-protein kinase erbB-2 Proteins 0.000 description 3
- 101000738771 Homo sapiens Receptor-type tyrosine-protein phosphatase C Proteins 0.000 description 3
- 101000906283 Homo sapiens Solute carrier family 2, facilitated glucose transporter member 1 Proteins 0.000 description 3
- 101000679851 Homo sapiens Tumor necrosis factor receptor superfamily member 4 Proteins 0.000 description 3
- 101000851376 Homo sapiens Tumor necrosis factor receptor superfamily member 8 Proteins 0.000 description 3
- 108010073816 IgE Receptors Proteins 0.000 description 3
- 102000009438 IgE Receptors Human genes 0.000 description 3
- 108010017535 Interleukin-15 Receptors Proteins 0.000 description 3
- 102000004556 Interleukin-15 Receptors Human genes 0.000 description 3
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 3
- 108010064548 Lymphocyte Function-Associated Antigen-1 Proteins 0.000 description 3
- 208000031888 Mycoses Diseases 0.000 description 3
- 230000006051 NK cell activation Effects 0.000 description 3
- 101710093908 Outer capsid protein VP4 Proteins 0.000 description 3
- 101710135467 Outer capsid protein sigma-1 Proteins 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 229920001213 Polysorbate 20 Polymers 0.000 description 3
- 101710176177 Protein A56 Proteins 0.000 description 3
- 102100030086 Receptor tyrosine-protein kinase erbB-2 Human genes 0.000 description 3
- 102100037422 Receptor-type tyrosine-protein phosphatase C Human genes 0.000 description 3
- 241000701093 Suid alphaherpesvirus 1 Species 0.000 description 3
- 230000006044 T cell activation Effects 0.000 description 3
- 102100036857 Tumor necrosis factor receptor superfamily member 8 Human genes 0.000 description 3
- 108091008605 VEGF receptors Proteins 0.000 description 3
- 102000005789 Vascular Endothelial Growth Factors Human genes 0.000 description 3
- 108010019530 Vascular Endothelial Growth Factors Proteins 0.000 description 3
- 238000007792 addition Methods 0.000 description 3
- 230000002411 adverse Effects 0.000 description 3
- 230000002924 anti-infective effect Effects 0.000 description 3
- 230000001028 anti-proliverative effect Effects 0.000 description 3
- 239000000611 antibody drug conjugate Substances 0.000 description 3
- 239000002246 antineoplastic agent Substances 0.000 description 3
- 230000001413 cellular effect Effects 0.000 description 3
- 238000007796 conventional method Methods 0.000 description 3
- 229960004397 cyclophosphamide Drugs 0.000 description 3
- 210000000805 cytoplasm Anatomy 0.000 description 3
- 229960000975 daunorubicin Drugs 0.000 description 3
- STQGQHZAVUOBTE-VGBVRHCVSA-N daunorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(C)=O)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 STQGQHZAVUOBTE-VGBVRHCVSA-N 0.000 description 3
- 238000012217 deletion Methods 0.000 description 3
- 230000037430 deletion Effects 0.000 description 3
- 230000000779 depleting effect Effects 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- VJJPUSNTGOMMGY-MRVIYFEKSA-N etoposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@H](C)OC[C@H]4O3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 VJJPUSNTGOMMGY-MRVIYFEKSA-N 0.000 description 3
- 239000012997 ficoll-paque Substances 0.000 description 3
- 208000024908 graft versus host disease Diseases 0.000 description 3
- 239000000185 hemagglutinin Substances 0.000 description 3
- 201000005787 hematologic cancer Diseases 0.000 description 3
- 102000052191 human SLC2A1 Human genes 0.000 description 3
- 102000053064 human TIGAR Human genes 0.000 description 3
- 230000010354 integration Effects 0.000 description 3
- 230000000670 limiting effect Effects 0.000 description 3
- 230000037353 metabolic pathway Effects 0.000 description 3
- CFCUWKMKBJTWLW-BKHRDMLASA-N mithramycin Chemical compound O([C@@H]1C[C@@H](O[C@H](C)[C@H]1O)OC=1C=C2C=C3C[C@H]([C@@H](C(=O)C3=C(O)C2=C(O)C=1C)O[C@@H]1O[C@H](C)[C@@H](O)[C@H](O[C@@H]2O[C@H](C)[C@H](O)[C@H](O[C@@H]3O[C@H](C)[C@@H](O)[C@@](C)(O)C3)C2)C1)[C@H](OC)C(=O)[C@@H](O)[C@@H](C)O)[C@H]1C[C@@H](O)[C@H](O)[C@@H](C)O1 CFCUWKMKBJTWLW-BKHRDMLASA-N 0.000 description 3
- 229960001156 mitoxantrone Drugs 0.000 description 3
- KKZJGLLVHKMTCM-UHFFFAOYSA-N mitoxantrone Chemical compound O=C1C2=C(O)C=CC(O)=C2C(=O)C2=C1C(NCCNCCO)=CC=C2NCCNCCO KKZJGLLVHKMTCM-UHFFFAOYSA-N 0.000 description 3
- 238000010369 molecular cloning Methods 0.000 description 3
- 210000005087 mononuclear cell Anatomy 0.000 description 3
- 244000052769 pathogen Species 0.000 description 3
- 239000008188 pellet Substances 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 229960003171 plicamycin Drugs 0.000 description 3
- 102000054765 polymorphisms of proteins Human genes 0.000 description 3
- 102000040430 polynucleotide Human genes 0.000 description 3
- 108091033319 polynucleotide Proteins 0.000 description 3
- 239000002157 polynucleotide Substances 0.000 description 3
- 239000000256 polyoxyethylene sorbitan monolaurate Substances 0.000 description 3
- 235000010486 polyoxyethylene sorbitan monolaurate Nutrition 0.000 description 3
- 230000009257 reactivity Effects 0.000 description 3
- 230000004044 response Effects 0.000 description 3
- 229960001153 serine Drugs 0.000 description 3
- 230000009870 specific binding Effects 0.000 description 3
- 230000008685 targeting Effects 0.000 description 3
- MWWSFMDVAYGXBV-MYPASOLCSA-N (7r,9s)-7-[(2r,4s,5s,6s)-4-amino-5-hydroxy-6-methyloxan-2-yl]oxy-6,9,11-trihydroxy-9-(2-hydroxyacetyl)-4-methoxy-8,10-dihydro-7h-tetracene-5,12-dione;hydrochloride Chemical compound Cl.O([C@@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 MWWSFMDVAYGXBV-MYPASOLCSA-N 0.000 description 2
- AOJJSUZBOXZQNB-VTZDEGQISA-N 4'-epidoxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-VTZDEGQISA-N 0.000 description 2
- 239000004475 Arginine Substances 0.000 description 2
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 2
- 208000023275 Autoimmune disease Diseases 0.000 description 2
- 108090001008 Avidin Proteins 0.000 description 2
- 102100029822 B- and T-lymphocyte attenuator Human genes 0.000 description 2
- 108010028006 B-Cell Activating Factor Proteins 0.000 description 2
- 102100038080 B-cell receptor CD22 Human genes 0.000 description 2
- 241000894006 Bacteria Species 0.000 description 2
- 208000035143 Bacterial infection Diseases 0.000 description 2
- 108010006654 Bleomycin Proteins 0.000 description 2
- 102100040840 C-type lectin domain family 7 member A Human genes 0.000 description 2
- 102100038078 CD276 antigen Human genes 0.000 description 2
- 102000017420 CD3 protein, epsilon/gamma/delta subunit Human genes 0.000 description 2
- 108050005493 CD3 protein, epsilon/gamma/delta subunit Proteins 0.000 description 2
- 108010029697 CD40 Ligand Proteins 0.000 description 2
- 102100036008 CD48 antigen Human genes 0.000 description 2
- 108010021064 CTLA-4 Antigen Proteins 0.000 description 2
- 229940045513 CTLA4 antagonist Drugs 0.000 description 2
- KLWPJMFMVPTNCC-UHFFFAOYSA-N Camptothecin Natural products CCC1(O)C(=O)OCC2=C1C=C3C4Nc5ccccc5C=C4CN3C2=O KLWPJMFMVPTNCC-UHFFFAOYSA-N 0.000 description 2
- 101710132601 Capsid protein Proteins 0.000 description 2
- 102000014914 Carrier Proteins Human genes 0.000 description 2
- 206010008342 Cervix carcinoma Diseases 0.000 description 2
- PTOAARAWEBMLNO-KVQBGUIXSA-N Cladribine Chemical compound C1=NC=2C(N)=NC(Cl)=NC=2N1[C@H]1C[C@H](O)[C@@H](CO)O1 PTOAARAWEBMLNO-KVQBGUIXSA-N 0.000 description 2
- 108010047041 Complementarity Determining Regions Proteins 0.000 description 2
- 241000702421 Dependoparvovirus Species 0.000 description 2
- 102100025012 Dipeptidyl peptidase 4 Human genes 0.000 description 2
- AOJJSUZBOXZQNB-TZSSRYMLSA-N Doxorubicin Chemical compound O([C@H]1C[C@@](O)(CC=2C(O)=C3C(=O)C=4C=CC=C(C=4C(=O)C3=C(O)C=21)OC)C(=O)CO)[C@H]1C[C@H](N)[C@H](O)[C@H](C)O1 AOJJSUZBOXZQNB-TZSSRYMLSA-N 0.000 description 2
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 2
- 238000002965 ELISA Methods 0.000 description 2
- HTIJFSOGRVMCQR-UHFFFAOYSA-N Epirubicin Natural products COc1cccc2C(=O)c3c(O)c4CC(O)(CC(OC5CC(N)C(=O)C(C)O5)c4c(O)c3C(=O)c12)C(=O)CO HTIJFSOGRVMCQR-UHFFFAOYSA-N 0.000 description 2
- 102000018233 Fibroblast Growth Factor Human genes 0.000 description 2
- 108050007372 Fibroblast Growth Factor Proteins 0.000 description 2
- 102100035139 Folate receptor alpha Human genes 0.000 description 2
- YXWOAJXNVLXPMU-ZXXMMSQZSA-N Fructose 2,6-diphosphate Chemical compound OP(=O)(O)O[C@]1(CO)O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O YXWOAJXNVLXPMU-ZXXMMSQZSA-N 0.000 description 2
- 206010017533 Fungal infection Diseases 0.000 description 2
- 241000233866 Fungi Species 0.000 description 2
- 208000005577 Gastroenteritis Diseases 0.000 description 2
- 102100041003 Glutamate carboxypeptidase 2 Human genes 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 108060003393 Granulin Proteins 0.000 description 2
- HTTJABKRGRZYRN-UHFFFAOYSA-N Heparin Chemical compound OC1C(NC(=O)C)C(O)OC(COS(O)(=O)=O)C1OC1C(OS(O)(=O)=O)C(O)C(OC2C(C(OS(O)(=O)=O)C(OC3C(C(O)C(O)C(O3)C(O)=O)OS(O)(=O)=O)C(CO)O2)NS(O)(=O)=O)C(C(O)=O)O1 HTTJABKRGRZYRN-UHFFFAOYSA-N 0.000 description 2
- 208000009889 Herpes Simplex Diseases 0.000 description 2
- 241001559542 Hippocampus hippocampus Species 0.000 description 2
- 101000864344 Homo sapiens B- and T-lymphocyte attenuator Proteins 0.000 description 2
- 101000884305 Homo sapiens B-cell receptor CD22 Proteins 0.000 description 2
- 101000934356 Homo sapiens CD70 antigen Proteins 0.000 description 2
- 101100113079 Homo sapiens CTH gene Proteins 0.000 description 2
- 101001023230 Homo sapiens Folate receptor alpha Proteins 0.000 description 2
- 101000892862 Homo sapiens Glutamate carboxypeptidase 2 Proteins 0.000 description 2
- 101000878602 Homo sapiens Immunoglobulin alpha Fc receptor Proteins 0.000 description 2
- 101001090713 Homo sapiens L-lactate dehydrogenase A chain Proteins 0.000 description 2
- 101000946889 Homo sapiens Monocyte differentiation antigen CD14 Proteins 0.000 description 2
- 101100202991 Homo sapiens PSPH gene Proteins 0.000 description 2
- 101000633778 Homo sapiens SLAM family member 5 Proteins 0.000 description 2
- 101000633786 Homo sapiens SLAM family member 6 Proteins 0.000 description 2
- 101000633784 Homo sapiens SLAM family member 7 Proteins 0.000 description 2
- 101000633782 Homo sapiens SLAM family member 8 Proteins 0.000 description 2
- 101000633792 Homo sapiens SLAM family member 9 Proteins 0.000 description 2
- 101000914496 Homo sapiens T-cell antigen CD7 Proteins 0.000 description 2
- 101000934341 Homo sapiens T-cell surface glycoprotein CD5 Proteins 0.000 description 2
- 101000914484 Homo sapiens T-lymphocyte activation antigen CD80 Proteins 0.000 description 2
- 101000845170 Homo sapiens Thymic stromal lymphopoietin Proteins 0.000 description 2
- 101000638251 Homo sapiens Tumor necrosis factor ligand superfamily member 9 Proteins 0.000 description 2
- 101000795167 Homo sapiens Tumor necrosis factor receptor superfamily member 13B Proteins 0.000 description 2
- 101000679903 Homo sapiens Tumor necrosis factor receptor superfamily member 25 Proteins 0.000 description 2
- 101000666896 Homo sapiens V-type immunoglobulin domain-containing suppressor of T-cell activation Proteins 0.000 description 2
- 102100034980 ICOS ligand Human genes 0.000 description 2
- XDXDZDZNSLXDNA-TZNDIEGXSA-N Idarubicin Chemical compound C1[C@H](N)[C@H](O)[C@H](C)O[C@H]1O[C@@H]1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2C[C@@](O)(C(C)=O)C1 XDXDZDZNSLXDNA-TZNDIEGXSA-N 0.000 description 2
- XDXDZDZNSLXDNA-UHFFFAOYSA-N Idarubicin Natural products C1C(N)C(O)C(C)OC1OC1C2=C(O)C(C(=O)C3=CC=CC=C3C3=O)=C3C(O)=C2CC(O)(C(C)=O)C1 XDXDZDZNSLXDNA-UHFFFAOYSA-N 0.000 description 2
- 229940076838 Immune checkpoint inhibitor Drugs 0.000 description 2
- 108010021625 Immunoglobulin Fragments Proteins 0.000 description 2
- 102000008394 Immunoglobulin Fragments Human genes 0.000 description 2
- 102100038005 Immunoglobulin alpha Fc receptor Human genes 0.000 description 2
- 102100021317 Inducible T-cell costimulator Human genes 0.000 description 2
- 102100032818 Integrin alpha-4 Human genes 0.000 description 2
- FFEARJCKVFRZRR-BYPYZUCNSA-N L-methionine Chemical compound CSCC[C@H](N)C(O)=O FFEARJCKVFRZRR-BYPYZUCNSA-N 0.000 description 2
- COLNVLDHVKWLRT-QMMMGPOBSA-N L-phenylalanine Chemical compound OC(=O)[C@@H](N)CC1=CC=CC=C1 COLNVLDHVKWLRT-QMMMGPOBSA-N 0.000 description 2
- OUYCCCASQSFEME-QMMMGPOBSA-N L-tyrosine Chemical compound OC(=O)[C@@H](N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-QMMMGPOBSA-N 0.000 description 2
- KZSNJWFQEVHDMF-BYPYZUCNSA-N L-valine Chemical compound CC(C)[C@H](N)C(O)=O KZSNJWFQEVHDMF-BYPYZUCNSA-N 0.000 description 2
- 102000004083 Lymphotoxin-alpha Human genes 0.000 description 2
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 2
- 239000004472 Lysine Substances 0.000 description 2
- 101710175625 Maltose/maltodextrin-binding periplasmic protein Proteins 0.000 description 2
- 229930192392 Mitomycin Natural products 0.000 description 2
- 102100035877 Monocyte differentiation antigen CD14 Human genes 0.000 description 2
- 241001529936 Murinae Species 0.000 description 2
- 241000699670 Mus sp. Species 0.000 description 2
- NWIBSHFKIJFRCO-WUDYKRTCSA-N Mytomycin Chemical compound C1N2C(C(C(C)=C(N)C3=O)=O)=C3[C@@H](COC(N)=O)[C@@]2(OC)[C@@H]2[C@H]1N2 NWIBSHFKIJFRCO-WUDYKRTCSA-N 0.000 description 2
- ZDZOTLJHXYCWBA-VCVYQWHSSA-N N-debenzoyl-N-(tert-butoxycarbonyl)-10-deacetyltaxol Chemical compound O([C@H]1[C@H]2[C@@](C([C@H](O)C3=C(C)[C@@H](OC(=O)[C@H](O)[C@@H](NC(=O)OC(C)(C)C)C=4C=CC=CC=4)C[C@]1(O)C3(C)C)=O)(C)[C@@H](O)C[C@H]1OC[C@]12OC(=O)C)C(=O)C1=CC=CC=C1 ZDZOTLJHXYCWBA-VCVYQWHSSA-N 0.000 description 2
- 102100038082 Natural killer cell receptor 2B4 Human genes 0.000 description 2
- 108091028043 Nucleic acid sequence Proteins 0.000 description 2
- MSHZHSPISPJWHW-UHFFFAOYSA-N O-(chloroacetylcarbamoyl)fumagillol Chemical compound O1C(CC=C(C)C)C1(C)C1C(OC)C(OC(=O)NC(=O)CCl)CCC21CO2 MSHZHSPISPJWHW-UHFFFAOYSA-N 0.000 description 2
- 108700026244 Open Reading Frames Proteins 0.000 description 2
- 101710160107 Outer membrane protein A Proteins 0.000 description 2
- 229930012538 Paclitaxel Natural products 0.000 description 2
- 102100024216 Programmed cell death 1 ligand 1 Human genes 0.000 description 2
- 101710089372 Programmed cell death protein 1 Proteins 0.000 description 2
- 102000004022 Protein-Tyrosine Kinases Human genes 0.000 description 2
- 108090000412 Protein-Tyrosine Kinases Proteins 0.000 description 2
- 102000012751 Pyruvate Dehydrogenase Complex Human genes 0.000 description 2
- 108010090051 Pyruvate Dehydrogenase Complex Proteins 0.000 description 2
- 102100029216 SLAM family member 5 Human genes 0.000 description 2
- 102100029197 SLAM family member 6 Human genes 0.000 description 2
- 102100029198 SLAM family member 7 Human genes 0.000 description 2
- 102100029214 SLAM family member 8 Human genes 0.000 description 2
- 102100029196 SLAM family member 9 Human genes 0.000 description 2
- MTCFGRXMJLQNBG-UHFFFAOYSA-N Serine Natural products OCC(N)C(O)=O MTCFGRXMJLQNBG-UHFFFAOYSA-N 0.000 description 2
- 102100029215 Signaling lymphocytic activation molecule Human genes 0.000 description 2
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 2
- 102100027208 T-cell antigen CD7 Human genes 0.000 description 2
- 102100025244 T-cell surface glycoprotein CD5 Human genes 0.000 description 2
- 102100027222 T-lymphocyte activation antigen CD80 Human genes 0.000 description 2
- 102100033447 T-lymphocyte surface antigen Ly-9 Human genes 0.000 description 2
- NKANXQFJJICGDU-QPLCGJKRSA-N Tamoxifen Chemical compound C=1C=CC=CC=1C(/CC)=C(C=1C=CC(OCCN(C)C)=CC=1)/C1=CC=CC=C1 NKANXQFJJICGDU-QPLCGJKRSA-N 0.000 description 2
- 102100036407 Thioredoxin Human genes 0.000 description 2
- FOCVUCIESVLUNU-UHFFFAOYSA-N Thiotepa Chemical compound C1CN1P(N1CC1)(=S)N1CC1 FOCVUCIESVLUNU-UHFFFAOYSA-N 0.000 description 2
- 102100031294 Thymic stromal lymphopoietin Human genes 0.000 description 2
- 102000004887 Transforming Growth Factor beta Human genes 0.000 description 2
- 108090001012 Transforming Growth Factor beta Proteins 0.000 description 2
- 102100040247 Tumor necrosis factor Human genes 0.000 description 2
- 102100024587 Tumor necrosis factor ligand superfamily member 15 Human genes 0.000 description 2
- 102100032100 Tumor necrosis factor ligand superfamily member 8 Human genes 0.000 description 2
- 102100029675 Tumor necrosis factor receptor superfamily member 13B Human genes 0.000 description 2
- 102100033733 Tumor necrosis factor receptor superfamily member 1B Human genes 0.000 description 2
- 102100022203 Tumor necrosis factor receptor superfamily member 25 Human genes 0.000 description 2
- 102100038282 V-type immunoglobulin domain-containing suppressor of T-cell activation Human genes 0.000 description 2
- KZSNJWFQEVHDMF-UHFFFAOYSA-N Valine Natural products CC(C)C(N)C(O)=O KZSNJWFQEVHDMF-UHFFFAOYSA-N 0.000 description 2
- JXLYSJRDGCGARV-WWYNWVTFSA-N Vinblastine Natural products O=C(O[C@H]1[C@](O)(C(=O)OC)[C@@H]2N(C)c3c(cc(c(OC)c3)[C@]3(C(=O)OC)c4[nH]c5c(c4CCN4C[C@](O)(CC)C[C@H](C3)C4)cccc5)[C@@]32[C@H]2[C@@]1(CC)C=CCN2CC3)C JXLYSJRDGCGARV-WWYNWVTFSA-N 0.000 description 2
- 208000036142 Viral infection Diseases 0.000 description 2
- 108010017070 Zinc Finger Nucleases Proteins 0.000 description 2
- ZSLZBFCDCINBPY-ZSJPKINUSA-N acetyl-CoA Chemical compound O[C@@H]1[C@H](OP(O)(O)=O)[C@@H](COP(O)(=O)OP(O)(=O)OCC(C)(C)[C@@H](O)C(=O)NCCC(=O)NCCSC(=O)C)O[C@H]1N1C2=NC=NC(N)=C2N=C1 ZSLZBFCDCINBPY-ZSJPKINUSA-N 0.000 description 2
- 239000012190 activator Substances 0.000 description 2
- 239000004480 active ingredient Substances 0.000 description 2
- 239000013543 active substance Substances 0.000 description 2
- 230000000996 additive effect Effects 0.000 description 2
- OIRDTQYFTABQOQ-KQYNXXCUSA-N adenosine Chemical compound C1=NC=2C(N)=NC=NC=2N1[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O OIRDTQYFTABQOQ-KQYNXXCUSA-N 0.000 description 2
- 229960000473 altretamine Drugs 0.000 description 2
- 229960001220 amsacrine Drugs 0.000 description 2
- XCPGHVQEEXUHNC-UHFFFAOYSA-N amsacrine Chemical compound COC1=CC(NS(C)(=O)=O)=CC=C1NC1=C(C=CC=C2)C2=NC2=CC=CC=C12 XCPGHVQEEXUHNC-UHFFFAOYSA-N 0.000 description 2
- 238000004458 analytical method Methods 0.000 description 2
- 229940045799 anthracyclines and related substance Drugs 0.000 description 2
- 230000001093 anti-cancer Effects 0.000 description 2
- 230000002927 anti-mitotic effect Effects 0.000 description 2
- 210000000612 antigen-presenting cell Anatomy 0.000 description 2
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 2
- 229960001230 asparagine Drugs 0.000 description 2
- VSRXQHXAPYXROS-UHFFFAOYSA-N azanide;cyclobutane-1,1-dicarboxylic acid;platinum(2+) Chemical compound [NH2-].[NH2-].[Pt+2].OC(=O)C1(C(O)=O)CCC1 VSRXQHXAPYXROS-UHFFFAOYSA-N 0.000 description 2
- 208000022362 bacterial infectious disease Diseases 0.000 description 2
- 239000011230 binding agent Substances 0.000 description 2
- 108091008324 binding proteins Proteins 0.000 description 2
- 230000033228 biological regulation Effects 0.000 description 2
- 229960001561 bleomycin Drugs 0.000 description 2
- OYVAGSVQBOHSSS-UAPAGMARSA-O bleomycin A2 Chemical compound N([C@H](C(=O)N[C@H](C)[C@@H](O)[C@H](C)C(=O)N[C@@H]([C@H](O)C)C(=O)NCCC=1SC=C(N=1)C=1SC=C(N=1)C(=O)NCCC[S+](C)C)[C@@H](O[C@H]1[C@H]([C@@H](O)[C@H](O)[C@H](CO)O1)O[C@@H]1[C@H]([C@@H](OC(N)=O)[C@H](O)[C@@H](CO)O1)O)C=1N=CNC=1)C(=O)C1=NC([C@H](CC(N)=O)NC[C@H](N)C(N)=O)=NC(N)=C1C OYVAGSVQBOHSSS-UAPAGMARSA-O 0.000 description 2
- 229960002092 busulfan Drugs 0.000 description 2
- 210000004899 c-terminal region Anatomy 0.000 description 2
- 229940127093 camptothecin Drugs 0.000 description 2
- VSJKWCGYPAHWDS-FQEVSTJZSA-N camptothecin Chemical compound C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-FQEVSTJZSA-N 0.000 description 2
- 150000001720 carbohydrates Chemical class 0.000 description 2
- 235000014633 carbohydrates Nutrition 0.000 description 2
- 229960004562 carboplatin Drugs 0.000 description 2
- 230000020411 cell activation Effects 0.000 description 2
- 239000006143 cell culture medium Substances 0.000 description 2
- 229960004630 chlorambucil Drugs 0.000 description 2
- JCKYGMPEJWAADB-UHFFFAOYSA-N chlorambucil Chemical compound OC(=O)CCCC1=CC=C(N(CCCl)CCCl)C=C1 JCKYGMPEJWAADB-UHFFFAOYSA-N 0.000 description 2
- DQLATGHUWYMOKM-UHFFFAOYSA-L cisplatin Chemical compound N[Pt](N)(Cl)Cl DQLATGHUWYMOKM-UHFFFAOYSA-L 0.000 description 2
- 229960004316 cisplatin Drugs 0.000 description 2
- 238000003776 cleavage reaction Methods 0.000 description 2
- 238000010367 cloning Methods 0.000 description 2
- 238000011284 combination treatment Methods 0.000 description 2
- 230000000295 complement effect Effects 0.000 description 2
- 210000004443 dendritic cell Anatomy 0.000 description 2
- 239000003599 detergent Substances 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 229950006137 dexfosfoserine Drugs 0.000 description 2
- 230000004069 differentiation Effects 0.000 description 2
- 238000010494 dissociation reaction Methods 0.000 description 2
- 230000005593 dissociations Effects 0.000 description 2
- VSJKWCGYPAHWDS-UHFFFAOYSA-N dl-camptothecin Natural products C1=CC=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)C5(O)CC)C4=NC2=C1 VSJKWCGYPAHWDS-UHFFFAOYSA-N 0.000 description 2
- 229960003668 docetaxel Drugs 0.000 description 2
- 238000005516 engineering process Methods 0.000 description 2
- 102000052116 epidermal growth factor receptor activity proteins Human genes 0.000 description 2
- 108700015053 epidermal growth factor receptor activity proteins Proteins 0.000 description 2
- 229960001904 epirubicin Drugs 0.000 description 2
- 229960005420 etoposide Drugs 0.000 description 2
- 210000003527 eukaryotic cell Anatomy 0.000 description 2
- 229940126864 fibroblast growth factor Drugs 0.000 description 2
- 239000003102 growth factor Substances 0.000 description 2
- 230000036541 health Effects 0.000 description 2
- 206010073071 hepatocellular carcinoma Diseases 0.000 description 2
- UUVWYPNAQBNQJQ-UHFFFAOYSA-N hexamethylmelamine Chemical compound CN(C)C1=NC(N(C)C)=NC(N(C)C)=N1 UUVWYPNAQBNQJQ-UHFFFAOYSA-N 0.000 description 2
- 102000055848 human LDHA Human genes 0.000 description 2
- 102000048810 human PDK1 Human genes 0.000 description 2
- JYGXADMDTFJGBT-VWUMJDOOSA-N hydrocortisone Chemical compound O=C1CC[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 JYGXADMDTFJGBT-VWUMJDOOSA-N 0.000 description 2
- 238000002169 hydrotherapy Methods 0.000 description 2
- 229960000908 idarubicin Drugs 0.000 description 2
- 230000002519 immonomodulatory effect Effects 0.000 description 2
- 210000000987 immune system Anatomy 0.000 description 2
- 239000012274 immune-checkpoint protein inhibitor Substances 0.000 description 2
- 239000002955 immunomodulating agent Substances 0.000 description 2
- 239000000411 inducer Substances 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- PGHMRUGBZOYCAA-UHFFFAOYSA-N ionomycin Natural products O1C(CC(O)C(C)C(O)C(C)C=CCC(C)CC(C)C(O)=CC(=O)C(C)CC(C)CC(CCC(O)=O)C)CCC1(C)C1OC(C)(C(C)O)CC1 PGHMRUGBZOYCAA-UHFFFAOYSA-N 0.000 description 2
- PGHMRUGBZOYCAA-ADZNBVRBSA-N ionomycin Chemical compound O1[C@H](C[C@H](O)[C@H](C)[C@H](O)[C@H](C)/C=C/C[C@@H](C)C[C@@H](C)C(/O)=C/C(=O)[C@@H](C)C[C@@H](C)C[C@@H](CCC(O)=O)C)CC[C@@]1(C)[C@@H]1O[C@](C)([C@@H](C)O)CC1 PGHMRUGBZOYCAA-ADZNBVRBSA-N 0.000 description 2
- YGPSJZOEDVAXAB-UHFFFAOYSA-N kynurenine Chemical compound OC(=O)C(N)CC(=O)C1=CC=CC=C1N YGPSJZOEDVAXAB-UHFFFAOYSA-N 0.000 description 2
- 239000007788 liquid Substances 0.000 description 2
- 230000033001 locomotion Effects 0.000 description 2
- 238000004020 luminiscence type Methods 0.000 description 2
- 210000004698 lymphocyte Anatomy 0.000 description 2
- 229960001924 melphalan Drugs 0.000 description 2
- SGDBTWWWUNNDEQ-LBPRGKRZSA-N melphalan Chemical compound OC(=O)[C@@H](N)CC1=CC=C(N(CCCl)CCCl)C=C1 SGDBTWWWUNNDEQ-LBPRGKRZSA-N 0.000 description 2
- 229930182817 methionine Natural products 0.000 description 2
- 230000003278 mimic effect Effects 0.000 description 2
- 229960004857 mitomycin Drugs 0.000 description 2
- YOHYSYJDKVYCJI-UHFFFAOYSA-N n-[3-[[6-[3-(trifluoromethyl)anilino]pyrimidin-4-yl]amino]phenyl]cyclopropanecarboxamide Chemical compound FC(F)(F)C1=CC=CC(NC=2N=CN=C(NC=3C=C(NC(=O)C4CC4)C=CC=3)C=2)=C1 YOHYSYJDKVYCJI-UHFFFAOYSA-N 0.000 description 2
- 229910052757 nitrogen Inorganic materials 0.000 description 2
- 230000036284 oxygen consumption Effects 0.000 description 2
- 238000004806 packaging method and process Methods 0.000 description 2
- 229960001592 paclitaxel Drugs 0.000 description 2
- COLNVLDHVKWLRT-UHFFFAOYSA-N phenylalanine Natural products OC(=O)C(N)CC1=CC=CC=C1 COLNVLDHVKWLRT-UHFFFAOYSA-N 0.000 description 2
- 230000026731 phosphorylation Effects 0.000 description 2
- 238000006366 phosphorylation reaction Methods 0.000 description 2
- BZQFBWGGLXLEPQ-REOHCLBHSA-N phosphoserine Chemical compound OC(=O)[C@@H](N)COP(O)(O)=O BZQFBWGGLXLEPQ-REOHCLBHSA-N 0.000 description 2
- BASFCYQUMIYNBI-UHFFFAOYSA-N platinum Chemical compound [Pt] BASFCYQUMIYNBI-UHFFFAOYSA-N 0.000 description 2
- 229920001481 poly(stearyl methacrylate) Polymers 0.000 description 2
- 230000027317 positive regulation of immune response Effects 0.000 description 2
- CPTBDICYNRMXFX-UHFFFAOYSA-N procarbazine Chemical compound CNNCC1=CC=C(C(=O)NC(C)C)C=C1 CPTBDICYNRMXFX-UHFFFAOYSA-N 0.000 description 2
- 229960000624 procarbazine Drugs 0.000 description 2
- 238000012545 processing Methods 0.000 description 2
- ZAHRKKWIAAJSAO-UHFFFAOYSA-N rapamycin Natural products COCC(O)C(=C/C(C)C(=O)CC(OC(=O)C1CCCCN1C(=O)C(=O)C2(O)OC(CC(OC)C(=CC=CC=CC(C)CC(C)C(=O)C)C)CCC2C)C(C)CC3CCC(O)C(C3)OC)C ZAHRKKWIAAJSAO-UHFFFAOYSA-N 0.000 description 2
- 230000008707 rearrangement Effects 0.000 description 2
- 230000001105 regulatory effect Effects 0.000 description 2
- 230000010076 replication Effects 0.000 description 2
- 238000011160 research Methods 0.000 description 2
- 230000002441 reversible effect Effects 0.000 description 2
- 230000007017 scission Effects 0.000 description 2
- 230000028327 secretion Effects 0.000 description 2
- 229960002930 sirolimus Drugs 0.000 description 2
- QFJCIRLUMZQUOT-HPLJOQBZSA-N sirolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1C[C@@H](C)[C@H]1OC(=O)[C@@H]2CCCCN2C(=O)C(=O)[C@](O)(O2)[C@H](C)CC[C@H]2C[C@H](OC)/C(C)=C/C=C/C=C/[C@@H](C)C[C@@H](C)C(=O)[C@H](OC)[C@H](O)/C(C)=C/[C@@H](C)C(=O)C1 QFJCIRLUMZQUOT-HPLJOQBZSA-N 0.000 description 2
- 239000007787 solid Substances 0.000 description 2
- 238000010186 staining Methods 0.000 description 2
- 239000000021 stimulant Substances 0.000 description 2
- 230000001502 supplementing effect Effects 0.000 description 2
- RCINICONZNJXQF-MZXODVADSA-N taxol Chemical compound O([C@@H]1[C@@]2(C[C@@H](C(C)=C(C2(C)C)[C@H](C([C@]2(C)[C@@H](O)C[C@H]3OC[C@]3([C@H]21)OC(C)=O)=O)OC(=O)C)OC(=O)[C@H](O)[C@@H](NC(=O)C=1C=CC=CC=1)C=1C=CC=CC=1)O)C(=O)C1=CC=CC=C1 RCINICONZNJXQF-MZXODVADSA-N 0.000 description 2
- NRUKOCRGYNPUPR-QBPJDGROSA-N teniposide Chemical compound COC1=C(O)C(OC)=CC([C@@H]2C3=CC=4OCOC=4C=C3[C@@H](O[C@H]3[C@@H]([C@@H](O)[C@@H]4O[C@@H](OC[C@H]4O3)C=3SC=CC=3)O)[C@@H]3[C@@H]2C(OC3)=O)=C1 NRUKOCRGYNPUPR-QBPJDGROSA-N 0.000 description 2
- 229960001278 teniposide Drugs 0.000 description 2
- 238000012360 testing method Methods 0.000 description 2
- 108060008226 thioredoxin Proteins 0.000 description 2
- WYWHKKSPHMUBEB-UHFFFAOYSA-N tioguanine Chemical compound N1C(N)=NC(=S)C2=C1N=CN2 WYWHKKSPHMUBEB-UHFFFAOYSA-N 0.000 description 2
- 238000012546 transfer Methods 0.000 description 2
- OUYCCCASQSFEME-UHFFFAOYSA-N tyrosine Natural products OC(=O)C(N)CC1=CC=C(O)C=C1 OUYCCCASQSFEME-UHFFFAOYSA-N 0.000 description 2
- 241001430294 unidentified retrovirus Species 0.000 description 2
- 239000004474 valine Substances 0.000 description 2
- 229960003048 vinblastine Drugs 0.000 description 2
- JXLYSJRDGCGARV-XQKSVPLYSA-N vincaleukoblastine Chemical compound C([C@@H](C[C@]1(C(=O)OC)C=2C(=CC3=C([C@]45[C@H]([C@@]([C@H](OC(C)=O)[C@]6(CC)C=CCN([C@H]56)CC4)(O)C(=O)OC)N3C)C=2)OC)C[C@@](C2)(O)CC)N2CCC2=C1NC1=CC=CC=C21 JXLYSJRDGCGARV-XQKSVPLYSA-N 0.000 description 2
- 229960004528 vincristine Drugs 0.000 description 2
- OGWKCGZFUXNPDA-UHFFFAOYSA-N vincristine Natural products C1C(CC)(O)CC(CC2(C(=O)OC)C=3C(=CC4=C(C56C(C(C(OC(C)=O)C7(CC)C=CCN(C67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)CN1CCC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-UHFFFAOYSA-N 0.000 description 2
- OGWKCGZFUXNPDA-XQKSVPLYSA-N vincristine Chemical compound C([N@]1C[C@@H](C[C@]2(C(=O)OC)C=3C(=CC4=C([C@]56[C@H]([C@@]([C@H](OC(C)=O)[C@]7(CC)C=CCN([C@H]67)CC5)(O)C(=O)OC)N4C=O)C=3)OC)C[C@@](C1)(O)CC)CC1=C2NC2=CC=CC=C12 OGWKCGZFUXNPDA-XQKSVPLYSA-N 0.000 description 2
- 230000009385 viral infection Effects 0.000 description 2
- 238000001262 western blot Methods 0.000 description 2
- GRZXWCHAXNAUHY-NSISKUIASA-N (2S)-2-(4-chlorophenyl)-1-[4-[(5R,7R)-7-hydroxy-5-methyl-6,7-dihydro-5H-cyclopenta[d]pyrimidin-4-yl]-1-piperazinyl]-3-(propan-2-ylamino)-1-propanone Chemical compound C1([C@H](C(=O)N2CCN(CC2)C=2C=3[C@H](C)C[C@@H](O)C=3N=CN=2)CNC(C)C)=CC=C(Cl)C=C1 GRZXWCHAXNAUHY-NSISKUIASA-N 0.000 description 1
- JPSHPWJJSVEEAX-OWPBQMJCSA-N (2s)-2-amino-4-fluoranylpentanedioic acid Chemical compound OC(=O)[C@@H](N)CC([18F])C(O)=O JPSHPWJJSVEEAX-OWPBQMJCSA-N 0.000 description 1
- AUXMWYRZQPIXCC-KNIFDHDWSA-N (2s)-2-amino-4-methylpentanoic acid;(2s)-2-aminopropanoic acid Chemical group C[C@H](N)C(O)=O.CC(C)C[C@H](N)C(O)=O AUXMWYRZQPIXCC-KNIFDHDWSA-N 0.000 description 1
- MZOFCQQQCNRIBI-VMXHOPILSA-N (3s)-4-[[(2s)-1-[[(2s)-1-[[(1s)-1-carboxy-2-hydroxyethyl]amino]-4-methyl-1-oxopentan-2-yl]amino]-5-(diaminomethylideneamino)-1-oxopentan-2-yl]amino]-3-[[2-[[(2s)-2,6-diaminohexanoyl]amino]acetyl]amino]-4-oxobutanoic acid Chemical compound OC[C@@H](C(O)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H](CCCN=C(N)N)NC(=O)[C@H](CC(O)=O)NC(=O)CNC(=O)[C@@H](N)CCCCN MZOFCQQQCNRIBI-VMXHOPILSA-N 0.000 description 1
- FPVKHBSQESCIEP-UHFFFAOYSA-N (8S)-3-(2-deoxy-beta-D-erythro-pentofuranosyl)-3,6,7,8-tetrahydroimidazo[4,5-d][1,3]diazepin-8-ol Natural products C1C(O)C(CO)OC1N1C(NC=NCC2O)=C2N=C1 FPVKHBSQESCIEP-UHFFFAOYSA-N 0.000 description 1
- FDKXTQMXEQVLRF-ZHACJKMWSA-N (E)-dacarbazine Chemical compound CN(C)\N=N\c1[nH]cnc1C(N)=O FDKXTQMXEQVLRF-ZHACJKMWSA-N 0.000 description 1
- LKJPYSCBVHEWIU-KRWDZBQOSA-N (R)-bicalutamide Chemical compound C([C@@](O)(C)C(=O)NC=1C=C(C(C#N)=CC=1)C(F)(F)F)S(=O)(=O)C1=CC=C(F)C=C1 LKJPYSCBVHEWIU-KRWDZBQOSA-N 0.000 description 1
- 102100025573 1-alkyl-2-acetylglycerophosphocholine esterase Human genes 0.000 description 1
- VSNHCAURESNICA-NJFSPNSNSA-N 1-oxidanylurea Chemical compound N[14C](=O)NO VSNHCAURESNICA-NJFSPNSNSA-N 0.000 description 1
- FUFLCEKSBBHCMO-UHFFFAOYSA-N 11-dehydrocorticosterone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)C(=O)CO)C4C3CCC2=C1 FUFLCEKSBBHCMO-UHFFFAOYSA-N 0.000 description 1
- JKMHFZQWWAIEOD-UHFFFAOYSA-N 2-[4-(2-hydroxyethyl)piperazin-1-yl]ethanesulfonic acid Chemical compound OCC[NH+]1CCN(CCS([O-])(=O)=O)CC1 JKMHFZQWWAIEOD-UHFFFAOYSA-N 0.000 description 1
- BGFTWECWAICPDG-UHFFFAOYSA-N 2-[bis(4-chlorophenyl)methyl]-4-n-[3-[bis(4-chlorophenyl)methyl]-4-(dimethylamino)phenyl]-1-n,1-n-dimethylbenzene-1,4-diamine Chemical compound C1=C(C(C=2C=CC(Cl)=CC=2)C=2C=CC(Cl)=CC=2)C(N(C)C)=CC=C1NC(C=1)=CC=C(N(C)C)C=1C(C=1C=CC(Cl)=CC=1)C1=CC=C(Cl)C=C1 BGFTWECWAICPDG-UHFFFAOYSA-N 0.000 description 1
- AXAVXPMQTGXXJZ-UHFFFAOYSA-N 2-aminoacetic acid;2-amino-2-(hydroxymethyl)propane-1,3-diol Chemical compound NCC(O)=O.OCC(N)(CO)CO AXAVXPMQTGXXJZ-UHFFFAOYSA-N 0.000 description 1
- CTRPRMNBTVRDFH-UHFFFAOYSA-N 2-n-methyl-1,3,5-triazine-2,4,6-triamine Chemical class CNC1=NC(N)=NC(N)=N1 CTRPRMNBTVRDFH-UHFFFAOYSA-N 0.000 description 1
- FWMNVWWHGCHHJJ-SKKKGAJSSA-N 4-amino-1-[(2r)-6-amino-2-[[(2r)-2-[[(2r)-2-[[(2r)-2-amino-3-phenylpropanoyl]amino]-3-phenylpropanoyl]amino]-4-methylpentanoyl]amino]hexanoyl]piperidine-4-carboxylic acid Chemical compound C([C@H](C(=O)N[C@H](CC(C)C)C(=O)N[C@H](CCCCN)C(=O)N1CCC(N)(CC1)C(O)=O)NC(=O)[C@H](N)CC=1C=CC=CC=1)C1=CC=CC=C1 FWMNVWWHGCHHJJ-SKKKGAJSSA-N 0.000 description 1
- JDUBGYFRJFOXQC-KRWDZBQOSA-N 4-amino-n-[(1s)-1-(4-chlorophenyl)-3-hydroxypropyl]-1-(7h-pyrrolo[2,3-d]pyrimidin-4-yl)piperidine-4-carboxamide Chemical compound C1([C@H](CCO)NC(=O)C2(CCN(CC2)C=2C=3C=CNC=3N=CN=2)N)=CC=C(Cl)C=C1 JDUBGYFRJFOXQC-KRWDZBQOSA-N 0.000 description 1
- 102100033400 4F2 cell-surface antigen heavy chain Human genes 0.000 description 1
- 102100023990 60S ribosomal protein L17 Human genes 0.000 description 1
- HWUHTJIKQZZBRA-UHFFFAOYSA-N 8-[4-(1-aminocyclobutyl)phenyl]-9-phenyl-2h-[1,2,4]triazolo[3,4-f][1,6]naphthyridin-3-one;dihydrochloride Chemical compound Cl.Cl.C=1C=C(C=2C(=CC=3C=4N(C(NN=4)=O)C=CC=3N=2)C=2C=CC=CC=2)C=CC=1C1(N)CCC1 HWUHTJIKQZZBRA-UHFFFAOYSA-N 0.000 description 1
- 239000013607 AAV vector Substances 0.000 description 1
- 102000007469 Actins Human genes 0.000 description 1
- 108010085238 Actins Proteins 0.000 description 1
- 208000024893 Acute lymphoblastic leukemia Diseases 0.000 description 1
- 208000014697 Acute lymphocytic leukaemia Diseases 0.000 description 1
- 241000710929 Alphavirus Species 0.000 description 1
- 102000012936 Angiostatins Human genes 0.000 description 1
- 108010079709 Angiostatins Proteins 0.000 description 1
- 108020000948 Antisense Oligonucleotides Proteins 0.000 description 1
- 108020005544 Antisense RNA Proteins 0.000 description 1
- 108091023037 Aptamer Proteins 0.000 description 1
- 101001120734 Ascaris suum Pyruvate dehydrogenase E1 component subunit alpha type I, mitochondrial Proteins 0.000 description 1
- 108010024976 Asparaginase Proteins 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- BSYNRYMUTXBXSQ-UHFFFAOYSA-N Aspirin Chemical compound CC(=O)OC1=CC=CC=C1C(O)=O BSYNRYMUTXBXSQ-UHFFFAOYSA-N 0.000 description 1
- NOWKCMXCCJGMRR-UHFFFAOYSA-N Aziridine Chemical class C1CN1 NOWKCMXCCJGMRR-UHFFFAOYSA-N 0.000 description 1
- 102000006942 B-Cell Maturation Antigen Human genes 0.000 description 1
- 108010008014 B-Cell Maturation Antigen Proteins 0.000 description 1
- 208000010839 B-cell chronic lymphocytic leukemia Diseases 0.000 description 1
- 208000028564 B-cell non-Hodgkin lymphoma Diseases 0.000 description 1
- 102100022005 B-lymphocyte antigen CD20 Human genes 0.000 description 1
- 239000005552 B01AC04 - Clopidogrel Substances 0.000 description 1
- 239000005528 B01AC05 - Ticlopidine Substances 0.000 description 1
- 108010074708 B7-H1 Antigen Proteins 0.000 description 1
- 108010077805 Bacterial Proteins Proteins 0.000 description 1
- 102100021663 Baculoviral IAP repeat-containing protein 5 Human genes 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- 239000002126 C01EB10 - Adenosine Substances 0.000 description 1
- 108700012439 CA9 Proteins 0.000 description 1
- 102100024263 CD160 antigen Human genes 0.000 description 1
- 108010046080 CD27 Ligand Proteins 0.000 description 1
- 101710185679 CD276 antigen Proteins 0.000 description 1
- 108010017987 CD30 Ligand Proteins 0.000 description 1
- 108010038940 CD48 Antigen Proteins 0.000 description 1
- 108010084313 CD58 Antigens Proteins 0.000 description 1
- 102100027217 CD82 antigen Human genes 0.000 description 1
- 102100037904 CD9 antigen Human genes 0.000 description 1
- 108091033409 CRISPR Proteins 0.000 description 1
- 238000010354 CRISPR gene editing Methods 0.000 description 1
- 101100510617 Caenorhabditis elegans sel-8 gene Proteins 0.000 description 1
- GAGWJHPBXLXJQN-UORFTKCHSA-N Capecitabine Chemical compound C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1[C@H]1[C@H](O)[C@H](O)[C@@H](C)O1 GAGWJHPBXLXJQN-UORFTKCHSA-N 0.000 description 1
- GAGWJHPBXLXJQN-UHFFFAOYSA-N Capecitabine Natural products C1=C(F)C(NC(=O)OCCCCC)=NC(=O)N1C1C(O)C(O)C(C)O1 GAGWJHPBXLXJQN-UHFFFAOYSA-N 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- 101710197658 Capsid protein VP1 Proteins 0.000 description 1
- 102100024423 Carbonic anhydrase 9 Human genes 0.000 description 1
- DLGOEMSEDOSKAD-UHFFFAOYSA-N Carmustine Chemical compound ClCCNC(=O)N(N=O)CCCl DLGOEMSEDOSKAD-UHFFFAOYSA-N 0.000 description 1
- 102100026548 Caspase-8 Human genes 0.000 description 1
- 108090000538 Caspase-8 Proteins 0.000 description 1
- 102100026550 Caspase-9 Human genes 0.000 description 1
- 108090000566 Caspase-9 Proteins 0.000 description 1
- 229940123587 Cell cycle inhibitor Drugs 0.000 description 1
- 241000606161 Chlamydia Species 0.000 description 1
- JWBOIMRXGHLCPP-UHFFFAOYSA-N Chloditan Chemical compound C=1C=CC=C(Cl)C=1C(C(Cl)Cl)C1=CC=C(Cl)C=C1 JWBOIMRXGHLCPP-UHFFFAOYSA-N 0.000 description 1
- 108010077544 Chromatin Proteins 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- 102100031162 Collagen alpha-1(XVIII) chain Human genes 0.000 description 1
- 208000001333 Colorectal Neoplasms Diseases 0.000 description 1
- 206010010144 Completed suicide Diseases 0.000 description 1
- 241000711573 Coronaviridae Species 0.000 description 1
- MFYSYFVPBJMHGN-UHFFFAOYSA-N Cortisone Natural products O=C1CCC2(C)C3C(=O)CC(C)(C(CC4)(O)C(=O)CO)C4C3CCC2=C1 MFYSYFVPBJMHGN-UHFFFAOYSA-N 0.000 description 1
- MFYSYFVPBJMHGN-ZPOLXVRWSA-N Cortisone Chemical compound O=C1CC[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 MFYSYFVPBJMHGN-ZPOLXVRWSA-N 0.000 description 1
- PMATZTZNYRCHOR-CGLBZJNRSA-N Cyclosporin A Chemical compound CC[C@@H]1NC(=O)[C@H]([C@H](O)[C@H](C)C\C=C\C)N(C)C(=O)[C@H](C(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](CC(C)C)N(C)C(=O)[C@@H](C)NC(=O)[C@H](C)NC(=O)[C@H](CC(C)C)N(C)C(=O)[C@H](C(C)C)NC(=O)[C@H](CC(C)C)N(C)C(=O)CN(C)C1=O PMATZTZNYRCHOR-CGLBZJNRSA-N 0.000 description 1
- 108010036949 Cyclosporine Proteins 0.000 description 1
- YPWSLBHSMIKTPR-UHFFFAOYSA-N Cystathionine Natural products OC(=O)C(N)CCSSCC(N)C(O)=O YPWSLBHSMIKTPR-UHFFFAOYSA-N 0.000 description 1
- UHDGCWIWMRVCDJ-CCXZUQQUSA-N Cytarabine Chemical compound O=C1N=C(N)C=CN1[C@H]1[C@@H](O)[C@H](O)[C@@H](CO)O1 UHDGCWIWMRVCDJ-CCXZUQQUSA-N 0.000 description 1
- 102000000311 Cytosine Deaminase Human genes 0.000 description 1
- 108010080611 Cytosine Deaminase Proteins 0.000 description 1
- 102100027816 Cytotoxic and regulatory T-cell molecule Human genes 0.000 description 1
- ILRYLPWNYFXEMH-UHFFFAOYSA-N D-cystathionine Natural products OC(=O)C(N)CCSCC(N)C(O)=O ILRYLPWNYFXEMH-UHFFFAOYSA-N 0.000 description 1
- 239000012623 DNA damaging agent Substances 0.000 description 1
- 241000725619 Dengue virus Species 0.000 description 1
- 108700022150 Designed Ankyrin Repeat Proteins Proteins 0.000 description 1
- 206010059866 Drug resistance Diseases 0.000 description 1
- 201000009051 Embryonal Carcinoma Diseases 0.000 description 1
- 108010079505 Endostatins Proteins 0.000 description 1
- 241000991587 Enterovirus C Species 0.000 description 1
- 101710121417 Envelope glycoprotein Proteins 0.000 description 1
- 108010055196 EphA2 Receptor Proteins 0.000 description 1
- 102100030340 Ephrin type-A receptor 2 Human genes 0.000 description 1
- 102100031984 Ephrin type-B receptor 6 Human genes 0.000 description 1
- 102000018651 Epithelial Cell Adhesion Molecule Human genes 0.000 description 1
- 108010066687 Epithelial Cell Adhesion Molecule Proteins 0.000 description 1
- 208000000461 Esophageal Neoplasms Diseases 0.000 description 1
- 108010042634 F2A4-K-NS peptide Proteins 0.000 description 1
- 102100024785 Fibroblast growth factor 2 Human genes 0.000 description 1
- 108090000379 Fibroblast growth factor 2 Proteins 0.000 description 1
- 108010000916 Fimbriae Proteins Proteins 0.000 description 1
- 238000012413 Fluorescence activated cell sorting analysis Methods 0.000 description 1
- GHASVSINZRGABV-UHFFFAOYSA-N Fluorouracil Chemical compound FC1=CNC(=O)NC1=O GHASVSINZRGABV-UHFFFAOYSA-N 0.000 description 1
- 229940123414 Folate antagonist Drugs 0.000 description 1
- 102100035144 Folate receptor beta Human genes 0.000 description 1
- 102100022629 Fructose-2,6-bisphosphatase Human genes 0.000 description 1
- KGPGFQWBCSZGEL-ZDUSSCGKSA-N GSK690693 Chemical compound C=12N(CC)C(C=3C(=NON=3)N)=NC2=C(C#CC(C)(C)O)N=CC=1OC[C@H]1CCCNC1 KGPGFQWBCSZGEL-ZDUSSCGKSA-N 0.000 description 1
- 229940032072 GVAX vaccine Drugs 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 241000713813 Gibbon ape leukemia virus Species 0.000 description 1
- 101710088083 Glomulin Proteins 0.000 description 1
- KOSRFJWDECSPRO-WDSKDSINSA-N Glu-Glu Chemical compound OC(=O)CC[C@H](N)C(=O)N[C@@H](CCC(O)=O)C(O)=O KOSRFJWDECSPRO-WDSKDSINSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- BLCLNMBMMGCOAS-URPVMXJPSA-N Goserelin Chemical compound C([C@@H](C(=O)N[C@H](COC(C)(C)C)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CCCN=C(N)N)C(=O)N1[C@@H](CCC1)C(=O)NNC(N)=O)NC(=O)[C@H](CO)NC(=O)[C@H](CC=1C2=CC=CC=C2NC=1)NC(=O)[C@H](CC=1NC=NC=1)NC(=O)[C@H]1NC(=O)CC1)C1=CC=C(O)C=C1 BLCLNMBMMGCOAS-URPVMXJPSA-N 0.000 description 1
- 108010069236 Goserelin Proteins 0.000 description 1
- 102100022662 Guanylyl cyclase C Human genes 0.000 description 1
- 239000007995 HEPES buffer Substances 0.000 description 1
- 102100035943 HERV-H LTR-associating protein 2 Human genes 0.000 description 1
- 102000006354 HLA-DR Antigens Human genes 0.000 description 1
- 108010058597 HLA-DR Antigens Proteins 0.000 description 1
- 241000711549 Hepacivirus C Species 0.000 description 1
- 108010007712 Hepatitis A Virus Cellular Receptor 1 Proteins 0.000 description 1
- 101710185991 Hepatitis A virus cellular receptor 1 homolog Proteins 0.000 description 1
- 102100034458 Hepatitis A virus cellular receptor 2 Human genes 0.000 description 1
- 108700008783 Hepatitis C virus E1 Proteins 0.000 description 1
- 108010073141 Hepatitis C virus glycoprotein E2 Proteins 0.000 description 1
- 241000282412 Homo Species 0.000 description 1
- 101000800023 Homo sapiens 4F2 cell-surface antigen heavy chain Proteins 0.000 description 1
- 101000897405 Homo sapiens B-lymphocyte antigen CD20 Proteins 0.000 description 1
- 101000749325 Homo sapiens C-type lectin domain family 7 member A Proteins 0.000 description 1
- 101000761938 Homo sapiens CD160 antigen Proteins 0.000 description 1
- 101000884279 Homo sapiens CD276 antigen Proteins 0.000 description 1
- 101000716130 Homo sapiens CD48 antigen Proteins 0.000 description 1
- 101000914469 Homo sapiens CD82 antigen Proteins 0.000 description 1
- 101000738354 Homo sapiens CD9 antigen Proteins 0.000 description 1
- 101000914324 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 5 Proteins 0.000 description 1
- 101000914321 Homo sapiens Carcinoembryonic antigen-related cell adhesion molecule 7 Proteins 0.000 description 1
- 101000889276 Homo sapiens Cytotoxic T-lymphocyte protein 4 Proteins 0.000 description 1
- 101000908391 Homo sapiens Dipeptidyl peptidase 4 Proteins 0.000 description 1
- 101001064451 Homo sapiens Ephrin type-B receptor 6 Proteins 0.000 description 1
- 101100334524 Homo sapiens FCGR3B gene Proteins 0.000 description 1
- 101001023204 Homo sapiens Folate receptor beta Proteins 0.000 description 1
- 101000823463 Homo sapiens Fructose-2,6-bisphosphatase Proteins 0.000 description 1
- 101000899808 Homo sapiens Guanylyl cyclase C Proteins 0.000 description 1
- 101001068133 Homo sapiens Hepatitis A virus cellular receptor 2 Proteins 0.000 description 1
- 101001019455 Homo sapiens ICOS ligand Proteins 0.000 description 1
- 101000994375 Homo sapiens Integrin alpha-4 Proteins 0.000 description 1
- 101001003132 Homo sapiens Interleukin-13 receptor subunit alpha-2 Proteins 0.000 description 1
- 101000998120 Homo sapiens Interleukin-3 receptor subunit alpha Proteins 0.000 description 1
- 101001039113 Homo sapiens Leucine-rich repeat-containing protein 15 Proteins 0.000 description 1
- 101000777628 Homo sapiens Leukocyte antigen CD37 Proteins 0.000 description 1
- 101000980823 Homo sapiens Leukocyte surface antigen CD53 Proteins 0.000 description 1
- 101000878605 Homo sapiens Low affinity immunoglobulin epsilon Fc receptor Proteins 0.000 description 1
- 101001137987 Homo sapiens Lymphocyte activation gene 3 protein Proteins 0.000 description 1
- 101001063392 Homo sapiens Lymphocyte function-associated antigen 3 Proteins 0.000 description 1
- 101000669513 Homo sapiens Metalloproteinase inhibitor 1 Proteins 0.000 description 1
- 101000645296 Homo sapiens Metalloproteinase inhibitor 2 Proteins 0.000 description 1
- 101001133056 Homo sapiens Mucin-1 Proteins 0.000 description 1
- 101000623901 Homo sapiens Mucin-16 Proteins 0.000 description 1
- 101000934338 Homo sapiens Myeloid cell surface antigen CD33 Proteins 0.000 description 1
- 101001109503 Homo sapiens NKG2-C type II integral membrane protein Proteins 0.000 description 1
- 101000581981 Homo sapiens Neural cell adhesion molecule 1 Proteins 0.000 description 1
- 101001098352 Homo sapiens OX-2 membrane glycoprotein Proteins 0.000 description 1
- 101000617725 Homo sapiens Pregnancy-specific beta-1-glycoprotein 2 Proteins 0.000 description 1
- 101000734646 Homo sapiens Programmed cell death protein 6 Proteins 0.000 description 1
- 101000684208 Homo sapiens Prolyl endopeptidase FAP Proteins 0.000 description 1
- 101001136592 Homo sapiens Prostate stem cell antigen Proteins 0.000 description 1
- 101001120726 Homo sapiens Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial Proteins 0.000 description 1
- 101000874179 Homo sapiens Syndecan-1 Proteins 0.000 description 1
- 101000837401 Homo sapiens T-cell leukemia/lymphoma protein 1A Proteins 0.000 description 1
- 101000837398 Homo sapiens T-cell leukemia/lymphoma protein 1B Proteins 0.000 description 1
- 101000596234 Homo sapiens T-cell surface protein tactile Proteins 0.000 description 1
- 101000800116 Homo sapiens Thy-1 membrane glycoprotein Proteins 0.000 description 1
- 101000830596 Homo sapiens Tumor necrosis factor ligand superfamily member 15 Proteins 0.000 description 1
- 101000597779 Homo sapiens Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 description 1
- 101000764263 Homo sapiens Tumor necrosis factor ligand superfamily member 4 Proteins 0.000 description 1
- 101000638255 Homo sapiens Tumor necrosis factor ligand superfamily member 8 Proteins 0.000 description 1
- 101000795169 Homo sapiens Tumor necrosis factor receptor superfamily member 13C Proteins 0.000 description 1
- 101000648507 Homo sapiens Tumor necrosis factor receptor superfamily member 14 Proteins 0.000 description 1
- 101000762805 Homo sapiens Tumor necrosis factor receptor superfamily member 19L Proteins 0.000 description 1
- 101000801232 Homo sapiens Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 101000611185 Homo sapiens Tumor necrosis factor receptor superfamily member 5 Proteins 0.000 description 1
- 241000714260 Human T-lymphotropic virus 1 Species 0.000 description 1
- 241000701074 Human alphaherpesvirus 2 Species 0.000 description 1
- 101000807236 Human cytomegalovirus (strain AD169) Membrane glycoprotein US3 Proteins 0.000 description 1
- 241000711920 Human orthopneumovirus Species 0.000 description 1
- 241000701806 Human papillomavirus Species 0.000 description 1
- 101710093458 ICOS ligand Proteins 0.000 description 1
- 108010073807 IgG Receptors Proteins 0.000 description 1
- 102000009490 IgG Receptors Human genes 0.000 description 1
- 102000017182 Ikaros Transcription Factor Human genes 0.000 description 1
- 108010013958 Ikaros Transcription Factor Proteins 0.000 description 1
- 108700002232 Immediate-Early Genes Proteins 0.000 description 1
- 102000037984 Inhibitory immune checkpoint proteins Human genes 0.000 description 1
- 108091008026 Inhibitory immune checkpoint proteins Proteins 0.000 description 1
- 102100034349 Integrase Human genes 0.000 description 1
- 108010041012 Integrin alpha4 Proteins 0.000 description 1
- 108010008212 Integrin alpha4beta1 Proteins 0.000 description 1
- 102000006992 Interferon-alpha Human genes 0.000 description 1
- 108010047761 Interferon-alpha Proteins 0.000 description 1
- 102100020793 Interleukin-13 receptor subunit alpha-2 Human genes 0.000 description 1
- 102100033493 Interleukin-3 receptor subunit alpha Human genes 0.000 description 1
- 108010002586 Interleukin-7 Proteins 0.000 description 1
- QNAYBMKLOCPYGJ-REOHCLBHSA-N L-alanine Chemical compound C[C@H](N)C(O)=O QNAYBMKLOCPYGJ-REOHCLBHSA-N 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- ILRYLPWNYFXEMH-WHFBIAKZSA-N L-cystathionine Chemical compound [O-]C(=O)[C@@H]([NH3+])CCSC[C@H]([NH3+])C([O-])=O ILRYLPWNYFXEMH-WHFBIAKZSA-N 0.000 description 1
- AGPKZVBTJJNPAG-WHFBIAKZSA-N L-isoleucine Chemical compound CC[C@H](C)[C@H](N)C(O)=O AGPKZVBTJJNPAG-WHFBIAKZSA-N 0.000 description 1
- ROHFNLRQFUQHCH-YFKPBYRVSA-N L-leucine Chemical compound CC(C)C[C@H](N)C(O)=O ROHFNLRQFUQHCH-YFKPBYRVSA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- FBOZXECLQNJBKD-ZDUSSCGKSA-N L-methotrexate Chemical compound C=1N=C2N=C(N)N=C(N)C2=NC=1CN(C)C1=CC=C(C(=O)N[C@@H](CCC(O)=O)C(O)=O)C=C1 FBOZXECLQNJBKD-ZDUSSCGKSA-N 0.000 description 1
- QIVBCDIJIAJPQS-VIFPVBQESA-N L-tryptophane Chemical compound C1=CC=C2C(C[C@H](N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-VIFPVBQESA-N 0.000 description 1
- 102000017578 LAG3 Human genes 0.000 description 1
- ROHFNLRQFUQHCH-UHFFFAOYSA-N Leucine Natural products CC(C)CC(N)C(O)=O ROHFNLRQFUQHCH-UHFFFAOYSA-N 0.000 description 1
- 102100040645 Leucine-rich repeat-containing protein 15 Human genes 0.000 description 1
- 102100031586 Leukocyte antigen CD37 Human genes 0.000 description 1
- 102100024221 Leukocyte surface antigen CD53 Human genes 0.000 description 1
- 102000003960 Ligases Human genes 0.000 description 1
- 108090000364 Ligases Proteins 0.000 description 1
- 102100038007 Low affinity immunoglobulin epsilon Fc receptor Human genes 0.000 description 1
- 102100029205 Low affinity immunoglobulin gamma Fc region receptor II-b Human genes 0.000 description 1
- 108060001084 Luciferase Proteins 0.000 description 1
- 239000005089 Luciferase Substances 0.000 description 1
- 102100030984 Lymphocyte function-associated antigen 3 Human genes 0.000 description 1
- 208000031422 Lymphocytic Chronic B-Cell Leukemia Diseases 0.000 description 1
- 108090000542 Lymphotoxin-alpha Proteins 0.000 description 1
- FYYHWMGAXLPEAU-UHFFFAOYSA-N Magnesium Chemical compound [Mg] FYYHWMGAXLPEAU-UHFFFAOYSA-N 0.000 description 1
- 108700018351 Major Histocompatibility Complex Proteins 0.000 description 1
- 101710105759 Major outer membrane porin Proteins 0.000 description 1
- 101710164702 Major outer membrane protein Proteins 0.000 description 1
- 241000712079 Measles morbillivirus Species 0.000 description 1
- 108090000015 Mesothelin Proteins 0.000 description 1
- 102000003735 Mesothelin Human genes 0.000 description 1
- 108010006035 Metalloproteases Proteins 0.000 description 1
- 102000005741 Metalloproteases Human genes 0.000 description 1
- 102100039364 Metalloproteinase inhibitor 1 Human genes 0.000 description 1
- 102100026262 Metalloproteinase inhibitor 2 Human genes 0.000 description 1
- 206010027476 Metastases Diseases 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- FQISKWAFAHGMGT-SGJOWKDISA-M Methylprednisolone sodium succinate Chemical compound [Na+].C([C@@]12C)=CC(=O)C=C1[C@@H](C)C[C@@H]1[C@@H]2[C@@H](O)C[C@]2(C)[C@@](O)(C(=O)COC(=O)CCC([O-])=O)CC[C@H]21 FQISKWAFAHGMGT-SGJOWKDISA-M 0.000 description 1
- 102000029749 Microtubule Human genes 0.000 description 1
- 108091022875 Microtubule Proteins 0.000 description 1
- 102100034256 Mucin-1 Human genes 0.000 description 1
- 102100023123 Mucin-16 Human genes 0.000 description 1
- 101100328148 Mus musculus Cd300a gene Proteins 0.000 description 1
- 101100407308 Mus musculus Pdcd1lg2 gene Proteins 0.000 description 1
- 101000686934 Mus musculus Prolactin-7D1 Proteins 0.000 description 1
- 101000597780 Mus musculus Tumor necrosis factor ligand superfamily member 18 Proteins 0.000 description 1
- 102100025243 Myeloid cell surface antigen CD33 Human genes 0.000 description 1
- AFJRDFWMXUECEW-LBPRGKRZSA-N N-[(2S)-1-amino-3-(3-fluorophenyl)propan-2-yl]-5-chloro-4-(4-chloro-2-methyl-3-pyrazolyl)-2-thiophenecarboxamide Chemical compound CN1N=CC(Cl)=C1C1=C(Cl)SC(C(=O)N[C@H](CN)CC=2C=C(F)C=CC=2)=C1 AFJRDFWMXUECEW-LBPRGKRZSA-N 0.000 description 1
- 102100022683 NKG2-C type II integral membrane protein Human genes 0.000 description 1
- 101710141230 Natural killer cell receptor 2B4 Proteins 0.000 description 1
- 102100035486 Nectin-4 Human genes 0.000 description 1
- 101710043865 Nectin-4 Proteins 0.000 description 1
- 229930193140 Neomycin Natural products 0.000 description 1
- 102100027347 Neural cell adhesion molecule 1 Human genes 0.000 description 1
- 102100024964 Neural cell adhesion molecule L1 Human genes 0.000 description 1
- 108010006232 Neuraminidase Proteins 0.000 description 1
- 102000005348 Neuraminidase Human genes 0.000 description 1
- 206010029350 Neurotoxicity Diseases 0.000 description 1
- MWUXSHHQAYIFBG-UHFFFAOYSA-N Nitric oxide Chemical class O=[N] MWUXSHHQAYIFBG-UHFFFAOYSA-N 0.000 description 1
- 102000004459 Nitroreductase Human genes 0.000 description 1
- KYRVNWMVYQXFEU-UHFFFAOYSA-N Nocodazole Chemical compound C1=C2NC(NC(=O)OC)=NC2=CC=C1C(=O)C1=CC=CS1 KYRVNWMVYQXFEU-UHFFFAOYSA-N 0.000 description 1
- 102100037589 OX-2 membrane glycoprotein Human genes 0.000 description 1
- 206010030155 Oesophageal carcinoma Diseases 0.000 description 1
- 239000002033 PVDF binder Substances 0.000 description 1
- 101100098621 Paramecium tetraurelia T2A gene Proteins 0.000 description 1
- 241000237988 Patellidae Species 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 108091000080 Phosphotransferase Proteins 0.000 description 1
- 102000013566 Plasminogen Human genes 0.000 description 1
- 108010051456 Plasminogen Proteins 0.000 description 1
- 102000004211 Platelet factor 4 Human genes 0.000 description 1
- 108090000778 Platelet factor 4 Proteins 0.000 description 1
- 241001505332 Polyomavirus sp. Species 0.000 description 1
- 208000006664 Precursor Cell Lymphoblastic Leukemia-Lymphoma Diseases 0.000 description 1
- 102100022019 Pregnancy-specific beta-1-glycoprotein 2 Human genes 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- 101710101148 Probable 6-oxopurine nucleoside phosphorylase Proteins 0.000 description 1
- 108700030875 Programmed Cell Death 1 Ligand 2 Proteins 0.000 description 1
- 102100024213 Programmed cell death 1 ligand 2 Human genes 0.000 description 1
- 102100034785 Programmed cell death protein 6 Human genes 0.000 description 1
- 102000003946 Prolactin Human genes 0.000 description 1
- 108010057464 Prolactin Proteins 0.000 description 1
- 102100023832 Prolyl endopeptidase FAP Human genes 0.000 description 1
- 102100040120 Prominin-1 Human genes 0.000 description 1
- 102100036735 Prostate stem cell antigen Human genes 0.000 description 1
- 229940124158 Protease/peptidase inhibitor Drugs 0.000 description 1
- 244000236580 Psidium pyriferum Species 0.000 description 1
- 235000013929 Psidium pyriferum Nutrition 0.000 description 1
- 102000030764 Purine-nucleoside phosphorylase Human genes 0.000 description 1
- 102100026067 Pyruvate dehydrogenase E1 component subunit alpha, somatic form, mitochondrial Human genes 0.000 description 1
- 238000012341 Quantitative reverse-transcriptase PCR Methods 0.000 description 1
- 102000018795 RELT Human genes 0.000 description 1
- 108010052562 RELT Proteins 0.000 description 1
- 101710118046 RNA-directed RNA polymerase Proteins 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 108700008625 Reporter Genes Proteins 0.000 description 1
- 241000725643 Respiratory syncytial virus Species 0.000 description 1
- 239000006146 Roswell Park Memorial Institute medium Substances 0.000 description 1
- 241000714474 Rous sarcoma virus Species 0.000 description 1
- 239000012721 SDS lysis buffer Substances 0.000 description 1
- 206010070834 Sensitisation Diseases 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- 241000700584 Simplexvirus Species 0.000 description 1
- 108700015968 Slam family Proteins 0.000 description 1
- 101001039853 Sonchus yellow net virus Matrix protein Proteins 0.000 description 1
- 241000194017 Streptococcus Species 0.000 description 1
- 108010023197 Streptokinase Proteins 0.000 description 1
- 108010052762 Suid herpesvirus 1 glycoprotein E Proteins 0.000 description 1
- 108010002687 Survivin Proteins 0.000 description 1
- 102100035721 Syndecan-1 Human genes 0.000 description 1
- 230000006052 T cell proliferation Effects 0.000 description 1
- 102100039367 T-cell immunoglobulin and mucin domain-containing protein 4 Human genes 0.000 description 1
- 101710174757 T-cell immunoglobulin and mucin domain-containing protein 4 Proteins 0.000 description 1
- 102100028676 T-cell leukemia/lymphoma protein 1A Human genes 0.000 description 1
- 102100028678 T-cell leukemia/lymphoma protein 1B Human genes 0.000 description 1
- 102100035268 T-cell surface protein tactile Human genes 0.000 description 1
- 101710114141 T-lymphocyte surface antigen Ly-9 Proteins 0.000 description 1
- 238000010459 TALEN Methods 0.000 description 1
- 101150052863 THY1 gene Proteins 0.000 description 1
- QJJXYPPXXYFBGM-LFZNUXCKSA-N Tacrolimus Chemical compound C1C[C@@H](O)[C@H](OC)C[C@@H]1\C=C(/C)[C@@H]1[C@H](C)[C@@H](O)CC(=O)[C@H](CC=C)/C=C(C)/C[C@H](C)C[C@H](OC)[C@H]([C@H](C[C@H]2C)OC)O[C@@]2(O)C(=O)C(=O)N2CCCC[C@H]2C(=O)O1 QJJXYPPXXYFBGM-LFZNUXCKSA-N 0.000 description 1
- 229940123237 Taxane Drugs 0.000 description 1
- 108090000190 Thrombin Proteins 0.000 description 1
- 108010046722 Thrombospondin 1 Proteins 0.000 description 1
- 102100036034 Thrombospondin-1 Human genes 0.000 description 1
- 102100033523 Thy-1 membrane glycoprotein Human genes 0.000 description 1
- 108090000373 Tissue Plasminogen Activator Proteins 0.000 description 1
- 102000003978 Tissue Plasminogen Activator Human genes 0.000 description 1
- 206010044221 Toxic encephalopathy Diseases 0.000 description 1
- 108010043645 Transcription Activator-Like Effector Nucleases Proteins 0.000 description 1
- QIVBCDIJIAJPQS-UHFFFAOYSA-N Tryptophan Natural products C1=CC=C2C(CC(N)C(O)=O)=CNC2=C1 QIVBCDIJIAJPQS-UHFFFAOYSA-N 0.000 description 1
- 108060008682 Tumor Necrosis Factor Proteins 0.000 description 1
- 108010065158 Tumor Necrosis Factor Ligand Superfamily Member 14 Proteins 0.000 description 1
- 102100024586 Tumor necrosis factor ligand superfamily member 14 Human genes 0.000 description 1
- 108090000138 Tumor necrosis factor ligand superfamily member 15 Proteins 0.000 description 1
- 102100035283 Tumor necrosis factor ligand superfamily member 18 Human genes 0.000 description 1
- 102100029690 Tumor necrosis factor receptor superfamily member 13C Human genes 0.000 description 1
- 102100026716 Tumor necrosis factor receptor superfamily member 19L Human genes 0.000 description 1
- 101710187830 Tumor necrosis factor receptor superfamily member 1B Proteins 0.000 description 1
- 108090000435 Urokinase-type plasminogen activator Proteins 0.000 description 1
- 102000003990 Urokinase-type plasminogen activator Human genes 0.000 description 1
- 208000006105 Uterine Cervical Neoplasms Diseases 0.000 description 1
- 108010079206 V-Set Domain-Containing T-Cell Activation Inhibitor 1 Proteins 0.000 description 1
- 102100038929 V-set domain-containing T-cell activation inhibitor 1 Human genes 0.000 description 1
- 108010053096 Vascular Endothelial Growth Factor Receptor-1 Proteins 0.000 description 1
- 108010053099 Vascular Endothelial Growth Factor Receptor-2 Proteins 0.000 description 1
- 102000009484 Vascular Endothelial Growth Factor Receptors Human genes 0.000 description 1
- 229940122803 Vinca alkaloid Drugs 0.000 description 1
- 108010015780 Viral Core Proteins Proteins 0.000 description 1
- 101710108545 Viral protein 1 Proteins 0.000 description 1
- 208000008383 Wilms tumor Diseases 0.000 description 1
- 229960000446 abciximab Drugs 0.000 description 1
- 229960001138 acetylsalicylic acid Drugs 0.000 description 1
- 229930183665 actinomycin Natural products 0.000 description 1
- 230000033289 adaptive immune response Effects 0.000 description 1
- 239000000654 additive Substances 0.000 description 1
- 229960005305 adenosine Drugs 0.000 description 1
- 229950000079 afuresertib Drugs 0.000 description 1
- 239000000556 agonist Substances 0.000 description 1
- 235000004279 alanine Nutrition 0.000 description 1
- OFHCOWSQAMBJIW-AVJTYSNKSA-N alfacalcidol Chemical compound C1(/[C@@H]2CC[C@@H]([C@]2(CCC1)C)[C@H](C)CCCC(C)C)=C\C=C1\C[C@@H](O)C[C@H](O)C1=C OFHCOWSQAMBJIW-AVJTYSNKSA-N 0.000 description 1
- 125000000217 alkyl group Chemical group 0.000 description 1
- 229940100198 alkylating agent Drugs 0.000 description 1
- 239000002168 alkylating agent Substances 0.000 description 1
- SHGAZHPCJJPHSC-YCNIQYBTSA-N all-trans-retinoic acid Chemical compound OC(=O)\C=C(/C)\C=C\C=C(/C)\C=C\C1=C(C)CCCC1(C)C SHGAZHPCJJPHSC-YCNIQYBTSA-N 0.000 description 1
- KOSRFJWDECSPRO-UHFFFAOYSA-N alpha-L-glutamyl-L-glutamic acid Natural products OC(=O)CCC(N)C(=O)NC(CCC(O)=O)C(O)=O KOSRFJWDECSPRO-UHFFFAOYSA-N 0.000 description 1
- 229960003437 aminoglutethimide Drugs 0.000 description 1
- ROBVIMPUHSLWNV-UHFFFAOYSA-N aminoglutethimide Chemical compound C=1C=C(N)C=CC=1C1(CC)CCC(=O)NC1=O ROBVIMPUHSLWNV-UHFFFAOYSA-N 0.000 description 1
- 229960002932 anastrozole Drugs 0.000 description 1
- YBBLVLTVTVSKRW-UHFFFAOYSA-N anastrozole Chemical compound N#CC(C)(C)C1=CC(C(C)(C#N)C)=CC(CN2N=CN=C2)=C1 YBBLVLTVTVSKRW-UHFFFAOYSA-N 0.000 description 1
- 238000004873 anchoring Methods 0.000 description 1
- 239000004037 angiogenesis inhibitor Substances 0.000 description 1
- 229940125364 angiotensin receptor blocker Drugs 0.000 description 1
- 210000004102 animal cell Anatomy 0.000 description 1
- 239000005557 antagonist Substances 0.000 description 1
- 239000003242 anti bacterial agent Substances 0.000 description 1
- 230000001772 anti-angiogenic effect Effects 0.000 description 1
- 230000000340 anti-metabolite Effects 0.000 description 1
- 230000000845 anti-microbial effect Effects 0.000 description 1
- 230000002095 anti-migrative effect Effects 0.000 description 1
- 230000000840 anti-viral effect Effects 0.000 description 1
- 229940088710 antibiotic agent Drugs 0.000 description 1
- 238000011319 anticancer therapy Methods 0.000 description 1
- 239000003146 anticoagulant agent Substances 0.000 description 1
- 229940127219 anticoagulant drug Drugs 0.000 description 1
- 229940100197 antimetabolite Drugs 0.000 description 1
- 239000002256 antimetabolite Substances 0.000 description 1
- 229940045687 antimetabolites folic acid analogs Drugs 0.000 description 1
- 239000003080 antimitotic agent Substances 0.000 description 1
- 229940045719 antineoplastic alkylating agent nitrosoureas Drugs 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- 229940127218 antiplatelet drug Drugs 0.000 description 1
- 239000000074 antisense oligonucleotide Substances 0.000 description 1
- 238000012230 antisense oligonucleotides Methods 0.000 description 1
- 239000007864 aqueous solution Substances 0.000 description 1
- 239000003886 aromatase inhibitor Substances 0.000 description 1
- 229940046844 aromatase inhibitors Drugs 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 235000010323 ascorbic acid Nutrition 0.000 description 1
- 239000011668 ascorbic acid Substances 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- FZCSTZYAHCUGEM-UHFFFAOYSA-N aspergillomarasmine B Natural products OC(=O)CNC(C(O)=O)CNC(C(O)=O)CC(O)=O FZCSTZYAHCUGEM-UHFFFAOYSA-N 0.000 description 1
- 230000001363 autoimmune Effects 0.000 description 1
- 229960002170 azathioprine Drugs 0.000 description 1
- LMEKQMALGUDUQG-UHFFFAOYSA-N azathioprine Chemical compound CN1C=NC([N+]([O-])=O)=C1SC1=NC=NC2=C1NC=N2 LMEKQMALGUDUQG-UHFFFAOYSA-N 0.000 description 1
- 239000011324 bead Substances 0.000 description 1
- 230000009286 beneficial effect Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 108010010804 beta2 Heterotrimer Lymphotoxin alpha1 Proteins 0.000 description 1
- 229960000397 bevacizumab Drugs 0.000 description 1
- 229960000997 bicalutamide Drugs 0.000 description 1
- 230000004071 biological effect Effects 0.000 description 1
- 230000006696 biosynthetic metabolic pathway Effects 0.000 description 1
- 230000036765 blood level Effects 0.000 description 1
- 230000037396 body weight Effects 0.000 description 1
- 238000006664 bond formation reaction Methods 0.000 description 1
- 210000000988 bone and bone Anatomy 0.000 description 1
- 238000002619 cancer immunotherapy Methods 0.000 description 1
- 229960004117 capecitabine Drugs 0.000 description 1
- 229960005243 carmustine Drugs 0.000 description 1
- 230000015556 catabolic process Effects 0.000 description 1
- 230000024245 cell differentiation Effects 0.000 description 1
- 230000022534 cell killing Effects 0.000 description 1
- 230000007248 cellular mechanism Effects 0.000 description 1
- 230000005754 cellular signaling Effects 0.000 description 1
- 238000005119 centrifugation Methods 0.000 description 1
- 201000010881 cervical cancer Diseases 0.000 description 1
- 208000019065 cervical carcinoma Diseases 0.000 description 1
- 239000003153 chemical reaction reagent Substances 0.000 description 1
- 230000000973 chemotherapeutic effect Effects 0.000 description 1
- 238000002512 chemotherapy Methods 0.000 description 1
- 210000003483 chromatin Anatomy 0.000 description 1
- 210000000349 chromosome Anatomy 0.000 description 1
- 208000032852 chronic lymphocytic leukemia Diseases 0.000 description 1
- 229960001265 ciclosporin Drugs 0.000 description 1
- 229960002436 cladribine Drugs 0.000 description 1
- 108010072917 class-I restricted T cell-associated molecule Proteins 0.000 description 1
- 229960003009 clopidogrel Drugs 0.000 description 1
- GKTWGGQPFAXNFI-HNNXBMFYSA-N clopidogrel Chemical compound C1([C@H](N2CC=3C=CSC=3CC2)C(=O)OC)=CC=CC=C1Cl GKTWGGQPFAXNFI-HNNXBMFYSA-N 0.000 description 1
- 239000003184 complementary RNA Substances 0.000 description 1
- 238000003271 compound fluorescence assay Methods 0.000 description 1
- 230000001276 controlling effect Effects 0.000 description 1
- 239000003246 corticosteroid Substances 0.000 description 1
- 229960001334 corticosteroids Drugs 0.000 description 1
- 229960004544 cortisone Drugs 0.000 description 1
- 239000012228 culture supernatant Substances 0.000 description 1
- 229930182912 cyclosporin Natural products 0.000 description 1
- 235000018417 cysteine Nutrition 0.000 description 1
- XUJNEKJLAYXESH-UHFFFAOYSA-N cysteine Natural products SCC(N)C(O)=O XUJNEKJLAYXESH-UHFFFAOYSA-N 0.000 description 1
- 229960000684 cytarabine Drugs 0.000 description 1
- 206010052015 cytokine release syndrome Diseases 0.000 description 1
- 210000005220 cytoplasmic tail Anatomy 0.000 description 1
- 231100000433 cytotoxic Toxicity 0.000 description 1
- 210000001151 cytotoxic T lymphocyte Anatomy 0.000 description 1
- 230000001472 cytotoxic effect Effects 0.000 description 1
- 238000006114 decarboxylation reaction Methods 0.000 description 1
- 108010025838 dectin 1 Proteins 0.000 description 1
- 230000001934 delay Effects 0.000 description 1
- CFCUWKMKBJTWLW-UHFFFAOYSA-N deoliosyl-3C-alpha-L-digitoxosyl-MTM Natural products CC=1C(O)=C2C(O)=C3C(=O)C(OC4OC(C)C(O)C(OC5OC(C)C(O)C(OC6OC(C)C(O)C(C)(O)C6)C5)C4)C(C(OC)C(=O)C(O)C(C)O)CC3=CC2=CC=1OC(OC(C)C1O)CC1OC1CC(O)C(O)C(C)O1 CFCUWKMKBJTWLW-UHFFFAOYSA-N 0.000 description 1
- 238000013461 design Methods 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 238000003745 diagnosis Methods 0.000 description 1
- 238000000502 dialysis Methods 0.000 description 1
- 235000014113 dietary fatty acids Nutrition 0.000 description 1
- 230000003292 diminished effect Effects 0.000 description 1
- XEYBRNLFEZDVAW-ARSRFYASSA-N dinoprostone Chemical compound CCCCC[C@H](O)\C=C\[C@H]1[C@H](O)CC(=O)[C@@H]1C\C=C/CCCC(O)=O XEYBRNLFEZDVAW-ARSRFYASSA-N 0.000 description 1
- 229960002986 dinoprostone Drugs 0.000 description 1
- 229960002768 dipyridamole Drugs 0.000 description 1
- IZEKFCXSFNUWAM-UHFFFAOYSA-N dipyridamole Chemical compound C=12N=C(N(CCO)CCO)N=C(N3CCCCC3)C2=NC(N(CCO)CCO)=NC=1N1CCCCC1 IZEKFCXSFNUWAM-UHFFFAOYSA-N 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 239000003534 dna topoisomerase inhibitor Substances 0.000 description 1
- 229960004679 doxorubicin Drugs 0.000 description 1
- 208000023965 endometrium neoplasm Diseases 0.000 description 1
- 239000003623 enhancer Substances 0.000 description 1
- 230000002255 enzymatic effect Effects 0.000 description 1
- 210000003979 eosinophil Anatomy 0.000 description 1
- 108010087914 epidermal growth factor receptor VIII Proteins 0.000 description 1
- 230000010502 episomal replication Effects 0.000 description 1
- 229930013356 epothilone Natural products 0.000 description 1
- HESCAJZNRMSMJG-KKQRBIROSA-N epothilone A Chemical class C/C([C@@H]1C[C@@H]2O[C@@H]2CCC[C@@H]([C@@H]([C@@H](C)C(=O)C(C)(C)[C@@H](O)CC(=O)O1)O)C)=C\C1=CSC(C)=N1 HESCAJZNRMSMJG-KKQRBIROSA-N 0.000 description 1
- 201000004101 esophageal cancer Diseases 0.000 description 1
- 229940011871 estrogen Drugs 0.000 description 1
- 239000000262 estrogen Substances 0.000 description 1
- 239000013613 expression plasmid Substances 0.000 description 1
- 229930195729 fatty acid Natural products 0.000 description 1
- 239000000194 fatty acid Substances 0.000 description 1
- 150000004665 fatty acids Chemical class 0.000 description 1
- 239000003527 fibrinolytic agent Substances 0.000 description 1
- 238000009459 flexible packaging Methods 0.000 description 1
- 229960000961 floxuridine Drugs 0.000 description 1
- ODKNJVUHOIMIIZ-RRKCRQDMSA-N floxuridine Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(=O)NC(=O)C(F)=C1 ODKNJVUHOIMIIZ-RRKCRQDMSA-N 0.000 description 1
- 229960000390 fludarabine Drugs 0.000 description 1
- GIUYCYHIANZCFB-FJFJXFQQSA-N fludarabine phosphate Chemical compound C1=NC=2C(N)=NC(F)=NC=2N1[C@@H]1O[C@H](COP(O)(O)=O)[C@@H](O)[C@@H]1O GIUYCYHIANZCFB-FJFJXFQQSA-N 0.000 description 1
- MHMNJMPURVTYEJ-UHFFFAOYSA-N fluorescein-5-isothiocyanate Chemical compound O1C(=O)C2=CC(N=C=S)=CC=C2C21C1=CC=C(O)C=C1OC1=CC(O)=CC=C21 MHMNJMPURVTYEJ-UHFFFAOYSA-N 0.000 description 1
- 238000000799 fluorescence microscopy Methods 0.000 description 1
- 229960002949 fluorouracil Drugs 0.000 description 1
- IJJVMEJXYNJXOJ-UHFFFAOYSA-N fluquinconazole Chemical compound C=1C=C(Cl)C=C(Cl)C=1N1C(=O)C2=CC(F)=CC=C2N=C1N1C=NC=N1 IJJVMEJXYNJXOJ-UHFFFAOYSA-N 0.000 description 1
- 150000002224 folic acids Chemical class 0.000 description 1
- 238000005755 formation reaction Methods 0.000 description 1
- 230000008014 freezing Effects 0.000 description 1
- 238000007710 freezing Methods 0.000 description 1
- 238000002825 functional assay Methods 0.000 description 1
- 108020001507 fusion proteins Proteins 0.000 description 1
- 102000037865 fusion proteins Human genes 0.000 description 1
- IRSCQMHQWWYFCW-UHFFFAOYSA-N ganciclovir Chemical compound O=C1NC(N)=NC2=C1N=CN2COC(CO)CO IRSCQMHQWWYFCW-UHFFFAOYSA-N 0.000 description 1
- 229960002963 ganciclovir Drugs 0.000 description 1
- 239000000499 gel Substances 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 238000002523 gelfiltration Methods 0.000 description 1
- 229960005277 gemcitabine Drugs 0.000 description 1
- SDUQYLNIPVEERB-QPPQHZFASA-N gemcitabine Chemical compound O=C1N=C(N)C=CN1[C@H]1C(F)(F)[C@H](O)[C@@H](CO)O1 SDUQYLNIPVEERB-QPPQHZFASA-N 0.000 description 1
- 230000008303 genetic mechanism Effects 0.000 description 1
- 229940045109 genistein Drugs 0.000 description 1
- TZBJGXHYKVUXJN-UHFFFAOYSA-N genistein Natural products C1=CC(O)=CC=C1C1=COC2=CC(O)=CC(O)=C2C1=O TZBJGXHYKVUXJN-UHFFFAOYSA-N 0.000 description 1
- 235000006539 genistein Nutrition 0.000 description 1
- ZCOLJUOHXJRHDI-CMWLGVBASA-N genistein 7-O-beta-D-glucoside Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CO)O[C@H]1OC1=CC(O)=C2C(=O)C(C=3C=CC(O)=CC=3)=COC2=C1 ZCOLJUOHXJRHDI-CMWLGVBASA-N 0.000 description 1
- 238000010362 genome editing Methods 0.000 description 1
- 210000004602 germ cell Anatomy 0.000 description 1
- 230000004153 glucose metabolism Effects 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 108010055341 glutamyl-glutamic acid Proteins 0.000 description 1
- 125000003630 glycyl group Chemical group [H]N([H])C([H])([H])C(*)=O 0.000 description 1
- 229960002913 goserelin Drugs 0.000 description 1
- 229940093915 gynecological organic acid Drugs 0.000 description 1
- 238000003306 harvesting Methods 0.000 description 1
- 230000003862 health status Effects 0.000 description 1
- 230000002489 hematologic effect Effects 0.000 description 1
- 208000024200 hematopoietic and lymphoid system neoplasm Diseases 0.000 description 1
- 108060003552 hemocyanin Proteins 0.000 description 1
- 229960002897 heparin Drugs 0.000 description 1
- 229920000669 heparin Polymers 0.000 description 1
- 208000002672 hepatitis B Diseases 0.000 description 1
- 208000006359 hepatoblastoma Diseases 0.000 description 1
- 231100000844 hepatocellular carcinoma Toxicity 0.000 description 1
- 229940088597 hormone Drugs 0.000 description 1
- 239000005556 hormone Substances 0.000 description 1
- 239000003668 hormone analog Substances 0.000 description 1
- 229960000890 hydrocortisone Drugs 0.000 description 1
- 230000007062 hydrolysis Effects 0.000 description 1
- 238000006460 hydrolysis reaction Methods 0.000 description 1
- 229920001600 hydrophobic polymer Polymers 0.000 description 1
- 229960001101 ifosfamide Drugs 0.000 description 1
- HOMGKSMUEGBAAB-UHFFFAOYSA-N ifosfamide Chemical compound ClCCNP1(=O)OCCCN1CCCl HOMGKSMUEGBAAB-UHFFFAOYSA-N 0.000 description 1
- 210000001822 immobilized cell Anatomy 0.000 description 1
- 239000012642 immune effector Substances 0.000 description 1
- 238000003364 immunohistochemistry Methods 0.000 description 1
- 229940121354 immunomodulator Drugs 0.000 description 1
- 229940125721 immunosuppressive agent Drugs 0.000 description 1
- 230000008676 import Effects 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 230000005917 in vivo anti-tumor Effects 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 230000004968 inflammatory condition Effects 0.000 description 1
- 230000002757 inflammatory effect Effects 0.000 description 1
- 230000005764 inhibitory process Effects 0.000 description 1
- 108091008042 inhibitory receptors Proteins 0.000 description 1
- 230000000977 initiatory effect Effects 0.000 description 1
- 238000002347 injection Methods 0.000 description 1
- 239000007924 injection Substances 0.000 description 1
- 210000005007 innate immune system Anatomy 0.000 description 1
- 238000003780 insertion Methods 0.000 description 1
- 230000037431 insertion Effects 0.000 description 1
- 108010043603 integrin alpha4beta7 Proteins 0.000 description 1
- 229960004768 irinotecan Drugs 0.000 description 1
- UWKQSNNFCGGAFS-XIFFEERXSA-N irinotecan Chemical compound C1=C2C(CC)=C3CN(C(C4=C([C@@](C(=O)OC4)(O)CC)C=4)=O)C=4C3=NC2=CC=C1OC(=O)N(CC1)CCC1N1CCCCC1 UWKQSNNFCGGAFS-XIFFEERXSA-N 0.000 description 1
- AGPKZVBTJJNPAG-UHFFFAOYSA-N isoleucine Natural products CCC(C)C(N)C(O)=O AGPKZVBTJJNPAG-UHFFFAOYSA-N 0.000 description 1
- 229960000310 isoleucine Drugs 0.000 description 1
- 229960000318 kanamycin Drugs 0.000 description 1
- 229930027917 kanamycin Natural products 0.000 description 1
- SBUJHOSQTJFQJX-NOAMYHISSA-N kanamycin Chemical compound O[C@@H]1[C@@H](O)[C@H](O)[C@@H](CN)O[C@@H]1O[C@H]1[C@H](O)[C@@H](O[C@@H]2[C@@H]([C@@H](N)[C@H](O)[C@@H](CO)O2)O)[C@H](N)C[C@@H]1N SBUJHOSQTJFQJX-NOAMYHISSA-N 0.000 description 1
- 229930182823 kanamycin A Natural products 0.000 description 1
- 229940043355 kinase inhibitor Drugs 0.000 description 1
- 229960003881 letrozole Drugs 0.000 description 1
- HPJKCIUCZWXJDR-UHFFFAOYSA-N letrozole Chemical compound C1=CC(C#N)=CC=C1C(N1N=CN=C1)C1=CC=C(C#N)C=C1 HPJKCIUCZWXJDR-UHFFFAOYSA-N 0.000 description 1
- 150000002632 lipids Chemical class 0.000 description 1
- 239000002502 liposome Substances 0.000 description 1
- 201000001142 lung small cell carcinoma Diseases 0.000 description 1
- 210000001165 lymph node Anatomy 0.000 description 1
- 229940124302 mTOR inhibitor Drugs 0.000 description 1
- 210000002540 macrophage Anatomy 0.000 description 1
- 229910052749 magnesium Inorganic materials 0.000 description 1
- 239000011777 magnesium Substances 0.000 description 1
- 210000004962 mammalian cell Anatomy 0.000 description 1
- 239000003628 mammalian target of rapamycin inhibitor Substances 0.000 description 1
- 239000003550 marker Substances 0.000 description 1
- 230000007246 mechanism Effects 0.000 description 1
- 229960004961 mechlorethamine Drugs 0.000 description 1
- HAWPXGHAZFHHAD-UHFFFAOYSA-N mechlorethamine Chemical compound ClCCN(C)CCCl HAWPXGHAZFHHAD-UHFFFAOYSA-N 0.000 description 1
- 239000002609 medium Substances 0.000 description 1
- 201000001441 melanoma Diseases 0.000 description 1
- GLVAUDGFNGKCSF-UHFFFAOYSA-N mercaptopurine Chemical compound S=C1NC=NC2=C1NC=N2 GLVAUDGFNGKCSF-UHFFFAOYSA-N 0.000 description 1
- 229960001428 mercaptopurine Drugs 0.000 description 1
- 230000004066 metabolic change Effects 0.000 description 1
- 229910052751 metal Inorganic materials 0.000 description 1
- 239000002184 metal Chemical class 0.000 description 1
- 230000009401 metastasis Effects 0.000 description 1
- 229960000485 methotrexate Drugs 0.000 description 1
- 229960004584 methylprednisolone Drugs 0.000 description 1
- 210000004688 microtubule Anatomy 0.000 description 1
- 210000003470 mitochondria Anatomy 0.000 description 1
- 230000004065 mitochondrial dysfunction Effects 0.000 description 1
- 229960000350 mitotane Drugs 0.000 description 1
- 230000004048 modification Effects 0.000 description 1
- 238000012986 modification Methods 0.000 description 1
- 238000003032 molecular docking Methods 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 229960004866 mycophenolate mofetil Drugs 0.000 description 1
- RTGDFNSFWBGLEC-SYZQJQIISA-N mycophenolate mofetil Chemical compound COC1=C(C)C=2COC(=O)C=2C(O)=C1C\C=C(/C)CCC(=O)OCCN1CCOCC1 RTGDFNSFWBGLEC-SYZQJQIISA-N 0.000 description 1
- 210000004985 myeloid-derived suppressor cell Anatomy 0.000 description 1
- AXTAPYRUEKNRBA-JTQLQIEISA-N n-[(2s)-1-amino-3-(3,4-difluorophenyl)propan-2-yl]-5-chloro-4-(4-chloro-2-methylpyrazol-3-yl)furan-2-carboxamide Chemical compound CN1N=CC(Cl)=C1C1=C(Cl)OC(C(=O)N[C@H](CN)CC=2C=C(F)C(F)=CC=2)=C1 AXTAPYRUEKNRBA-JTQLQIEISA-N 0.000 description 1
- 229930014626 natural product Natural products 0.000 description 1
- 229940086322 navelbine Drugs 0.000 description 1
- 229960004927 neomycin Drugs 0.000 description 1
- 201000008026 nephroblastoma Diseases 0.000 description 1
- 201000002120 neuroendocrine carcinoma Diseases 0.000 description 1
- 230000007135 neurotoxicity Effects 0.000 description 1
- 231100000228 neurotoxicity Toxicity 0.000 description 1
- 230000003472 neutralizing effect Effects 0.000 description 1
- 210000000440 neutrophil Anatomy 0.000 description 1
- 229960002653 nilutamide Drugs 0.000 description 1
- XWXYUMMDTVBTOU-UHFFFAOYSA-N nilutamide Chemical compound O=C1C(C)(C)NC(=O)N1C1=CC=C([N+]([O-])=O)C(C(F)(F)F)=C1 XWXYUMMDTVBTOU-UHFFFAOYSA-N 0.000 description 1
- 239000002840 nitric oxide donor Substances 0.000 description 1
- 108020001162 nitroreductase Proteins 0.000 description 1
- OSTGTTZJOCZWJG-UHFFFAOYSA-N nitrosourea Chemical compound NC(=O)N=NO OSTGTTZJOCZWJG-UHFFFAOYSA-N 0.000 description 1
- 229950006344 nocodazole Drugs 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 238000007899 nucleic acid hybridization Methods 0.000 description 1
- 238000002515 oligonucleotide synthesis Methods 0.000 description 1
- 238000011275 oncology therapy Methods 0.000 description 1
- 210000003463 organelle Anatomy 0.000 description 1
- 150000007524 organic acids Chemical class 0.000 description 1
- 235000005985 organic acids Nutrition 0.000 description 1
- 229960001756 oxaliplatin Drugs 0.000 description 1
- DWAFYCQODLXJNR-BNTLRKBRSA-L oxaliplatin Chemical compound O1C(=O)C(=O)O[Pt]11N[C@@H]2CCCC[C@H]2N1 DWAFYCQODLXJNR-BNTLRKBRSA-L 0.000 description 1
- 230000000242 pagocytic effect Effects 0.000 description 1
- 229960002340 pentostatin Drugs 0.000 description 1
- FPVKHBSQESCIEP-JQCXWYLXSA-N pentostatin Chemical compound C1[C@H](O)[C@@H](CO)O[C@H]1N1C(N=CNC[C@H]2O)=C2N=C1 FPVKHBSQESCIEP-JQCXWYLXSA-N 0.000 description 1
- 239000000137 peptide hydrolase inhibitor Substances 0.000 description 1
- SZFPYBIJACMNJV-UHFFFAOYSA-N perifosine Chemical compound CCCCCCCCCCCCCCCCCCOP([O-])(=O)OC1CC[N+](C)(C)CC1 SZFPYBIJACMNJV-UHFFFAOYSA-N 0.000 description 1
- 210000005259 peripheral blood Anatomy 0.000 description 1
- 239000011886 peripheral blood Substances 0.000 description 1
- 230000002688 persistence Effects 0.000 description 1
- 230000002085 persistent effect Effects 0.000 description 1
- 239000000546 pharmaceutical excipient Substances 0.000 description 1
- 238000001050 pharmacotherapy Methods 0.000 description 1
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 1
- 150000003904 phospholipids Chemical class 0.000 description 1
- 102000020233 phosphotransferase Human genes 0.000 description 1
- 239000003757 phosphotransferase inhibitor Substances 0.000 description 1
- 230000003169 placental effect Effects 0.000 description 1
- 239000013612 plasmid Substances 0.000 description 1
- 239000000106 platelet aggregation inhibitor Substances 0.000 description 1
- 238000007747 plating Methods 0.000 description 1
- 229910052697 platinum Inorganic materials 0.000 description 1
- 238000003752 polymerase chain reaction Methods 0.000 description 1
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 1
- 231100000683 possible toxicity Toxicity 0.000 description 1
- 229960005205 prednisolone Drugs 0.000 description 1
- OIGNJSKKLXVSLS-VWUMJDOOSA-N prednisolone Chemical compound O=C1C=C[C@]2(C)[C@H]3[C@@H](O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 OIGNJSKKLXVSLS-VWUMJDOOSA-N 0.000 description 1
- 229960004618 prednisone Drugs 0.000 description 1
- XOFYZVNMUHMLCC-ZPOLXVRWSA-N prednisone Chemical compound O=C1C=C[C@]2(C)[C@H]3C(=O)C[C@](C)([C@@](CC4)(O)C(=O)CO)[C@@H]4[C@@H]3CCC2=C1 XOFYZVNMUHMLCC-ZPOLXVRWSA-N 0.000 description 1
- 238000002360 preparation method Methods 0.000 description 1
- 239000003755 preservative agent Substances 0.000 description 1
- 230000008569 process Effects 0.000 description 1
- 229940097325 prolactin Drugs 0.000 description 1
- 230000009696 proliferative response Effects 0.000 description 1
- XEYBRNLFEZDVAW-UHFFFAOYSA-N prostaglandin E2 Natural products CCCCCC(O)C=CC1C(O)CC(=O)C1CC=CCCCC(O)=O XEYBRNLFEZDVAW-UHFFFAOYSA-N 0.000 description 1
- 238000002731 protein assay Methods 0.000 description 1
- 239000003197 protein kinase B inhibitor Substances 0.000 description 1
- 108010015936 pseudorabies virus glycoprotein gH Proteins 0.000 description 1
- 150000003212 purines Chemical class 0.000 description 1
- 150000003230 pyrimidines Chemical class 0.000 description 1
- 230000005855 radiation Effects 0.000 description 1
- 229940044551 receptor antagonist Drugs 0.000 description 1
- 239000002464 receptor antagonist Substances 0.000 description 1
- 238000010188 recombinant method Methods 0.000 description 1
- 230000009467 reduction Effects 0.000 description 1
- 210000003289 regulatory T cell Anatomy 0.000 description 1
- 108091008146 restriction endonucleases Proteins 0.000 description 1
- 238000012552 review Methods 0.000 description 1
- 102220000529 rs118203992 Human genes 0.000 description 1
- 108091008601 sVEGFR Proteins 0.000 description 1
- 238000012216 screening Methods 0.000 description 1
- 230000003248 secreting effect Effects 0.000 description 1
- 230000035945 sensitivity Effects 0.000 description 1
- 230000008313 sensitization Effects 0.000 description 1
- 108091006024 signal transducing proteins Proteins 0.000 description 1
- 102000034285 signal transducing proteins Human genes 0.000 description 1
- 208000000587 small cell lung carcinoma Diseases 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 238000000527 sonication Methods 0.000 description 1
- 238000004611 spectroscopical analysis Methods 0.000 description 1
- 210000000952 spleen Anatomy 0.000 description 1
- 239000003381 stabilizer Substances 0.000 description 1
- 239000002731 stomach secretion inhibitor Substances 0.000 description 1
- 229960005202 streptokinase Drugs 0.000 description 1
- 229960001052 streptozocin Drugs 0.000 description 1
- ZSJLQEPLLKMAKR-GKHCUFPYSA-N streptozocin Chemical compound O=NN(C)C(=O)N[C@H]1[C@@H](O)O[C@H](CO)[C@@H](O)[C@@H]1O ZSJLQEPLLKMAKR-GKHCUFPYSA-N 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 239000000126 substance Substances 0.000 description 1
- 238000005987 sulfurization reaction Methods 0.000 description 1
- 230000020382 suppression by virus of host antigen processing and presentation of peptide antigen via MHC class I Effects 0.000 description 1
- 238000002198 surface plasmon resonance spectroscopy Methods 0.000 description 1
- 239000004094 surface-active agent Substances 0.000 description 1
- 238000001356 surgical procedure Methods 0.000 description 1
- 239000000725 suspension Substances 0.000 description 1
- 230000002195 synergetic effect Effects 0.000 description 1
- 238000007910 systemic administration Methods 0.000 description 1
- 229960001603 tamoxifen Drugs 0.000 description 1
- 238000002626 targeted therapy Methods 0.000 description 1
- DKPFODGZWDEEBT-QFIAKTPHSA-N taxane Chemical class C([C@]1(C)CCC[C@@H](C)[C@H]1C1)C[C@H]2[C@H](C)CC[C@@H]1C2(C)C DKPFODGZWDEEBT-QFIAKTPHSA-N 0.000 description 1
- 210000001550 testis Anatomy 0.000 description 1
- ZRKFYGHZFMAOKI-QMGMOQQFSA-N tgfbeta Chemical compound C([C@H](NC(=O)[C@H](C(C)C)NC(=O)CNC(=O)[C@H](CCC(O)=O)NC(=O)[C@H](CCCNC(N)=N)NC(=O)[C@H](CC(N)=O)NC(=O)[C@H](CC(C)C)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CCC(O)=O)NC(=O)[C@H]([C@@H](C)O)NC(=O)[C@H](CC(C)C)NC(=O)CNC(=O)[C@H](C)NC(=O)[C@H](CO)NC(=O)[C@H](CCC(N)=O)NC(=O)[C@@H](NC(=O)[C@H](C)NC(=O)[C@H](C)NC(=O)[C@@H](NC(=O)[C@H](CC(C)C)NC(=O)[C@@H](N)CCSC)C(C)C)[C@@H](C)CC)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](C(C)C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](C)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H]([C@@H](C)O)C(=O)N[C@@H](CC(N)=O)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](C)C(=O)N[C@@H](CC=1C=CC=CC=1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](C)C(=O)N[C@@H](CC(C)C)C(=O)N1[C@@H](CCC1)C(=O)N1[C@@H](CCC1)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CCC(O)=O)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CO)C(=O)N[C@@H](CCCNC(N)=N)C(=O)N[C@@H](CC(C)C)C(=O)N[C@@H](CC(C)C)C(O)=O)C1=CC=C(O)C=C1 ZRKFYGHZFMAOKI-QMGMOQQFSA-N 0.000 description 1
- 229940021747 therapeutic vaccine Drugs 0.000 description 1
- 229940094937 thioredoxin Drugs 0.000 description 1
- 229960001196 thiotepa Drugs 0.000 description 1
- 229960004072 thrombin Drugs 0.000 description 1
- 210000001541 thymus gland Anatomy 0.000 description 1
- 229960005001 ticlopidine Drugs 0.000 description 1
- PHWBOXQYWZNQIN-UHFFFAOYSA-N ticlopidine Chemical compound ClC1=CC=CC=C1CN1CC(C=CS2)=C2CC1 PHWBOXQYWZNQIN-UHFFFAOYSA-N 0.000 description 1
- 229960003087 tioguanine Drugs 0.000 description 1
- 229960000187 tissue plasminogen activator Drugs 0.000 description 1
- 229940044693 topoisomerase inhibitor Drugs 0.000 description 1
- 229960000303 topotecan Drugs 0.000 description 1
- UCFGDBYHRUNTLO-QHCPKHFHSA-N topotecan Chemical compound C1=C(O)C(CN(C)C)=C2C=C(CN3C4=CC5=C(C3=O)COC(=O)[C@]5(O)CC)C4=NC2=C1 UCFGDBYHRUNTLO-QHCPKHFHSA-N 0.000 description 1
- 239000003053 toxin Substances 0.000 description 1
- 231100000765 toxin Toxicity 0.000 description 1
- 230000005030 transcription termination Effects 0.000 description 1
- 239000012096 transfection reagent Substances 0.000 description 1
- 230000010474 transient expression Effects 0.000 description 1
- 230000014621 translational initiation Effects 0.000 description 1
- 102000035160 transmembrane proteins Human genes 0.000 description 1
- 108091005703 transmembrane proteins Proteins 0.000 description 1
- 229960000575 trastuzumab Drugs 0.000 description 1
- 229960001727 tretinoin Drugs 0.000 description 1
- 229950003873 triciribine Drugs 0.000 description 1
- HOGVTUZUJGHKPL-HTVVRFAVSA-N triciribine Chemical compound C=12C3=NC=NC=1N(C)N=C(N)C2=CN3[C@@H]1O[C@H](CO)[C@@H](O)[C@H]1O HOGVTUZUJGHKPL-HTVVRFAVSA-N 0.000 description 1
- 230000004614 tumor growth Effects 0.000 description 1
- 230000000381 tumorigenic effect Effects 0.000 description 1
- 125000001493 tyrosinyl group Chemical group [H]OC1=C([H])C([H])=C(C([H])=C1[H])C([H])([H])C([H])(N([H])[H])C(*)=O 0.000 description 1
- 241000712461 unidentified influenza virus Species 0.000 description 1
- 229950005787 uprosertib Drugs 0.000 description 1
- 229960005356 urokinase Drugs 0.000 description 1
- 229960005486 vaccine Drugs 0.000 description 1
- GBABOYUKABKIAF-IELIFDKJSA-N vinorelbine Chemical compound C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC GBABOYUKABKIAF-IELIFDKJSA-N 0.000 description 1
- 229960002066 vinorelbine Drugs 0.000 description 1
- CILBMBUYJCWATM-PYGJLNRPSA-N vinorelbine ditartrate Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O.OC(=O)[C@H](O)[C@@H](O)C(O)=O.C1N(CC=2C3=CC=CC=C3NC=22)CC(CC)=C[C@H]1C[C@]2(C(=O)OC)C1=CC([C@]23[C@H]([C@@]([C@H](OC(C)=O)[C@]4(CC)C=CCN([C@H]34)CC2)(O)C(=O)OC)N2C)=C2C=C1OC CILBMBUYJCWATM-PYGJLNRPSA-N 0.000 description 1
- 108010065816 zeta chain antigen T cell receptor Proteins 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/461—Cellular immunotherapy characterised by the cell type used
- A61K39/4613—Natural-killer cells [NK or NK-T]
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4632—T-cell receptors [TCR]; antibody T-cell receptor constructs
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K39/00—Medicinal preparations containing antigens or antibodies
- A61K39/46—Cellular immunotherapy
- A61K39/463—Cellular immunotherapy characterised by recombinant expression
- A61K39/4637—Other peptides or polypeptides
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61P—SPECIFIC THERAPEUTIC ACTIVITY OF CHEMICAL COMPOUNDS OR MEDICINAL PREPARATIONS
- A61P35/00—Antineoplastic agents
Definitions
- the present invention relates to genetically modified Natural Killer (NK) cells expressing a chimeric receptor polypeptide (e.g., Chimeric Antigen Receptor or CAR) and a metabolism modulating polypeptide.
- NK Natural Killer
- the present invention further relates to CAR-NK cells and the use of CAR-NK cells in particular for treating cancer.
- BACKGROUND OF DISCLOSURE Cancer immunotherapy including cell-based therapy, is used to provoke immune responses attacking tumor cells while sparing normal tissues.
- Cell-based therapy may involve cytotoxic T cells having reactivity skewed toward cancer cells (Eshhar et al., Proc Natl Acad Sci U S A, 90(2): 720-724 (1993); Geiger et al., The Journal of Immunology, 162(10): 5931-5939 (1999); Brentjens et al., Nat Med, 9(3): 279-286 (2003); Cooper et al., Blood, 101(4): 1637-1644 (2003); Imai et al., Leukemia, 18(4): 676-684 (2004)).
- TME tumor microenvironment 1 DM_US 198678773-1.112309.0120
- TME tumor microenvironment 1 DM_US 198678773-1.112309.0120
- TME tumor microenvironment 1 DM_US 198678773-1.112309.0120
- the present disclosure is based on the development of strategies to divert or redirect glucose metabolites, increase glucose uptake, modulate glycolysis, the Krebs cycle, intracellular lactate concentration, amino acid uptake and/or its conversion in NK cells, including those that express a chimeric receptor polypeptide, such as an antibody-coupled T- cells receptor (ACTR) polypeptide or a chimeric antigen receptor (CAR) polypeptide, for use in cell-based immune therapy.
- a chimeric receptor polypeptide such as an antibody-coupled T- cells receptor (ACTR) polypeptide or a chimeric antigen receptor (CAR) polypeptide
- Such metabolic modulation may be achieved by expressing or over-expressing at least one of the selected metabolism modulating polypeptides such as those described herein.
- the present disclosure provides genetically engineered NK cells expressing at least one metabolism modulating polypeptide as disclosed herein.
- the at least one metabolism modulating polypeptide is encoded by an exogenous nucleic acid introduced into the NK cells.
- Such genetically engineered NK cells are expected to have an enhanced metabolic activity relative to native immune cells of the same type, for example, in a low glucose, low amino acid, low pH, and/or hypoxic environment (e.g., in a tumor microenvironment (TME)).
- TEE tumor microenvironment
- Exemplary metabolism modulating polypeptides include TP53- inducible glycolysis and apoptosis regulator (TIGAR), glucose importation factor Glucose Transporter1 (GLUT1), Glutamic-oxaloacetic transaminase 2 (GOT2), L-Lactate Dehydrogenase A (LDHA), Pyruvate dehydrogenase Kinase 1 (PDK1), Cystathionine gamma- lyase (CTH), Argininosuccinate synthase (ASS1) and Phosphoserine Phosphatase (PSPH).
- TIGAR TP53- inducible glycolysis and apoptosis regulator
- GLUT1 glucose importation factor Glucose Transporter1
- GTT2 Glutamic-oxaloacetic transaminase 2
- LDHA L-Lactate Dehydrogenase A
- PDK1 Pyruvate dehydrogenase
- NK cells co-expressing at least one metabolism modulating polypeptide such as those disclosed herein and a chimeric receptor polypeptide would exhibit superior bioactivities (e.g., under low glucose, low amino acid, low pH, and/or hypoxic conditions), for example, cell proliferation, activation (e.g., increased cytokine production, e.g., IL-2 or IFN- ⁇ production), cytotoxicity, and/or in vivo anti-tumor activity.
- the metabolism modulating polypeptide redirects glucose metabolites may divert or redirect substrates out of the glycolysis pathway indirectly by 2 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) decreasing the rate of glucose breakdown in the glycolysis pathway. Examples include TIGAR or the GLUT1.
- the metabolism modulating polypeptide modulates the Krebs cycle via an enzyme that catalyzes a reaction of the Krebs cycle.
- GOT2 is GOT2.
- the metabolism modulating polypeptide is an enzyme involved in lactate synthesis, for example, LDHA.
- the metabolism modulating polypeptide is an enzyme that inhibits a pathway that competes for lactate-synthesis substrates, for example, PDK1.
- the metabolism modulating polypeptides modulate the intracellular concentration of amino acids by increasing amino acid synthesis. Examples include CTH, ASS1 and PSPH.
- selected metabolism modulating polypeptides that are expected to enhance metabolic readouts in NK cells genetically modified by expressing/overexpressing nucleic acids encoding such a metabolism modulating polypeptide.
- the modified NK cells further express a chimeric receptor polypeptide, which comprises (a) an extracellular target binding domain; (b) a transmembrane domain; and (c) a cytoplasmic signaling domain.
- the disclosure relates to a genetically engineered NK cell, which (i) express or overly expresses at least one metabolism modulating polypeptide selected from the group consisting of GOT2, GLUT1, LDHA, PDK1, TIGAR, CTH, ASS1 and PSPH; and (ii) expresses a chimeric receptor polypeptide; wherein the chimeric receptor polypeptide comprises (a) an extracellular target binding domain; (b) a transmembrane domain; and (c) at least one cytoplasmic signaling domain. Any of the chimeric polypeptides disclosed herein may further comprise at least one co-stimulatory signaling domain.
- the chimeric receptor polypeptide may be free of co-stimulatory signaling domains.
- the chimeric receptor polypeptide is an antibody-coupled T cell receptor (ACTR), which comprises an extracellular Fc-binding domain (a).
- the chimeric receptor is a chimeric antigen receptor (CAR), which comprises an extracellular antigen binding domain (a).
- the genetically engineered NK cells described herein may comprise a nucleic acid or a nucleic acid set, which collectively comprises: (A) a first nucleotide sequence encoding the at least one metabolism modulating polypeptide as disclosed herein; and (B) a second nucleotide sequence encoding the chimeric receptor polypeptide as also disclosed herein.
- the present disclosure provides a pharmaceutical composition, comprising the NK cells of the present invention described herein and a pharmaceutically 3 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) acceptable carrier.
- a method for inhibiting and/or killing cells expressing a target antigen comprising administering to a subject in need thereof a population of the NK cells described herein.
- the subject e.g., a human patient such as a human patient suffering from a cancer
- an anti-cancer therapy e.g., an anti-cancer agent
- the disclosure relates to a nucleic acid or nucleic acid set, which collectively comprises: (A) a first nucleotide sequence encoding the at least one metabolism modulating polypeptide as disclosed herein; and (B) a second nucleotide sequence encoding the chimeric receptor polypeptide as also disclosed herein.
- FIG. 1 is an immunoblot showing transgene expression upon retroviral transduction with CAR only or CAR and transgene (GOT2 and TIGAR) relative to mock transduced control (null) in NK92 cells.
- FIGs. 2A and 2B are flow cytometric plots depicting CAR expression upon retroviral transduction with CAR only (right panel in FIG.2A) or CAR and transgene GOT2 (right panel) and TIGAR (left panel (FIG.2B) relative to mock transduced control (null, left panel in FIG. 2A) in NK92 cells.
- DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) DETAILED DESCRIPTION OF DISCLOSURE
- Immune cell therapy involving genetically engineered immune cells, especially with T cells has shown promising effects in cancer therapy.
- One approach is to express a chimeric receptor having an antigen-binding domain (CAR) fused to one or more T cell activation signaling domains. Binding of a cancer antigen via the antigen-binding domain results in T cell activation and triggers cytotoxicity.
- CAR antigen-binding domain
- NK cells natural killer cells
- the innate immune cells known to exhibit high anti-tumor, anti-viral and anti-microbial activity. They exhibit unique advantages such as low risk of on-target/off-tumor toxicity in normal tissues, cytokine release syndrome and neurotoxicity. They also exhibit natural cytotoxicity against tumor cells.
- an off-the-shelf cell therapy product may be prepared (Schmidt et al., Front Immunol, 11: 611163 (2020); Wang et al., Cancer Lett, 472: 175-180 (2020); Xie et al., EBioMedicine, 59: 102975 (2020); Gong et al., J Hematol Oncol, 14(1): 73 (2021); Wrona et al., Int J Mol Sci, 22(11): (2021)).
- NK cells expressing a chimeric receptor polypeptide also called “CAR-NK cells” may have increased effector functions such as increased inflammatory cytokine production, antigen acquisition and presentation or ability to activate adaptive immune responses.
- Another approach is to express an antibody-coupled T cell Receptor (ACTR) polypeptide in a NK cell, the ACTR polypeptide containing an extracellular Fc-binding domain.
- ACTR antibody-coupled T cell Receptor
- ACTR-expressing NK cells also called “ACTR-NK cells”
- they may enhance toxicity against cancer cells targeted by the antibody via their binding to the Fc domain of the antibody
- 5 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00)
- Tumor microenvironments (TME) have specific characteristics, such as low glucose, low amino acid, low pH, and/or hypoxic conditions, some of which may constrain the activity of NK cells.
- TME Tumor microenvironments
- the present disclosure is based, at least in part, on the development of strategies for enhancing NK cell activities in the TME.
- the present disclosure features methods for enhancing the metabolic activity of the NK cells (e.g., diverting or re-directing one or more glucose metabolites out of the glycolysis pathway) in the NK cells, thereby enhancing their growth and bioactivity.
- the present disclosure provides genetically engineered NK cells that possess altered glucose metabolism and/or uptake, lactate production and enhanced amino acid synthesis as compared with a native NK cell.
- modified NK cells that have for e.g., altered intracellular regulation of glucose concentrations, capacity for an increased rate of glycolysis or intracellular lactate concentrations relative to the wild-type NK cells.
- the modified NK cells may express or overly express the metabolism modulating polypeptide for example, a polypeptide that diverts or redirects glucose metabolites out of the glycolysis pathway.
- the modified NK cell may be engineered to transfect at least one exogenous nucleic acid encoding at least two metabolism modulating polypeptides for producing additional amount of the polypeptide in the modified immune cell.
- Such genetically engineered NK cells express or overly express at least one metabolism modulating polypeptide to enhance the metabolism in the NK cells and express a chimeric receptor polypeptide comprising an extracellular target binding domain, a transmembrane domain and a cytoplasmic signaling domain, e.g., an antibody-coupled T cell receptor (ACTR) polypeptide or, preferably, a chimeric antigen receptor (CAR) polypeptide.
- a chimeric receptor polypeptide comprising an extracellular target binding domain, a transmembrane domain and a cytoplasmic signaling domain, e.g., an antibody-coupled T cell receptor (ACTR) polypeptide or, preferably, a chimeric antigen receptor (CAR) polypeptide.
- ACTR antibody-coupled T cell receptor
- CAR chimeric antigen receptor
- a modified NK cell expressing at least one polypeptide refers to a genetically engineered NK cell into which one or more exogenous nucleic acids encoding at least one metabolism modulating polypeptides are introduced such that the encoded metabolism modulating polypeptides are expressed in the resulting modified NK cell, while the unmodified NK cell does not express such a metabolism modulating polypeptide.
- TIGAR was found to be not detectable by immunoblotting in mock transduced NK92 cells (see FIG. 1).
- a modified NK cell overly expressing at least one of the polypeptides that modulate metabolism refers to a genetically engineered NK cell, which is engineered to enhance the expression level of the metabolism modulating polypeptide as relative to the unmodified NK cell.
- GOT2 was 6 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) found have a basic expression in mock transduced NK92 cells, whereas retroviral transduction with CAR and GOT2 lead to a detectable increased GOT2 expression using immunoblotting (see FIG.1).
- metabolism modulating polypeptide is overly expressed compared to a native NK cell, e.g., by polypeptides encoded by a transgene introduced into the immune cells (e.g., exogenous to the NK cells). Expression or overexpression can be determined in analogy as shown for TIGAR and GOT2 respectively in Example 14.
- NK cells for improving NK cell proliferation, and/or an inhibiting or decreasing target cells (e.g., target cancer cells) in a subject (e.g., a human cancer patient), e.g., via CAR-NK mediated or ACTR-NK mediated cell killing.
- target cancer cells e.g., target cancer cells
- the genetically engineered NK cells may proliferate better, produce more preferably cytotoxic cytokines, exhibit greater anti-tumor cytotoxicity, and/or exhibit greater survival of the respective genetically engineered NK cells in a low-glucose, low amino acid, low pH, and/or hypoxic environment (e.g., a TME) relative to NK cells that do not express or do not over-express the at least one metabolism modulating polypeptide selected from GOT2, GLUT1, LDHA, PDK1, TIGAR, CTH, ASS1 and PSPH, as further described below, leading to enhanced cytokine production, survival rate, cytotoxicity, and/or anti-tumor activity.
- a low-glucose, low amino acid, low pH, and/or hypoxic environment e.g., a TME
- the at least one metabolism modulating polypeptide selected from GOT2, GLUT1, LDHA, PDK1, TIGAR, CTH, ASS1 and PSPH,
- Metabolism Modulating Polypeptides refer to polypeptides that regulate a metabolism pathway, for example, re-directing glucose metabolites out of the glycolysis pathway, increasing glucose uptake, modulating Krebs cycle, modulating intracellular lactate concentration, increasing amino acid uptake and/or its conversion.
- Exemplary metabolism modulating polypeptides for use in making the genetically engineered NK cells disclosed herein may include GOT2, GLUT1, LDHA, PDK1, TIGAR, CTH, ASS1 and PSPH.
- the at least one metabolism modulating polypeptide reduces the function of an enzyme in the glycolysis pathway.
- TIGAR metabolism modulating polypeptide
- TIGAR functions to block glycolysis and re-direct glucose metabolites into the pentose phosphate shunt pathway.
- TIGAR 7 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) is in direct opposition with PFKFB3 with respect to their shared regulation of fructose-2,6- bisphosphate, a molecule that increases the activity of the glycolytic pathway enzyme PFK.
- TIGAR degrades fructose-2,6-bisphosphate which effectively slows down the enzymatic rate of PFK. This allows for more glucose metabolites to be re-directed into nucleotide synthesis and glycosylation pathways, e.g., the pentose phosphate shunt pathway. Elevated TIGAR expression or activity levels increase the re-direction of glucose metabolites away from the glycolysis pathway.
- the amino acid sequence of an exemplary human TIGAR is provided in Table 1 below.
- TIGAR is human TIGAR (e.g., SEQ ID NO: 75).
- TIGAR encompasses functional equivalents of TIGAR
- a functional equivalent of TIGAR is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human TIGAR (e.g., SEQ ID NO: 75).
- the at least one metabolism modulating polypeptide modulates the Krebs cycle and/or links various metabolic pathways such as the metabolic pathways for processing glucose, amino acids and/or fatty acids.
- the metabolism modulating polypeptide is GOT2 (disclosed in WO2020/037066, the relevant disclosures of which are incorporated by reference for the subject matter and purpose referenced herein).
- the GOT2 polypeptide modulates the Krebs cycle as a metabolic substrate located within the inner mitochondria.
- GOT2 is human GOT2 (e.g., SEQ ID NO: 77).
- the term “GOT2” encompasses functional equivalents of GOT2 (, whereas a functional equivalent of GOT2 is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human GOT2 (e.g., SEQ ID NO: 77).
- the at least one metabolism modulating polypeptide mediates glucose uptake (i.e., increases glucose import) across the plasma membrane of cells, which is also known as glucose importation polypeptides.
- GLUT1 Glucose Transporter 1
- SEQ ID NO: 76 human GLUT1(e.g., SEQ ID NO: 76).
- GLUT1 encompasses functional equivalents of GLUT1, whereas a functional equivalent of GLUT1 is a polypeptide having at least 85%, 8 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) preferably at least 90%, more preferably at least 95% sequence identity with human GLUT1 (e.g., SEQ ID NO: 76).
- the at least one metabolism modulating polypeptide is a lactate modulating factor that can be either involved in lactate synthesis.
- the metabolism modulating polypeptide LDHA (disclosed in WO2020/051493, the relevant disclosures of which are incorporated by reference for the subject matter and purpose referenced herein).
- LDHA is a dehydrogenase enzyme that catalyzes the interconversion of pyruvate, a key molecule in the Krebs cycle, and lactate.
- the over-expression of LDHA may facilitate the conversion of lactate into pyruvate as a cell’s store of pyruvate is diminished at times of high metabolic activity. This leads to an increase in the intracellular concentration of pyruvate and a decrease in the intracellular concentration of lactate and has the effect of providing flux into the Krebs cycle and increasing the transport of lactate. Accordingly, elevated expression or activity of LDHA increases the transport of lactate, leading to an ultimate elevated intracellular lactate concentration.
- the amino acid sequence of an exemplary human LDHA is provided in Table 1 below.
- LDHA encompasses functional equivalents of LDHA
- a functional equivalent of LDHA is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human LDHA (e.g., SEQ ID NO: 71).
- the at least one metabolism modulating polypeptides is an enzyme that inhibits a pathway competing for substrates used in lactate synthesis.
- Such a metabolism modulating polypeptide may be PDK1 (disclosed in WO2020/051493, the relevant disclosures of which are incorporated by reference for the subject matter and purpose referenced herein).
- PDK1 is a kinase which acts to inhibit pyruvate dehydrogenase (such as PDHA1), a component of the pyruvate dehydrogenase complex, via phosphorylation.
- pyruvate dehydrogenase such as PDHA1
- the pyruvate dehydrogenase complex converts pyruvate into acetyl-CoA through decarboxylation.
- Increased PDK1 expression or activity and subsequent inhibition of pyruvate dehydrogenase increases the amount of pyruvate available for LDHA-mediated conversion to lactate.
- the amino acid sequence of an exemplary human PDK1 is provided in Table 1 below.
- PDK1 encompasses functional equivalents of PDK1, whereas a functional equivalent of PDK1 is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human PDK1 (e.g., SEQ ID NO: 79).
- 9 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00)
- at least one metabolism modulating polypeptide capable of modulating the intracellular concentration of amino acids include ASS1, PSHP or CTH. These polypeptides modulate the intracellular concentration of amino acids and increase amino acid synthesis (e.g., an enzyme that stimulates amino acid synthesis or the conversion of an amino acid into another molecule).
- ASS1 catalyzes the penultimate step of the arginine biosynthetic pathway
- PSPH catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine
- CTH catalyzes the last step of the trans-sulfuration pathway, interconverting cystathionine with cysteine.
- the amino acid sequence of exemplary human ASS1, PSPH and CTH are provided in Table 1.
- human ASS1 e.g., SEQ ID NO: 80
- human PSPH e.g., SEQ ID NO: 81
- human CTH e.g., SEQ ID NO: 82
- ASS1 encompasses functional equivalents of ASS1 (e.g., SEQ ID NO: 80), whereas a functional equivalent of ASS1 is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human ASS1 (e.g., SEQ ID NO: 80).
- PSPH encompasses functional equivalents of PSPH, whereas a functional equivalent of PSPH is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human PSPH (e.g., SEQ ID NO: 81).
- CTH encompasses functional equivalents of CTH (e.g., SEQ ID NO: 82), whereas a functional equivalent of CTH is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human CTH (e.g., SEQ ID NO: 82).
- the metabolism modulating polypeptides may be naturally-occurring polypeptides from a suitable species, for example, a mammalian glucose importation polypeptide such as those derived from human or a non-human primate. Such naturally-occurring polypeptides are known in the art and can be obtained, for example, using any of the above-noted amino acid sequences as a query to search a publicly available gene database, for example GenBank.
- the metabolism modulating polypeptides for use in the instant disclosure may share a sequence identity of at least 85% (e.g., 90%, 95%, 97%, 98%, 99%, or above) as any of the exemplary proteins noted above.
- the “percent identity” of two amino acid sequences is determined using the algorithm of (Karlin and Altschul, Proc Natl Acad Sci U S A, 87(6): 2264-2268 (1990)), modified as in (Karlin and Altschul, Proc Natl Acad Sci U S A, 90(12): 5873-5877 (1993)).
- Gapped BLAST can be utilized as described in (Altschul et al., Nucleic Acids Res, 25(17): 3389-3402 (1997)).
- the metabolism modulating polypeptides may be a functional variant of a native counterpart.
- a functional variant may contain one or more mutations outside the functional domain(s) of the native counterpart.
- Functional domains of a native metabolism modulating polypeptides may be known in the art or can be predicted based on its amino acid sequence. Mutations outside the functional domain(s) would not be expected to substantially affect the biological activity of the protein.
- the functional variant may exhibit an increased activity (for example, glucose uptake as relative to the native counterpart).
- the functional variant may exhibit a decreased activity in glucose uptake as relative to the native counterpart.
- the functional variant may have increased trafficking to the cell surface.
- the functional variant may have decreased trafficking to the cell surface.
- the functional variant may contain a conservative mutation(s)/substitution(s) at one or more positions in the native counterpart (e.g., up to 20 positions, up to 15 positions, up to 10 positions, up to 5, 4, 3, 2, 1 position(s)).
- a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made.
- Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g., Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989, or Current Protocols in Molecular Biology, F.M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York.
- Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D.
- Conservative Mutations that result still in functional variants include besides conservative substitutions small (e.g., 1 to 3 amino acids) insertions, deletions or inversions that do not result in altered relative charge or does not substantially change the size of the 11 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) protein.
- Table 1 below provides amino acid sequences of exemplary metabolism modulating polypeptides. Table 1.
- Polypeptides for Modulating Metabolism Sequences SEQ ID NO T IGAR MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLN 75 12 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Polypeptides Sequences SEQ ID NO PIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGN EDLTVKM DR VPLRKIDRLFNYMY TAPRPRVET RAVPLA F II.
- a chimeric receptor polypeptide refers to a non-naturally occurring molecule that can be expressed on the surface of an immune cell, here an NK cell, and comprises an extracellular target binding domain, a transmembrane domain and at least one cytoplasmic signaling domain.
- the extracellular target binding domain targets an antigen of interest (e.g., an antigen associated with a disease such as cancer or an antigen associated with a pathogen; see disclosures herein).
- an antigen of interest may bind to an antigen of interest directly (e.g., an extracellular antigen binding domain in a CAR polypeptide as disclosed herein), or may bind to the antigen of interest via an intermediate, for example, an Fc-containing agent such as an antibody.
- an Fc-containing agent such as an antibody.
- the transmembrane domain ankers the chimeric receptor polypeptide within the cellular membrane of the NK cell.
- the chimeric receptor polypeptides are configured such that, when expressed in an immune cell, i.e., NK cell, the extracellular target binding domain 13 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) is located extracellularly for binding to a target antigen, directly or indirectly, whereas the cytoplasmic signaling domain is located intracellularly to allow for signaling into the cell upon binding of the target binding domain to the target.
- a chimeric receptor polypeptide may further comprise a hinge domain, one or more co-stimulatory domains, or a combination thereof.
- the chimeric receptor polypeptide comprises one or more of the following features: (i) the chimeric receptor polypeptide further comprises a signal peptide at its N-terminus; (ii) the chimeric receptor polypeptide further comprises a hinge domain, which is located at the C-terminus of (a) and the N-terminus of (b); (iii) the chimeric receptor polypeptide is free of a hinge domain; (iv) the chimeric receptor polypeptide further comprises at least one co-stimulatory signaling domain; (v) the chimeric receptor polypeptide is free of a co-stimulatory signaling domain; (vi) the cytoplasmic signaling domain comprises an immunoreceptor tyrosine-based activation motif (ITAM); and (vii) the cytoplasmic signaling domain (c) is located at the C-terminus of the chimeric receptor polypeptide.
- ITAM immunoreceptor tyrosine-based activation motif
- a chimeric receptor polypeptide as described herein may comprise, from N-terminus to C-terminus, the extracellular target binding domain, the transmembrane domain, and the cytoplasmic signaling domain. In some embodiments, a chimeric receptor polypeptide as described herein comprises, from N-terminus to C-terminus, the extracellular target binding domain, the transmembrane domain, at least one co-stimulatory signaling domain, and the cytoplasmic signaling domain.
- a chimeric receptor polypeptide as described herein comprises, from N-terminus to C-terminus, the extracellular target binding domain, the transmembrane domain, the cytoplasmic signaling domains, and at least one co-stimulatory signaling domain.
- the chimeric receptor polypeptide can be an antibody-coupled T cell receptor (ACTR) polypeptide.
- an ACTR polypeptide refers to a non-naturally occurring molecule that can be expressed on the surface of an NK cell and comprises an extracellular domain with binding affinity and specificity for the Fc portion of an immunoglobulin (“Fc binder” or “Fc binding domain”), a transmembrane domain, and a cytoplasmic signaling domain.
- the ACTR polypeptides described herein may further include at least one co-stimulatory signaling domain.
- the chimeric receptor polypeptide disclosed herein may be a chimeric antigen receptor (CAR) polypeptide.
- a CAR polypeptide refers to a non-naturally occurring molecule that can be expressed on the 14 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) surface of an NK cell and comprises an extracellular antigen binding domain, a transmembrane domain, and a cytoplasmic signaling domain.
- the CAR polypeptides described herein may further include at least one co-stimulatory signaling domain.
- a protein X transmembrane domain refers to any portion of a given protein, i.e., transmembrane-spanning protein X, that is thermodynamically stable in a membrane.
- a protein X cytoplasmic signaling domain for example, a CD3 ⁇ cytoplasmic signaling domain, refers to any portion of a protein (protein X) that interacts with the interior of a cell or organelle and is capable of relaying a primary signal as known in the art, which leads to immune cell proliferation and/or activation.
- the cytoplasmic signaling domain as described herein differs from a co-stimulatory signaling domain, which relays a secondary signal for fully activating NK cells.
- a protein X co-stimulatory signaling domain e.g., a CD28 co-stimulatory signaling domain
- protein X such as CD28, 4-1BB, OX40, CD27, or ICOS
- co-stimulatory signals secondary signals
- immune cells such as NK cells
- the chimeric receptor polypeptides disclosed herein comprise an extracellular domain that targets an antigen of interest (e.g., those described herein) via either direct binding or indirectly binding (through an intermediate such as an antibody).
- the chimeric receptor polypeptides may be ACTR polypeptides that comprise a Fc binding domain.
- the chimeric receptor polypeptides may be CAR polypeptides that comprise an extracellular antigen binding domain.
- Fc binding domains The ACTR polypeptides described herein comprise an extracellular target binding domain that is an Fc binding domain, i.e., capable of binding to the Fc portion of an immunoglobulin (e.g., IgG, IgA, IgM, or IgE) of a suitable mammal (e.g., human, mouse, rat, goat, sheep, or monkey).
- Suitable Fc binding domains may be derived from naturally occurring proteins such as mammalian Fc receptors or certain bacterial proteins (e.g., protein A, protein 15 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) G).
- Fc binding domains may be synthetic polypeptides engineered specifically to bind the Fc portion of any of the antibodies described herein with high affinity and specificity.
- an Fc binding domain can be an antibody or an antigen-binding fragment thereof that specifically binds the Fc portion of an immunoglobulin. Examples include, but are not limited to, a single-chain variable fragment (scFv), a domain antibody, or single domain antibodies (e.g., nanobodies).
- an Fc binding domain can be a synthetic peptide that specifically binds the Fc portion, such as a Kunitz domain, a small modular immunopharmaceutical (SMIP), an adnectin, an avimer, an affibody, a DARPin, or an anticalin, which may be identified by screening a peptide combinatory library for binding activities to Fc.
- the Fc binding domain is an extracellular ligand-binding domain of a mammalian Fc receptor.
- an “Fc receptor” is a cell surface bound receptor that is expressed on the surface of many immune cells (including B cells, T cells and NK cells) and exhibits binding specificity to the Fc domain of an antibody.
- Fc receptors are typically comprised of at least two immunoglobulin (Ig)-like domains with binding specificity to an Fc (fragment crystallizable) portion of an antibody.
- binding of an Fc receptor to an Fc portion of the antibody may trigger antibody dependent cell-mediated cytotoxicity (ADCC) effects.
- the Fc receptor used for constructing an ACTR polypeptide as described herein may be a naturally occurring polymorphism variant (e.g., the CD16 V158 variant), which may have increased or decreased affinity to Fc as compared to a wild-type counterpart.
- the Fc receptor may be a functional variant of a wild-type counterpart, which carry one or more mutations (e.g., up to 10 amino acid residue substitutions including 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mutations) that alter the binding affinity to the Fc portion of an Ig molecule.
- the mutation may alter the glycosylation pattern of the Fc receptor and thus the binding affinity to Fc.
- Table 2 lists a number of exemplary polymorphisms in Fc receptor extracellular domains see, e.g., (Kim et al., Journal of Molecular Evolution, 53(1): 1-9 (2001)) which may be used in any of the methods or constructs described herein: 16 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Table 2.
- Exemplary Polymorphisms in Fc Receptors Amino Acid N umber 19 48 65 89 105 130 134 141 142 158 c recep ors are cass e ase on e so ype o e an o y o w c is able to bind.
- Fc-gamma receptors generally bind to IgG antibodies, such as one or more subtype thereof (i.e., IgG1, IgG2, IgG3, IgG4); Fc-alpha receptors (Fc ⁇ R) generally bind to IgA antibodies; and Fc-epsilon receptors (Fc ⁇ R) generally bind to IgE antibodies.
- the Fc receptor is an Fc ⁇ R receptor, an Fc ⁇ R, or an Fc ⁇ R.
- Fc ⁇ Rs include, without limitation, CD64A, CD64B, CD64C, CD32A, CD32B, CD16A, and CD16B.
- Fc ⁇ Rs are Fc ⁇ R1/CD89.
- Fc ⁇ Rs include, without limitation, Fc ⁇ RI and Fc ⁇ RII/CD23.
- Table 3 lists exemplary Fc receptors for use in constructing the ACTR polypeptides described herein and their binding activity to corresponding Fc domains: Table 3.
- Exemplary Fc Receptors Receptor name Principal antibody ligand Affinity for ligand 17 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Receptor name Principal antibody ligand Affinity for ligand Fc ⁇ RIIIB (CD16b) I G Low (Kd > 10 ⁇ 6 M)
- a peptides described herein will be apparent to one of skill in the art. For example, it may depend on factors such as the isotype of the antibody to which binding of the Fc receptor is desired and the desired affinity of the binding interaction.
- the Fc binding domain is the extracellular ligand-binding domain of CD16, which may incorporate a naturally occurring polymorphism that may modulate affinity for Fc.
- the Fc binding domain is the extracellular ligand-binding domain of CD16 incorporating a polymorphism at position 158 (e.g., valine or phenylalanine).
- the Fc binding domain is produced under conditions that alter its glycosylation state and its affinity for Fc.
- the amino acid sequences of human CD16A F158 and CD16A V158 variants are provided herewith with the F158 and V158 residue in bold/underlined.
- CD16A F158 (F158 bold/underlined) (SEQ ID NO: 83) MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNS TQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAP RWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYF CRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFS VKTNIRSSTRDWKDHKFKWRKDPQDK CD16A V158 (V158 bold/underlined) (SEQ ID NO: 84) MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNS TQWFHNESLISSQASSYFIDAATVD
- binding affinity refers to the apparent association constant or K A .
- K A is the reciprocal of the dissociation constant, K D .
- the extracellular ligand-binding domain of an Fc receptor domain of the ACTR polypeptides described herein may have a binding affinity K D of at least 10 -5 , 10 -6 , 10 -7 , 10 -8 , 10 -9 , 10 -10 M or lower for the Fc portion of antibody.
- the Fc binding domain has a high binding affinity for an antibody, isotype(s) of antibodies, or subtype(s) thereof, as compared to the binding affinity of the Fc binding domain to another antibody, isotype(s) of antibodies, or subtypes(s) thereof.
- the extracellular ligand-binding domain of an Fc receptor has specificity for an antibody, isotype(s) of antibodies, or subtype(s) thereof, as compared to binding of the extracellular ligand-binding domain of an Fc receptor to another antibody, isotype(s) of antibodies, or subtypes(s) thereof.
- Extracellular antigen binding domains may also be used in the ACTR constructs described herein including, for example, those described in WO2015/058018A1 and WO2018/140960, the relevant disclosures of each of which are incorporated by reference for the purpose and subject matter referenced herein.
- Extracellular antigen binding domains The CAR polypeptides described herein comprise an extracellular antigen binding domain, which re-directs the specificity of NK cells expressing the CAR polypeptide.
- an extracellular antigen binding domain refers to a peptide or polypeptide having binding specificity to a target antigen of interest, which can be a naturally occurring antigen.
- target antigen may be any molecule that is associated with a disease or condition, including, but are not limited to, tumor antigens, pathogenic antigens (e.g., bacterial, fungal, or viral), or antigens present on diseased cells, such as those described herein.
- the target antigen binding domain targets a native tumor antigen protein.
- the target antigen binding domain targets a variant (e.g., mutation) of a tumor 19 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) antigen protein.
- EGFRvIII scFv recognizes the tumor specific variant of EGFR (Wang, Jiang et al., Cancer Lett, 472: 175-180 (2020)).
- the extracellular antigen binding domains are tumor antigens, pathogenic antigens and immune cells specific to an autoantigen (Gubin et al., J Clin Invest, 125(9): 3413-3421 (2015); Linnemann et al., Nat Med, 21(1): 81-85 (2015)).
- Respective diseases and/or conditions to be treated include tumors, inflammatory conditions and auto- immune disorders.
- the antigen is selectively expressed or overexpressed on cells of the disease or condition, e.g., the tumor or pathogenic cells, as compared to normal or non-targeted cells or tissues.
- the extracellular antigen binding domain of binds to a tumor antigen, which is associated with a hematologic or solid tumor.
- hematologic tumor extracellular binding domains are domains of CD19, CD20, CD22, Kappa-chain, CD30, CD123, CD33, LeY, CD138, CD5, BCMA, CD7, CD40, ROR1 and IL-1RAP.
- Non-limiting examples of solid tumor extracellular binding domains are domains of GD2, GPC3, FOLR (e.g., FOLR1 or FOLR2), HER2, EphA2, EFGRVIII, IL13RA2, VEGFR2, ROR1, NKG2D, EpCAM, CEA, Mesothelin, MUC1, CLDN18.2, CD171, CD133, PSCA, cMET, EGFR, PSMA, ROR1, FAP, CD70, MUC16, L1- CAM, B7H3, GUCY2C, Nectin4, LRRC15, PSMA and CAIX.
- tumor antigens are derived from cancers that are characterized by tumor-associated antigen expression, such as HER2 expression.
- Antigens may include epitopic regions or epitopic peptides derived from genes mutated in tumor cells or from genes transcribed at different levels in tumor cells compared to normal cells (e.g., survivin, mutated Ras, bcr/abl rearrangement, HER2, mutated or wild-type p53).
- the extracellular antigen binding domain as described herein does not comprise the Fc portion of an immunoglobulin, and may not bind to an extracellular domain of an Fc receptor.
- An extracellular domain that does not bind to an FcR means that the binding activity between the two is not detectable using a conventional assay or only background or biologically insignificant binding activity is detected using the conventional assay.
- the extracellular antigen binding domain of any CAR polypeptides described herein is a peptide or polypeptide capable of binding to a cell surface antigen (e.g., a native and mutated tumor antigen), and may be presented on the cell surface of an antigen- presenting cell.
- a cell surface antigen e.g., a native and mutated tumor antigen
- the extracellular antigen binding domain may be a single-chain antibody fragment (scFv) or a single domain antibody that binds to a tumor antigen, a pathogenic antigen, or an immune cell specific to an autoantigen. These may be derived from an antibody that binds the target cell surface antigen with a high binding affinity.
- the extracellular antigen binding domain is a single chain variable fragment (scFv). In some embodiments, extracellular antigen binding domain is a single domain antibody. In exemplary embodiments, the scFv or single domain antibody binds to a tumor antigen, a pathogenic antigen, or an immune cell specific to an autoantigen. Table 4 lists exemplary cell-surface target antigens and exemplary antibodies binding to such. Table 4.
- the antigen binding fragment may comprise the same heavy chain and light chain complementarity determining regions (CDRs) as the antibodies listed in Table 4 depending upon the target antigen of interest.
- the antigen binding fragment e.g., an scFv
- the extracellular antigen binding domain of any of the CAR polypeptides described herein may be specific to a pathogenic antigen, such as a bacterial antigen, a viral antigen, or a fungal antigen.
- influenza virus neuraminidase hemagglutinin, or M2 protein
- human respiratory syncytial virus (RSV) F glycoprotein or G glycoprotein herpes simplex virus glycoprotein gB, gC, gD, or gE, Chlamydia MOMP or PorB protein, Dengue virus core protein, matrix protein, or glycoprotein E, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus I VP1, envelope glycoproteins of HIV 1, hepatitis B core antigen or surface antigen, diptheria toxin, 28 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Streptococcus 24M epitope, Gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus III (gpC), pseudorabies virus glycoprotein
- the extracellular antigen binding domain of the CAR polypeptide described herein may be specific to a tag conjugated to a therapeutic agent, which targets an antigen associated with a disease or disorder (e.g., a tumor antigen or a pathogenic antigen as described herein).
- the tag conjugated to the therapeutic agent can be antigenic and the extracellular antigen binding domain of the CAR polypeptide can be an antigen-binding fragment (e.g., scFv) of an antibody having high binding affinity and/or specificity to the antigenic tag.
- Exemplary antigenic tags include, but are not limited to, biotin, avidin, a fluorescent molecule (e.g., GFP, YRP, luciferase, or RFP), Myc, Flag, His (e.g., poly His such as 6xHis), HA (hemagglutinin), GST, MBP (maltose binding protein), KLH (keyhole limpet hemocyanins), trx, T7, HSV, VSV (e.g., VSV-G), Glu-Glu, V5, e-tag, S-tag, KT3, E2, Au1, Au5, and/or thioredoxin.
- biotin avidin
- a fluorescent molecule e.g., GFP, YRP, luciferase, or RFP
- Myc Flag
- His e.g., poly His such as 6xHis
- HA hemagglutinin
- GST hemagglutinin
- MBP maltose binding
- the tag conjugated to the therapeutic agent is a member of a ligand- receptor pair and the extracellular antigen binding domain comprises the other member of the ligand-receptor pair or a fragment thereof that binds the tag.
- the tag conjugated to the therapeutic agent can be biotin and the extracellular antigen binding domain of the CAR polypeptide can comprise a biotin-binding fragment of avidin.
- binding affinity refers to the apparent association constant or KA or the KD.
- the KA is the reciprocal of the dissociation constant (K D ).
- the extracellular antigen binding domain for use in the CAR polypeptides described herein may have a binding affinity (KD) of at least 10 -5 , 10 -6 , 10 -7 , 10 -8 , 10 -9 , 10 -10 M, or lower for the target antigen or antigenic epitope.
- KD binding affinity
- An increased binding affinity corresponds to a decreased KD.
- Higher affinity binding of an extracellular antigen binding domain for a first antigen relative to a second antigen can be indicated by a higher K A (or a smaller numerical value KD) for binding the first antigen than the KA (or numerical value KD) for binding the second antigen.
- the extracellular antigen binding domain has specificity for the first antigen (e.g., a first protein in a first conformation or mimic thereof) relative to the second antigen (e.g., the same first protein in a second conformation or mimic thereof; or a second protein).
- Differences in binding affinity can be at least 1.5, 2, 3, 4, 5, 10, 15, 20, 37.5, 50, 70, 80, 91, 100, 500, 1000, 10,000 or 100,000-fold.
- Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance, or spectroscopy (e.g., using a fluorescence assay).
- Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 0.005% (v/v) Surfactant P20). These techniques can be used to measure the concentration of bound binding protein as a function of target protein concentration.
- transmembrane domain The transmembrane domain of the chimeric receptor polypeptides (e.g., ACTR polypeptides or CAR polypeptides) described herein can be in any form known in the art.
- a “transmembrane domain” refers to any protein structure that is thermodynamically stable in a cell membrane, preferably a eukaryotic cell membrane.
- a transmembrane domain compatible for use in the chimeric receptor polypeptides used herein may be obtained from a naturally occurring protein.
- Transmembrane domains are classified based on the three-dimensional structure of the transmembrane domain. For example, transmembrane domains may form an alpha helix, a complex of more than one alpha helices, a beta-barrel, or any other stable structure capable of spanning the phospholipid bilayer of a cell. Furthermore, transmembrane domains may also or alternatively be classified based on the transmembrane domain topology, including the number of passes that the transmembrane domain makes across the membrane and the orientation of the protein.
- membrane proteins cross the cell membrane once, and multi-pass membrane proteins cross the cell membrane at least twice (e.g., 2, 3, 4, 5, 6, 7 or more times).
- Membrane proteins may be defined as Type I, Type II or Type III depending upon the topology of their termini and membrane-passing segment(s) relative to the inside and outside of the cell.
- Type I membrane proteins have a single membrane-spanning region and are oriented such that the N-terminus of the protein is present on the extracellular side of the lipid bilayer of the cell and the C-terminus of the protein is present on the cytoplasmic side.
- Type II membrane proteins also have a single membrane-spanning region but are oriented such that the C-terminus of the protein is present on the extracellular side of the lipid bilayer of the cell and the N-terminus of the protein is present on the cytoplasmic side.
- Type III membrane proteins have multiple membrane-spanning segments and may be further sub-classified based on the number of transmembrane segments and the location of N- and C-terminus.
- the transmembrane domain of the chimeric receptor polypeptide described herein is derived from a Type I single-pass membrane protein.
- the transmembrane domain is of a membrane protein selected from the group consisting of CD8 ⁇ , CD8 ⁇ , 4-1BB/CD137, CD27, CD28, CD34, CD4, Fc ⁇ RI ⁇ , CD16A, OX40/CD134, CD3 ⁇ , 31 DM_US 198678773-1.112309.0120
- a membrane protein selected from the group consisting of CD8 ⁇ , CD8 ⁇ , 4-1BB/CD137, CD27, CD28, CD34, CD4, Fc ⁇ RI
- the transmembrane domain is from a membrane protein selected from the following: CD8a, CD8b, 4-1BB, CD28, CD34, CD4, Fc ⁇ RI ⁇ , CD16A, OX40, CD3z, CD3e, CD3g, CD3d, TCR ⁇ , CD32, CD64, VEGFR2, FAS, FGFR2B, DNAM-1, 2B4, NKG2D, NKp44 and NKp46.
- the transmembrane domain is of CD8 (e.g., the transmembrane domain is of CD8 ⁇ ).
- the transmembrane domain is of 4-1BB/CD137.
- the transmembrane domain is of CD28.
- the transmembrane domain is of NKG2D, NKp44 or NKp46. In other examples, the transmembrane domain is of CD34. In yet other examples, the transmembrane domain is not derived from human CD8a. In some embodiments, the transmembrane domain of the chimeric receptor polypeptide is a single-pass alpha helix.
- the amino acid sequences of exemplary transmembrane domains are provided in Table 5: Table 5.
- Transmembrane Domains Transmembrane domain Sequences SEQ ID NO 32 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Transmembrane domain Sequences SEQ ID NO C D3 ⁇ DGIIVTDVIATLLLALGVFCFAGHET 39 patible for use in the chimeric receptor polypeptides described herein.
- Multi-pass membrane proteins may comprise a complex alpha helical structure (e.g., at least 2, 3, 4, 5, 6, 7 or more alpha helices) or a beta sheet structure.
- the N-terminus and the C-terminus of a multi- pass membrane protein are present on opposing sides of the lipid bilayer, e.g., the N-terminus of the protein is present on the cytoplasmic side of the lipid bilayer and the C-terminus of the protein is present on the extracellular side.
- the reverse orientation of such a native transmembrane protein may be constructed for efficient orientation of the chimeric receptor polypeptide (e.g., CAR) within the immune cell membrane.
- Either one or multiple helices passes from a multi-pass membrane protein can be used for constructing the chimeric receptor polypeptide described herein.
- Transmembrane domains for use in the chimeric receptor polypeptides described herein can also comprise at least a portion of a synthetic, non-naturally occurring protein segment.
- the transmembrane domain is a synthetic, non-naturally occurring alpha helix or beta sheet.
- the protein segment is at least approximately 20 amino acids, e.g., at least 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more amino acids. Examples of synthetic transmembrane domains are known in the art, for example in US 7,052,906 B1 and WO 2000/032776A2, the relevant disclosures of each of which are incorporated by reference herein.
- the amino acid sequence of the transmembrane domain does not comprise cysteine residues. In some embodiments, the amino acid sequence of the transmembrane domain comprises one cysteine residue. In some embodiments, the amino acid sequence of the transmembrane domain comprises two cysteine residues. In some 33 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) embodiments, the amino acid sequence of the transmembrane domain comprises more than two cysteine residues (e.g., 3, 4, 5, or more).
- the transmembrane domain may comprise a transmembrane region and a cytoplasmic region located at the C-terminal side of the transmembrane domain.
- the cytoplasmic region of the transmembrane domain may comprise three or more amino acids and, in some embodiments, helps to orient the transmembrane domain in the lipid bilayer.
- one or more cysteine residues are present in the transmembrane region of the transmembrane domain.
- one or more cysteine residues are present in the cytoplasmic region of the transmembrane domain.
- the cytoplasmic region of the transmembrane domain comprises positively charged amino acids.
- the cytoplasmic region of the transmembrane domain comprises the amino acids arginine, serine, and lysine.
- the transmembrane region of the transmembrane domain comprises hydrophobic amino acid residues. In some embodiments, the transmembrane region comprises mostly hydrophobic amino acid residues, such as alanine, leucine, isoleucine, methionine, phenylalanine, tryptophan, or valine. In some embodiments, the transmembrane region is hydrophobic. In some embodiments, the transmembrane region comprises a poly- leucine-alanine sequence.
- the hydropathy, hydrophobic or hydrophilic characteristics of a protein or protein segment can be assessed by any method known in the art including, for example, the Kyte and Doolittle hydropathy analysis. C.
- Co-stimulatory signaling domains It is beneficial to include a co-stimulatory signaling domain in NK cell for stimulation of an antigen-specific signal, to promote cell proliferation, differentiation and survival, as well as to activate effector functions of the NK cell.
- co-stimulatory signaling domain refers to at least a fragment of a co-stimulatory signaling protein that mediates signal transduction within a cell to induce an immune response such as an effector function (a secondary signal).
- TCR T cell receptor
- antigenic peptide/MHC complexes presented by antigen presenting cells, which typically is driven by CD3 ⁇ as a component of the TCR complex
- secondary signal a co- 34 DM_US 198678773-1.112309.0120
- a co-stimulatory receptor transduces a co-stimulatory signal (secondary signal) as an addition to the TCR-triggered signaling.
- T cell or NK cell activation usually results in cellular changes such as cellular proliferation, metabolic changes, and acquisition of effector functions thereby, being recognized and/or modulates responses mediated by other immune cells, such as T cells, NK cells, macrophages, neutrophils, or eosinophils.
- NK cells belong to the family of Group I innate lymphocytes of the innate immune system and can react without prior sensitization.
- NK cells Unlike T cells (that are dependent on TCR rearrangement) NK cells express a large repertoire of germ-line activating and inhibitory receptors, for specificity and tolerance (Pallmer and Oxenius, Front Immunol, 7: 251 (2016); Rosenberg and Huang, Curr Opin Chem Eng, 19: 9-20 (2016); Uzhachenko and Shanker, Front Immunol, 10: 1906 (2019)); .
- Activation of a co-stimulatory signaling domain in a NK cell may induce the cell to increase or decrease the production and secretion of cytokines, phagocytic properties, proliferation, differentiation, survival, and/or cytotoxicity.
- the co-stimulatory signaling domain of any co-stimulatory molecule may be compatible for use in the chimeric receptor polypeptides described herein.
- the type(s) of co-stimulatory signaling domain is selected based on the desired immune effector function (e.g., ADCC). Accordingly, it is in one embodiment that the chimeric receptor polypeptide of the genetically engineered NK cell comprises the at least one co-stimulatory signaling domain.
- co-stimulatory signaling domains for use in the chimeric receptor polypeptides may be the cytoplasmic signaling domain of co-stimulatory proteins, including, without limitation, members of the B7/CD28 family (e.g., B7-1/CD80, B7-2/CD86, B7-H1/PD-L1, B7-H2, B7-H3, B7-H4, B7- H6, B7-H7, BTLA/CD272, CD28, CTLA-4, Gi24/VISTA/B7-H5, ICOS/CD278, PD-1, PD- L2/B7-DC, and PDCD6); members of the TNF superfamily (e.g.,4-1BB/TNFRSF9/CD137, 4- 1BB Ligand/TNFSF9, BAFF/BLyS/TNFSF13B, BAFF R/TNFRSF13C, CD27/TNFRSF7, CD27 Ligand/TNFSF7, CD30/TNFRSF8, CD30 Ligand/TNFSF8,
- the chimeric receptor polypeptides may contain a CD28 co-stimulatory signaling domain or a 4-1BB (CD137) co-stimulatory signaling domain.
- at least one co- stimulatory signaling domain is selected from the group consisting of 4-1BB, CD28, CD8 ⁇ , 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL, or any variant thereof.
- the co-stimulatory signaling domains comprise up to 10 amino acid residue mutations (e.g., 1, 2, 3, 4, 5, or 8) such as amino acid substitutions, deletions, or additions as compared to a wild-type counterpart.
- Such co-stimulatory signaling domains comprising one or more amino acid variations may be referred to as variants.
- Mutation of amino acid residues of the co-stimulatory signaling domain may result in an increase in signaling transduction and enhanced stimulation of immune responses relative to co-stimulatory signaling domains that do not comprise the mutation. Mutation of amino acid residues of the co-stimulatory signaling domain may result in a decrease in signaling transduction and reduced stimulation of immune responses relative to co-stimulatory signaling domains that do not comprise the mutation. For example, mutation of residues 186 and 187 of the native CD28 amino acid sequence may result in an increase in co-stimulatory activity and induction of immune responses by the co-stimulatory domain of the chimeric receptor polypeptide.
- the mutations are substitution of a lysine at each of positions 186 and 187 with a glycine residue of the CD28 co-stimulatory domain, referred to as a CD28 LL ⁇ GG variant. Therefore, a suitable variant of CD28 is the CD28 LL ⁇ GG variant.
- 36 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Additional mutations can be made in co-stimulatory signaling domains that may enhance or reduce co-stimulatory activity of the domain will be evident to one of ordinary skill in the art.
- the co-stimulatory signaling domain is selected from the group of 4-1BB, CD28, OX40, and CD28LL ⁇ GG variant.
- the chimeric receptor polypeptides may contain a single co- stimulatory domain such as, for example, a CD27 co-stimulatory domain, a CD28 co- stimulatory domain, a 4-1BB co-stimulatory domain, an ICOS co-stimulatory domain, an OX40 co-stimulatory domain, an OX40L co-stimulatory domain, a 2B4 co-stimulatory domain, a GITR co-stimulatory domain, a NKG2D co-stimulatory domain, a NKp30 co- stimulatory domain, a NKp44co-stimulatory domain, a NKp46 co-stimulatory domain, a DAP10 co-stimulatory domain, a DAP12 co-stimulatory domain, a DNAM1 co-stimulatory domain, a LFA-1 co-stimulatory domain, a HVEM co-stimulatory domain or a JAMAL co- stimulatory domain.
- a single co- stimulatory domain such as, for example,
- the at least one co-stimulatory signaling domain is a CD28 co-stimulatory signaling domain or a 4-1BB co-stimulatory signaling domain.
- the chimeric receptor polypeptides may comprise more than one co-stimulatory signaling domain (e.g., 2, 3, or more).
- the chimeric receptor polypeptide comprises at least two co-stimulatory signaling domains.
- the chimeric receptor polypeptide comprises two co-stimulatory signaling domains.
- the chimeric receptor polypeptide comprises two or more of the same co-stimulatory signaling domains, for example, two copies of the co-stimulatory signaling domain of CD28.
- the chimeric receptor polypeptide comprises two or more co-stimulatory signaling domains from different co-stimulatory proteins, such as any two or more co-stimulatory proteins described herein.
- the chimeric receptor polypeptide may comprise two or more co-stimulatory signaling domains from different co-stimulatory receptors, such as any two or more co- stimulatory receptors described herein, for example, CD28 and 4-1BB, CD28 and CD27, CD28 and ICOS, CD28 LL ⁇ GG variant and 4-1BB, CD28 and OX40, or CD28 LL ⁇ GG variant and OX40.
- the two co-stimulatory signaling domains are CD28 and 4-1BB.
- the two co-stimulatory signaling domains are CD28 LL ⁇ GG variant and 4- 1BB. In some embodiments, the two co-stimulatory signaling domains are CD28 and OX40. In some embodiments, the two co-stimulatory signaling domains are CD28 LL ⁇ GG variant and OX40. In some embodiments, the chimeric receptor polypeptides described herein may 37 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) contain a combination of a CD28 and ICOSL. In some embodiments, the chimeric receptor polypeptide described herein may contain a combination of CD28 and CD27.
- the 4-1BB co-stimulatory domain is located N-terminal to the CD28 or CD28LL ⁇ GG variant co-stimulatory signaling domain.
- one of the co-stimulatory signaling domains is a CD28 co- stimulatory signaling domain and the other co-stimulatory domain is selected from the group consisting of a CD8 ⁇ , 4-1BB, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL co- stimulatory signaling domain.
- one of the co-stimulatory signaling domains is a CD8 ⁇ co-stimulatory signaling domain and the other co-stimulatory domain is selected from the group consisting of a CD28, 4-1BB, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL co-stimulatory signaling domain.
- one of the co- stimulatory signaling domains is a 4-1BB co-stimulatory signaling domain and the other co- stimulatory domain is selected from the group consisting of a CD8 ⁇ , CD28, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL co-stimulatory signaling domain.
- the chimeric receptor polypeptides described herein do not comprise a co-stimulatory signaling domain.
- the amino acid sequences of exemplary co- stimulatory domains are provided in Table 6. Table 6.
- Co-stimulatory Sequences SEQ d i ID NO 38 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Co-stimulatory Sequences SEQ domain ID NO T IM1 KKYFFKKEV L V F L IKAL NAVEKEV AEDNIYIEN LY , p p yp p y y signaling domain.
- the optional co-stimulatory signaling domain may be located in the cytoplasm for triggering activation and/or effector signaling. D.
- Cytoplasmic signaling domain Any cytoplasmic signaling domain can be used to create the chimeric receptor polypeptides described herein (e.g., ACTR polypeptides or CAR polypeptides). Such a cytoplasmic domain may be any signaling domain involved in triggering cell signaling (primary signaling) that leads to NK cell proliferation and/or activation.
- the cytoplasmic signaling domain as described herein is not a co-stimulatory signaling domain, which, as 39 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) known in the art, relays a co-stimulatory or secondary signal for fully activating other known immune cells (e.g., T cells such as CAR-T cells).
- the cytoplasmic signaling domain described herein may comprise an immunoreceptor tyrosine-based activation motif (ITAM) domain (e.g., at least one ITAM domain, at least two ITAM domains, or at least three ITAM domains) or may be ITAM free.
- ITAM immunoreceptor tyrosine-based activation motif
- ITAM is a conserved protein motif that is generally present in the tail portion of signaling molecules expressed in many immune cells.
- the motif may comprise two repeats of the amino acid sequence YxxL/I separated by 6-8 amino acids, wherein each x is independently any amino acid, producing the conserved motif YxxL/Ix (6-8) YxxL/I.
- ITAMs within signaling molecules are important for signal transduction within the cell, which is mediated at least in part by phosphorylation of tyrosine residues in the ITAM following activation of the signaling molecule. ITAMs may also function as docking sites for other proteins involved in signaling pathways.
- ITAMs for use in the chimeric receptor polypeptides comprised within the cytoplasmic signaling domain, without limitation may be: CD3 ⁇ , CD3 ⁇ , CD3 ⁇ , each containing a single ITAM motif while each ⁇ chain contains 3 distinct ITAM domains ( ⁇ a, ⁇ b and ⁇ c).
- the number and ITAM sequences are also important in the design of CARs (Bettini et al., J Immunol, 199(5): 1555-1560 (2017); Jayaraman et al., EBioMedicine, 58: 102931 (2020)).
- the amino acid sequence of one exemplary cytoplasmic signaling domain of human CD3 ⁇ is provided as SEQ ID NO: 73.
- the cytoplasmic signaling domain is of CD3 ⁇ or Fc ⁇ R1 ⁇ . In other examples, cytoplasmic signaling domain is not derived from human CD3 ⁇ . In yet other examples, the cytoplasmic signaling domain is not derived from an FcR, when the extracellular Fc-binding domain of the same chimeric receptor polypeptide is derived from CD16A.
- cytoplasmic signaling domains can be fused together for additive or synergistic effect.
- useful additional signaling domains include part or all of one or more of TCR ⁇ chain, CD28, OX40/CD134, 4-1BB/CD137, Fc ⁇ RI ⁇ , ICOS/CD278, IL2R ⁇ /CD122, IL-2R ⁇ /CD132, and CD40.
- 40 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00)
- the cytoplasmic signaling domain described herein is free of the ITAM motif.
- the chimeric receptor polypeptides e.g., ACTR polypeptide or CAR polypeptide
- a hinge domain is an amino acid segment that is generally found between two domains of a protein and may allow for flexibility of the protein and movement of one or both domains relative to one another.
- any amino acid sequence that provides such flexibility and movement of the extracellular ligand- binding domain relative to the transmembrane domain of the chimeric receptor polypeptide can be used.
- Hinge domains of any protein known in the art to comprise a hinge domain are compatible for use in the chimeric receptor polypeptides described herein.
- the hinge domain is at least a portion of a hinge domain of a naturally occurring protein and confers flexibility to the chimeric receptor polypeptide.
- the chimeric receptor polypeptide comprises a hinge domain, which is a hinge domain selected from the list of CD28, CD16A, CD8, IgG, murine CD8 ⁇ , and DAP12.
- the hinge domain is of CD8 (e.g., the hinge domain is of CD8 ⁇ ). In some embodiments, the hinge domain is a portion of the hinge domain of CD8, e.g., a fragment containing at least 15 (e.g., 20, 25, 30, 35, or 40) consecutive amino acids of the hinge domain of CD8. In some embodiments, the hinge domain is of CD28. In some embodiments, the hinge domain is a portion of the hinge domain of CD28, e.g., a fragment containing at least 15 (e.g., 20, 25, 30, 35, or 40) consecutive amino acids of the hinge domain of CD28.
- the hinge domain and/or the transmembrane domain may be linked to additional amino acids (e.g., 15 aa, 10-aa, 8-aa, 6-aa, or 4-aa) at the N-terminal portion, at the C-terminal portion, or both. Examples can be found, e.g., in (Ying et al., Nat Med, 25(6): 947-953 (2019)).
- the hinge domain is of a CD16A receptor, for example, the whole hinge domain of a CD16A receptor or a portion thereof, which may consist of up to 40 consecutive amino acid residues of the CD16A receptor (e.g., 20, 25, 30, 35, or 40).
- Such a chimeric receptor polypeptide may contain no hinge domain from 41 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) a different receptor (a non-CD16A receptor).
- the chimeric receptor polypeptide described herein may be free of a hinge domain from any non-CD16A receptor.
- such a chimeric receptor polypeptide may be free of any hinge domain.
- Hinge domains of IgG antibodies such as an IgG, IgA, IgM, IgE, or IgD antibodies, are also compatible for use in the chimeric receptor polypeptides described herein.
- the hinge domain joins the constant domains CH1 and CH2 of an antibody.
- the hinge domain is of an antibody and comprises the hinge domain of the antibody and one or more constant regions of the antibody.
- the hinge domain comprises the hinge domain of an antibody and the CH3 constant region of the antibody.
- the hinge domain comprises the hinge domain of an antibody and the CH2 and CH3 constant regions of the antibody.
- the antibody is an IgG, IgA, IgM, IgE, or IgD antibody.
- the antibody is an IgG antibody.
- the antibody is an IgG1, IgG2, IgG3, or IgG4 antibody, preferably IgG1 and IgG4.
- the hinge region comprises the hinge region and the CH2 and CH3 constant regions of an IgG1 antibody. In some embodiments, the hinge region comprises the hinge region and the CH3 constant region of an IgG1 antibody.
- Non-naturally occurring peptides may also be used as hinge domains for the chimeric receptor polypeptides described herein.
- the hinge domain between the C-terminus of the extracellular target-binding domain and the N-terminus of the transmembrane domain is a peptide linker, such as a (GlyxSer)n linker, wherein x and n, independently can be an integer between 3 and 12, including 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more.
- the hinge domain is (Gly4Ser)n, wherein n can be an integer between 3 and 60, including 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60. In certain embodiments, n can be an integer greater than 60. In some embodiments, the hinge domain is (Gly4Ser)3 (SEQ ID NO: 15). In some embodiments, the hinge domain is (Gly 4 Ser) 6 (SEQ ID NO: 16).
- the hinge domain is (Gly4Ser)9 (SEQ ID NO: 17). In some embodiments, the hinge domain is (Gly 4 Ser) 12 (SEQ ID NO: 18). In some embodiments, the hinge domain is (Gly 4 Ser) 15 (SEQ ID NO: 19). In some embodiments, the hinge domain is (Gly4Ser)30 (SEQ ID NO: 20). In some embodiments, the hinge domain is (Gly 4 Ser) 45 (SEQ ID NO: 21). In some embodiments, the hinge domain is (Gly4Ser)60 (SEQ ID NO: 22).
- the hinge domain is an extended recombinant polypeptide (XTEN), which is an unstructured polypeptide consisting of hydrophilic residues of varying lengths (e.g., 10-80 amino acid residues). Amino acid sequences of XTEN peptides will be evident to one of skill in the art and can be found, for example, in US 8,673,860, the relevant disclosures of which are incorporated by reference herein.
- the hinge domain is an XTEN peptide and comprises 60 amino acids. In some embodiments, the hinge domain is an XTEN peptide and comprises 30 amino acids.
- the hinge domain is an XTEN peptide and comprises 45 amino acids. In some embodiments, the hinge domain is an XTEN peptide and comprises 15 amino acids. Any of the hinge domains used for making the chimeric receptor polypeptide as described herein may contain up to 250 amino acid residues. In some instances, the chimeric receptor polypeptide may contain a relatively long hinge domain, for example, containing 150- 250 amino acid residues (e.g., 150-180 amino acid residues, 180-200 amino acid residues, or 200-250 amino acid residues).
- the chimeric receptor polypeptide may contain a medium sized hinge domain, which may contain 60-150 amino acid residues (e.g., 60-80, 80-100, 100-120, or 120-150 amino acid residues).
- the hinge domain may be a flexible linker consisting of glycine and serine amino acids having a length between 15 and 60 amino acids, preferably composed of Gly4Ser units, especially one of the linkers of SEQ ID NO: 16 to SEQ ID NO: 18.
- the chimeric receptor polypeptide may contain a short hinge domain, which may contain less than 60 amino acid residues (e.g., 1-30 amino acids or 31-60 amino acids).
- a chimeric receptor polypeptide e.g., an ACTR polypeptide
- the amino acid sequences of exemplary hinge domains are provided in Table 7: Table 7.
- chimeric receptor polypeptides described herein may further comprise a hinge domain, which may be located at the C-terminus of the extracellular target binding domain and the N-terminus of the transmembrane domain.
- the hinge domain may be of any suitable length.
- the chimeric receptor polypeptide described 44 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) herein may have no hinge domain.
- the chimeric receptor polypeptide described herein may have a shortened hinge domain (e.g., including up to 25 amino acid residues).
- F. Signal peptide the chimeric receptor polypeptide (e.g., ACTR polypeptide or CAR polypeptide) may also comprise a signal peptide (also known as a signal sequence) at the N-terminus of the polypeptide.
- the nucleic acid encoding the chimeric receptor polypeptide is also encoding a signal peptide, whereas in the mature polypeptide the signal peptide has been cleaved off.
- signal sequences are peptide sequences that target a polypeptide to the desired site in a cell.
- the signal sequence targets the chimeric receptor polypeptide to the secretory pathway of the NK cell and will allow for integration and anchoring of the chimeric receptor polypeptide into the lipid bilayer.
- Signal sequences including signal sequences of naturally occurring proteins or synthetic, non- naturally occurring signal sequences that are compatible for use in the chimeric receptor polypeptides described herein will be evident to one of skill in the art.
- the signal sequence from CD8 ⁇ (SEQ ID NO: 1).
- the signal sequence is from CD28 (SEQ ID NO: 2).
- the signal sequence is from the murine kappa chain.
- the signal sequence is from CD16. See Table 8 below. Table 8.
- Exemplary Signal Peptides Signal Peptide Sequences SEQ ID NO any of the chimeric receptor polypeptides disclosed herein may further comprise a protein tag, examples of which are provided in Table 9 below. 45 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Table 9.
- Exemplary ACTR constructs for use with the methods and compositions described herein may be found, for example, in the instant description and figures or may be found in WO2016/040441A1, WO2017/161333A1, and WO2018/140960A1, each of which is incorporated by reference herein for this purpose.
- the ACTR polypeptides described herein may comprise a CD16A extracellular domain with binding affinity and specificity for the Fc portion of an IgG molecule, a transmembrane domain, and a CD3 ⁇ cytoplasmic signaling domain.
- the ACTR polypeptides may further include one or more co- stimulatory signaling domains, one of which may be a CD28 co-stimulatory signaling domain or a 4-1BB co-stimulatory signaling domain.
- the ACTR polypeptides are configured such that, when expressed on a NK cell, the extracellular ligand-binding domain is located extracellularly for binding to a target molecule and the CD3 ⁇ cytoplasmic signaling domain.
- the co-stimulatory signaling domain may be located in the cytoplasm for triggering activation and/or effector signaling.
- an ACTR polypeptide as described herein may comprise, from N-terminus to C-terminus, the Fc binding domain such as a CD16A extracellular domain, the transmembrane domain, the optional one or more co-stimulatory domains (e.g., a CD28 co- stimulatory domain, a 4-1BB co-stimulatory signaling domain, an OX40 co-stimulatory signaling domain, a CD27 co-stimulatory signaling domain, or an ICOS co-stimulatory signaling domain), and the CD3 ⁇ cytoplasmic signaling domain.
- the Fc binding domain such as a CD16A extracellular domain
- the transmembrane domain the optional one or more co-stimulatory domains (e.g., a CD28 co- stimulatory domain, a 4-1BB co-stimulatory signaling domain, an OX40 co-stimulatory signaling domain, a CD27 co-stimulatory signaling domain, or an ICOS co-stimulatory signaling domain)
- the ACTR polypeptides described herein may contain two or more co-stimulatory signaling domains, which may link to each other or be separated by the cytoplasmic signaling domain.
- the extracellular Fc binder, transmembrane domain, optional co-stimulatory signaling domain(s), and cytoplasmic signaling domain in an ACTR polypeptide may be linked to each other directly, or via a peptide linker.
- 46 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) any of the ACTR polypeptides described herein may comprise a signal sequence at the N- terminus.
- Table 10 provides exemplary ACTR polypeptides described herein.
- exemplary constructs have, from N-terminus to C-terminus in order, the signal sequence, the Fc binding domain (e.g., an extracellular domain of an Fc receptor), the hinge domain, and the transmembrane, while the positions of the optional co-stimulatory domain and the cytoplasmic signaling domain can be switched.
- Table 10 Exemplary Components of ACTR polypeptides.
- CAR polypeptides for use with the methods and compositions described herein may be found, for example, in the instant description and figures or as those known in the art.
- the CAR polypeptides described herein may comprise an extracellular domain comprising a single-chain antibody fragment (scFv) with binding affinity and specificity for an antigen of interest (e.g., those listed in Table 4), a co-stimulatory domain (e.g., those listed in Table 6) and a CD3 ⁇ cytoplasmic signaling domain.
- the CAR polypeptide may further comprise a hinge domain (e.g., those listed in Table 7).
- a CAR polypeptide described herein may comprise (i) a CD28 co-stimulatory domain or a 4-1BB co-stimulatory domain; and (ii) a CD28 transmembrane domain, a CD28 hinge domain, or a combination thereof.
- a CAR polypeptide described herein may comprise (i) a CD28 co-stimulatory domain or a 4-1BB co- 49 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) stimulatory domain, (ii) a CD8 ⁇ transmembrane domain, a CD8 ⁇ hinge domain, or a combination thereof.
- the CAR polypeptides may further include one or more co-stimulatory signaling domains, one of which may be a CD28 co-stimulatory signaling domain or a 4-1BB co-stimulatory signaling domain.
- a CAR polypeptide described herein may comprise (i) a CD28 co-stimulatory domain or a 4-1BB co-stimulatory domain, (ii) a CD28 transmembrane domain, a CD8 ⁇ hinge domain, or a combination thereof.
- the CAR polypeptide comprises (i) a CD8 ⁇ hinge domain (ii) a CD8 ⁇ transmembrane domain, (iii) a CD28 co-stimulatory domain or a 4-1BB co- stimulatory domain, (iv) a CD3 ⁇ cytoplasmic signaling domain or a combination thereof.
- the CAR polypeptide comprising two co-stimulatory domains further comprises (i) a CD8 ⁇ or CD28 hinge domain (ii) a CD8 ⁇ or CD28 transmembrane domain, (iii) a CD28 co-stimulatory domain or a 4-1BB co-stimulatory domain, (iv) a OX40L co- stimulatory domain, a 2B4 co-stimulatory domain, a DAP10 co-stimulatory domain, a DNAM- 1 co-stimulatory domain, a NKG2D co-stimulatory domain, a NKp30 co-stimulatory domain, a NKp44 co-stimulatory domain, a NKp46 co-stimulatory domain or a JAMAL co-stimulatory domain, or (v) a CD3 ⁇ cytoplasmic signaling domain or a combination thereof.
- the CAR polypeptide comprising two co-stimulatory domains further comprises (i) a CD8 ⁇ hinge domain (ii) a CD28 transmembrane domain, (iii) a CD28 co- stimulatory domain or a 4-1BB co-stimulatory domain, (iv) a OX40L co-stimulatory domain, a 2B4 co-stimulatory domain, a DAP10 co-stimulatory domain, a DNAM-1 co-stimulatory or a JAMAL co-stimulatory domain, or (v) a CD3 ⁇ cytoplasmic signaling domain or a combination thereof.
- the CAR polypeptide comprising two co- stimulatory domains further comprises (i) a CD8 ⁇ hinge domain (ii) a CD28 transmembrane domain, a NKp44 transmembrane domain, a NKG2D transmembrane domain or a NKp46 transmembrane domain, (iii) a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain, a 2B4 co-stimulatory domain or a DAP10 co-stimulatory, (iv) an OX40L co-stimulatory domain, a 2B4 co-stimulatory domain, a DAP10 co-stimulatory domain, a DAP12 co- stimulatory domain, a DNAM-1 co-stimulatory domain or a JAMAL co-stimulatory domain, or (v) a CD3 ⁇ cytoplasmic signaling domain, a DAP12 cytoplasmic signaling domain or a 2B4 cytoplasmic signaling domain
- the CAR polypeptide comprises (i) a CD8 ⁇ hinge domain (ii) a CD28 transmembrane domain, (iii) 50 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) a CD28 co-stimulatory domain or a 4-1BB co-stimulatory domain, (iv) an OX40L co- stimulatory domain or an OX40 co-stimulatory domain, (v) a CD3 ⁇ cytoplasmic signaling domain or a combination thereof.
- the CAR polypeptide may comprise an amino acid sequence selected from SEQ ID NO: 86, SEQ ID NO: 87 or SEQ ID NO: 94 provided below.
- the CAR polypeptides are configured such that, when expressed on a NK cell, the extracellular antigen-binding domain is located extracellularly for binding to a target molecule (e.g., a tumor antigen) and the CD3 ⁇ cytoplasmic signaling domain is located intracellularly for signaling into the cell.
- a target molecule e.g., a tumor antigen
- the co-stimulatory signaling domain may be located in the cytoplasm for triggering activation and/or effector signaling.
- a CAR polypeptide as described herein may comprise, from N- terminus to C-terminus, the extracellular antigen binding domain, the transmembrane domain, the optional one or more co-stimulatory domains (e.g., a CD28 co-stimulatory domain, a 4- 1BB co-stimulatory signaling domain, an OX40L co-stimulatory signaling domain, an OX40 co-stimulatory signaling domain, a CD27 co-stimulatory signaling domain, a 2B4 co- stimulatory signaling domain or an ICOS co-stimulatory signaling domain), and the CD3 ⁇ cytoplasmic signaling domain.
- co-stimulatory domains e.g., a CD28 co-stimulatory domain, a 4- 1BB co-stimulatory signaling domain, an OX40L co-stimulatory signaling domain, an OX40 co-stimulatory signaling domain, a CD27 co-stimulatory signaling domain, a 2B4 co- stimulatory signaling
- the CAR polypeptides described herein may contain two or more co-stimulatory signaling domains, which may link to each other or be separated by the cytoplasmic signaling domain.
- the extracellular antigen binding domain, transmembrane domain, optional co-stimulatory signaling domain(s), and cytoplasmic signaling domain in a CAR polypeptide may be linked to each other directly, or via a peptide linker.
- any of the CAR polypeptides described herein may comprise a signal sequence at the N-terminus.
- the CAR polypeptides described herein may further include at least one co-stimulatory signaling domain.
- the CAR polypeptides are configured such that, when expressed on an immune cell, the extracellular antigen-binding domain is located extracellularly for binding to a target molecule and the cytoplasmic signaling domain intracellularly.
- Tables 11 provide exemplary CAR polypeptides for NK cells described herein.
- exemplary constructs have, from N-terminus to C-terminus in order, the signal sequence, the antigen binding domain (e.g., an scFv fragment targeting an antigen such as a tumor antigen or 51 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) a pathogenic antigen), the hinge domain, and the transmembrane, while the positions of the optional co-stimulatory domain(s) and the cytoplasmic signaling domain can be switched.
- Cytoplasmic CAR # Signal S equence binding domain brane domain (b) Domain Domain Signaling 52 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Antigen Hinge Transmembrane Co-stim. Co-stim. Cytoplasmic C AR # Signal S equence binding domain domain (b) Domain Domain Signaling ) 53 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) Antigen Hinge Transmembrane Co-stim. Co-stim.
- Exemplary examples of GPC3 targeting CAR-NK cell constructs Signal Extracellular domain Hinge Transmembrane Co-stimulatory Cytoplasmic Sequence (antigen binding) domain domain domain domain Signaling domain 3 CAR constructs is SEQ ID NO: 85
- exemplary anti-GPC3 CAR constructs comprising such scFv are provided by SEQ ID NO: 86 and SEQ ID NO: 87.
- Anti-GPC3 scFv derived from GC33 (SEQ ID NO: 85) DVVMTQSPLSLPVTPGEPASISCRSSQSLVHSNRNTYLHWYLQKPGQSPQLLIYKVS NRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQNTHVPPTFGQGTKLEIKRG GGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEMHWVRQAPGQ GLEWMGALDPKTGDTAYSQKFKGRVTLTADKSTSTAYMELSSLTSEDTAVYYCTRFY SYTYWGQGTLVTVSS Anti-GPC3-CAR 1 (SEQ ID NO: 86) MALPVTALLLPLALLLHAARPDVVMTQSPLSLPVTPGEPASISCRSSQSLVHSNRNT YLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDV
- Anti-ROR1 scFv (SEQ ID NO 93) DIVMTQSPLSQPVTPGEPASISCRSSQSLLHRYGYNSLHWYLQKPGQSPQLLIYLGS NRASGVPDRFSGSGSGTDFTLKVSRVEAEDVGVYYCMQALQTPYTFGQGTKLEIKGS TSGSGKPGSGEGSTKGQVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQP PGKGLEWLGEISHSGITNYNPSLKSRVTISVDKSKNHFSLKLNSVTAADTAVYYCTK KWELLAFDFWGQGTMVTVSS anti-ROR1 CAR (1730): anti-ROR scFv with CD8 ⁇ signal sequence (italic) / anti- ROR1 scFv / IgG4 hinge/ CD28 transmembrane domain / 4-1BB Co-stimulatory domain / CD3 ⁇ cytoplasmic tail (SEQ ID NO
- NK Cells Expressing Polypeptides modulating metabolism and Optionally Chimeric Receptor Polypeptides Provided herein are genetically engineered NK cells that co-express at least one metabolism modulating polypeptides as described herein.
- these metabolism modulating polypeptides of the present invention are encoded by transgenes introduced into the NK cells (e.g., exogenous to the NK cells).
- the genetically engineered NK cells further express a chimeric receptor polypeptide (i.e., ACTR-NK cells, or CAR-NK cells) as also described herein.
- the chimeric receptor polypeptide is a CAR polypeptide that comprises components as shown in Table 11.
- the genetically engineered NK cells described herein can be derived from a cell line, e.g., selected from NK-92, NK-92MI, YTS, and KHYG-1, preferably NK-92 cells.
- the genetically engineered NK cells described herein can be derived from peripheral blood mononuclear cells (PBMC), hematopoietic stem cells (HSCs), cord blood stem cells (CBSCs) or induced pluripotent stem cells (iPSCs).
- PBMC peripheral blood mononuclear cells
- HSCs hematopoietic stem cells
- CBSCs cord blood stem cells
- iPSCs induced pluripotent stem cells
- the NK cell population described herein can be obtained from other sources, such asbone marrow, or tissues such as spleen, lymph node, thymus, or tumor tissue.
- the starting population of NK cells is obtained from isolating mononuclear cells using ficoll-paque density gradient.
- the method further comprises depleting the mononuclear cells of CD3, CD14, and/or CD19 cells to obtain the starting population of NK cells. In some embodiments, the method further comprises depleting the mononuclear cells CD3, CD14, and CD19 cells to obtain the starting population of NK cells. In a particular embodiment, depleting comprises performing magnetic sorting. In some instances, NK cells could be positively selected using sorting, magnetic bead selection or other methods to obtain the starting populations of NK cells. A source suitable for obtaining NK cells would be evident to one of skill in the art. In some examples, the NK cells can be a mixture of different types of T cells and/or NK cells as known in the art.
- the NK cells can be isolated from a suitable donor (e.g., a human patient).
- the population of NK cells is derived from PBMCs, which may be obtained from the patient (e.g., a human patient) who is in need for the treatment described herein and who will be treated with the genetically engineered immune cells described herein (autologous approach).
- the NK cells desired may be expanded within the population of cells obtained by co-incubating the cells with stimulatory molecules.
- NK cells are derived from cord blood stem cells or induced pluripotent stem cells (iPSCs) providing from “off-the shelf” source for immunotherapy (Li et al., Cell Stem Cell, 23(2): 181-192.e185 (2016); Liu et al., Leukemia, 32(2): 520-531 (2016); Morgan et al., Front Immunol, 11: 1965 (2020); Wrona, Borowiec et al., Int J Mol Sci, 22(11): (2021)).
- the starting population of NK cells is obtained from cord blood.
- the cord blood has previously been frozen.
- cells are derived from cell lines (e.g., NK-92 and V ⁇ 9V ⁇ 2 T cell). 63 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00)
- the genetically engineered NK cells may co-express any of the CAR constructs with at least two metabolism modulating polypeptides such as those disclosed herein.
- the CAR construct may comprise a co-stimulatory domain from 4-1BB or CD28 and the metabolism modulating polypeptides.
- the CAR construct may further comprise a hinge and transmembrane domain from CD8 (e.g., CD8 ⁇ ) or CD28.
- the genetically engineered NK cells may co-express any of the ACTR constructs with at least two metabolism modulating polypeptides such as those disclosed herein.
- the ACTR construct may comprise a co-stimulatory domain from 4-1BB or CD28.
- the ACTR constructs may further comprise a hinge and transmembrane domain from CD8 or CD28.
- the genetically engineered immune cells disclosed herein may not express any chimeric receptor polypeptides.
- the genetically engineered NK cells, which may express or overly express at least two metabolism modulating polypeptides as disclosed herein may be derived from tumor-infiltrating lymphocytes (TILs).
- TILs tumor-infiltrating lymphocytes
- the genetically engineered NK cells which may overly express at least one metabolic modulating polypeptide as disclosed herein, may be derived from tumor- infiltrating lymphocytes (TILs). Overexpression of the metabolic modulating polypeptide may enhance the anti-tumor activity or the TILs in tumor microenvironment.
- the genetically engineered NK cell comprises a nucleic acid or nucleic acid set, which collectively comprises a first nucleotide sequence encoding the at least one metabolism modulating polypeptide; and a second nucleotide sequence encoding the chimeric receptor polypeptide.
- such metabolism modulating polypeptides are identical to an endogenous protein of the immune cell. Introducing additional copies of the coding sequences of such polypeptides into the NK cell would enhance the expression level of such polypeptide(s) (i.e., overly expressed) as relative to the native counterpart.
- the at least one metabolism modulating polypeptide to be introduced into the NK cell are heterologous to the NK cell, i.e., do not exist or are not expressed (i.e., at a measurable level, e.g., by western/immuno blotting) in the NK cell.
- heterologous metabolism modulating polypeptide described herein may be a naturally-occurring protein not expressed in the NK cell in nature (e.g., from a different species, 64 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) or from a different cell type of the same species).
- heterologous metabolism modulating polypeptides may be a variant of a native protein, such as those described herein.
- the exogenous (i.e., not native to the NK cells) copy of the coding nucleic acid may exist extra-chromosomally.
- the exogenous copy of the coding sequence may be integrated into the chromosome of the NK cell, and may be located at a site that is different from the native locus of the endogenous gene.
- the genetically engineered NK cells when expressing a chimeric receptor polypeptide as disclosed herein, can recognize and inhibit target cells, either directly (e.g., by CAR- NK cells) or via an Fc-containing therapeutic agents such as an anti-tumor antibody (e.g., by ACTR-NK cells).
- the genetically engineered NK cells would be expected to have higher therapeutic efficacy relative to chimeric receptor polypeptide NK cells that do not express or express a lower level or less active form of the metabolism modulating polypeptides.
- expression vectors may be created via conventional methods as described in the present invention and introduced into immune cells.
- nucleic acids encoding at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides may be cloned into one or two suitable expression vectors, such as a viral vector or a non-viral vector in operable linkage to a suitable promoter.
- each of the coding sequences for the chimeric receptor polypeptide and the at least one metabolism modulating polypeptide are on two separate nucleic acid molecules and can be cloned into two separate vectors, which may be introduced into NK cells simultaneously or sequentially.
- the coding sequences for the chimeric receptor polypeptide and at least one metabolism modulating polypeptide are on one nucleic acid molecule and can be cloned into one vector.
- the NK cell comprises the nucleic acid, which comprises a first nucleotide sequence, and a second nucleotide sequence.
- the coding sequences of the chimeric receptor polypeptide and at least one metabolism modulating polypeptide may be in operable linkage to two distinct promoters such that the expression of the two polypeptides is controlled by different promoters.
- the coding sequences of the chimeric receptor polypeptide and two separate metabolism 65 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) modulating polypeptides may be in operable linkage to two or three distinct promoters such that the expression of the three polypeptides is controlled by different promoters (i.e., in case of two metabolic modulating polypeptides) and so on.
- the coding sequences of the chimeric receptor polypeptide and three separate metabolism modulating polypeptides may be in operably linkage to one promoter such that the expression of the two polypeptides is controlled by a single promoter.
- Suitable sequences may be inserted between the coding sequences of the two or more metabolism modulating polypeptides so that two or more separate polypeptides can be translated from a single mRNA molecule.
- Such sequences for example, IRES or ribosomal skipping site, are well known in the art.
- promoters can be used for expression of the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides described herein, including, without limitation, cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR, the simian virus 40 (SV40) early promoter, the human EF1-alpha promoter, or herpes simplex tk virus promoter.
- CMV cytomegalovirus
- viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR
- SV40 simian virus 40
- Additional promoters for expression of the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides include any constitutively active promoter in a NK cell.
- any regulatable/inducible promoter may be used, such that its expression can be modulated within a NK cell.
- Suitable induction systems are known in the art, see e.g., Kallunki et al. (Cells, 8(8): 796 (2019)).
- the NK cells described herein may comprise two metabolism modulating polypeptides selected from GOT2, GLUT1, LDHA, PDK1, TIGAR, CTH, ASS1 and PSPH.
- the genetically engineered NK cell comprises a nucleic acid or nucleic acid set, which collectively comprises a first nucleotide sequence encoding the first metabolism modulating polypeptide; a second nucleotide sequence encoding the second metabolism modulating polypeptide; and a third nucleotide sequence encoding the chimeric receptor polypeptide.
- each of the coding sequences for the chimeric receptor polypeptide and at least one metabolism modulating polypeptides are on separate nucleic acid molecules and can be cloned into separate vectors, which may be introduced into NK cells simultaneously or sequentially.
- each of the coding sequences for the chimeric receptor polypeptide and at least one metabolism modulating polypeptides are on separate nucleic acid molecules and can be cloned into one vector which may be introduced into NK cells.
- 66 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00)
- the nucleic acid or nucleic acid set is comprised within one or more viral vectors.
- the nucleic acids and the vector(s) may be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined with a ligase.
- synthetic nucleic acid linkers can be ligated to the termini of the nucleic acid encoding at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides.
- the synthetic linkers may contain nucleic acid sequences that correspond to a particular restriction site in the vector. The selection of expression vectors/plasmids/viral vectors would depend on the NK cells for expression of the at least one metabolism modulating polypeptides described herein and/or the chimeric receptor polypeptides, but should be suitable for integration and replication in eukaryotic cells.
- An exemplary embodiment is a method of modifying the metabolism of NK cells, comprising transfecting immune cells transiently or stably with the vector or vector set and collecting immune cells transfected with the vector or vector set.
- the vector may contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene or the kanamycin gene for selection of stable or transient transfectants in NK cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; intron sequences from the human EF1-alpha gene, transcription termination and RNA processing signals from SV40 for mRNA stability; SV40 or polyomavirus origins of replication and ColE1 for proper episomal replication; internal ribosome binding sites (IRESs), versatile multiple cloning sites; T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA; a “suicide switch” or “suicide gene” which when triggered causes cells carrying the vector
- such vectors also include a suicide gene.
- suicide gene refers to a gene that causes the cell expressing the suicide gene to die.
- the suicide gene can be a gene (e.g., HSV thymidine kinase) that confers sensitivity to an agent, e.g., a drug (e.g., ganciclovir for HSV thymidine kinase), upon the cell in which the gene is expressed, and causes the cell to die when the cell is contacted with or exposed to the agent.
- agent e.g., a drug for HSV thymidine kinase
- Suicide genes are known in the art (see, for example, Springer, C. J.
- vectors for expression of metabolism modulating polypeptides and/or chimeric receptor polypeptides can be found, for example, in US 2014/0106449, herein incorporated in its entirety by reference.
- Any of the vectors comprising a nucleic acid sequence that encodes the metabolism modulating polypeptides and/or a chimeric receptor polypeptide described herein is also within the scope of the present invention.
- Such a vector, or the sequence encoding such metabolism modulating polypeptides and/or a chimeric receptor polypeptide contained therein may be delivered into immune cells such as immune cells by any suitable method.
- Methods of delivering vectors to immune cells are well known in the art and may include DNA electroporation, RNA electroporation, transfection using reagents such as liposomes, or viral transduction (e.g., retroviral transduction such as lentiviral or gamma-retroviral transduction).
- viral transduction e.g., retroviral transduction such as lentiviral or gamma-retroviral transduction.
- the vectors for expression of the at least one metabolism modulating polypeptides and/or the chimeric receptor polypeptides are delivered to immune cells by viral transduction (e.g., retroviral transduction such as lentiviral or gamma-retroviral transduction).
- Exemplary viral methods for delivery include, but are not limited to, recombinant retroviruses (see, e.g., WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; and WO 91/02805; US 5,219,740 and US 4,777,127; GB 2,200,651; and EP 0345242), alphavirus-based vectors, and adeno-associated virus (AAV) vectors (see, e.g., WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984; and WO 95/00655).
- retroviruses see, e.g., WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230;
- the vectors for expression of the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides are retroviruses.
- the vectors are lentiviruses. Examples of references describing retroviral transduction include US 5,399,346; Mann et al. (Cell, 33(1): 153-159 (1983)); US 4,650,764; US 4,980,289; Markowitz et al. (J Virol, 62(4): 1120-1124 (1988)); US 5,124,263; WO 95/07358 and Kuo et al. (Blood, 82(3): 845-852 (1993)).
- WO 95/07358 describes high efficiency transduction of primary B lymphocytes. See also WO 2016/040441A1, all incorporated by reference herein for the purpose and subject matter referenced herein. 68 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00)
- viral particles that are capable of infecting the immune cells and carry the vector may be produced by any method known in the art and can be found, for example in WO 91/02805A2, WO 98/09271A1, and US 6,194,191.
- RNA molecules encoding the at least one metabolism modulating polypeptides and/or the chimeric receptor polypeptides as described herein may be prepared by a conventional method (e.g., in vitro transcription) and then introduced into suitable immune cells, e.g., those described herein, via known methods, e.g., Rabinovich et al. (Human Gene Therapy, 17(10): 1027-1035 (2006)).
- suitable immune cells e.g., those described herein, via known methods, e.g., Rabinovich et al. (Human Gene Therapy, 17(10): 1027-1035 (2006)).
- the disclosure also relates to a nucleic acid of the present invention.
- the nucleic acid encoding at least one metabolism modulating polypeptide and the nucleic acid encoding a suitable chimeric receptor polypeptide may be cloned into separate expression vectors, which may be introduced into suitable immune cells concurrently or sequentially.
- an expression vector (or an RNA molecule) for expressing at least one metabolism modulating polypeptide may be introduced into NK cells first and the transfected NK cells expressing at least one metabolism modulating polypeptides may be isolated and cultured in vitro.
- an expression vector (or an RNA molecule) expressing a suitable chimeric receptor polypeptide can then introduced into the NK cells expressing at least one metabolism modulating polypeptide where both polypeptides can be isolated.
- expression vectors each for expressing at least one metabolism modulating polypeptide and the chimeric receptor polypeptide can be introduced into NK cells simultaneously and transfected NK cells expressing both polypeptides can be isolated via routine methodology.
- the nucleic acid(s) encoding at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptide may be delivered into NK cells via transposons (e.g., piggybac).
- the encoding nucleic acid(s) may be delivered into NK cells via gene editing, for example, by CRISPR, TALEN, zinc-finger nuclease (ZFN), or meganucleases.
- nucleic acid encoding at least one metabolism modulating polypeptide and the nucleic acid encoding the chimeric receptor polypeptide may be cloned 69 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) into the same expression vector.
- Polynucleotides including vectors in which such polynucleotides are operably linked to at least one regulatory element) for expression of the chimeric receptor polypeptide and at least one metabolism modulating polypeptide are also within the scope of the present disclosure.
- Non-limiting examples of useful vectors of the disclosure include viral vectors such as, e.g., retroviral vectors including gamma retroviral vectors and lentiviral vectors, and adeno-associated virus vectors (AAV vectors).
- the nucleic acid described herein may comprise two coding sequences, one encoding a chimeric receptor polypeptide as described herein, and the other at least one encoding metabolism modulating polypeptide.
- the nucleic acid comprising the coding sequences described herein may be configured such that the coding sequences encoding the metabolism modulating polypeptides can be expressed as independent (and physically separate) polypeptides.
- the nucleic acid described herein may contain a third nucleotide sequence located between the coding sequences for the metabolism modulating polypeptide and the Chimeric receptor polypeptide.
- This third nucleotide sequence may, for example, encode a ribosomal skipping site.
- a ribosomal skipping site is a sequence that impairs normal peptide bond formation. This mechanism results in the translation of additional open reading frames from one messenger RNA.
- This third nucleotide sequence may, for example, encode a P2A, T2A, or F2A peptide (see, for example, Kim, Lee et al. (PLoS One, 6(4): e18556 (2011)). See Table 13 below. Table 13.
- the third nucleotide sequence may encode an internal ribosome entry site (IRES).
- IRES is an RNA element that allows translation initiation in an end- independent manner, also permitting the translation of additional open reading frames from one messenger RNA.
- the third nucleotide sequence may encode a promoter controlling the expression of the first polypeptide and/or the second polypeptide.
- the third nucleotide sequence may also encode more than one ribosomal skipping sequence, IRES 70 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) sequence, additional promoter sequence, or a combination thereof.
- An exemplar IRES sequence is provided as SEQ ID NO: 91.
- IRES Sequence (SEQ ID NO: 91) GAGGGCCCGGAAACCTGGCCCTGTCTTCTTGACGAGCATTCCTAGGGGTCTTTCCCC TCTCGCCAAAGGAATGCAAGGTCTGTTGAATGTCGTGAAGGAAGCAGTTCCTCTGGA AGCTTCTTGAAGACAAACAACGTCTGTAGCGACCCTTTGCAGGCAGCGGAACCCCCC ACCTGGCGACAGGTGCCTCTGCGGCCAAAAGCCACGTGTATAAGATACACCTGCAAA GGCGGCACAACCCCAGTGCCACGTTGTGAGTTGGATAGTTGTGGAAAGAGTCAAATG GCTCTCCTCAAGCGTATTCAACAAGGGGCTGAAGGATGCCCAGAAGGTACCCCATTG TATGGGATCTGATCTGGGGCCTCGGTGCACATGCTTTACATGTGTTTAGTCGAGGTT AAAAAAACGTCTAGGCCCCCCGAACCACGGGGACGTGGTTTTCCTTTGAAAAACACG ATGATAA The nucleic acid may also include additional coding sequences (S
- the additional coding sequences may be separated from other coding sequences for a polypeptide by one or more nucleotide sequences encoding one or more ribosomal skipping sequences, IRES sequences, or additional promoter sequences.
- the nucleic acid e.g., an expression vector or an RNA molecule as described herein
- the nucleic acid may comprise coding sequences for at least one metabolism modulating polypeptide and a suitable chimeric receptor polypeptide, the coding sequences (for example, two), in any order, being separated by a third nucleotide sequence coding for a P2A peptide (e.g., SEQ ID NO: 74).
- two separate polypeptides at least the one metabolism modulating polypeptide and the chimeric receptor, can be produced from such a nucleic acid, wherein at least one P2A portion (e.g., SEQ ID NO: 74) is linked to the upstream polypeptide (encoded by the upstream coding sequence) and residue P from the P2A peptide is linked to the downstream polypeptide (encoded by the downstream coding sequence).
- the chimeric receptor polypeptide is the upstream one and the at least one metabolism modulating polypeptide is the downstream one.
- the at least one metabolism modulating polypeptide is the upstream one and the chimeric receptor polypeptide is the downstream one.
- the nucleic acid may comprise coding sequences of at least one metabolism modulating 71 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) polypeptides (e.g., those described herein) and a suitable ACTR or CAR polypeptide, the coding sequences, in any order, being separated by an additional nucleotide sequence coding for a P2A peptide (e.g., SEQ ID NO: 74).
- a P2A peptide e.g., SEQ ID NO: 74
- the metabolism modulating polypeptide and the ACTR or CAR can be produced from such a nucleic acid, wherein the P2A portion (e.g., SEQ ID NO: 74 is linked to the upstream polypeptide (encoded by the upstream coding sequence) and residue P from the P2A peptide is linked to the downstream polypeptide (encoded by the downstream coding sequence).
- the ACTR or CAR polypeptide is the upstream one and the two metabolism modulating polypeptides are the downstream one.
- the two metabolism modulating polypeptides are the upstream one and the ACTR or CAR polypeptide is the downstream one.
- the nucleic acid described above may further encode a linker (e.g., a GSG linker) between two segments of the encoded sequences, for example, between the upstream polypeptide and the P2A peptide.
- a linker e.g., a GSG linker
- Specific embodiments relate to a vector or vector set comprising the nucleic acid or nucleic acid set.
- the vector or vector set is comprised within a viral vector wherein the viral vector is lentiviral or retroviral.
- the method of producing viral particles using the viral vector comprising the nucleic acid or nucleic acid are well known in the art and have been described below.
- Specific embodiments relate to a method of producing viral particles, wherein (a) providing host cells stably transfected with the nucleic acid or nucleic acid set of or the vector or vector set; (b) growing the stably transfected host cells in a cell culture medium under conditions allowing for producing viral particles by the host cells; and (c) harvesting the viral particles from the cell culture medium.
- Some embodiments relate to the viral particle produced.
- Exemplary embodiments relates to a method of producing a NK cell that expresses the metabolism modulating polypeptide and the chimeric receptor polypeptide, comprising incubating NK cells with the viral particle under conditions allowing for infection of immune cells by the viral particle.
- a NK cell is prodced by the method described herein.
- the NK cell expresses at least one metabolism modulating polypeptide (e.g., any of SEQ ID Nos: SEQ ID NO: 75 – SEQ ID NO: 82), and/or the chimeric receptor polypeptide.
- at least one metabolism modulating polypeptide e.g., any of SEQ ID Nos: SEQ ID NO: 75 – SEQ ID NO: 82
- the NK cells may be cultured under conditions that allow for expression of the polypeptide and/or the chimeric receptor polypeptide (e.g., under a regulatable promoter, the immune cells may be cultured in conditions wherein the regulatable promoter is activated).
- the promoter is an inducible promoter and the NK cells are cultured in the presence of the inducing molecule or in conditions in which the inducing molecule is produced. Determining whether the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptide is expressed will be evident to one of skill in the art and may be assessed by any known method, for example, mRNA by quantitative reverse transcriptase PCR (qRT- PCR) or protein by methods including Western/immuno blotting, fluorescence microscopy, and flow cytometry. Alternatively, expression of the chimeric receptor polypeptide may take place in vivo after the NK cells are administered to a subject.
- qRT- PCR quantitative reverse transcriptase PCR
- the term “subject” refers to any mammal such as a human, monkey, mouse, rabbit, or domestic mammal.
- the subject may be a primate.
- the subject is human.
- expression of at least one metabolism modulating polypeptide, and/or a chimeric receptor polypeptide in the NK cells disclosed herein can be achieved by introducing RNA molecules.
- RNA molecules can be prepared by in vitro transcription or by chemical synthesis.
- the RNA molecules can then be introduced into the NK cells by, e.g., electroporation.
- RNA molecules can be synthesized and introduced into the NK cells following the methods described in Rabinovich, Komarovskaya et al.
- a vector(s) or RNA molecule(s) comprising at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptide may be introduced to the NK cells in vivo.
- this may be accomplished by administering a vector or RNA molecule described herein directly to the subject (e.g., through intravenous administration).
- An exemplary embodiment is a method of modifying the metabolism of NK cells, comprising transfecting NK cells transiently or stably with the vector or vector set and collecting NK cells transfected with the vector or vector set.
- the method for generating modified NK cells in vivo comprises administering to 73 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) a subject in need thereof the nucleic acid or nucleic acid set, the vector or vector set, or the viral particles described herein.
- a preferred embodiment is a population of genetically engineered NK cells for use in inhibiting cells expressing a target antigen in a subject.
- Methods for preparing NK cells expressing at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides described herein may also comprise activating the NK cells ex vivo.
- Activating the NK cell means stimulating a NK cell into an activated state in which the NK cell may be able to perform effector functions.
- the NK cells are activated ex vivo in the presence of one or more molecules such as a 4-1BB ligand, an anti-4-1BB antibody, IL-2, IL-15, an anti-IL-15 receptor antibody, IL12, IL-21, K562 cells, and/or engineered artificial stimulatory cells or particles.
- the NK cells of the present invention and described herein are activated ex vivo prior to administration to a subject. Determining whether the NK cell is activated will be evident to one of skill in the art and may include assessing expression of one or more cell surface markers associated with NK cell activation, expression or secretion of cytokines, and morphology. Expanding NK cells may involve any method that results in an increase in the number of NK cells expressing metabolism modulating polypeptides and/or chimeric receptor polypeptides, for example, allowing the NK cells to proliferate or stimulating the NK cells to proliferate. Methods for stimulating expansion of NK cells will be evident to one of skill in the art.
- the NK cells expressing at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides are activated, expanded or both ex vivo prior to administration of the cells to the subject.
- NK cell activation and expansion may be used to allow integration of a viral vector into the genome and expression of the gene encoding the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptide as described herein. If mRNA electroporation is used, no activation and/or expansion may be required, although electroporation may be more effective when performed on activated NK cells.
- the at least one metabolism modulating polypeptide and/or a chimeric receptor polypeptide is transiently expressed in the NK cell (e.g., for 3-5 days). Transient expression may be advantageous if there is a potential toxicity and should be helpful in initial phases of clinical testing for possible side effects.
- a pharmaceutical composition comprising a genetically engineered immune cell of the invention is another embodiment.
- compositions of the present disclosure refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a mammal (e.g., a human).
- pharmaceutically acceptable means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans.
- Acceptable means that the carrier is compatible with the active ingredient of the composition (e.g., the nucleic acids, vectors, cells, or therapeutic antibodies) and does not negatively affect the subject to which the composition(s) are administered.
- compositions to be used in the present methods can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formations or aqueous solutions.
- Pharmaceutically acceptable carriers including buffers, are well known in the art, and may comprise phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives; low molecular weight polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; amino acids; hydrophobic polymers; monosaccharides; disaccharides; and other carbohydrates; metal complexes; and/or non-ionic surfactants. See, e.g. Remington: The Science and Practice of Pharmacy 20 th Ed.
- compositions of the disclosure may also contain one or more additional active compounds as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other.
- additional active compounds include, e.g., IL-2 as well as various agents known in the field and listed in the discussion of combination treatments, below.
- another embodiment of the present invention is a method for inhibiting/and or killing cells expressing a target antigen in a subject, the method comprising administering to a subject in need thereof a population of the genetically engineered NK cells set forth herein or a pharmaceutical composition comprising a population of the genetically engineered NK cells set forth herein.
- the exemplary ACTR polypeptides of the present disclosure enhance antibody- dependent cell cytotoxicity (ADCC) in NK cells.
- the degree of affinity of CD16 for the Fc portion of Ig is a critical determinant of ADCC and thus to clinical responses to antibody immunotherapy.
- the CD16 with the V158 polymorphism which has a higher binding affinity for Ig and mediates superior ADCC relative to CD16 with the F158 polymorphism was selected as an example.
- the F158 receptor has lower potency than the V158 receptor in induction of T cell proliferation and ADCC, the F158 receptor may have lower in vivo toxicity than the V158 receptor making it useful in some clinical contexts.
- At least one metabolism modulating polypeptide co-expressed with an ACTR polypeptide in NK cells would facilitate NK-cell therapy by allowing the cells to grow and/or function effectively in a low glucose, low amino acid, low pH, and/or hypoxic environment. Antibody-directed cytotoxicity could be stopped whenever required by simple withdrawal of antibody administration. Clinical safety can be further enhanced by using mRNA electroporation to express at least one metabolism modulating polypeptide and/or the ACTR polypeptides transiently, to limit any potential autoimmune reactivity.
- the disclosure provides a method for enhancing efficacy of an antibody-based immunotherapy of a cancer in a subject in need thereof, which subject is being treated with an Fc-containing therapeutic agent such as a therapeutic antibody, which can bind to antigen-expressing cells.
- the Fc-containing therapeutic agent contains an Fc portion, for example, a human or humanized Fc portion, which can be recognized and bound by the Fc-binding portion (e.g., the extracellular domain of human CD16A) of the ACTR expressed on the engineered immune cells.
- Exemplary ACTR constructs are provided in Table 10 above.
- the methods described herein may comprise introducing into the subject a therapeutically effective amount an antibody and a therapeutically effective amount of the genetically engineered NK cells, of the present invention.
- the subject e.g., a human patient such as a human cancer patient
- a target antigen may be any molecule that is associated with a disease or condition, including, but are not limited to, tumor antigens, pathogenic antigens (e.g., bacterial, fungal or viral), or antigens present on diseased cells, such as those described herein.
- the terms “treat”, “treatment”, and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression of such condition.
- the term “treat” also denotes to arrest, delay the onset (i.e., the period prior to clinical manifestation of a disease) and/or reduce the risk of developing or worsening a disease.
- the term “treat” may mean eliminate or reduce a patient’s tumor burden, or prevent, delay or inhibit metastasis, etc.
- the term “therapeutically effective” applied to dose or amount refers to that quantity of a compound or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof.
- a combination of active ingredients e.g., a first pharmaceutical composition comprising an antibody, and a second pharmaceutical composition comprising a population of the genetically modified NK cells that express at least one metabolism modulating polypeptide and/or an antibody-coupled T-cell receptor (ACTR) construct
- the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually.
- NK cells expressing at least one metabolism modulating polypeptides and an ACTR polypeptides described herein are useful for enhancing ADCC in a subject, for enhancing the efficacy of an antibody-based immunotherapy and/or for enhancing growth and/or proliferation of the genetically engineered NK cells in a low-glucose environment.
- 77 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) the subject is a mammal, such as a human, monkey, mouse, rabbit, or domestic mammal.
- the subject is a human.
- the subject is a human cancer patient.
- the subject has been treated or is being treated with any of the therapeutic antibodies described herein.
- an effective amount of the NK cells, described herein and an effective amount of an antibody, or compositions thereof may be administered to a subject in need of the treatment via a suitable route, such as intravenous administration.
- an effective amount refers to the amount of the respective agent (e.g., the genetically engineered NK cells of the present invention and the ACTR polypeptide, antibodies, or compositions thereof) that upon administration confers a therapeutic effect on the subject. Determination of whether an amount of the cells or compositions described herein achieved the therapeutic effect would be evident to one of skill in the art. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender, sex, and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner.
- the respective agent e.g., the genetically engineered NK cells of the present invention and the ACTR polypeptide, antibodies, or compositions thereof
- the effective amount alleviates, relieves, ameliorates, improves, reduces the symptoms, or delays the progression of any disease or disorder in the subject.
- the subject in need of treatment is a human.
- the subject in need of treatment is a human cancer patient.
- the subject in need of treatment suffers from one or more pathogenic infections (e.g., viral, bacterial, and/or fungal infections).
- the genetically engineered NK cells described herein are administered to a subject in an amount effective in enhancing ADCC activity by least 20% and/or by at least 2-fold, e.g., enhancing ADCC by 50%, 80%, 100%, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold, or more.
- the NK cells are co-administered with an Fc-containing therapeutic agent such as a therapeutic antibody in order to target cells expressing the antigen to which the Fc-containing therapeutic agent binds.
- an Fc-containing therapeutic agent such as a therapeutic antibody
- more than one Fc- containing therapeutic agents, such as more than one antibody can be co-used with the immune cells.
- Antibody-based treatment may therefore, improve the overall health status of the patient in need receiving the treatment.
- An antibody (interchangeably used in plural form) is 78 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule.
- a target such as a carbohydrate, polynucleotide, lipid, polypeptide, etc.
- antibody encompasses not only intact (i.e., full-length) polyclonal or monoclonal antibodies, but also antigen-binding fragments thereof which comprise an Fc region, mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies, single domain antibodies (e.g., nanobodies), linear antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity and an Fc region, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies.
- An antibody includes an antibody of any class, such as IgD, IgE, IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class.
- immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2.
- the heavy- chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively.
- the subunit structures and three- dimensional configurations of different classes of immunoglobulins are well known.
- the antibody for use in the present disclosure contains an Fc region recognizable by the co-used ACTR- NK cells.
- the Fc region may be a human or humanized Fc region.
- Any of the antibodies described herein can be either monoclonal or polyclonal.
- a “monoclonal antibody” refers to a homogenous antibody population and a “polyclonal antibody” refers to a heterogeneous antibody population.
- the antibodies described herein specifically bind to the corresponding target antigen or an epitope thereof.
- An antibody that “specifically binds” to an antigen or an epitope is a term well understood in the art. A molecule is said to exhibit “specific binding” if it reacts more frequently, more rapidly, with greater duration and/or with greater affinity with a particular target antigen than it does with alternative targets.
- An antibody “specifically binds” to a target antigen or epitope if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances.
- an antibody 79 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) that specifically (or preferentially) binds to an antigen or an antigenic epitope therein is an antibody that binds this target antigen with greater affinity, avidity, more readily, and/or with greater duration than it binds to other antigens or other epitopes in the same antigen. It is also understood with this definition that, for example, an antibody that specifically binds to a first target antigen may or may not specifically or preferentially bind to a second target antigen. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding.
- an antibody that “specifically binds” to a target antigen or an epitope thereof may not bind to other antigens or other epitopes in the same antigen.
- an antibody as described herein has a suitable binding affinity for the target antigen (e.g., any one of the targets described herein) or antigenic epitopes thereof.
- the antibodies for use in the immune therapy methods described herein may bind to (e.g., specifically bind to) a target antigen of interest, or a specific region or an antigenic epitope therein. Table 4 above lists exemplary target antigens of interest and exemplary antibodies specific to such. The methods of the disclosure may be used for treatment of any cancer have been described herein.
- the methods of this disclosure may also be used for treating infectious diseases, which may be caused by bacterial infection, viral infection, or fungus infection.
- the genetically engineered immune cells can be co-used with an Fc-containing therapeutic agent (e.g., an antibody) that targets a pathogenic antigen (e.g., an antigen associated with the bacterium, virus, or fungus that causes the infection).
- an Fc-containing therapeutic agent e.g., an antibody
- a pathogenic antigen e.g., an antigen associated with the bacterium, virus, or fungus that causes the infection.
- NK-cell therapy for inhibiting and/or killing diseased cells expressing an antigen to which the CAR polypeptide targets, directly or indirectly (e.g., via a therapeutic agent conjugated to a tag to which the CAR polypeptide binds).
- Their co-expression with a CAR polypeptide in NK cells would facilitate the cell-based immune therapy by allowing the cells to grow and/or function effectively in a low glucose, low amino acid, low pH, and/or a hypoxic environment, for example, in a tumor microenvironment.
- Clinical safety may be further enhanced by using mRNA electroporation to express the at least one metabolism modulating polypeptide from above and/or the CAR polypeptides transiently, to limit any potential non-tumor specific reactivity.
- 80 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00)
- the methods described herein may comprise introducing into the subject a therapeutically effective amount of genetically engineered NK cells which co-express the at least one metabolism modulating polypeptide and a CAR polypeptide of the disclosure (see exemplary examples in Table 11).
- the subject may additionally have been treated or is being treated with an anti-cancer or anti-infection therapy including, but not limited to, an anti-cancer therapeutic agent or anti-infection agent.
- NK cells e.g., T and NK cells
- expressing at least one metabolism modulating polypeptides and a CAR polypeptide described herein are useful for inhibiting cells expressing a target antigen and/or for enhancing growth and/or proliferation of immune cells in a low- glucose environment, a low amino acid environment, a low pH environment, and/or a hypoxic environment, for example, in a tumor microenvironment.
- the subject is a mammal, such as a human, monkey, mouse, rabbit, or domestic mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a human cancer patient. In some embodiments, the subject is a human patient suffering from an infectious disease.
- an effective amount of the genetically engineered NK cells described herein, or compositions thereof may be administered to a subject in need of the treatment via a suitable route, such as intravenous, subcutaneous and intradermal administration, preferably intravenous.
- an effective amount refers to the amount of the respective agent (i.e., the NK and/or T cells expressing metabolism modulating polypeptide CAR polypeptides, or compositions thereof) that upon administration confers a therapeutic effect on the subject. Determination of whether an amount of the cells or compositions described herein achieved the therapeutic effect would be evident to one of skill in the art. Effective amounts vary, as recognized by those skilled in the art and have been described herein. The methods of the disclosure may be used for treatment of any cancer or any pathogen.
- cancers which can be treated by the methods of the disclosure include, for example, lymphoma, breast cancer, gastric cancer, neuroblastoma, osteosarcoma, lung cancer, skin cancer, prostate cancer, colorectal cancer, renal cell carcinoma, ovarian cancer, rhabdomyosarcoma, leukemia, mesothelioma, pancreatic cancer, head and neck cancer, retinoblastoma, glioma, glioblastoma, thyroid cancer, hepatocellular cancer, esophageal cancer, and cervical cancer.
- the cancer may be a solid 81 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) tumor.
- the cancer may be a liquid tumor.
- a preferred embodiment is a method for inhibiting cells expressing a target antigen in a subject, wherein the subject is a human patient suffering from a cancer and the target antigen is a tumor antigen; wherein the cancer is selected from the group consisting of carcinoma, lymphoma, sarcoma, blastoma, and leukemia, preferably wherein the cancer is selected from the group consisting of a cancer of B-cell origin, breast cancer, gastric cancer, neuroblastoma, osteosarcoma, lung cancer, skin cancer, prostate cancer, colon cancer, renal cell carcinoma, ovarian cancer, rhabdomyosarcoma, leukemia, mesothelioma, pancreatic cancer, head and neck cancer, retinoblastoma
- the methods of this disclosure may also be used for treating infectious diseases, which may be caused by bacterial infection, viral infection, or fungal infection.
- genetically engineered NK cells expressing a CAR polypeptide specific to a pathogenic antigen can be used to eliminate infected cells.
- pathogenic antigens include, but are not limited to, bacterial, viral, and/or fungal antigens.
- the NK cells are administered to a subject in an amount effective in inhibiting cells expressing the target antigen by least 20% and/or by at least 2-fold, e.g., inhibiting cells expressing the target antigen by 50%, 80%, 100%, 2-fold, 5-fold, 10-fold, 20- fold, 50-fold, 100-fold, or more.
- Additional therapeutic agents e.g., antibody-based immunotherapeutic agents
- the efficacy of the cell-based immunotherapy as described herein may be assessed by any method known in the art and would be evident to a skilled medical professional.
- the efficacy of cell-based immunotherapy may be assessed by survival of the subject or tumor or cancer burden in the subject or tissue or sample thereof.
- the NK cells are administered to a subject in need of the treatment in an amount effective in enhancing the efficacy of an cell- based immunotherapy by at least 20% and/or by at least 2-fold, e.g., enhancing the efficacy of an antibody-based immunotherapy by 50%, 80%, 100%, 2-fold, 5-fold, 10-fold, 20-fold, 50- fold, 100-fold or more, as compared to the efficacy in the absence of the immune cells 82 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) expressing at least one metabolism modulating polypeptide and/or the CAR polypeptide.
- the NK cells may be autologous to the subject, i.e., the NK cells may be obtained from the subject in need of the treatment, genetically engineered for expression of at least one metabolism modulating polypeptide described herein and/or the CAR polypeptides, and then administered to the same subject.
- the autologous NK cells prior to re-introduction into the subject, are activated and/or expanded ex vivo. Administration of autologous cells to a subject may result in reduced rejection of the immune cells as compared to administration of non- autologous cells.
- the NK cells are allogeneic cells, i.e., the cells are obtained from a first subject, genetically engineered for expression of at least one metabolism modulating polypeptide described herein and/or the CAR polypeptide and administered to a second subject that is different from the first subject but of the same species.
- allogeneic NK cells may be derived from a human donor and administered to a human recipient who is different from the donor.
- NK cells can be activated by any method known in the art, e.g., in the presence of one or more agents selected from the group consisting of CD137 ligand protein, CD137 antibody, IL-15, IL-15 receptor antibody, IL-2, IL-12, IL-21, and cells from the K562 cell line, and/or engineered artificial stimulatory cells or particles. See, e.g., US 7,435,596 and US 8,026,097 for the description of useful methods for expanding NK cells.
- NK cells used in the compositions or methods of the disclosure may be preferentially expanded by exposure to cells that lack or poorly express major histocompatibility complex I and/or II molecules and which have been genetically modified to express membrane bound IL-15 and 4-1BB ligand (CD137L).
- Such cell lines include, but are not necessarily limited to, K562 [ATCC, CCL 243; (Lozzio and Lozzio, Blood, 45(3): 321-334 (1975); Klein et al., Int J Cancer, 18(4): 421-431 (1976))], and the Wilms tumor cell line HFWT (Fehniger and Caligiuri, Int Rev Immunol, 20(3- 4): 503-534 (2001); Harada et al., Exp Hematol, 32(7): 614-621 (2004)), the uterine endometrium tumor cell line HHUA, the melanoma cell line HMV-II, the hepatoblastoma cell line HuH-6, the lung small cell carcinoma cell lines Lu-130 and Lu-134-A, the neuroblastoma cell lines NB19 and N1369, the embryonal carcinoma cell line from testis NEC 14, the cervix carcinoma cell line TCO-2, and the bone marrow-metastasized neuroblastoma cell line T
- the cell line used lacks 83 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) or poorly expresses both MHC I and II molecules, such as the K562 and HFWT cell lines.
- a solid support may be used instead of a cell line.
- Such support should preferably have attached on its surface at least one molecule capable of binding to NK cells and inducing a primary activation event and/or a proliferative response or capable of binding a molecule having such an affect thereby acting as a scaffold.
- the support may have attached to its surface the CD137 ligand protein, a CD137 antibody, the IL-15 protein or an IL-15 receptor antibody.
- the support will have IL-15 receptor antibody and CD137 antibody bound on its surface.
- introduction (or re- introduction) of NK cells to the subject is followed by administering to the subject a therapeutically effective amount of IL-2.
- the method further comprises cryopreserving the population of engineered NK cells.
- a genetically engineered NK cells are cryopreserved.
- patients can be treated by infusing therapeutically effective doses of NK cells comprising at least one metabolism modulating polypeptide and/or a CAR polypeptide of the disclosure in the range of about 10 5 to 10 10 or more cells per kilogram of body weight (cells/Kg).
- the infusion can be repeated as often and as many times as the patient can tolerate until the desired response is achieved.
- the appropriate infusion dose and schedule will vary from patient to patient, but can be determined by the treating physician for a particular patient. Typically, initial doses of approximately 10 6 cells/kg will be infused, escalating to 10 8 or more cells/kg.
- IL-2 can be co-administered to expand infused cells. The amount of IL-2 can be about 1-5 x 10 6 international units per square meter of body surface.
- the term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system.
- “about” can mean within an acceptable standard deviation, per the practice in the art.
- “about” can mean a range of up to ⁇ 20%, preferably up to ⁇ 10%, more preferably up to ⁇ 5%, and more preferably still up to ⁇ 1% of a given value.
- the term can mean within an order of magnitude, preferably within 2-fold, of a value.
- compositions or methods described herein may be assessed by any method known in the art and would be evident to a skilled medical professional.
- the efficacy of the compositions or methods described herein may be assessed by survival of the subject or cancer or pathogen burden in the subject or tissue or sample thereof.
- compositions and methods described herein may be assessed based on the safety or toxicity of the therapy (e.g., administration of the immune cells expressing the metabolism modulating polypeptides that redirect glucose metabolites and the CAR polypeptides) in the subject, for example, by the overall health of the subject and/or the presence of adverse events or severe adverse events.
- the therapy e.g., administration of the immune cells expressing the metabolism modulating polypeptides that redirect glucose metabolites and the CAR polypeptides
- C. Other Immunotherapies Some embodiments provide for a composition comprising an effective amount of the engineered NK cells of the embodiments for use in the treatment of a disease or disorder in a subject. Also provided herein is the use of a composition comprising an effective amount of the engineered NK cells of the embodiments for the treatment of an immune-related disorder in a subject.
- a further embodiment provides for a method of treating an immune-related disorder in a subject comprising administering an effective amount of engineered NK cells of the embodiments to the subject.
- the method does not comprise performing HLA matching.
- the NK cells are KIR-ligand mismatched between the subject and donor.
- the method does not comprise performing HLA matching.
- the absence of HLA matching does not result in graft versus host disease or toxicity.
- Such therapies can be administered simultaneously or sequentially (in any order) with the immunotherapy according to the present disclosure.
- suitable therapeutically effective dosages for each agent may be lowered due to the additive action or synergy.
- 85 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00)
- the genetically engineered NK cells disclosed herein may be administered to a subject who has been treated or is being treated with an additional therapeutic agent (e.g., an additional anti-cancer therapeutic agent).
- these genetically engineered NK cells may be administered to a human subject simultaneously with the additional therapeutic agent.
- the genetically engineered NK cells may be administered to a human subject before the additional therapeutic agent. In some embodiments, the genetically engineered NK cells may be administered to a human subject after the additional therapeutic agent. Genetically engineered NK cells that co-express at least one metabolism modulating polypeptide and a CAR polypeptide specific to a tag can be co-used with a therapeutic agent conjugated to the tag. Via the therapeutic agent, which is capable of binding to an antigen associated with diseased cells such as tumor cells, such genetically engineered NK cells can be engaged with the diseased cells and inhibit their growth.
- any of the antibodies listed in Table 4 above, or others specific to the same target antigen also listed in Table 4 can be conjugated to a suitable tag (e.g., those described herein) and be co-used with immune cells co-expressing the factor that redirects glucose metabolites and a CAR polypeptide specific to the tag.
- the treatments of the disclosure can be combined with other immunomodulatory treatments such as, e.g., therapeutic vaccines (including but not limited to GVAX, dendritic cell (DC)-based vaccines, etc.), checkpoint inhibitors (including but not limited to agents that block CTLA-4, PD-1, LAG3, TIM3, etc.) or activators (including but not limited to agents that enhance 41BB, OX40, etc.).
- genetically engineered NK cells that co- express at least one metabolism modulating polypeptide and a CAR polypeptide is combined with an immunomodulatory treatment.
- therapeutic agents useful for combination with the immunotherapy of the disclosure include: (i) anti-angiogenic agents (e.g., TNP-470, platelet factor 4, thrombospondin-1, tissue inhibitors of metalloproteases (TIMP1 and TIMP2), prolactin (16-Kd fragment), angiostatin (38-Kd fragment of plasminogen), endostatin, bFGF soluble receptor, transforming growth factor beta, interferon alpha, soluble KDR and FLT-1 receptors, placental proliferin-related protein, as well as those listed by Carmeliet and Jain (Nature, 407(6801): 249-257 (2000)); (ii) a VEGF antagonist or a VEGF receptor antagonist such as anti-VEGF antibodies, VEGF variants, soluble VEGF receptor
- an additional therapeutic agent can be performed by any suitable route, including systemic administration as well as administration directly to the site of the disease (e.g., to a tumor).
- the method involves administering the additional therapeutic agent (e.g., an antibody) to the subject in one dose.
- the method involves administering the additional therapeutic agent (e.g., an antibody) to the subject in multiple doses (e.g., at least 2, 3, 4, 5, 6, 7, or 8 doses).
- the additional therapeutic agent e.g., an antibody
- the additional therapeutic agent is administered to the subject in multiple doses, with the first dose of the additional therapeutic agent (e.g., an antibody) administered to the subject about 1, 2, 3, 4, 5, 6, or 7 days prior to administration of the NK cells expressing at least one metabolism modulating polypeptide and/or the CAR polypeptide.
- the first dose of the additional therapeutic agent e.g., an antibody
- the first dose of the additional therapeutic agent is administered to the subject between about 24-48 hours prior to the administration of the immune cells described herein.
- the first dose of the additional therapeutic agent e.g., an antibody
- the additional therapeutic agent e.g., an antibody
- the additional therapeutic agent is administered to the subject prior to administration of the genetically engineered NK cells described herein and then subsequently about every two weeks.
- the first two doses of the additional therapeutic agent are 88 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) administered about one week (e.g., about 6, 7, 8, or 9 days) apart.
- the third and following doses are administered about every two weeks.
- the timing of the administration of the additional therapeutic agent is approximate and includes three days prior to and three days following the indicated day (e.g., administration every three weeks encompasses administration on day 18, day 19, day 20, day 21, day 22, day 23, or day 24).
- Efficacy of immune system induction for disease therapy may be enhanced by combination with other agents that, for example, reduce tumor burden prior to administration of the genetically engineered immune cells of the present invention.
- Antibody-drug conjugates can efficiently reduce tumor burden in many types of cancers.
- ADCs Numerous exemplary ADCs are known in the art (Mullard, Nat Rev Drug Discov, 12(5): 329-332 (2013); Coats et al., Clinical Cancer Research, 25(18): 5441-5448 (2019); Zhao et al., Acta Pharmaceutica Sinica B, 10(9): 1589-1600 (2020); Fu et al., Signal Transduction and Targeted Therapy, 7(1): 93 (2022)). Any such known ADC may be used in combination with a CAR-NK construct as described herein. Thus, in some embodiments, where an ADC is used in combination with a CAR-NK, the ADC is administered prior to the CAR-NK.
- an ADC is used in combination with a CAR-NK as disclosed herein.
- the first dose of the ADC is administered to the subject prior to the administration of the genetically engineered NK cells described herein.
- the efficacy of the immune system induction for the disease therapy may be enhanced by combination with other immunotherapeutic agents, e.g., cytokines that stimulate the CAR-NK cells in vivo (e.g., agonists of the IL-2/IL-15R ⁇ such as IL-2, IL- 15 (IL-2/IL-15 superagonists); IL-7, or IL-12, or derivatives thereof) or immune checkpoint inhibitors (e.g., anti-PD-1 antibodies, anti-PD-L1 antibodies, anti-LAG3 antibodies, anti- CTLA4 antibodies or anti-TIM3 antibodies).
- the method further comprises administering a lymphocyte reduction treatment, preferably selected from cyclophosphamide and fludarabine.
- a lymphocyte reduction treatment preferably selected from cyclophosphamide and fludarabine.
- Such lymphodepletion treatment is preferably applied prior to the infusion of the NK cells expressing a CAR in order to allow for greater T cell expansion of the infused cells (Shank et al., Pharmacotherapy, 37(3): 334-345 (2017)).
- the efficacy of the methods described herein may be assessed by any method known in the art and would be evident to a skilled medical professional and/or those described herein.
- 89 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) VI.
- kits for Therapeutic Use The present disclosure also provides kits for use of any of the compositions described herein.
- the present disclosure also provides kits comprising a population of genetically engineered NK cells (e.g., T or NK cells, constructed in vitro or in vivo) that express at least one metabolism modulating polypeptide and optionally a chimeric receptor (ACTR or CAR) polypeptide described herein for use in inhibiting the growth of diseased cells, e.g., tumor cells and/or enhancing NK cell growth and/or proliferation in a low glucose environment, a low amino acid environment, a low-pH environment, and/or hypoxic environment, for example, in a tumor microenvironment.
- NK cells e.g., T or NK cells, constructed in vitro or in vivo
- ACTR or CAR chimeric receptor
- kits may further comprise a therapeutic agent or a therapeutic agent conjugated to a tag (e.g., those described herein), to which the chimeric receptor polypeptide expressed on the NK cells bind.
- a therapeutic agent or a therapeutic agent conjugated to a tag e.g., those described herein
- kits may include one or more containers comprising the population of the genetically engineered NK cells as described herein, and optionally a therapeutic agent or a therapeutic agent conjugated to a tag.
- the kit comprises genetically engineered NK cells described herein which are expanded ex vivo.
- the kit comprises genetically engineered NK cells described herein and an antibody specific to a cell surface antibody that is present on activated NK cells.
- the kit comprises NK cells expressing at least the one metabolism modulating polypeptides and CAR constructs known in the art or disclosed herein.
- the kit disclosed herein may comprise a nucleic acid or a nucleic acid set as described herein, which collectively encodes any of the chimeric receptor polypeptides and at least the one metabolism modulating polypeptide as also described herein.
- the kit can additionally comprise instructions for use in any of the methods described herein. The included instructions may comprise a description of administration of the first and second pharmaceutical compositions to a subject to achieve the intended activity, e.g., inhibiting target cell growth in a subject.
- the kit may further comprise a description of selecting a subject suitable for treatment based on identifying whether the subject is in need of the treatment.
- the kit may further comprise a description of selecting a subject suitable for treatment based on identifying whether the subject is in need of the treatment.
- Non-limiting examples of such methods of identification may include expression of target in blood, DNA or tissue (e.g., immunohistochemistry). Further, in some instances, a cut-off range may be used to adjust treatment dosage.
- the instructions comprise a description of administering the population of genetically engineered NK cells and optionally a description of administering the tag-conjugated therapeutic agent.
- the instructions relating to the use of the NK cells and optionally the tag-conjugated therapeutic agent as described herein generally include information as to dosage, dosing schedule, and route of administration for the intended treatment.
- the containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub- unit doses. Instructions supplied in the kits of the disclosure are typically written instructions on a label or package insert.
- kits indicates that the pharmaceutical compositions are used for treating, delaying the onset, and/or alleviating a disease or disorder in a subject.
- kits provided herein are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging, and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device, or an infusion device.
- a kit may have a sterile access port (for example, the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port.
- At least one active agent in the second pharmaceutical composition is an antibody as described herein.
- At least one active agent in the first pharmaceutical composition is a population of genetically engineered NK cells as described herein.
- Kits optionally may provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container.
- the disclosure provides articles of manufacture comprising contents of the kits described above. GENERAL TECHNIQUES The practice of the present disclosure will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry, and immunology, which are within the skill of the art.
- Example 1 Impact of expressing one or more exemplary polypeptides in NK cell function expressing an ACTR polypeptide in lower glucose environments At least one transgenes encoding one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) is co-expressed in the same NK cell with an ACTR polypeptide.
- the transgene is, for example, encoding GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75).
- the NK cells are transduced with a virus encoding the ACTR polypeptide and at least one metabolism modulating polypeptide herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence.
- the NK cells are mixed at a given effector-to- target (E:T) ratio with tumor target cells, such as IGROV-1 cells, and a tumor-targeting antibody such as an anti-FOLR ⁇ antibody. Reactions are then incubated at 37 ⁇ C in a 5 % CO2 incubator for a period of time (e.g., 6 – 8 days) at different starting concentrations of glucose (e.g., 0 – 20 mM).
- NK cell function is then evaluated, for example, using cytokine production or proliferation assays or for resistance to chronic stimulation.
- Cytokine production e.g., IL- 2 and/or IFN-gamma
- co-cultures are harvested and stained with ⁇ -CD3, ⁇ -CD14, ⁇ -CD33, ⁇ -CD45, ⁇ - CD56 antibodies and a live-dead cell stain.
- the live NK cells are enumerated on CD45 + CD33-CD3-CD14-CD56 + and a live-dead cell stain is evaluated by flow cytometry.
- NK cells expressing at least one polypeptide described herein in addition to the ACTR polypeptide show enhanced NK cell function relative to NK cells expressing ACTR alone including, for example, enhanced cytokine production or enhanced proliferation. This enhanced function may be more pronounced at lower glucose concentrations.
- Example 2 Impact of expressing one or more exemplary polypeptides in NK cell function expressing an ACTR polypeptide in environments with higher soluble inhibitor concentrations
- At least one transgenes encoding one metabolism modulating polypeptide e.g., SEQ ID NO: 75 – SEQ ID NO: 82
- the transgene is, for example, encoding GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75).
- the NK cells are transduced with a virus encoding the ACTR polypeptide and at least one metabolism modulating polypeptideherein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for 93 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) example, by a P2A ribosomal skip sequence.
- the NK cells are mixed at a given effector-to- target (E:T) ratio with tumor target cells, such as IGROV-1 cells, and a tumor-targeting antibody such as an anti-FOLR ⁇ antibody.
- NK cell function is then evaluated, for example, using cytokine production or proliferation assays or for resistance to chronic stimulation. Cytokine production (e.g., IL- 2 and/or IFN-gamma) is measured from the reaction supernatant. For proliferation experiments, co-cultures of NK are harvested, stained and evaluated by flow cytometry (see Example 1).
- NK cells expressing at least one polypeptide described herein in addition to the ACTR polypeptide show enhanced cellular function relative to NK cells expressing ACTR alone including, for example, enhanced cytokine production. This enhanced function may be achieved at higher soluble inhibitor concentrations.
- Example 3 Impact of expressing one or more exemplary polypeptides in NK cell function expressing an ACTR polypeptide in environments with greater immunosuppressive cell presence
- At least one transgenes encoding one metabolism modulating polypeptide e.g., SEQ ID NO: 75 – SEQ ID NO: 82
- the transgene is, for example, encoding GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75).
- the NK cells are transduced with a virus encoding the ACTR polypeptide and at least one metabolism modulating polypeptideherein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence.
- the NK cells are mixed at a given effector-to- target (E:T) ratio with tumor target cells, such as IGROV-1 cells, and a tumor-targeting antibody such as an anti-FOLR ⁇ antibody. Reactions are then incubated at 37 ⁇ C in a 5 % CO2 incubator for a period of time (e.g., 6 – 8 days) at different starting concentrations of glucose (e.g., 0 – 20 mM).
- NK cell function is then evaluated, for example, using cytokine production or proliferation assays or for resistance to chronic stimulation. Cytokine production (e.g., IL- 2 and/or IFN-gamma) is measured from the reaction supernatant. Proliferation experiments is performed and evaluated as described in example 1. NK cells expressing at least one polypeptide described herein in addition to the ACTR or CAR polypeptide show enhanced NK cell function relative to NK cells expressing ACTR 94 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) or CAR alone including, for example, enhanced cytokine production or enhanced proliferation.
- Cytokine production e.g., IL- 2 and/or IFN-gamma
- Proliferation experiments is performed and evaluated as described in example 1.
- NK cells expressing at least one polypeptide described herein in addition to the ACTR or CAR polypeptide show enhanced NK cell function relative to NK cells
- Example 4 Impact of expressing one or more exemplary polypeptides in NK cell function expressing an ACTR polypeptide on tumor models At least one transgenes encoding a metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) is co-expressed in the same NK cell with an ACTR polypeptide.
- the transgene is, for example, encoding GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75).
- the NK cells are transduced with a virus encoding the ACTR polypeptide and at least one metabolism modulating polypeptide herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence.
- Transduced NK cells are evaluated for anti-tumor activity in mouse tumor models.
- a tumor cell line for example IGROV- 1, is inoculated into NSGTM (NOD scid gamma, NOD.Cg-Prkdc scid IL2rg tm1Wjl /SzJ, Strain 005557) mice.
- Tumor-bearing mice are subsequently dosed with a tumor-targeting antibody, for example an anti-FOLR ⁇ antibody, and NK cells expressing ACTR alone or ACTR and a metabolism modulating polypeptide. Tumor growth is monitored throughout the course of the experiment.
- a tumor-targeting antibody for example an anti-FOLR ⁇ antibody
- NK cells expressing at least one polypeptide described herein in addition to an ACTR polypeptide show enhanced anti-tumor activity relative to NK cells expressing an ACTR polypeptide alone.
- NK cells expressing at least one polypeptide described herein in addition to an ACTR polypeptide may show enhanced NK cell activity including, for example, enhanced proliferation, enhanced NK cell persistence, and/or enhanced cytokine production relative to NK cells expressing the ACTR polypeptide alone.
- Example 5 Impact of expressing one or more exemplary polypeptides in NK cell function using a GPC3-targeting CAR-NK expression construct
- Gamma-retrovirus encoding an exemplary GPC3-targeting CAR polypeptide expression construct (SEQ ID NO: 86 or SEQ ID NO: 87) is generated via recombinant 95 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) technology and used to infect primary human NK-cells to generate cells expressing a GPC3- targeting CAR polypeptide on their cell surface.
- gamma-retroviruses encoding an exemplary GPC3-targeting CAR polypeptide and at least one transgene encoding for factors are generated via recombinant technology and used to infect primary human NK- cells to generate cells that express a GPC3-targeting polypeptide and a metabolism modulating polypeptide.
- the two polypeptides are separated, for example, by at least one P2A ribosomal skip sequence.
- a six-day flow-based proliferation assay is then used to test the functionality of the GPC3-targeting CAR expressing cells.
- 200,000 untransduced mock NK cells, NK cells expressing a GPC3-targeting CAR polypeptide, or NK cells expressing a GPC3-targeting CAR polypeptide and at least one metabolism modulating polypeptide are incubated together at a ratio of 4:1 (effector cells/CAR- NK cells to target cells) with 50,000 GPC3 + hepatocellular carcinoma JHH7 tumor cells.
- the co-culture is incubated at 37 °C in a 5% CO2 for six days in the presence of 1.25 mM glucose (tumor-relevant) and 10 mM glucose (approximate peripheral blood levels).
- NK cell proliferation the live NK cells are enumerated in CD45 + CD33-CD3-CD14-CD56 + and a live-dead cell stain is evaluated by flow cytometry.
- NK cells expressing the at least the one polypeptide described herein in addition to the CAR polypeptide demonstrate enhanced NK cell proliferation relative to NK cells expressing the CAR construct alone. This enhanced proliferation also occurs at tumor-relevant low glucose concentrations.
- Example 6 Impact of expressing one or more exemplary polypeptides in immune cell function expressing a CAR polypeptide in environments with higher soluble inhibitor concentrations At least one transgene encoding one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) are co-expressed in the same NK cell with an CAR polypeptide.
- the transgenes are, for example, encoding GOT2 (SEQ ID NO: 77).
- the NK cells are transduced with a virus encoding the ACTR polypeptide and the at least one polypeptide 96 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) described herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence.
- Transduced NK cells are mixed at a given effector-to-target (E:T) ratio with tumor target cells, such as HepG2 cells, in media containing different concentrations of soluble inhibitors that are present in the tumor microenvironment (e.g., TGF ⁇ , PGE2, kynurenine, and/or adenosine).
- tumor target cells such as HepG2 cells
- NK cell function is then evaluated, for example, using cytokine production or proliferation assays or for resistance to chronic stimulation. Cytokine production (e.g., IL-2 and/or IFN-gamma) is measured from the reaction supernatant. For proliferation experiments, co-cultures of NK are harvested, stained, and evaluated by flow cytometry. NK cells expressing at least one polypeptide described herein in addition to the CAR polypeptide show enhanced NK cell function relative to NK cells expressing CAR alone including, for example, enhanced cytokine production or enhanced proliferation.
- cytokine production e.g., IL-2 and/or IFN-gamma
- Example 7 Impact of expressing one or more exemplary polypeptides in immune cell function expressing a CAR polypeptide in environments with greater immunosuppressive cell presence
- At least one transgene encoding at least one metabolism modulating polypeptide e.g., SEQ ID NO: 68 – SEQ ID NO: 75
- the transgenes are, for example, GOT2 (SEQ ID NO: 77).
- the NK cells are transduced with a virus encoding the CAR polypeptide and the at least one polypeptides described herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence.
- Transduced NK cells are mixed at a given effector-to-target (E:T) ratio with tumor target cells, such as HepG2 cells, in the presence of immunosuppressive cells (e.g., myeloid-derived suppressor cells and/or regulatory T cells). Reactions are then incubated at 37°C in a 5% CO2 incubator for a period of time (e.g., 3 – 10 days).
- NK cell function is then evaluated, for example, using cytokine production or cell proliferation assays or for resistance to chronic stimulation.
- Cytokine production e.g., IL-2 and/or IFN-gamma
- Proliferation experiments is performed and evaluated as described in example 1.
- NK cells expressing the at least one polypeptide described herein in addition to the 97 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) CAR polypeptide show enhanced NK cell function relative to NK cells expressing CAR alone including, for example, enhanced cytokine production or enhanced proliferation.
- Example 8 Impact of expressing one or more exemplary polypeptides in NK cells expressing an ACTR polypeptide At least one transgene encoding at least one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82)are co-expressed in the same NK cell with a ACTR polypeptide.
- the transgenes are, for example, GOT2 (SEQ ID NO: 77).
- the NK cells are stimulated with anti-CD3 and anti-CD28 for a time period (e.g., 1 – 4 days) followed by transduction with virus (e.g., lentivirus or gamma-retrovirus) encoding the ACTR polypeptide and the at least one polypeptide described herein (SEQ ID NO: 75 – SEQ ID NO: 82), which can be separated, for example, by a P2A ribosomal skip sequence.
- virus e.g., lentivirus or gamma-retrovirus
- the transduced cells are supplemented with cytokines (e.g., IL-2) for 3 – 10 days. All reactions are incubated at 37°C in a 5% CO 2 incubator.
- cytokines e.g., IL-2
- NK cells expressing the at least one factor described herein, in addition to the ACTR polypeptide, are expected to show enhanced glucose uptake. This enhanced function is suggestive of increased metabolic fitness and has a positive impact on the NK cell activity.
- Example 9 Impact of expressing one or more exemplary polypeptides in NK cells expressing a CAR polypeptide
- At least one transgenes encoding at least one metabolism modulating polypeptide e.g., SEQ ID NO: 75 – SEQ ID NO: 82
- the transgenes are, for example, GOT2 (SEQ ID NO: 77).
- the NK cells are stimulated with anti-CD3 and anti-CD28 for a time period (e.g., 1 – 4 days) followed by transduction with virus (e.g., lentivirus or gamma-retrovirus) encoding the CAR polypeptide and the at least one polypeptide described herein, which can be separated, for example, by a P2A ribosomal skip sequence.
- virus e.g., lentivirus or gamma-retrovirus
- the transduced cells are supplemented with cytokines (e.g., IL- 98 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) 2) for 3 – 10 days. All reactions are incubated at 37 °C in a 5% CO 2 incubator.
- NK cells expressing the at least one polypeptide described herein, in addition to the CAR polypeptide, are expected to show enhanced glucose uptake. This enhanced function is suggestive of increased metabolic fitness and has a positive impact on NK cell activity.
- Example 10 Impact of expressing one or more exemplary polypeptides that redirect lactate production in immune cells expressing an ACTR polypeptide
- At least one transgene encoding at least one metabolism modulating polypeptide e.g., SEQ ID NO: 75 – SEQ ID NO: 82
- the transgenes are, for example, GOT2 (SEQ ID NO: 77)).
- the NK cells are stimulated with anti-CD3 and anti-CD28 for a time period (e.g., 1 – 4 days) followed by transduction with virus (e.g., lentivirus or gamma-retrovirus) encoding the ACTR polypeptide and the at least one polypeptide described herein (SEQ ID NO: 75 – SEQ ID NO: 82), which can be separated, for example, by a P2A ribosomal skip sequence.
- virus e.g., lentivirus or gamma-retrovirus
- the transduced cells are supplemented with cytokines (e.g., IL-2) and additionally with stimulants (e.g., PMA and/or Ionomycin) for 3 – 10 days. All reactions are incubated at 37 °C in a 5% CO 2 incubator.
- NK cells are harvested and assayed for lactate production using Lactate Glow Assay. This luminescence- based assay was evaluated, and data represented as a fold change.
- NK cells expressing the at least one polypeptide described herein in addition to the ACTR polypeptide are expected to show enhanced lactate production. This enhanced function is suggestive of increased metabolic fitness and has a positive impact on NK cell activity.
- Example 11 Impact of expressing one or more exemplary polypeptides that redirect lactate production in NK cells expressing a CAR polypeptide
- At least one transgene encoding at least one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) are co-expressed in the same NK cell with a CAR polypeptide.
- the transgenes are, for example, GOT2 (SEQ ID NO: 77).
- the NK cells are stimulated with anti-CD3 and anti-CD28 for a time period (e.g., 1 – 4 days) followed by 99 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) transduction with virus (e.g., lentivirus or gamma-retrovirus) encoding the CAR polypeptide and the at least one polypeptide described herein (SEQ ID NO: 75 – SEQ ID NO: 82), which can be separated, for example, by a P2A ribosomal skip sequence.
- virus e.g., lentivirus or gamma-retrovirus
- the transduced cells are supplemented with cytokines (e.g., IL-2) and additionally with stimulants (e.g., PMA and/or Ionomycin) for 3 – 10 days. All reactions are incubated at 37 °C in a 5% CO 2 incubator. Cells are harvested and assayed for lactate production using Lactate Glow Assay. This luminescence- based assay was evaluated, and data represented as a fold change.
- NK cells expressing the at least one polypeptide described herein, in addition to the CAR polypeptide, are expected to show enhanced lactate production. This enhanced function is suggestive of increased metabolic fitness and has a positive impact on NK cell activity.
- Example 12 Production of retroviral particles
- 12x10 6 low passage HEK293T cells were plated on 15 cm coated tissue culture plates in DMEM media containing 10% FBS. The following day, i.e., day 2, the cells were 80% confluent.
- day 3 the cells were subjected to transfection.
- 3 ml of transfection mix containing 10 ⁇ g of GAG/Pol, 6.6 ⁇ g of GALV helper, 20 ⁇ g of transfer plasmids and 74 ⁇ l of PEI Pro transfection reagent (Cat # 115-010, PolyPlus) was prepared and added to the cell culture plates.
- the transfected cells were replenished with fresh DMEM media containing 10% FBS media 6 h post-transfection.
- NK cells were isolated either from fresh blood samples or are derived from cell lines.
- Peripheral blood mononuclear cells (PBMCs) containing the Nk cells were isolated by the density gradient method using Ficoll-paque. Briefly, equal volume of whole blood and PBS was mixed carefully by inversion, overlayed on Ficoll-paque followed by centrifugation at 400 g for 30 min at RT.
- PBMCs Peripheral blood mononuclear cells
- PBMCs were retrieved from the buffy layer (see (Low and Wan Abas, Biomed Res Int, 2015: 239362 (2015))). PBMCs were stimulated with anti-CD3 and anti-CD28 until day2 prior to transduction.
- the NK-92 cell line was used in assessment of NK cell functions. 1x10 6 NK-92 cells were grown in T75 flasks and stimulated with IL-2 (100 UI/ml) in RPMI media containing 100 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) 10% FBS. The cells were maintained for one week by supplementing IL-2 (100 UI/ml) every 48 h.
- At least one transgenes encoding at least one metabolism modulating polypeptide as disclosed herein are co-expressed in the same NK cell with an ACTR (see Table 10) or CAR (see Table 11) polypeptide.
- the transgenes are, for example, GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75).
- the NK cells were transduced with a virus encoding the ACTR or CAR polypeptide and at least one polypeptide described herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by at least one P2A ribosomal skip sequence.
- 1x10 6 cells were mixed with 1 ml of viral supernatant (see Example 1) in a total volume of 2 ml, centrifuged at 1200 g for 45 min followed by plating into a 24-well plate. The cells were then incubated at 37 ⁇ C in a 5 % CO 2 incubator.
- NK-92 transduced cells the culture was monitored for growth every 48 h and split to a final concentration of 0.5 x10 6 cell/ml by supplementing IL-2 (100 UI/ml) every 48 h.
- the transduced NK cells were assessed for the transgene expression by immunoblotting.
- the transduced cells (e.g., NK-92), were harvested by centrifuging at 1500 rpm for 5 min at RT. The supernatant was removed, and the cell pellet was washed twice in 1XPBS before flash freezing in liquid nitrogen and stored at -80°C until further use. Cell pellets were subsequently lysed in 200 ⁇ l of SDS Lysis buffer (Cat # NP0008; Novex) containing 1x HALT Protease Inhibitor Cocktail (Cat# 78430; Thermo Fisher Scientific) followed by sonication. The suspension was centrifuged at 15,000 rpm for 15 min at RT and the supernatant containing total protein was collected.
- SDS Lysis buffer Cat # NP0008; Novex
- 1x HALT Protease Inhibitor Cocktail Cat# 78430; Thermo Fisher Scientific
- the total protein concentration was measured using Pierce 660 nm Protein Assay (Cat# 1861426; Thermo Fisher Scientific) followed by immunoblotting. 10 ⁇ g total protein was loaded in each lane of a NovexTM 4 to 12 % Tris- Glycine Plus, 1.0 mm, 20-well Midi Protein Gel (Invitrogen), transferred onto PVDF membrane using Transblot Turbo (Biorad) and blocked for 1 h at RT using LICOR Blocking buffer.
- the membrane was probed for transgenes (e.g., GOT2, TIGAR) using mouse ⁇ -Actin (3700S, CST; dilution 1:2000), Rabbit ⁇ -TIGAR (14751S CST; dilution 1:1000) and Rabbit ⁇ - GOT2 (NBP232241, Novus; dilution 1:2000) antibodies overnight (in 0.1% Tween 20 + LICOR Blocking buffer) at 4°C.
- transgenes e.g., GOT2, TIGAR
- mouse ⁇ -Actin 3700S, CST; dilution 1:2000
- Rabbit ⁇ -TIGAR 1451S CST; dilution 1:1000
- Rabbit ⁇ - GOT2 NBP232241, Novus; dilution 1:2000
- membranes were washed thrice with 1x TBS containing 0.1% Tween20 detergent (w/v) for 5 min each.
- Membranes were subsequently incubated with standard rabbit or mouse secondary antibodies (LICOR;
- NK cells were isolated either from fresh blood samples or are derived from cell lines and were transduced as described in Example 13. On day7 post-transduction, the NK cells were harvested by centrifuging at 1500 rpm for 5 min at RT.
- FIG. 1 Transgene overexpression was analyzed for harvested cells on day 7 by immunoblotting as shown in FIG. 1.
- GOT2 expression was observed with all constructs and control due to the endogenous expression of GOT2, whereas a stronger band was observed in case of GOT2 co-expression with the CAR.
- No endogenous TIGAR expression was observed under these conditions. Strong expression was only seen once TIGAR was co-expressed with the CAR.
- harvested cells were stained with a recombinant antibody against the Fc part of the CAR, and presence of the CAR on the surface of the NK cell was assessed using flow cytometry.
- FIGs. 2A-2D show that all constructs expressed the CAR on the surface of the NK92 cells.
- At least one of A and B can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including 104 DM_US 198678773-1.112309.0120 Attorney Docket No.: 112309-0120 (70006WO00) elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc.
Abstract
Genetically engineered NK cells, which express at least one metabolism modulating polypeptides and optionally a chimeric receptor polypeptide (e.g., an antibody-coupled T cell receptor (ACTR) polypeptide or a chimeric antigen receptor (CAR) polypeptide) capable of binding to a target antigen of interest. Also disclosed herein are uses of the engineered immune cells for inhibiting cells expressing a target antigen in a subject in need thereof.
Description
Attorney Docket No.: 112309-0120 (70006WO00) GENETICALLY ENGINEERED NATURAL KILLER (NK) CELLS WITH CHIMERIC RECEPTOR POLYPEPTIDES IN COMBINATION WITH TRANS METABOLISM MOLECULES AND THERAPEUTIC USES THEREOF CROSS REFERENCE TO RELATED APPLICATIONS This application claims the benefit of the filing dates of U.S. Provisional Application No.63/399,326, filed August 19, 2022, the entire contents of which are incorporated by reference herein. SEQUENCE LISTING The instant application contains a Sequence Listing which has been filed electronically in XML format and is hereby incorporated by reference in its entirety. Said XML copy, created on August 17, 2023, is named 112309-0120-70006WO00_SEQ.XML and is 97,884 bytes in size. FIELD OF THE INVENTION The present invention relates to genetically modified Natural Killer (NK) cells expressing a chimeric receptor polypeptide (e.g., Chimeric Antigen Receptor or CAR) and a metabolism modulating polypeptide. The present invention further relates to CAR-NK cells and the use of CAR-NK cells in particular for treating cancer. BACKGROUND OF DISCLOSURE Cancer immunotherapy, including cell-based therapy, is used to provoke immune responses attacking tumor cells while sparing normal tissues. It is a promising option for treating various types of cancer because of its potential to evade genetic and cellular mechanisms of drug resistance, and to target tumor cells while sparing normal tissues. Cell-based therapy may involve cytotoxic T cells having reactivity skewed toward cancer cells (Eshhar et al., Proc Natl Acad Sci U S A, 90(2): 720-724 (1993); Geiger et al., The Journal of Immunology, 162(10): 5931-5939 (1999); Brentjens et al., Nat Med, 9(3): 279-286 (2003); Cooper et al., Blood, 101(4): 1637-1644 (2003); Imai et al., Leukemia, 18(4): 676-684 (2004)). While cell-based immune therapies have shown promising therapeutic effects, they have faced challenges caused by specific characteristics of the tumor microenvironment 1 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) (TME), which is cellular environment created via the interaction between malignant tumor cells and non-transformed cells. It is therefore of great importance to develop strategies to improve efficacy of cell- based immune therapies in light of the TME. SUMMARY OF DISCLOSURE The present disclosure is based on the development of strategies to divert or redirect glucose metabolites, increase glucose uptake, modulate glycolysis, the Krebs cycle, intracellular lactate concentration, amino acid uptake and/or its conversion in NK cells, including those that express a chimeric receptor polypeptide, such as an antibody-coupled T- cells receptor (ACTR) polypeptide or a chimeric antigen receptor (CAR) polypeptide, for use in cell-based immune therapy. Such metabolic modulation may be achieved by expressing or over-expressing at least one of the selected metabolism modulating polypeptides such as those described herein. Accordingly, the present disclosure provides genetically engineered NK cells expressing at least one metabolism modulating polypeptide as disclosed herein. The at least one metabolism modulating polypeptide is encoded by an exogenous nucleic acid introduced into the NK cells. Such genetically engineered NK cells are expected to have an enhanced metabolic activity relative to native immune cells of the same type, for example, in a low glucose, low amino acid, low pH, and/or hypoxic environment (e.g., in a tumor microenvironment (TME)). Exemplary metabolism modulating polypeptides include TP53- inducible glycolysis and apoptosis regulator (TIGAR), glucose importation factor Glucose Transporter1 (GLUT1), Glutamic-oxaloacetic transaminase 2 (GOT2), L-Lactate Dehydrogenase A (LDHA), Pyruvate dehydrogenase Kinase 1 (PDK1), Cystathionine gamma- lyase (CTH), Argininosuccinate synthase (ASS1) and Phosphoserine Phosphatase (PSPH). NK cells co-expressing at least one metabolism modulating polypeptide such as those disclosed herein and a chimeric receptor polypeptide would exhibit superior bioactivities (e.g., under low glucose, low amino acid, low pH, and/or hypoxic conditions), for example, cell proliferation, activation (e.g., increased cytokine production, e.g., IL-2 or IFN-γ production), cytotoxicity, and/or in vivo anti-tumor activity. In some embodiments, the metabolism modulating polypeptide redirects glucose metabolites may divert or redirect substrates out of the glycolysis pathway indirectly by 2 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) decreasing the rate of glucose breakdown in the glycolysis pathway. Examples include TIGAR or the GLUT1. In some embodiments, the metabolism modulating polypeptide modulates the Krebs cycle via an enzyme that catalyzes a reaction of the Krebs cycle. One example is GOT2. In some embodiments the metabolism modulating polypeptide is an enzyme involved in lactate synthesis, for example, LDHA. In other embodiments, the metabolism modulating polypeptide is an enzyme that inhibits a pathway that competes for lactate-synthesis substrates, for example, PDK1. In yet other embodiments, the metabolism modulating polypeptides modulate the intracellular concentration of amino acids by increasing amino acid synthesis. Examples include CTH, ASS1 and PSPH. Provided herein are selected metabolism modulating polypeptides that are expected to enhance metabolic readouts in NK cells genetically modified by expressing/overexpressing nucleic acids encoding such a metabolism modulating polypeptide. The modified NK cells further express a chimeric receptor polypeptide, which comprises (a) an extracellular target binding domain; (b) a transmembrane domain; and (c) a cytoplasmic signaling domain. In one embodiment, the disclosure relates to a genetically engineered NK cell, which (i) express or overly expresses at least one metabolism modulating polypeptide selected from the group consisting of GOT2, GLUT1, LDHA, PDK1, TIGAR, CTH, ASS1 and PSPH; and (ii) expresses a chimeric receptor polypeptide; wherein the chimeric receptor polypeptide comprises (a) an extracellular target binding domain; (b) a transmembrane domain; and (c) at least one cytoplasmic signaling domain. Any of the chimeric polypeptides disclosed herein may further comprise at least one co-stimulatory signaling domain. In other embodiments, the chimeric receptor polypeptide may be free of co-stimulatory signaling domains. In some embodiments, the chimeric receptor polypeptide is an antibody-coupled T cell receptor (ACTR), which comprises an extracellular Fc-binding domain (a). In other embodiments, the chimeric receptor is a chimeric antigen receptor (CAR), which comprises an extracellular antigen binding domain (a). In specific embodiments, the genetically engineered NK cells described herein may comprise a nucleic acid or a nucleic acid set, which collectively comprises: (A) a first nucleotide sequence encoding the at least one metabolism modulating polypeptide as disclosed herein; and (B) a second nucleotide sequence encoding the chimeric receptor polypeptide as also disclosed herein. In another aspect, the present disclosure provides a pharmaceutical composition, comprising the NK cells of the present invention described herein and a pharmaceutically 3 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) acceptable carrier. Moreover, provided herein is a method for inhibiting and/or killing cells expressing a target antigen (e.g., reducing the number of such cells, blocking cell proliferation, and/or suppressing cell activity) in a subject, the method comprising administering to a subject in need thereof a population of the NK cells described herein. The subject (e.g., a human patient such as a human patient suffering from a cancer) may have been treated or is being treated with an anti-cancer therapy (e.g., an anti-cancer agent). In some examples, at least some of the cells expressing the target antigen are located in a low-glucose environment, a low-amino acid (e.g., low glutamine) environment, a low-pH environment, and/or a hypoxic environment, for example a tumor microenvironment. In one embodiment, the disclosure relates to a nucleic acid or nucleic acid set, which collectively comprises: (A) a first nucleotide sequence encoding the at least one metabolism modulating polypeptide as disclosed herein; and (B) a second nucleotide sequence encoding the chimeric receptor polypeptide as also disclosed herein. Also, within the scope of the present disclosure are uses of the genetically engineered NK cells of the present invention for treating a target disease or disorder such as cancer or an infectious disorder, and uses thereof for manufacturing a medicament for the intended medical treatment. The details of one or more embodiments of the disclosure are set forth in the description below. Other features or advantages of the present disclosure will be apparent from the detailed description of several embodiments and from the appended claims. BRIEF DESCRIPTION OF THE DRAWINGS The following drawings form part of the present specification and are included to further demonstrate certain aspects of the present disclosure, which can be better understood by reference to one or more of these drawings in combination with the detailed description of specific embodiments presented herein. FIG. 1 is an immunoblot showing transgene expression upon retroviral transduction with CAR only or CAR and transgene (GOT2 and TIGAR) relative to mock transduced control (null) in NK92 cells. FIGs. 2A and 2B are flow cytometric plots depicting CAR expression upon retroviral transduction with CAR only (right panel in FIG.2A) or CAR and transgene GOT2 (right panel) and TIGAR (left panel (FIG.2B) relative to mock transduced control (null, left panel in FIG. 2A) in NK92 cells. 4 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) DETAILED DESCRIPTION OF DISCLOSURE Immune cell therapy involving genetically engineered immune cells, especially with T cells, has shown promising effects in cancer therapy. One approach is to express a chimeric receptor having an antigen-binding domain (CAR) fused to one or more T cell activation signaling domains. Binding of a cancer antigen via the antigen-binding domain results in T cell activation and triggers cytotoxicity. Recent results of clinical trials with infusions of chimeric receptor-expressing autologous T lymphocytes provided compelling evidence of their clinical potential. (Brentjens, Latouche et al., Nat Med, 9(3): 279-286 (2003); Pule et al., Nat Med, 14(11): 1264-1270 (2008); Brentjens et al., Blood, 118(18): 4817-4828 (2011); Porter et al., New England Journal of Medicine, 365(8): 725-733 (2011); Kochenderfer et al., Blood, 119(12): 2709-2720 (2012); Till et al., Blood, 119(17): 3940-3950 (2012); Brentjens et al., Sci Transl Med, 5(177): 177ra138 (2013)). Initially, the field was focusing on T cells. More recently, cell-based therapy has expanded to include natural killer (NK) cells, the innate immune cells known to exhibit high anti-tumor, anti-viral and anti-microbial activity. They exhibit unique advantages such as low risk of on-target/off-tumor toxicity in normal tissues, cytokine release syndrome and neurotoxicity. They also exhibit natural cytotoxicity against tumor cells. Finally, due to reduced graft versus host disease (GVHD), an off-the-shelf cell therapy product may be prepared (Schmidt et al., Front Immunol, 11: 611163 (2020); Wang et al., Cancer Lett, 472: 175-180 (2020); Xie et al., EBioMedicine, 59: 102975 (2020); Gong et al., J Hematol Oncol, 14(1): 73 (2021); Wrona et al., Int J Mol Sci, 22(11): (2021)). In addition, persistent activation of these T cells due to antigen dependent or independent CAR activation can lead to exhaustion and reduced bioactivity which is again an advantage of the innate cells such as NK cells. Finally, NK cells expressing a chimeric receptor polypeptide also called “CAR-NK cells” may have increased effector functions such as increased inflammatory cytokine production, antigen acquisition and presentation or ability to activate adaptive immune responses. Another approach is to express an antibody-coupled T cell Receptor (ACTR) polypeptide in a NK cell, the ACTR polypeptide containing an extracellular Fc-binding domain. When the ACTR-expressing NK cells also called “ACTR-NK cells”) are administered to a subject together with an anti-cancer antibody, they may enhance toxicity against cancer cells targeted by the antibody via their binding to the Fc domain of the antibody (Kudo et al., Cancer Res, 74(1): 93-103 (2014)). 5 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Tumor microenvironments (TME) have specific characteristics, such as low glucose, low amino acid, low pH, and/or hypoxic conditions, some of which may constrain the activity of NK cells. The present disclosure is based, at least in part, on the development of strategies for enhancing NK cell activities in the TME. In particular, the present disclosure features methods for enhancing the metabolic activity of the NK cells (e.g., diverting or re-directing one or more glucose metabolites out of the glycolysis pathway) in the NK cells, thereby enhancing their growth and bioactivity. The present disclosure provides genetically engineered NK cells that possess altered glucose metabolism and/or uptake, lactate production and enhanced amino acid synthesis as compared with a native NK cell. Accordingly, provided herein are modified (e.g., genetically engineered) NK cells that have for e.g., altered intracellular regulation of glucose concentrations, capacity for an increased rate of glycolysis or intracellular lactate concentrations relative to the wild-type NK cells. In some instances, the modified NK cells may express or overly express the metabolism modulating polypeptide for example, a polypeptide that diverts or redirects glucose metabolites out of the glycolysis pathway. Alternatively, the modified NK cell may be engineered to transfect at least one exogenous nucleic acid encoding at least two metabolism modulating polypeptides for producing additional amount of the polypeptide in the modified immune cell. Such genetically engineered NK cells express or overly express at least one metabolism modulating polypeptide to enhance the metabolism in the NK cells and express a chimeric receptor polypeptide comprising an extracellular target binding domain, a transmembrane domain and a cytoplasmic signaling domain, e.g., an antibody-coupled T cell receptor (ACTR) polypeptide or, preferably, a chimeric antigen receptor (CAR) polypeptide. A modified NK cell expressing at least one polypeptide refers to a genetically engineered NK cell into which one or more exogenous nucleic acids encoding at least one metabolism modulating polypeptides are introduced such that the encoded metabolism modulating polypeptides are expressed in the resulting modified NK cell, while the unmodified NK cell does not express such a metabolism modulating polypeptide. For example, TIGAR was found to be not detectable by immunoblotting in mock transduced NK92 cells (see FIG. 1). A modified NK cell overly expressing at least one of the polypeptides that modulate metabolism refers to a genetically engineered NK cell, which is engineered to enhance the expression level of the metabolism modulating polypeptide as relative to the unmodified NK cell. E.g., GOT2 was 6 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) found have a basic expression in mock transduced NK92 cells, whereas retroviral transduction with CAR and GOT2 lead to a detectable increased GOT2 expression using immunoblotting (see FIG.1). In a preferred embodiment, such metabolism modulating polypeptide is overly expressed compared to a native NK cell, e.g., by polypeptides encoded by a transgene introduced into the immune cells (e.g., exogenous to the NK cells). Expression or overexpression can be determined in analogy as shown for TIGAR and GOT2 respectively in Example 14. Also, provided herein are uses of the genetically engineered NK cells, for improving NK cell proliferation, and/or an inhibiting or decreasing target cells (e.g., target cancer cells) in a subject (e.g., a human cancer patient), e.g., via CAR-NK mediated or ACTR-NK mediated cell killing. As such, the genetically engineered NK cells may proliferate better, produce more preferably cytotoxic cytokines, exhibit greater anti-tumor cytotoxicity, and/or exhibit greater survival of the respective genetically engineered NK cells in a low-glucose, low amino acid, low pH, and/or hypoxic environment (e.g., a TME) relative to NK cells that do not express or do not over-express the at least one metabolism modulating polypeptide selected from GOT2, GLUT1, LDHA, PDK1, TIGAR, CTH, ASS1 and PSPH, as further described below, leading to enhanced cytokine production, survival rate, cytotoxicity, and/or anti-tumor activity. I. Metabolism Modulating Polypeptides As used herein, the term “metabolism modulating polypeptide” refer to polypeptides that regulate a metabolism pathway, for example, re-directing glucose metabolites out of the glycolysis pathway, increasing glucose uptake, modulating Krebs cycle, modulating intracellular lactate concentration, increasing amino acid uptake and/or its conversion. Exemplary metabolism modulating polypeptides for use in making the genetically engineered NK cells disclosed herein may include GOT2, GLUT1, LDHA, PDK1, TIGAR, CTH, ASS1 and PSPH. In some instances, the at least one metabolism modulating polypeptide reduces the function of an enzyme in the glycolysis pathway. Such a metabolism modulating polypeptide is TIGAR (disclosed in WO2023/049933A1, the relevant disclosures of which are incorporated by reference for the subject matter and purpose referenced herein). TIGAR functions to block glycolysis and re-direct glucose metabolites into the pentose phosphate shunt pathway. TIGAR 7 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) is in direct opposition with PFKFB3 with respect to their shared regulation of fructose-2,6- bisphosphate, a molecule that increases the activity of the glycolytic pathway enzyme PFK. TIGAR degrades fructose-2,6-bisphosphate which effectively slows down the enzymatic rate of PFK. This allows for more glucose metabolites to be re-directed into nucleotide synthesis and glycosylation pathways, e.g., the pentose phosphate shunt pathway. Elevated TIGAR expression or activity levels increase the re-direction of glucose metabolites away from the glycolysis pathway. The amino acid sequence of an exemplary human TIGAR is provided in Table 1 below. In a specific embodiment, TIGAR is human TIGAR (e.g., SEQ ID NO: 75). The term “TIGAR” encompasses functional equivalents of TIGAR, whereas a functional equivalent of TIGAR is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human TIGAR (e.g., SEQ ID NO: 75). In some instances, the at least one metabolism modulating polypeptide modulates the Krebs cycle and/or links various metabolic pathways such as the metabolic pathways for processing glucose, amino acids and/or fatty acids. In one example, the metabolism modulating polypeptide is GOT2 (disclosed in WO2020/037066, the relevant disclosures of which are incorporated by reference for the subject matter and purpose referenced herein). The GOT2 polypeptide modulates the Krebs cycle as a metabolic substrate located within the inner mitochondria. The amino acid sequence of an exemplary human GOT2 is provided in Table 1 below. In a specific embodiment, GOT2 is human GOT2 (e.g., SEQ ID NO: 77). The term “GOT2” encompasses functional equivalents of GOT2 (, whereas a functional equivalent of GOT2 is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human GOT2 (e.g., SEQ ID NO: 77). In some instances, the at least one metabolism modulating polypeptide mediates glucose uptake (i.e., increases glucose import) across the plasma membrane of cells, which is also known as glucose importation polypeptides. One such glucose importation polypeptide that increases glucose uptake is the class I Glucose Transporter 1 (GLUT1; disclosed in WO2020/010110, the relevant disclosures of which are incorporated by reference for the subject matter and purpose referenced herein). The amino acid sequence of an exemplary human GLUT1 is provided in Table 1 below. In a specific embodiment, GLUT1 is, human GLUT1(e.g., SEQ ID NO: 76). The term “GLUT1” encompasses functional equivalents of GLUT1, whereas a functional equivalent of GLUT1 is a polypeptide having at least 85%, 8 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) preferably at least 90%, more preferably at least 95% sequence identity with human GLUT1 (e.g., SEQ ID NO: 76). In some instances, the at least one metabolism modulating polypeptide is a lactate modulating factor that can be either involved in lactate synthesis. In one example, the metabolism modulating polypeptide LDHA (disclosed in WO2020/051493, the relevant disclosures of which are incorporated by reference for the subject matter and purpose referenced herein). LDHA is a dehydrogenase enzyme that catalyzes the interconversion of pyruvate, a key molecule in the Krebs cycle, and lactate. The over-expression of LDHA may facilitate the conversion of lactate into pyruvate as a cell’s store of pyruvate is diminished at times of high metabolic activity. This leads to an increase in the intracellular concentration of pyruvate and a decrease in the intracellular concentration of lactate and has the effect of providing flux into the Krebs cycle and increasing the transport of lactate. Accordingly, elevated expression or activity of LDHA increases the transport of lactate, leading to an ultimate elevated intracellular lactate concentration. The amino acid sequence of an exemplary human LDHA is provided in Table 1 below. The term “LDHA” encompasses functional equivalents of LDHA, whereas a functional equivalent of LDHA is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human LDHA (e.g., SEQ ID NO: 71). Alternatively, the at least one metabolism modulating polypeptides is an enzyme that inhibits a pathway competing for substrates used in lactate synthesis. Such a metabolism modulating polypeptide may be PDK1 (disclosed in WO2020/051493, the relevant disclosures of which are incorporated by reference for the subject matter and purpose referenced herein). PDK1 is a kinase which acts to inhibit pyruvate dehydrogenase (such as PDHA1), a component of the pyruvate dehydrogenase complex, via phosphorylation. The pyruvate dehydrogenase complex converts pyruvate into acetyl-CoA through decarboxylation. Increased PDK1 expression or activity and subsequent inhibition of pyruvate dehydrogenase increases the amount of pyruvate available for LDHA-mediated conversion to lactate. The amino acid sequence of an exemplary human PDK1 is provided in Table 1 below. The term “PDK1” encompasses functional equivalents of PDK1, whereas a functional equivalent of PDK1 is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human PDK1 (e.g., SEQ ID NO: 79). 9 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) In some instances, at least one metabolism modulating polypeptide capable of modulating the intracellular concentration of amino acids include ASS1, PSHP or CTH. These polypeptides modulate the intracellular concentration of amino acids and increase amino acid synthesis (e.g., an enzyme that stimulates amino acid synthesis or the conversion of an amino acid into another molecule). ASS1 catalyzes the penultimate step of the arginine biosynthetic pathway, PSPH catalyzes magnesium-dependent hydrolysis of L-phosphoserine and is also involved in an exchange reaction between L-serine and L-phosphoserine, and CTH catalyzes the last step of the trans-sulfuration pathway, interconverting cystathionine with cysteine. The amino acid sequence of exemplary human ASS1, PSPH and CTH are provided in Table 1. In some examples, human ASS1 (e.g., SEQ ID NO: 80), human PSPH (e.g., SEQ ID NO: 81) and/or human CTH (e.g., SEQ ID NO: 82) may be used. The term “ASS1” encompasses functional equivalents of ASS1 (e.g., SEQ ID NO: 80), whereas a functional equivalent of ASS1 is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human ASS1 (e.g., SEQ ID NO: 80). The term “PSPH” encompasses functional equivalents of PSPH, whereas a functional equivalent of PSPH is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human PSPH (e.g., SEQ ID NO: 81). The term “CTH” encompasses functional equivalents of CTH (e.g., SEQ ID NO: 82), whereas a functional equivalent of CTH is a polypeptide having at least 85%, preferably at least 90%, more preferably at least 95% sequence identity with human CTH (e.g., SEQ ID NO: 82). The metabolism modulating polypeptides may be naturally-occurring polypeptides from a suitable species, for example, a mammalian glucose importation polypeptide such as those derived from human or a non-human primate. Such naturally-occurring polypeptides are known in the art and can be obtained, for example, using any of the above-noted amino acid sequences as a query to search a publicly available gene database, for example GenBank. The metabolism modulating polypeptides for use in the instant disclosure may share a sequence identity of at least 85% (e.g., 90%, 95%, 97%, 98%, 99%, or above) as any of the exemplary proteins noted above. The “percent identity” of two amino acid sequences is determined using the algorithm of (Karlin and Altschul, Proc Natl Acad Sci U S A, 87(6): 2264-2268 (1990)), modified as in (Karlin and Altschul, Proc Natl Acad Sci U S A, 90(12): 5873-5877 (1993)). Such an algorithm is incorporated into the NBLAST and XBLAST programs (version 2.0) of (Altschul et al., J Mol Biol, 215(3): 403-410 (1990)). BLAST protein searches can be 10 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) performed with the XBLAST program, score=50, wordlength=3 to obtain amino acid sequences homologous to the protein molecules of the invention. Where gaps exist between two sequences, Gapped BLAST can be utilized as described in (Altschul et al., Nucleic Acids Res, 25(17): 3389-3402 (1997)). When utilizing BLAST and Gapped BLAST programs, the default parameters of the respective programs (e.g., XBLAST and NBLAST) can be used. Alternatively, the metabolism modulating polypeptides may be a functional variant of a native counterpart. Such a functional variant may contain one or more mutations outside the functional domain(s) of the native counterpart. Functional domains of a native metabolism modulating polypeptides may be known in the art or can be predicted based on its amino acid sequence. Mutations outside the functional domain(s) would not be expected to substantially affect the biological activity of the protein. In some instances, the functional variant may exhibit an increased activity (for example, glucose uptake as relative to the native counterpart). Alternatively, the functional variant may exhibit a decreased activity in glucose uptake as relative to the native counterpart. Additionally, the functional variant may have increased trafficking to the cell surface. Alternatively, the functional variant may have decreased trafficking to the cell surface. Alternatively or in addition, the functional variant may contain a conservative mutation(s)/substitution(s) at one or more positions in the native counterpart (e.g., up to 20 positions, up to 15 positions, up to 10 positions, up to 5, 4, 3, 2, 1 position(s)). As used herein, a “conservative amino acid substitution” refers to an amino acid substitution that does not alter the relative charge or size characteristics of the protein in which the amino acid substitution is made. Variants can be prepared according to methods for altering polypeptide sequence known to one of ordinary skill in the art such as are found in references which compile such methods, e.g., Molecular Cloning: A Laboratory Manual, J. Sambrook, et al., eds., Second Edition, Cold Spring Harbor Laboratory Press, Cold Spring Harbor, New York, 1989, or Current Protocols in Molecular Biology, F.M. Ausubel, et al., eds., John Wiley & Sons, Inc., New York. Conservative substitutions of amino acids include substitutions made amongst amino acids within the following groups: (a) M, I, L, V; (b) F, Y, W; (c) K, R, H; (d) A, G; (e) S, T; (f) Q, N; and (g) E, D. Conservative Mutations that result still in functional variants include besides conservative substitutions small (e.g., 1 to 3 amino acids) insertions, deletions or inversions that do not result in altered relative charge or does not substantially change the size of the 11 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) protein. Table 1 below provides amino acid sequences of exemplary metabolism modulating polypeptides. Table 1. Exemplary Polypeptides for Modulating Metabolism Polypeptides Sequences SEQ ID NO TIGAR MARFALTVVRHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLN 75
12 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Polypeptides Sequences SEQ ID NO PIQVVYVPSHLYHMVFELFKNAMRATMEHHANRGVYPPIQVHVTLGN EDLTVKM DR VPLRKIDRLFNYMY TAPRPRVET RAVPLA F
II. Chimeric Receptor Polypeptides As used herein, a chimeric receptor polypeptide refers to a non-naturally occurring molecule that can be expressed on the surface of an immune cell, here an NK cell, and comprises an extracellular target binding domain, a transmembrane domain and at least one cytoplasmic signaling domain. The extracellular target binding domain targets an antigen of interest (e.g., an antigen associated with a disease such as cancer or an antigen associated with a pathogen; see disclosures herein). It may bind to an antigen of interest directly (e.g., an extracellular antigen binding domain in a CAR polypeptide as disclosed herein), or may bind to the antigen of interest via an intermediate, for example, an Fc-containing agent such as an antibody. The transmembrane domain ankers the chimeric receptor polypeptide within the cellular membrane of the NK cell. The chimeric receptor polypeptides are configured such that, when expressed in an immune cell, i.e., NK cell, the extracellular target binding domain 13 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) is located extracellularly for binding to a target antigen, directly or indirectly, whereas the cytoplasmic signaling domain is located intracellularly to allow for signaling into the cell upon binding of the target binding domain to the target. A chimeric receptor polypeptide may further comprise a hinge domain, one or more co-stimulatory domains, or a combination thereof. In some embodiments, the chimeric receptor polypeptide comprises one or more of the following features: (i) the chimeric receptor polypeptide further comprises a signal peptide at its N-terminus; (ii) the chimeric receptor polypeptide further comprises a hinge domain, which is located at the C-terminus of (a) and the N-terminus of (b); (iii) the chimeric receptor polypeptide is free of a hinge domain; (iv) the chimeric receptor polypeptide further comprises at least one co-stimulatory signaling domain; (v) the chimeric receptor polypeptide is free of a co-stimulatory signaling domain; (vi) the cytoplasmic signaling domain comprises an immunoreceptor tyrosine-based activation motif (ITAM); and (vii) the cytoplasmic signaling domain (c) is located at the C-terminus of the chimeric receptor polypeptide. In some embodiments, a chimeric receptor polypeptide as described herein may comprise, from N-terminus to C-terminus, the extracellular target binding domain, the transmembrane domain, and the cytoplasmic signaling domain. In some embodiments, a chimeric receptor polypeptide as described herein comprises, from N-terminus to C-terminus, the extracellular target binding domain, the transmembrane domain, at least one co-stimulatory signaling domain, and the cytoplasmic signaling domain. In other embodiments, a chimeric receptor polypeptide as described herein comprises, from N-terminus to C-terminus, the extracellular target binding domain, the transmembrane domain, the cytoplasmic signaling domains, and at least one co-stimulatory signaling domain. In some embodiments, the chimeric receptor polypeptide can be an antibody-coupled T cell receptor (ACTR) polypeptide. As used herein, an ACTR polypeptide (a.k.a., an ACTR construct) refers to a non-naturally occurring molecule that can be expressed on the surface of an NK cell and comprises an extracellular domain with binding affinity and specificity for the Fc portion of an immunoglobulin (“Fc binder” or “Fc binding domain”), a transmembrane domain, and a cytoplasmic signaling domain. In some embodiments, the ACTR polypeptides described herein may further include at least one co-stimulatory signaling domain. In other embodiments, the chimeric receptor polypeptide disclosed herein may be a chimeric antigen receptor (CAR) polypeptide. As used herein, a CAR polypeptide (a.k.a., a CAR construct) refers to a non-naturally occurring molecule that can be expressed on the 14 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) surface of an NK cell and comprises an extracellular antigen binding domain, a transmembrane domain, and a cytoplasmic signaling domain. The CAR polypeptides described herein may further include at least one co-stimulatory signaling domain. As used herein, the phrase “a protein X transmembrane domain” (e.g., a CD8 transmembrane domain) refers to any portion of a given protein, i.e., transmembrane-spanning protein X, that is thermodynamically stable in a membrane. As used herein, the phrase “a protein X cytoplasmic signaling domain,” for example, a CD3ζ cytoplasmic signaling domain, refers to any portion of a protein (protein X) that interacts with the interior of a cell or organelle and is capable of relaying a primary signal as known in the art, which leads to immune cell proliferation and/or activation. The cytoplasmic signaling domain as described herein differs from a co-stimulatory signaling domain, which relays a secondary signal for fully activating NK cells. As used herein, the phrase “a protein X co-stimulatory signaling domain,” e.g., a CD28 co-stimulatory signaling domain, refers to the portion of a given co-stimulatory protein (protein X, such as CD28, 4-1BB, OX40, CD27, or ICOS) that can transduce co-stimulatory signals (secondary signals) into immune cells (such as NK cells), leading to fully activation of the immune cells. A. Extracellular Target Binding Domain The chimeric receptor polypeptides disclosed herein comprise an extracellular domain that targets an antigen of interest (e.g., those described herein) via either direct binding or indirectly binding (through an intermediate such as an antibody). The chimeric receptor polypeptides may be ACTR polypeptides that comprise a Fc binding domain. Alternatively, the chimeric receptor polypeptides may be CAR polypeptides that comprise an extracellular antigen binding domain. (i) Fc binding domains The ACTR polypeptides described herein comprise an extracellular target binding domain that is an Fc binding domain, i.e., capable of binding to the Fc portion of an immunoglobulin (e.g., IgG, IgA, IgM, or IgE) of a suitable mammal (e.g., human, mouse, rat, goat, sheep, or monkey). Suitable Fc binding domains may be derived from naturally occurring proteins such as mammalian Fc receptors or certain bacterial proteins (e.g., protein A, protein 15 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) G). Additionally, Fc binding domains may be synthetic polypeptides engineered specifically to bind the Fc portion of any of the antibodies described herein with high affinity and specificity. For example, such an Fc binding domain can be an antibody or an antigen-binding fragment thereof that specifically binds the Fc portion of an immunoglobulin. Examples include, but are not limited to, a single-chain variable fragment (scFv), a domain antibody, or single domain antibodies (e.g., nanobodies). Alternatively, an Fc binding domain can be a synthetic peptide that specifically binds the Fc portion, such as a Kunitz domain, a small modular immunopharmaceutical (SMIP), an adnectin, an avimer, an affibody, a DARPin, or an anticalin, which may be identified by screening a peptide combinatory library for binding activities to Fc. In some embodiments, the Fc binding domain is an extracellular ligand-binding domain of a mammalian Fc receptor. As used herein, an “Fc receptor” is a cell surface bound receptor that is expressed on the surface of many immune cells (including B cells, T cells and NK cells) and exhibits binding specificity to the Fc domain of an antibody. Fc receptors are typically comprised of at least two immunoglobulin (Ig)-like domains with binding specificity to an Fc (fragment crystallizable) portion of an antibody. In some instances, binding of an Fc receptor to an Fc portion of the antibody may trigger antibody dependent cell-mediated cytotoxicity (ADCC) effects. The Fc receptor used for constructing an ACTR polypeptide as described herein may be a naturally occurring polymorphism variant (e.g., the CD16 V158 variant), which may have increased or decreased affinity to Fc as compared to a wild-type counterpart. Alternatively, the Fc receptor may be a functional variant of a wild-type counterpart, which carry one or more mutations (e.g., up to 10 amino acid residue substitutions including 1, 2, 3, 4, 5, 6, 7, 8, 9, or 10 mutations) that alter the binding affinity to the Fc portion of an Ig molecule. In some instances, the mutation may alter the glycosylation pattern of the Fc receptor and thus the binding affinity to Fc. List of a few exemplary polymorphisms in Fc receptor extracellular domains and exemplary Fc receptors constructing ACTR polypeptides are disclosed in WO2020010110A1, WO2020037066A1 and WO2020/051493A1. Table 2 lists a number of exemplary polymorphisms in Fc receptor extracellular domains see, e.g., (Kim et al., Journal of Molecular Evolution, 53(1): 1-9 (2001)) which may be used in any of the methods or constructs described herein: 16 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Table 2. Exemplary Polymorphisms in Fc Receptors Amino Acid Number 19 48 65 89 105 130 134 141 142 158
c recep ors are cass e ase on e so ype o e an o y o w c is able to bind. For example, Fc-gamma receptors (FcγR) generally bind to IgG antibodies, such as one or more subtype thereof (i.e., IgG1, IgG2, IgG3, IgG4); Fc-alpha receptors (FcαR) generally bind to IgA antibodies; and Fc-epsilon receptors (FcεR) generally bind to IgE antibodies. In some embodiments, the Fc receptor is an FcγR receptor, an FcαR, or an FcεR. Examples of FcγRs include, without limitation, CD64A, CD64B, CD64C, CD32A, CD32B, CD16A, and CD16B. An example of an FcαRsis FcαR1/CD89. Examples of FcεRs include, without limitation, FcεRI and FcεRII/CD23. Table 3 lists exemplary Fc receptors for use in constructing the ACTR polypeptides described herein and their binding activity to corresponding Fc domains: Table 3. Exemplary Fc Receptors Receptor name Principal antibody ligand Affinity for ligand
17 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Receptor name Principal antibody ligand Affinity for ligand FcγRIIIB (CD16b) I G Low (Kd > 10−6 M) A
peptides described herein will be apparent to one of skill in the art. For example, it may depend on factors such as the isotype of the antibody to which binding of the Fc receptor is desired and the desired affinity of the binding interaction. In some examples, the Fc binding domain is the extracellular ligand-binding domain of CD16, which may incorporate a naturally occurring polymorphism that may modulate affinity for Fc. In some examples, the Fc binding domain is the extracellular ligand-binding domain of CD16 incorporating a polymorphism at position 158 (e.g., valine or phenylalanine). In some embodiments, the Fc binding domain is produced under conditions that alter its glycosylation state and its affinity for Fc. The amino acid sequences of human CD16A F158 and CD16A V158 variants are provided herewith with the F158 and V158 residue in bold/underlined. CD16A F158 (F158 bold/underlined) (SEQ ID NO: 83) MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNS TQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAP RWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYF CRGLFGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFS VKTNIRSSTRDWKDHKFKWRKDPQDK CD16A V158 (V158 bold/underlined) (SEQ ID NO: 84) MWQLLLPTALLLLVSAGMRTEDLPKAVVFLEPQWYRVLEKDSVTLKCQGAYSPEDNS TQWFHNESLISSQASSYFIDAATVDDSGEYRCQTNLSTLSDPVQLEVHIGWLLLQAP RWVFKEEDPIHLRCHSWKNTALHKVTYLQNGKGRKYFHHNSDFYIPKATLKDSGSYF CRGLVGSKNVSSETVNITITQGLAVSTISSFFPPGYQVSFCLVMVLLFAVDTGLYFS VKTNIRSSTRDWKDHKFKWRKDPQDK 18 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) In some embodiments, the Fc binding domain is the extracellular ligand-binding domain of CD16 incorporating modifications that render the ACTR polypeptide specific for a subset of IgG antibodies. For example, mutations that increase or decrease the affinity for an IgG subtype (e.g., IgG1) may be incorporated. Any of the Fc binding domains described herein may have a suitable binding affinity for the Fc portion of a therapeutic antibody. As used herein, “binding affinity” refers to the apparent association constant or KA. The KA is the reciprocal of the dissociation constant, KD. The extracellular ligand-binding domain of an Fc receptor domain of the ACTR polypeptides described herein may have a binding affinity KD of at least 10-5, 10-6, 10-7, 10-8, 10-9, 10-10 M or lower for the Fc portion of antibody. In some embodiments, the Fc binding domain has a high binding affinity for an antibody, isotype(s) of antibodies, or subtype(s) thereof, as compared to the binding affinity of the Fc binding domain to another antibody, isotype(s) of antibodies, or subtypes(s) thereof. In some embodiments, the extracellular ligand-binding domain of an Fc receptor has specificity for an antibody, isotype(s) of antibodies, or subtype(s) thereof, as compared to binding of the extracellular ligand-binding domain of an Fc receptor to another antibody, isotype(s) of antibodies, or subtypes(s) thereof. Other Fc binding domains as known in the art may also be used in the ACTR constructs described herein including, for example, those described in WO2015/058018A1 and WO2018/140960, the relevant disclosures of each of which are incorporated by reference for the purpose and subject matter referenced herein. (ii) Extracellular antigen binding domains The CAR polypeptides described herein comprise an extracellular antigen binding domain, which re-directs the specificity of NK cells expressing the CAR polypeptide. As used herein, “an extracellular antigen binding domain” refers to a peptide or polypeptide having binding specificity to a target antigen of interest, which can be a naturally occurring antigen. Such a target antigen may be any molecule that is associated with a disease or condition, including, but are not limited to, tumor antigens, pathogenic antigens (e.g., bacterial, fungal, or viral), or antigens present on diseased cells, such as those described herein. In some embodiments, the target antigen binding domain targets a native tumor antigen protein. In other embodiments, the target antigen binding domain targets a variant (e.g., mutation) of a tumor 19 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) antigen protein. Some examples include EGFRvIII scFv recognizes the tumor specific variant of EGFR (Wang, Jiang et al., Cancer Lett, 472: 175-180 (2020)). Non-limiting examples of the extracellular antigen binding domains are tumor antigens, pathogenic antigens and immune cells specific to an autoantigen (Gubin et al., J Clin Invest, 125(9): 3413-3421 (2015); Linnemann et al., Nat Med, 21(1): 81-85 (2015)). Respective diseases and/or conditions to be treated include tumors, inflammatory conditions and auto- immune disorders. In some embodiments, the antigen is selectively expressed or overexpressed on cells of the disease or condition, e.g., the tumor or pathogenic cells, as compared to normal or non-targeted cells or tissues. In some embodiments the extracellular antigen binding domain of binds to a tumor antigen, which is associated with a hematologic or solid tumor. Non-limiting examples of hematologic tumor extracellular binding domains are domains of CD19, CD20, CD22, Kappa-chain, CD30, CD123, CD33, LeY, CD138, CD5, BCMA, CD7, CD40, ROR1 and IL-1RAP. Non-limiting examples of solid tumor extracellular binding domains are domains of GD2, GPC3, FOLR (e.g., FOLR1 or FOLR2), HER2, EphA2, EFGRVIII, IL13RA2, VEGFR2, ROR1, NKG2D, EpCAM, CEA, Mesothelin, MUC1, CLDN18.2, CD171, CD133, PSCA, cMET, EGFR, PSMA, ROR1, FAP, CD70, MUC16, L1- CAM, B7H3, GUCY2C, Nectin4, LRRC15, PSMA and CAIX. In other instances, tumor antigens are derived from cancers that are characterized by tumor-associated antigen expression, such as HER2 expression. Antigens may include epitopic regions or epitopic peptides derived from genes mutated in tumor cells or from genes transcribed at different levels in tumor cells compared to normal cells (e.g., survivin, mutated Ras, bcr/abl rearrangement, HER2, mutated or wild-type p53). The extracellular antigen binding domain as described herein does not comprise the Fc portion of an immunoglobulin, and may not bind to an extracellular domain of an Fc receptor. An extracellular domain that does not bind to an FcR means that the binding activity between the two is not detectable using a conventional assay or only background or biologically insignificant binding activity is detected using the conventional assay. In some instances, the extracellular antigen binding domain of any CAR polypeptides described herein is a peptide or polypeptide capable of binding to a cell surface antigen (e.g., a native and mutated tumor antigen), and may be presented on the cell surface of an antigen- presenting cell. 20 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) The extracellular antigen binding domain may be a single-chain antibody fragment (scFv) or a single domain antibody that binds to a tumor antigen, a pathogenic antigen, or an immune cell specific to an autoantigen. These may be derived from an antibody that binds the target cell surface antigen with a high binding affinity. In some embodiments, the extracellular antigen binding domain is a single chain variable fragment (scFv). In some embodiments, extracellular antigen binding domain is a single domain antibody. In exemplary embodiments, the scFv or single domain antibody binds to a tumor antigen, a pathogenic antigen, or an immune cell specific to an autoantigen. Table 4 lists exemplary cell-surface target antigens and exemplary antibodies binding to such. Table 4. Exemplary Cell Surface Target Antigen and Exemplary Antibodies Binding to Such Exemplary target Exemplary Exemplary ib di Exemplary target antigens antibodies and Fc- bs
21 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Exemplary target Exemplary Exemplary antigens antibodies Exemplary target antigens antibodies and Fc- 1 bs s
22 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Exemplary target Exemplary Exemplary antigens antibodies Exemplary target antigens antibodies and Fc-
23 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Exemplary target Exemplary Exemplary antigens antibodies Exemplary target antigens antibodies and Fc- s s bs n n e
24 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Exemplary target Exemplary Exemplary antigens antibodies Exemplary target antigens antibodies and Fc- s e of
25 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Exemplary target Exemplary Exemplary antigens antibodies Exemplary target antigens antibodies and Fc- s s bs
26 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Exemplary target Exemplary Exemplary antigens antibodies Exemplary target antigens antibodies and Fc- bs s s bs
27 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Exemplary target Exemplary Exemplary antigens antibodies Exemplary target antigens antibodies and Fc-
ent (e.g., an scFv) derived from any of the antibodies listed in Table 4 depending upon the target antigen of interest. In some embodiments, the antigen binding fragment (e.g., an scFv) may comprise the same heavy chain and light chain complementarity determining regions (CDRs) as the antibodies listed in Table 4 depending upon the target antigen of interest. In some examples, the antigen binding fragment (e.g., an scFv) may comprise the same heavy chain variable region (VH) and light chain variable region VL as the antibodies listed in Table 4 depending upon the target antigen of interest. In other embodiments, the extracellular antigen binding domain of any of the CAR polypeptides described herein may be specific to a pathogenic antigen, such as a bacterial antigen, a viral antigen, or a fungal antigen. Some examples are provided below: influenza virus neuraminidase, hemagglutinin, or M2 protein, human respiratory syncytial virus (RSV) F glycoprotein or G glycoprotein, herpes simplex virus glycoprotein gB, gC, gD, or gE, Chlamydia MOMP or PorB protein, Dengue virus core protein, matrix protein, or glycoprotein E, measles virus hemagglutinin, herpes simplex virus type 2 glycoprotein gB, poliovirus I VP1, envelope glycoproteins of HIV 1, hepatitis B core antigen or surface antigen, diptheria toxin, 28 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Streptococcus 24M epitope, Gonococcal pilin, pseudorabies virus g50 (gpD), pseudorabies virus II (gpB), pseudorabies virus III (gpC), pseudorabies virus glycoprotein H, pseudorabies virus glycoprotein E, coronavirus polypeptides, transmissible gastroenteritis glycoprotein 195, transmissible gastroenteritis matrix protein, human papilloma virus E6 or E7, or human hepatitis C virus glycoprotein E1 or E2. In addition, the extracellular antigen binding domain of the CAR polypeptide described herein may be specific to a tag conjugated to a therapeutic agent, which targets an antigen associated with a disease or disorder (e.g., a tumor antigen or a pathogenic antigen as described herein). In some instances, the tag conjugated to the therapeutic agent can be antigenic and the extracellular antigen binding domain of the CAR polypeptide can be an antigen-binding fragment (e.g., scFv) of an antibody having high binding affinity and/or specificity to the antigenic tag. Exemplary antigenic tags include, but are not limited to, biotin, avidin, a fluorescent molecule (e.g., GFP, YRP, luciferase, or RFP), Myc, Flag, His (e.g., poly His such as 6xHis), HA (hemagglutinin), GST, MBP (maltose binding protein), KLH (keyhole limpet hemocyanins), trx, T7, HSV, VSV (e.g., VSV-G), Glu-Glu, V5, e-tag, S-tag, KT3, E2, Au1, Au5, and/or thioredoxin. In other instances, the tag conjugated to the therapeutic agent is a member of a ligand- receptor pair and the extracellular antigen binding domain comprises the other member of the ligand-receptor pair or a fragment thereof that binds the tag. For example, the tag conjugated to the therapeutic agent can be biotin and the extracellular antigen binding domain of the CAR polypeptide can comprise a biotin-binding fragment of avidin. See, e.g., (Urbanska et al., Cancer Res, 72(7): 1844-1852 (2012); Lohmueller et al., Oncoimmunology, 7(1): e1368604
include anti-Tag CAR, in which the extracellular antigen binding domain is a scFv fragment specific to a protein tag, such as FITC (Tamada et al., Clin Cancer Res, 18(23): 6436-6445 (2012); Kim et al., J Am Chem Soc, 137(8): 2832-2835 (2015); Cao et al., Angew Chem Int Ed Engl, 55(26): 7520-7524 (2016); Ma et al., Proc Natl Acad Sci U S A, 113(4): E450-458 (2016)), PNE (Ma, Kim et al., Proc Natl Acad Sci U S A, 113(4): E450-458 (2016)), La-SS-B (Cartellieri et al., Blood Cancer J, 6(8): e458 (2016)), Biotin (Lohmueller, Ham et al., Oncoimmunology, 7(1): e1368604 (2017)) and Leucine-Zipper (Cho et al., Cell, 173(6): 1426-1438.e1411 (2018)). Selection of the antigen binding domain for use in the CAR polypeptides described herein will be apparent to one of skill in the art. For example, it may 29 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) depend on factors such as the type of target antigen and the desired affinity of the binding interaction. The extracellular antigen binding domain of any of the CAR polypeptides described herein may have suitable binding affinity for a target antigen (e.g., any one of the targets described herein) or antigenic epitopes thereof. As used herein, “binding affinity” refers to the apparent association constant or KA or the KD. The KA is the reciprocal of the dissociation constant (KD). The extracellular antigen binding domain for use in the CAR polypeptides described herein may have a binding affinity (KD) of at least 10-5, 10-6, 10-7, 10-8, 10-9, 10-10 M, or lower for the target antigen or antigenic epitope. An increased binding affinity corresponds to a decreased KD. Higher affinity binding of an extracellular antigen binding domain for a first antigen relative to a second antigen can be indicated by a higher KA (or a smaller numerical value KD) for binding the first antigen than the KA (or numerical value KD) for binding the second antigen. In such cases, the extracellular antigen binding domain has specificity for the first antigen (e.g., a first protein in a first conformation or mimic thereof) relative to the second antigen (e.g., the same first protein in a second conformation or mimic thereof; or a second protein). Differences in binding affinity (e.g., for specificity or other comparisons) can be at least 1.5, 2, 3, 4, 5, 10, 15, 20, 37.5, 50, 70, 80, 91, 100, 500, 1000, 10,000 or 100,000-fold. Binding affinity (or binding specificity) can be determined by a variety of methods including equilibrium dialysis, equilibrium binding, gel filtration, ELISA, surface plasmon resonance, or spectroscopy (e.g., using a fluorescence assay). Exemplary conditions for evaluating binding affinity are in HBS-P buffer (10 mM HEPES pH 7.4, 150 mM NaCl, 0.005% (v/v) Surfactant P20). These techniques can be used to measure the concentration of bound binding protein as a function of target protein concentration. The concentration of bound binding protein ([Bound]) is generally related to the concentration of free target protein ([Free]) by the following equation: [Bound] = [Free]/(Kd+[Free]) It is not always necessary to make an exact determination of KA, though, since sometimes it is sufficient to obtain a quantitative measurement of affinity, e.g., determined using a method such as ELISA or FACS analysis, is proportional to KA, and thus can be used for comparisons, such as determining whether a higher affinity is, e.g., 2-fold higher, to obtain a qualitative measurement of affinity, or to obtain an inference of affinity, e.g., by activity in a functional assay, e.g., an in vitro or in vivo assay. 30 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) B. Transmembrane domain The transmembrane domain of the chimeric receptor polypeptides (e.g., ACTR polypeptides or CAR polypeptides) described herein can be in any form known in the art. As used herein, a “transmembrane domain” refers to any protein structure that is thermodynamically stable in a cell membrane, preferably a eukaryotic cell membrane. A transmembrane domain compatible for use in the chimeric receptor polypeptides used herein may be obtained from a naturally occurring protein. Alternatively, it can be a synthetic, non- naturally occurring protein segment, e.g., a hydrophobic protein segment that is thermodynamically stable in a cell membrane. Transmembrane domains are classified based on the three-dimensional structure of the transmembrane domain. For example, transmembrane domains may form an alpha helix, a complex of more than one alpha helices, a beta-barrel, or any other stable structure capable of spanning the phospholipid bilayer of a cell. Furthermore, transmembrane domains may also or alternatively be classified based on the transmembrane domain topology, including the number of passes that the transmembrane domain makes across the membrane and the orientation of the protein. For example, single-pass membrane proteins cross the cell membrane once, and multi-pass membrane proteins cross the cell membrane at least twice (e.g., 2, 3, 4, 5, 6, 7 or more times). Membrane proteins may be defined as Type I, Type II or Type III depending upon the topology of their termini and membrane-passing segment(s) relative to the inside and outside of the cell. Type I membrane proteins have a single membrane-spanning region and are oriented such that the N-terminus of the protein is present on the extracellular side of the lipid bilayer of the cell and the C-terminus of the protein is present on the cytoplasmic side. Type II membrane proteins also have a single membrane-spanning region but are oriented such that the C-terminus of the protein is present on the extracellular side of the lipid bilayer of the cell and the N-terminus of the protein is present on the cytoplasmic side. Type III membrane proteins have multiple membrane-spanning segments and may be further sub-classified based on the number of transmembrane segments and the location of N- and C-terminus. In some embodiments, the transmembrane domain of the chimeric receptor polypeptide described herein is derived from a Type I single-pass membrane protein. Preferably, the transmembrane domain is of a membrane protein selected from the group consisting of CD8α, CD8β, 4-1BB/CD137, CD27, CD28, CD34, CD4, FcεRIγ, CD16A, OX40/CD134, CD3ζ, 31 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) CD3ε, CD3γ, CD3δ, TCRα, TCRβ, TCRζ, CD32, CD64, CD45, CD5, CD9, CD22, CD37, CD80, CD86, CD40, CD40L/CD154, VEGFR2, FAS, FGFR2B, CD2, IL15, IL15R, IL21, DNAM-1, 2B4, NKG2D, NKp44 and NKp46. In some embodiments, the transmembrane domain is from a membrane protein selected from the following: CD8a, CD8b, 4-1BB, CD28, CD34, CD4, FcεRIγ, CD16A, OX40, CD3z, CD3e, CD3g, CD3d, TCRα, CD32, CD64, VEGFR2, FAS, FGFR2B, DNAM-1, 2B4, NKG2D, NKp44 and NKp46. In some examples, the transmembrane domain is of CD8 (e.g., the transmembrane domain is of CD8α). In some examples, the transmembrane domain is of 4-1BB/CD137. In other embodiments, the transmembrane domain is of CD28. In other embodiments, the transmembrane domain is of NKG2D, NKp44 or NKp46. In other examples, the transmembrane domain is of CD34. In yet other examples, the transmembrane domain is not derived from human CD8a. In some embodiments, the transmembrane domain of the chimeric receptor polypeptide is a single-pass alpha helix. The amino acid sequences of exemplary transmembrane domains are provided in Table 5: Table 5. Exemplary Transmembrane Domains Transmembrane domain Sequences SEQ ID NO
32 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Transmembrane domain Sequences SEQ ID NO CD3δ DGIIVTDVIATLLLALGVFCFAGHET 39
patible for use in the chimeric receptor polypeptides described herein. Multi-pass membrane proteins may comprise a complex alpha helical structure (e.g., at least 2, 3, 4, 5, 6, 7 or more alpha helices) or a beta sheet structure. Preferably, the N-terminus and the C-terminus of a multi- pass membrane protein are present on opposing sides of the lipid bilayer, e.g., the N-terminus of the protein is present on the cytoplasmic side of the lipid bilayer and the C-terminus of the protein is present on the extracellular side. In some instances, the reverse orientation of such a native transmembrane protein may be constructed for efficient orientation of the chimeric receptor polypeptide (e.g., CAR) within the immune cell membrane. Either one or multiple helices passes from a multi-pass membrane protein can be used for constructing the chimeric receptor polypeptide described herein. Transmembrane domains for use in the chimeric receptor polypeptides described herein can also comprise at least a portion of a synthetic, non-naturally occurring protein segment. In some embodiments, the transmembrane domain is a synthetic, non-naturally occurring alpha helix or beta sheet. In some embodiments, the protein segment is at least approximately 20 amino acids, e.g., at least 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, or more amino acids. Examples of synthetic transmembrane domains are known in the art, for example in US 7,052,906 B1 and WO 2000/032776A2, the relevant disclosures of each of which are incorporated by reference herein. In some embodiments, the amino acid sequence of the transmembrane domain does not comprise cysteine residues. In some embodiments, the amino acid sequence of the transmembrane domain comprises one cysteine residue. In some embodiments, the amino acid sequence of the transmembrane domain comprises two cysteine residues. In some 33 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) embodiments, the amino acid sequence of the transmembrane domain comprises more than two cysteine residues (e.g., 3, 4, 5, or more). The transmembrane domain may comprise a transmembrane region and a cytoplasmic region located at the C-terminal side of the transmembrane domain. The cytoplasmic region of the transmembrane domain may comprise three or more amino acids and, in some embodiments, helps to orient the transmembrane domain in the lipid bilayer. In some embodiments, one or more cysteine residues are present in the transmembrane region of the transmembrane domain. In some embodiments, one or more cysteine residues are present in the cytoplasmic region of the transmembrane domain. In some embodiments, the cytoplasmic region of the transmembrane domain comprises positively charged amino acids. In some embodiments, the cytoplasmic region of the transmembrane domain comprises the amino acids arginine, serine, and lysine. In some embodiments, the transmembrane region of the transmembrane domain comprises hydrophobic amino acid residues. In some embodiments, the transmembrane region comprises mostly hydrophobic amino acid residues, such as alanine, leucine, isoleucine, methionine, phenylalanine, tryptophan, or valine. In some embodiments, the transmembrane region is hydrophobic. In some embodiments, the transmembrane region comprises a poly- leucine-alanine sequence. The hydropathy, hydrophobic or hydrophilic characteristics of a protein or protein segment, can be assessed by any method known in the art including, for example, the Kyte and Doolittle hydropathy analysis. C. Co-stimulatory signaling domains It is beneficial to include a co-stimulatory signaling domain in NK cell for stimulation of an antigen-specific signal, to promote cell proliferation, differentiation and survival, as well as to activate effector functions of the NK cell. The term “co-stimulatory signaling domain”, as used herein, refers to at least a fragment of a co-stimulatory signaling protein that mediates signal transduction within a cell to induce an immune response such as an effector function (a secondary signal). As known in the art, activation of T cells and NK cells often requires two signals: (1) the antigen specific signal (primary signal) triggered by the engagement of T cell receptor (TCR) and antigenic peptide/MHC complexes presented by antigen presenting cells, which typically is driven by CD3ζ as a component of the TCR complex; and (ii) a co- 34 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) stimulatory signal (secondary signal) triggered by the interaction between a co-stimulatory receptor and its ligand. A co-stimulatory receptor transduces a co-stimulatory signal (secondary signal) as an addition to the TCR-triggered signaling. T cell or NK cell activation usually results in cellular changes such as cellular proliferation, metabolic changes, and acquisition of effector functions thereby, being recognized and/or modulates responses mediated by other immune cells, such as T cells, NK cells, macrophages, neutrophils, or eosinophils. NK cells belong to the family of Group I innate lymphocytes of the innate immune system and can react without prior sensitization. Unlike T cells (that are dependent on TCR rearrangement) NK cells express a large repertoire of germ-line activating and inhibitory receptors, for specificity and tolerance (Pallmer and Oxenius, Front Immunol, 7: 251 (2016); Rosenberg and Huang, Curr Opin Chem Eng, 19: 9-20 (2018); Uzhachenko and Shanker, Front Immunol, 10: 1906 (2019)); . Activation of a co-stimulatory signaling domain in a NK cell may induce the cell to increase or decrease the production and secretion of cytokines, phagocytic properties, proliferation, differentiation, survival, and/or cytotoxicity. The co-stimulatory signaling domain of any co-stimulatory molecule may be compatible for use in the chimeric receptor polypeptides described herein. The type(s) of co-stimulatory signaling domain is selected based on the desired immune effector function (e.g., ADCC). Accordingly, it is in one embodiment that the chimeric receptor polypeptide of the genetically engineered NK cell comprises the at least one co-stimulatory signaling domain. Examples of co-stimulatory signaling domains for use in the chimeric receptor polypeptides may be the cytoplasmic signaling domain of co-stimulatory proteins, including, without limitation, members of the B7/CD28 family (e.g., B7-1/CD80, B7-2/CD86, B7-H1/PD-L1, B7-H2, B7-H3, B7-H4, B7- H6, B7-H7, BTLA/CD272, CD28, CTLA-4, Gi24/VISTA/B7-H5, ICOS/CD278, PD-1, PD- L2/B7-DC, and PDCD6); members of the TNF superfamily (e.g.,4-1BB/TNFRSF9/CD137, 4- 1BB Ligand/TNFSF9, BAFF/BLyS/TNFSF13B, BAFF R/TNFRSF13C, CD27/TNFRSF7, CD27 Ligand/TNFSF7, CD30/TNFRSF8, CD30 Ligand/TNFSF8, CD40/TNFRSF5, CD40/TNFSF5, CD40 Ligand/TNFSF5, DR3/TNFRSF25, GITR/TNFRSF18, GITR Ligand/TNFSF18, HVEM/TNFRSF14, LIGHT/TNFSF14, Lymphotoxin-alpha/TNF-beta, OX40/TNFRSF4, OX40 Ligand/TNFSF4/CD2525, RELT/TNFRSF19L, TACI/TNFRSF13B, TL1A/TNFSF15, TNF-alpha, and TNF RII/TNFRSF1B); members of the SLAM family (e.g., 35 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) 2B4/CD244/SLAMF4, BLAME/SLAMF8, CD2, CD2F-10/SLAMF9, CD48/SLAMF2, CD58/LFA-3, CD84/SLAMF5, CD229/SLAMF3, CRACC/SLAMF7, NTB-A/SLAMF6, and SLAM/CD150); and any other co-stimulatory molecules, such as CD2, CD7, CD53, CD82/Kai-1, CD90/Thy1, CD96, CD160, CD200, CD300a/LMIR1, HLA Class I, HLA-DR, Ikaros, Integrin alpha 4/CD49d, Integrin alpha 4 beta 1, Integrin alpha 4 beta 7/LPAM-1, LAG- 3, TCL1A, TCL1B, CRTAM, DAP10, DAP12, Dectin-1/CLEC7A, DPPIV/CD26, EphB6, TIM-1/KIM-1/HAVCR, TIM-4, TSLP, TSLP R, lymphocyte function associated antigen-1 (LFA-1), NKG2D, NKG2C, NKp30, NKp44, NKp46 and JAMAL. In certain embodiments, the chimeric receptor polypeptides may contain a CD28 co-stimulatory signaling domain or a 4-1BB (CD137) co-stimulatory signaling domain. In some embodiments, at least one co- stimulatory signaling domain is selected from the group consisting of 4-1BB, CD28, CD8α, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL, or any variant thereof. Also within the scope of the present disclosure are functional variants of any of the co- stimulatory signaling domains described herein, such that the co-stimulatory signaling domain is capable of modulating the immune response of the NK cell. In some embodiments, the co- stimulatory signaling domains comprise up to 10 amino acid residue mutations (e.g., 1, 2, 3, 4, 5, or 8) such as amino acid substitutions, deletions, or additions as compared to a wild-type counterpart. Such co-stimulatory signaling domains comprising one or more amino acid variations (e.g., amino acid substitutions, deletions, or additions) may be referred to as variants. Mutation of amino acid residues of the co-stimulatory signaling domain may result in an increase in signaling transduction and enhanced stimulation of immune responses relative to co-stimulatory signaling domains that do not comprise the mutation. Mutation of amino acid residues of the co-stimulatory signaling domain may result in a decrease in signaling transduction and reduced stimulation of immune responses relative to co-stimulatory signaling domains that do not comprise the mutation. For example, mutation of residues 186 and 187 of the native CD28 amino acid sequence may result in an increase in co-stimulatory activity and induction of immune responses by the co-stimulatory domain of the chimeric receptor polypeptide. In some embodiments, the mutations are substitution of a lysine at each of positions 186 and 187 with a glycine residue of the CD28 co-stimulatory domain, referred to as a CD28LL→GG variant. Therefore, a suitable variant of CD28 is the CD28LL→GG variant. 36 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Additional mutations can be made in co-stimulatory signaling domains that may enhance or reduce co-stimulatory activity of the domain will be evident to one of ordinary skill in the art. In some embodiments, the co-stimulatory signaling domain is selected from the group of 4-1BB, CD28, OX40, and CD28LL→GG variant. In some embodiments, the chimeric receptor polypeptides may contain a single co- stimulatory domain such as, for example, a CD27 co-stimulatory domain, a CD28 co- stimulatory domain, a 4-1BB co-stimulatory domain, an ICOS co-stimulatory domain, an OX40 co-stimulatory domain, an OX40L co-stimulatory domain, a 2B4 co-stimulatory domain, a GITR co-stimulatory domain, a NKG2D co-stimulatory domain, a NKp30 co- stimulatory domain, a NKp44co-stimulatory domain, a NKp46 co-stimulatory domain, a DAP10 co-stimulatory domain, a DAP12 co-stimulatory domain, a DNAM1 co-stimulatory domain, a LFA-1 co-stimulatory domain, a HVEM co-stimulatory domain or a JAMAL co- stimulatory domain. In one embodiment, the at least one co-stimulatory signaling domain is a CD28 co-stimulatory signaling domain or a 4-1BB co-stimulatory signaling domain. In some embodiments, the chimeric receptor polypeptides may comprise more than one co-stimulatory signaling domain (e.g., 2, 3, or more). In one embodiment, the chimeric receptor polypeptide comprises at least two co-stimulatory signaling domains. In one preferred embodiment, the chimeric receptor polypeptide comprises two co-stimulatory signaling domains. In some embodiments, the chimeric receptor polypeptide comprises two or more of the same co-stimulatory signaling domains, for example, two copies of the co-stimulatory signaling domain of CD28. In some embodiments, the chimeric receptor polypeptide comprises two or more co-stimulatory signaling domains from different co-stimulatory proteins, such as any two or more co-stimulatory proteins described herein. In some embodiments, the chimeric receptor polypeptide may comprise two or more co-stimulatory signaling domains from different co-stimulatory receptors, such as any two or more co- stimulatory receptors described herein, for example, CD28 and 4-1BB, CD28 and CD27, CD28 and ICOS, CD28LL→GG variant and 4-1BB, CD28 and OX40, or CD28LL→GG variant and OX40. In some embodiments, the two co-stimulatory signaling domains are CD28 and 4-1BB. In some embodiments, the two co-stimulatory signaling domains are CD28LL→GG variant and 4- 1BB. In some embodiments, the two co-stimulatory signaling domains are CD28 and OX40. In some embodiments, the two co-stimulatory signaling domains are CD28LL→GG variant and OX40. In some embodiments, the chimeric receptor polypeptides described herein may 37 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) contain a combination of a CD28 and ICOSL. In some embodiments, the chimeric receptor polypeptide described herein may contain a combination of CD28 and CD27. In certain embodiments, the 4-1BB co-stimulatory domain is located N-terminal to the CD28 or CD28LL→GG variant co-stimulatory signaling domain. In some embodiments, one of the co-stimulatory signaling domains is a CD28 co- stimulatory signaling domain and the other co-stimulatory domain is selected from the group consisting of a CD8α, 4-1BB, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL co- stimulatory signaling domain. In some embodiments, one of the co-stimulatory signaling domains is a CD8α co-stimulatory signaling domain and the other co-stimulatory domain is selected from the group consisting of a CD28, 4-1BB, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL co-stimulatory signaling domain. In some embodiments, one of the co- stimulatory signaling domains is a 4-1BB co-stimulatory signaling domain and the other co- stimulatory domain is selected from the group consisting of a CD8α, CD28, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL co-stimulatory signaling domain. In some embodiments, the chimeric receptor polypeptides described herein do not comprise a co-stimulatory signaling domain. The amino acid sequences of exemplary co- stimulatory domains are provided in Table 6. Table 6. Exemplary Co-Stimulatory Domains Co-stimulatory Sequences SEQ d i ID NO
38 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Co-stimulatory Sequences SEQ domain ID NO TIM1 KKYFFKKEV L V F L IKAL NAVEKEV AEDNIYIEN LY
, p p yp p y y y signaling domain. The optional co-stimulatory signaling domain may be located in the cytoplasm for triggering activation and/or effector signaling. D. Cytoplasmic signaling domain Any cytoplasmic signaling domain can be used to create the chimeric receptor polypeptides described herein (e.g., ACTR polypeptides or CAR polypeptides). Such a cytoplasmic domain may be any signaling domain involved in triggering cell signaling (primary signaling) that leads to NK cell proliferation and/or activation. The cytoplasmic signaling domain as described herein is not a co-stimulatory signaling domain, which, as 39 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) known in the art, relays a co-stimulatory or secondary signal for fully activating other known immune cells (e.g., T cells such as CAR-T cells). The cytoplasmic signaling domain described herein may comprise an immunoreceptor tyrosine-based activation motif (ITAM) domain (e.g., at least one ITAM domain, at least two ITAM domains, or at least three ITAM domains) or may be ITAM free. An “ITAM,” as used herein, is a conserved protein motif that is generally present in the tail portion of signaling molecules expressed in many immune cells. The motif may comprise two repeats of the amino acid sequence YxxL/I separated by 6-8 amino acids, wherein each x is independently any amino acid, producing the conserved motif YxxL/Ix(6-8)YxxL/I. ITAMs within signaling molecules are important for signal transduction within the cell, which is mediated at least in part by phosphorylation of tyrosine residues in the ITAM following activation of the signaling molecule. ITAMs may also function as docking sites for other proteins involved in signaling pathways. Examples of ITAMs for use in the chimeric receptor polypeptides comprised within the cytoplasmic signaling domain, without limitation may be: CD3γ, CD3ε, CD3δ, each containing a single ITAM motif while each ζ chain contains 3 distinct ITAM domains (ζa, ζb and ζc). The number and ITAM sequences are also important in the design of CARs (Bettini et al., J Immunol, 199(5): 1555-1560 (2017); Jayaraman et al., EBioMedicine, 58: 102931 (2020)). The amino acid sequence of one exemplary cytoplasmic signaling domain of human CD3ζ is provided as SEQ ID NO: 73. CD3ζ Cytoplasmic Domain (SEQ ID NO: 73) RVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEG LYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHMQALPPR In some embodiments, the cytoplasmic signaling domain is of CD3ζ or FcεR1γ. In other examples, cytoplasmic signaling domain is not derived from human CD3ζ. In yet other examples, the cytoplasmic signaling domain is not derived from an FcR, when the extracellular Fc-binding domain of the same chimeric receptor polypeptide is derived from CD16A. In one specific embodiment, several signaling domains can be fused together for additive or synergistic effect. Non-limiting examples of useful additional signaling domains include part or all of one or more of TCRζ chain, CD28, OX40/CD134, 4-1BB/CD137, FcεRIγ, ICOS/CD278, IL2Rβ/CD122, IL-2Rγ/CD132, and CD40. 40 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) In other embodiments, the cytoplasmic signaling domain described herein is free of the ITAM motif. Examples include, but are not limited to, the cytoplasmic signaling domain of Jak/STAT, Toll-interleukin receptor (TIR), and tyrosine kinase. E. Hinge domain In some embodiments, the chimeric receptor polypeptides (e.g., ACTR polypeptide or CAR polypeptide) described herein further comprise a hinge domain that is located between the extracellular ligand-binding domain and the transmembrane domain. A hinge domain is an amino acid segment that is generally found between two domains of a protein and may allow for flexibility of the protein and movement of one or both domains relative to one another. Any amino acid sequence that provides such flexibility and movement of the extracellular ligand- binding domain relative to the transmembrane domain of the chimeric receptor polypeptide can be used. Hinge domains of any protein known in the art to comprise a hinge domain are compatible for use in the chimeric receptor polypeptides described herein. In some embodiments, the hinge domain is at least a portion of a hinge domain of a naturally occurring protein and confers flexibility to the chimeric receptor polypeptide. In one embodiment the chimeric receptor polypeptide comprises a hinge domain, which is a hinge domain selected from the list of CD28, CD16A, CD8, IgG, murine CD8α, and DAP12. In some embodiments, the hinge domain is of CD8 (e.g., the hinge domain is of CD8α). In some embodiments, the hinge domain is a portion of the hinge domain of CD8, e.g., a fragment containing at least 15 (e.g., 20, 25, 30, 35, or 40) consecutive amino acids of the hinge domain of CD8. In some embodiments, the hinge domain is of CD28. In some embodiments, the hinge domain is a portion of the hinge domain of CD28, e.g., a fragment containing at least 15 (e.g., 20, 25, 30, 35, or 40) consecutive amino acids of the hinge domain of CD28. The hinge domain and/or the transmembrane domain may be linked to additional amino acids (e.g., 15 aa, 10-aa, 8-aa, 6-aa, or 4-aa) at the N-terminal portion, at the C-terminal portion, or both. Examples can be found, e.g., in (Ying et al., Nat Med, 25(6): 947-953 (2019)). In some embodiments, the hinge domain is of a CD16A receptor, for example, the whole hinge domain of a CD16A receptor or a portion thereof, which may consist of up to 40 consecutive amino acid residues of the CD16A receptor (e.g., 20, 25, 30, 35, or 40). Such a chimeric receptor polypeptide (e.g., an ACTR polypeptide) may contain no hinge domain from 41 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) a different receptor (a non-CD16A receptor). In some cases, the chimeric receptor polypeptide described herein may be free of a hinge domain from any non-CD16A receptor. In some instances, such a chimeric receptor polypeptide may be free of any hinge domain. Hinge domains of IgG antibodies, such as an IgG, IgA, IgM, IgE, or IgD antibodies, are also compatible for use in the chimeric receptor polypeptides described herein. In some embodiments, the hinge domain joins the constant domains CH1 and CH2 of an antibody. In some embodiments, the hinge domain is of an antibody and comprises the hinge domain of the antibody and one or more constant regions of the antibody. In some embodiments, the hinge domain comprises the hinge domain of an antibody and the CH3 constant region of the antibody. In some embodiments, the hinge domain comprises the hinge domain of an antibody and the CH2 and CH3 constant regions of the antibody. In some embodiments, the antibody is an IgG, IgA, IgM, IgE, or IgD antibody. In some embodiments, the antibody is an IgG antibody. In some embodiments, the antibody is an IgG1, IgG2, IgG3, or IgG4 antibody, preferably IgG1 and IgG4. In some embodiments, the hinge region comprises the hinge region and the CH2 and CH3 constant regions of an IgG1 antibody. In some embodiments, the hinge region comprises the hinge region and the CH3 constant region of an IgG1 antibody. Non-naturally occurring peptides may also be used as hinge domains for the chimeric receptor polypeptides described herein. In some embodiments, the hinge domain between the C-terminus of the extracellular target-binding domain and the N-terminus of the transmembrane domain is a peptide linker, such as a (GlyxSer)n linker, wherein x and n, independently can be an integer between 3 and 12, including 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, or more. In some embodiments, the hinge domain is (Gly4Ser)n, wherein n can be an integer between 3 and 60, including 3, 4, 5, 6, 7, 8, 9, 10, 11, 12, 13, 14, 15, 16, 17, 18, 19, 20, 21, 22, 23, 24, 25, 26, 27, 28, 29, 30, 31, 32, 33, 34, 35, 36, 37, 38, 39, 40, 41, 42, 43, 44, 45, 46, 47, 48, 49, 50, 51, 52, 53, 54, 55, 56, 57, 58, 59, or 60. In certain embodiments, n can be an integer greater than 60. In some embodiments, the hinge domain is (Gly4Ser)3 (SEQ ID NO: 15). In some embodiments, the hinge domain is (Gly4Ser)6 (SEQ ID NO: 16). In some embodiments, the hinge domain is (Gly4Ser)9 (SEQ ID NO: 17). In some embodiments, the hinge domain is (Gly4Ser)12 (SEQ ID NO: 18). In some embodiments, the hinge domain is (Gly4Ser)15 (SEQ ID NO: 19). In some embodiments, the hinge domain is (Gly4Ser)30 (SEQ ID NO: 20). In some embodiments, the hinge domain is (Gly4Ser)45 (SEQ ID NO: 21). In some embodiments, the hinge domain is (Gly4Ser)60 (SEQ ID NO: 22). 42 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) In other embodiments, the hinge domain is an extended recombinant polypeptide (XTEN), which is an unstructured polypeptide consisting of hydrophilic residues of varying lengths (e.g., 10-80 amino acid residues). Amino acid sequences of XTEN peptides will be evident to one of skill in the art and can be found, for example, in US 8,673,860, the relevant disclosures of which are incorporated by reference herein. In some embodiments, the hinge domain is an XTEN peptide and comprises 60 amino acids. In some embodiments, the hinge domain is an XTEN peptide and comprises 30 amino acids. In some embodiments, the hinge domain is an XTEN peptide and comprises 45 amino acids. In some embodiments, the hinge domain is an XTEN peptide and comprises 15 amino acids. Any of the hinge domains used for making the chimeric receptor polypeptide as described herein may contain up to 250 amino acid residues. In some instances, the chimeric receptor polypeptide may contain a relatively long hinge domain, for example, containing 150- 250 amino acid residues (e.g., 150-180 amino acid residues, 180-200 amino acid residues, or 200-250 amino acid residues). In other instances, the chimeric receptor polypeptide may contain a medium sized hinge domain, which may contain 60-150 amino acid residues (e.g., 60-80, 80-100, 100-120, or 120-150 amino acid residues). In some instances, the hinge domain may be a flexible linker consisting of glycine and serine amino acids having a length between 15 and 60 amino acids, preferably composed of Gly4Ser units, especially one of the linkers of SEQ ID NO: 16 to SEQ ID NO: 18. Alternatively, the chimeric receptor polypeptide may contain a short hinge domain, which may contain less than 60 amino acid residues (e.g., 1-30 amino acids or 31-60 amino acids). In some embodiments, a chimeric receptor polypeptide (e.g., an ACTR polypeptide) described herein contains no hinge domain or no hinge domain from a non-CD16A receptor. The amino acid sequences of exemplary hinge domains are provided in Table 7: Table 7. Exemplary Hinge Domains Hinge domain Sequences SEQ ID NO
43 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Hinge domain Sequences SEQ ID NO IgG1 (hinge-CH3) EPKSCDKTHTCPGQPREPQVYTLPPSRDELTKNQVSLTCL 6 VK FYP DIAVEWE N PENNYKTTPPVLD D FFLY
In some embodiments, chimeric receptor polypeptides described herein may further comprise a hinge domain, which may be located at the C-terminus of the extracellular target binding domain and the N-terminus of the transmembrane domain. The hinge domain may be of any suitable length. In other embodiments, the chimeric receptor polypeptide described 44 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) herein may have no hinge domain. In yet other embodiments, the chimeric receptor polypeptide described herein may have a shortened hinge domain (e.g., including up to 25 amino acid residues). F. Signal peptide In some embodiments, the chimeric receptor polypeptide (e.g., ACTR polypeptide or CAR polypeptide) may also comprise a signal peptide (also known as a signal sequence) at the N-terminus of the polypeptide. Preferably, the nucleic acid encoding the chimeric receptor polypeptide is also encoding a signal peptide, whereas in the mature polypeptide the signal peptide has been cleaved off. In general, signal sequences are peptide sequences that target a polypeptide to the desired site in a cell. In some embodiments, the signal sequence targets the chimeric receptor polypeptide to the secretory pathway of the NK cell and will allow for integration and anchoring of the chimeric receptor polypeptide into the lipid bilayer. Signal sequences including signal sequences of naturally occurring proteins or synthetic, non- naturally occurring signal sequences that are compatible for use in the chimeric receptor polypeptides described herein will be evident to one of skill in the art. In some embodiments, the signal sequence from CD8α (SEQ ID NO: 1). In some embodiments, the signal sequence is from CD28 (SEQ ID NO: 2). In other embodiments, the signal sequence is from the murine kappa chain. In yet other embodiments, the signal sequence is from CD16. See Table 8 below. Table 8. Exemplary Signal Peptides Signal Peptide Sequences SEQ ID NO
In some instances, any of the chimeric receptor polypeptides disclosed herein may further comprise a protein tag, examples of which are provided in Table 9 below. 45 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Table 9. Exemplary Protein Tags Protein Tag Sequences SEQ ID NO 2xV5 Tag GKPIPNPLLGLDSTGKPIPNPLLGLDST 69 G
Exemplary ACTR constructs for use with the methods and compositions described herein may be found, for example, in the instant description and figures or may be found in WO2016/040441A1, WO2017/161333A1, and WO2018/140960A1, each of which is incorporated by reference herein for this purpose. The ACTR polypeptides described herein may comprise a CD16A extracellular domain with binding affinity and specificity for the Fc portion of an IgG molecule, a transmembrane domain, and a CD3ζ cytoplasmic signaling domain. In some embodiments, the ACTR polypeptides may further include one or more co- stimulatory signaling domains, one of which may be a CD28 co-stimulatory signaling domain or a 4-1BB co-stimulatory signaling domain. The ACTR polypeptides are configured such that, when expressed on a NK cell, the extracellular ligand-binding domain is located extracellularly for binding to a target molecule and the CD3ζ cytoplasmic signaling domain. The co-stimulatory signaling domain may be located in the cytoplasm for triggering activation and/or effector signaling. In some embodiments, an ACTR polypeptide as described herein may comprise, from N-terminus to C-terminus, the Fc binding domain such as a CD16A extracellular domain, the transmembrane domain, the optional one or more co-stimulatory domains (e.g., a CD28 co- stimulatory domain, a 4-1BB co-stimulatory signaling domain, an OX40 co-stimulatory signaling domain, a CD27 co-stimulatory signaling domain, or an ICOS co-stimulatory signaling domain), and the CD3ζ cytoplasmic signaling domain. Alternatively or in addition, the ACTR polypeptides described herein may contain two or more co-stimulatory signaling domains, which may link to each other or be separated by the cytoplasmic signaling domain. The extracellular Fc binder, transmembrane domain, optional co-stimulatory signaling domain(s), and cytoplasmic signaling domain in an ACTR polypeptide may be linked to each other directly, or via a peptide linker. In some embodiments, 46 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) any of the ACTR polypeptides described herein may comprise a signal sequence at the N- terminus. Table 10 provides exemplary ACTR polypeptides described herein. These exemplary constructs have, from N-terminus to C-terminus in order, the signal sequence, the Fc binding domain (e.g., an extracellular domain of an Fc receptor), the hinge domain, and the transmembrane, while the positions of the optional co-stimulatory domain and the cytoplasmic signaling domain can be switched. Table 10. Exemplary Components of ACTR polypeptides. Extracellular Hinge domain Transmembrane Co-stimula Cytoplasmic # Signal domain of F tory Se uence c ( ) d i (b) d i (d) Signaling
47 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Extracellular Hinge domain Transmembrane Co-sti Cytoplasmic # Signal domain of mulatory Sequence Fc (e) domain (b) domain (d) Signaling )
48 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Extracellular Cytoplasmic # Signal Sequence domain of Fc Hinge domain Transmembrane Co-stimulatory (e) domain (b) domain (d) Signaling )
H. Examples of CAR polypeptides Exemplary CAR polypeptides for use with the methods and compositions described herein may be found, for example, in the instant description and figures or as those known in the art. The CAR polypeptides described herein may comprise an extracellular domain comprising a single-chain antibody fragment (scFv) with binding affinity and specificity for an antigen of interest (e.g., those listed in Table 4), a co-stimulatory domain (e.g., those listed in Table 6) and a CD3ζ cytoplasmic signaling domain. In some embodiments, the CAR polypeptide may further comprise a hinge domain (e.g., those listed in Table 7). In specific examples, a CAR polypeptide described herein may comprise (i) a CD28 co-stimulatory domain or a 4-1BB co-stimulatory domain; and (ii) a CD28 transmembrane domain, a CD28 hinge domain, or a combination thereof. In further specific examples, a CAR polypeptide described herein may comprise (i) a CD28 co-stimulatory domain or a 4-1BB co- 49 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) stimulatory domain, (ii) a CD8α transmembrane domain, a CD8α hinge domain, or a combination thereof. In some embodiments, the CAR polypeptides may further include one or more co-stimulatory signaling domains, one of which may be a CD28 co-stimulatory signaling domain or a 4-1BB co-stimulatory signaling domain. In other examples, a CAR polypeptide described herein may comprise (i) a CD28 co-stimulatory domain or a 4-1BB co-stimulatory domain, (ii) a CD28 transmembrane domain, a CD8α hinge domain, or a combination thereof. In an exemplary embodiment, the CAR polypeptide comprises (i) a CD8α hinge domain (ii) a CD8α transmembrane domain, (iii) a CD28 co-stimulatory domain or a 4-1BB co- stimulatory domain, (iv) a CD3ζ cytoplasmic signaling domain or a combination thereof. In other embodiments, the CAR polypeptide comprising two co-stimulatory domains further comprises (i) a CD8α or CD28 hinge domain (ii) a CD8α or CD28 transmembrane domain, (iii) a CD28 co-stimulatory domain or a 4-1BB co-stimulatory domain, (iv) a OX40L co- stimulatory domain, a 2B4 co-stimulatory domain, a DAP10 co-stimulatory domain, a DNAM- 1 co-stimulatory domain, a NKG2D co-stimulatory domain, a NKp30 co-stimulatory domain, a NKp44 co-stimulatory domain, a NKp46 co-stimulatory domain or a JAMAL co-stimulatory domain, or (v) a CD3ζ cytoplasmic signaling domain or a combination thereof. In another exemplary embodiment, the CAR polypeptide comprising two co-stimulatory domains further comprises (i) a CD8α hinge domain (ii) a CD28 transmembrane domain, (iii) a CD28 co- stimulatory domain or a 4-1BB co-stimulatory domain, (iv) a OX40L co-stimulatory domain, a 2B4 co-stimulatory domain, a DAP10 co-stimulatory domain, a DNAM-1 co-stimulatory or a JAMAL co-stimulatory domain, or (v) a CD3ζ cytoplasmic signaling domain or a combination thereof. In another exemplary embodiment, the CAR polypeptide comprising two co- stimulatory domains further comprises (i) a CD8α hinge domain (ii) a CD28 transmembrane domain, a NKp44 transmembrane domain, a NKG2D transmembrane domain or a NKp46 transmembrane domain, (iii) a CD28 co-stimulatory domain, a 4-1BB co-stimulatory domain, a 2B4 co-stimulatory domain or a DAP10 co-stimulatory, (iv) an OX40L co-stimulatory domain, a 2B4 co-stimulatory domain, a DAP10 co-stimulatory domain, a DAP12 co- stimulatory domain, a DNAM-1 co-stimulatory domain or a JAMAL co-stimulatory domain, or (v) a CD3ζ cytoplasmic signaling domain, a DAP12 cytoplasmic signaling domain or a 2B4 cytoplasmic signaling domain or a combination thereof. In an exemplary embodiment, the CAR polypeptide comprises (i) a CD8α hinge domain (ii) a CD28 transmembrane domain, (iii) 50 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) a CD28 co-stimulatory domain or a 4-1BB co-stimulatory domain, (iv) an OX40L co- stimulatory domain or an OX40 co-stimulatory domain, (v) a CD3ζ cytoplasmic signaling domain or a combination thereof. For example, the CAR polypeptide may comprise an amino acid sequence selected from SEQ ID NO: 86, SEQ ID NO: 87 or SEQ ID NO: 94 provided below. The CAR polypeptides are configured such that, when expressed on a NK cell, the extracellular antigen-binding domain is located extracellularly for binding to a target molecule (e.g., a tumor antigen) and the CD3ζ cytoplasmic signaling domain is located intracellularly for signaling into the cell. The co-stimulatory signaling domain may be located in the cytoplasm for triggering activation and/or effector signaling. In some embodiments, a CAR polypeptide as described herein may comprise, from N- terminus to C-terminus, the extracellular antigen binding domain, the transmembrane domain, the optional one or more co-stimulatory domains (e.g., a CD28 co-stimulatory domain, a 4- 1BB co-stimulatory signaling domain, an OX40L co-stimulatory signaling domain, an OX40 co-stimulatory signaling domain, a CD27 co-stimulatory signaling domain, a 2B4 co- stimulatory signaling domain or an ICOS co-stimulatory signaling domain), and the CD3ζ cytoplasmic signaling domain. Alternatively or in addition, the CAR polypeptides described herein may contain two or more co-stimulatory signaling domains, which may link to each other or be separated by the cytoplasmic signaling domain. The extracellular antigen binding domain, transmembrane domain, optional co-stimulatory signaling domain(s), and cytoplasmic signaling domain in a CAR polypeptide may be linked to each other directly, or via a peptide linker. In some embodiments, any of the CAR polypeptides described herein may comprise a signal sequence at the N-terminus. In some embodiments, the CAR polypeptides described herein may further include at least one co-stimulatory signaling domain. The CAR polypeptides are configured such that, when expressed on an immune cell, the extracellular antigen-binding domain is located extracellularly for binding to a target molecule and the cytoplasmic signaling domain intracellularly. Tables 11 provide exemplary CAR polypeptides for NK cells described herein. These exemplary constructs have, from N-terminus to C-terminus in order, the signal sequence, the antigen binding domain (e.g., an scFv fragment targeting an antigen such as a tumor antigen or 51 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) a pathogenic antigen), the hinge domain, and the transmembrane, while the positions of the optional co-stimulatory domain(s) and the cytoplasmic signaling domain can be switched. Table 11. Exemplary examples of CAR-NK cell constructs Antigen Hinge Transmem Co-stim. Co-stim. Cytoplasmic CAR # Signal Sequence binding domain brane domain (b) Domain Domain Signaling
52 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Antigen Hinge Transmembrane Co-stim. Co-stim. Cytoplasmic CAR # Signal Sequence binding domain domain (b) Domain Domain Signaling )
53 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Antigen Hinge Transmembrane Co-stim. Co-stim. Cytoplasmic CAR # Signal Sequence binding domain domain (b) Domain Domain Signaling )
54 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Antigen Hinge Transmembrane Co-stim. Co-stim. Cytoplasmic CAR # Signal Sequence binding domain domain (b) Domain Domain Signaling )
55 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Antigen Hinge Transmembrane Co-stim. Co-stim. Cytoplasmic CAR # Signal Sequence binding domain domain (b) Domain Domain Signaling )
56 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Antigen Hinge Transmembrane Co-stim. Co-stim. Cytoplasmic CAR # Signal Sequence binding domain domain (b) Domain Domain Signaling )
57 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Antigen Hinge Transmembrane Co-stim. Co-stim. Cytoplasmic CAR # Signal Sequence binding domain domain (b) Domain Domain Signaling )
58 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Table 12. Exemplary examples of GPC3 targeting CAR-NK cell constructs Signal Extracellular domain Hinge Transmembrane Co-stimulatory Cytoplasmic Sequence (antigen binding) domain domain domain Signaling domain
3 CAR constructs is SEQ ID NO: 85, exemplary anti-GPC3 CAR constructs comprising such scFv are provided by SEQ ID NO: 86 and SEQ ID NO: 87. Anti-GPC3 scFv derived from GC33 (SEQ ID NO: 85) DVVMTQSPLSLPVTPGEPASISCRSSQSLVHSNRNTYLHWYLQKPGQSPQLLIYKVS NRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYCSQNTHVPPTFGQGTKLEIKRG GGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSCKASGYTFTDYEMHWVRQAPGQ GLEWMGALDPKTGDTAYSQKFKGRVTLTADKSTSTAYMELSSLTSEDTAVYYCTRFY SYTYWGQGTLVTVSS Anti-GPC3-CAR 1 (SEQ ID NO: 86) MALPVTALLLPLALLLHAARPDVVMTQSPLSLPVTPGEPASISCRSSQSLVHSNRNT YLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC SQNTHVPPTFGQGTKLEIKRGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSC KASGYTFTDYEMHWVRQAPGQGLEWMGALDPKTGDTAYSQKFKGRVTLTADKSTSTA YMELSSLTSEDTAVYYCTRFYSYTYWGQGTLVTVSSTTTPAPRPPTPAPTIASQPLS LRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLY IFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNEL NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERR RGKGHDGLYQGLSTATKDTYDALHMQALPPR Anti-GPC3-CAR 2 (SEQ ID NO: 87) MALPVTALLLPLALLLHAARPDVVMTQSPLSLPVTPGEPASISCRSSQSLVHSNRNT YLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC SQNTHVPPTFGQGTKLEIKRGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSC KASGYTFTDYEMHWVRQAPGQGLEWMGALDPKTGDTAYSQKFKGRVTLTADKSTSTA YMELSSLTSEDTAVYYCTRFYSYTYWGQGTLVTVSSIEVMYPPPYLDNEKSNGTIIH VKGKHLCPSPLFPGPSKPFWVLVVVGGVLACYSLLVTVAFIIFWVRSKRSRLLHSDY MNMTPRRPGPTRKHYQPYAPPRDFAAYRSRVKFSRSADAPAYQQGQNQLYNELNLGR REEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKG HDGLYQGLSTATKDTYDALHMQALPPR An exemplary anti-GPC3 CAR construct comprising such scFv suitable for co- expression of metabolism modifying polypeptides GOT2 and TIGAR is provided by SEQ ID 59 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) NO: 92 (transient translation product prior to cleavage at ribosomal skipping sites P2A and T2A): Anti-GPC3 CAR-P2A-GOT2-T2A-TIGAR (SEQ ID NO: 92) MALPVTALLLPLALLLHAARPDVVMTQSPLSLPVTPGEPASISCRSSQSLVHSNRNT YLHWYLQKPGQSPQLLIYKVSNRFSGVPDRFSGSGSGTDFTLKISRVEAEDVGVYYC SQNTHVPPTFGQGTKLEIKRGGGGSGGGGSGGGGSQVQLVQSGAEVKKPGASVKVSC KASGYTFTDYEMHWVRQAPGQGLEWMGALDPKTGDTAYSQKFKGRVTLTADKSTSTA YMELSSLTSEDTAVYYCTRFYSYTYWGQGTLVTVSSTTTPAPRPPTPAPTIASQPLS LRPEACRPAAGGAVHTRGLDFACDIYIWAPLAGTCGVLLLSLVITLYCKRGRKKLLY IFKQPFMRPVQTTQEEDGCSCRFPEEEEGGCELRVKFSRSADAPAYQQGQNQLYNEL NLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNELQKDKMAEAYSEIGMKGERR RGKGHDGLYQGLSTATKDTYDALHMQALPPRGSGATNFSLLKQAGDVEENPGPMALL HSGRVLPGIAAAFHPGLAAAASARASSWWTHVEMGPPDPILGVTEAFKRDTNSKKMN LGVGAYRDDNGKPYVLPSVRKAEAQIAAKNLDKEYLPIGGLAEFCKASAELALGENS EVLKSGRFVTVQTISGTGALRIGASFLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQ LQGYRYYDPKTCGFDFTGAVEDISKIPEQSVLLLHACAHNPTGVDPRPEQWKEIATV VKKRNLFAFFDMAYQGFASGDGDKDAWAVRHFIEQGINVCLCQSYAKNMGLYGERVG AFTMVCKDADEAKRVESQLKILIRPMYSNPPLNGARIAAAILNTPDLRKQWLQEVKV MADRIIGMRTQLVSNLKKEGSTHNWQHITDQIGMFCFTGLKPEQVERLIKEFSIYMT KDGRISVAGVTSSNVGYLAHAIHQVTKGSGEGRGSLLTCGDVEENPGPMARFALTVV RHGETRFNKEKIIQGQGVDEPLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTM HGILERSKFCKDMTVKYDSRLRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGE TLDQVKMRGIDFFEFLCQLILKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKV NSDSGIPGLAASVLVVSHGAYMRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSL FIINFEEGREVKPTVQCICMNLQDHLNGLTETR Amino acid sequences of an exemplary anti-ROR1 scFv for constructing anti-ROR1 CAR constructs is SEQ ID NO: 93, exemplary anti-ROR1 CAR constructs comprising such scFv is provided by SEQ ID NO 94. Anti-ROR1 scFv (SEQ ID NO 93) DIVMTQSPLSQPVTPGEPASISCRSSQSLLHRYGYNSLHWYLQKPGQSPQLLIYLGS NRASGVPDRFSGSGSGTDFTLKVSRVEAEDVGVYYCMQALQTPYTFGQGTKLEIKGS TSGSGKPGSGEGSTKGQVQLQESGPGLVKPSGTLSLTCAVSGGSISSSNWWSWVRQP PGKGLEWLGEISHSGITNYNPSLKSRVTISVDKSKNHFSLKLNSVTAADTAVYYCTK KWELLAFDFWGQGTMVTVSS anti-ROR1 CAR (1730): anti-ROR scFv with CD8α signal sequence (italic) / anti- ROR1 scFv / IgG4 hinge/ CD28 transmembrane domain / 4-1BB Co-stimulatory domain / CD3ζ cytoplasmic tail (SEQ ID NO: 94 MALPVTALLLPLALLLHAARPDIVMTQSPLSQPVTPGEPASISCRSSQSLLHRYGYN SLHWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKVSRVEAEDVGVYYC 60 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) MQALQTPYTFGQGTKLEIKGSTSGSGKPGSGEGSTKGQVQLQESGPGLVKPSGTLSL TCAVSGGSISSSNWWSWVRQPPGKGLEWLGEISHSGITNYNPSLKSRVTISVDKSKN HFSLKLNSVTAADTAVYYCTKKWELLAFDFWGQGTMVTVSSESKYGPPCPPCPFWVL VVVGGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPE EEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHM QALPPR Exemplary anti-ROR1 CAR constructs comprising such scFv suitable for co-expression of metabolism modifying polypeptides GOT2 and/or TIGAR are provided by SEQ ID NOs: 95 to 97 (transient translation products prior to cleavage at ribosomal skipping sites P2A and T2A): Transient translation product of anti-ROR1 CAR co-expressing TIGAR (1767): 1730 CAR / GSG linker / P2A / TIGAR (SEQ ID NO: 95): MALPVTALLLPLALLLHAARPDIVMTQSPLSQPVTPGEPASISCRSSQSLLHRYGYN SLHWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKVSRVEAEDVGVYYC MQALQTPYTFGQGTKLEIKGSTSGSGKPGSGEGSTKGQVQLQESGPGLVKPSGTLSL TCAVSGGSISSSNWWSWVRQPPGKGLEWLGEISHSGITNYNPSLKSRVTISVDKSKN HFSLKLNSVTAADTAVYYCTKKWELLAFDFWGQGTMVTVSSESKYGPPCPPCPFWVL VVVGGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPE EEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHM QALPPRGSGATNFSLLKQAGDVEENPGPMARFALTVVRHGETRFNKEKIIQGQGVDE PLSETGFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGILERSKFCKDMTVKYDSR LRERKYGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLCQLI LKEADQKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGA YMRSLFDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICM NLQDHLNGLTETR Transient translation product of anti-ROR1 CAR co-expressing GOT2 (1768): 1730 CAR / GSG linker / P2A / GOT2 (SEQ ID NO: 96): MALPVTALLLPLALLLHAARPDIVMTQSPLSQPVTPGEPASISCRSSQSLLHRYGYN SLHWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKVSRVEAEDVGVYYC MQALQTPYTFGQGTKLEIKGSTSGSGKPGSGEGSTKGQVQLQESGPGLVKPSGTLSL TCAVSGGSISSSNWWSWVRQPPGKGLEWLGEISHSGITNYNPSLKSRVTISVDKSKN HFSLKLNSVTAADTAVYYCTKKWELLAFDFWGQGTMVTVSSESKYGPPCPPCPFWVL VVVGGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPE EEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHM QALPPRGSGATNFSLLKQAGDVEENPGPMALLHSGRVLPGIAAAFHPGLAAAASARA SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQ 61 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) IAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGAS FLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISK IPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKD AWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRP MYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNW QHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQV TK Transient translation product of anti-ROR1 CAR co-expressing GOT2 and TIGAR (1798): 1730 CAR / GSG linker / P2A / GOT2 / GSG linker / T2A / TIGAR (SEQ ID NO: 97): MALPVTALLLPLALLLHAARPDIVMTQSPLSQPVTPGEPASISCRSSQSLLHRYGYN SLHWYLQKPGQSPQLLIYLGSNRASGVPDRFSGSGSGTDFTLKVSRVEAEDVGVYYC MQALQTPYTFGQGTKLEIKGSTSGSGKPGSGEGSTKGQVQLQESGPGLVKPSGTLSL TCAVSGGSISSSNWWSWVRQPPGKGLEWLGEISHSGITNYNPSLKSRVTISVDKSKN HFSLKLNSVTAADTAVYYCTKKWELLAFDFWGQGTMVTVSSESKYGPPCPPCPFWVL VVVGGVLACYSLLVTVAFIIFWVKRGRKKLLYIFKQPFMRPVQTTQEEDGCSCRFPE EEEGGCELRVKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKP RRKNPQEGLYNELQKDKMAEAYSEIGMKGERRRGKGHDGLYQGLSTATKDTYDALHM QALPPRGSGATNFSLLKQAGDVEENPGPMALLHSGRVLPGIAAAFHPGLAAAASARA SSWWTHVEMGPPDPILGVTEAFKRDTNSKKMNLGVGAYRDDNGKPYVLPSVRKAEAQ IAAKNLDKEYLPIGGLAEFCKASAELALGENSEVLKSGRFVTVQTISGTGALRIGAS FLQRFFKFSRDVFLPKPTWGNHTPIFRDAGMQLQGYRYYDPKTCGFDFTGAVEDISK IPEQSVLLLHACAHNPTGVDPRPEQWKEIATVVKKRNLFAFFDMAYQGFASGDGDKD AWAVRHFIEQGINVCLCQSYAKNMGLYGERVGAFTMVCKDADEAKRVESQLKILIRP MYSNPPLNGARIAAAILNTPDLRKQWLQEVKVMADRIIGMRTQLVSNLKKEGSTHNW QHITDQIGMFCFTGLKPEQVERLIKEFSIYMTKDGRISVAGVTSSNVGYLAHAIHQV TKGSGEGRGSLLTCGDVEENPGPMARFALTVVRHGETRFNKEKIIQGQGVDEPLSET GFKQAAAAGIFLNNVKFTHAFSSDLMRTKQTMHGILERSKFCKDMTVKYDSRLRERK YGVVEGKALSELRAMAKAAREECPVFTPPGGETLDQVKMRGIDFFEFLCQLILKEAD QKEQFSQGSPSNCLETSLAEIFPLGKNHSSKVNSDSGIPGLAASVLVVSHGAYMRSL FDYFLTDLKCSLPATLSRSELMSVTPNTGMSLFIINFEEGREVKPTVQCICMNLQDH LNGLTETR III. NK Cells Expressing Polypeptides modulating metabolism and Optionally Chimeric Receptor Polypeptides Provided herein are genetically engineered NK cells that co-express at least one metabolism modulating polypeptides as described herein. In some embodiments, these metabolism modulating polypeptides of the present invention are encoded by transgenes introduced into the NK cells (e.g., exogenous to the NK cells). The genetically engineered NK cells further express a chimeric receptor polypeptide (i.e., ACTR-NK cells, or CAR-NK cells) as also described herein. In another preferred 62 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) embodiment, the chimeric receptor polypeptide is a CAR polypeptide that comprises components as shown in Table 11. In some other embodiments, the genetically engineered NK cells described herein can be derived from a cell line, e.g., selected from NK-92, NK-92MI, YTS, and KHYG-1, preferably NK-92 cells. In other embodiments, the genetically engineered NK cells described herein can be derived from peripheral blood mononuclear cells (PBMC), hematopoietic stem cells (HSCs), cord blood stem cells (CBSCs) or induced pluripotent stem cells (iPSCs). In other embodiments, the NK cell population described herein can be obtained from other sources, such asbone marrow, or tissues such as spleen, lymph node, thymus, or tumor tissue. In some embodiments, the starting population of NK cells is obtained from isolating mononuclear cells using ficoll-paque density gradient. In some embodiments, the method further comprises depleting the mononuclear cells of CD3, CD14, and/or CD19 cells to obtain the starting population of NK cells. In some embodiments, the method further comprises depleting the mononuclear cells CD3, CD14, and CD19 cells to obtain the starting population of NK cells. In a particular embodiment, depleting comprises performing magnetic sorting. In some instances, NK cells could be positively selected using sorting, magnetic bead selection or other methods to obtain the starting populations of NK cells. A source suitable for obtaining NK cells would be evident to one of skill in the art. In some examples, the NK cells can be a mixture of different types of T cells and/or NK cells as known in the art. For example, the NK cells can be isolated from a suitable donor (e.g., a human patient). In a preferred embodiment, the population of NK cells is derived from PBMCs, which may be obtained from the patient (e.g., a human patient) who is in need for the treatment described herein and who will be treated with the genetically engineered immune cells described herein (autologous approach). The NK cells desired may be expanded within the population of cells obtained by co-incubating the cells with stimulatory molecules. Additionally, NK cells are derived from cord blood stem cells or induced pluripotent stem cells (iPSCs) providing from “off-the shelf” source for immunotherapy (Li et al., Cell Stem Cell, 23(2): 181-192.e185 (2018); Liu et al., Leukemia, 32(2): 520-531 (2018); Morgan et al., Front Immunol, 11: 1965 (2020); Wrona, Borowiec et al., Int J Mol Sci, 22(11): (2021)). In particular embodiments, the starting population of NK cells is obtained from cord blood. In other embodiments, the cord blood has previously been frozen. In some embodiments, cells are derived from cell lines (e.g., NK-92 and Vγ9Vδ2 T cell). 63 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) In some embodiments, the genetically engineered NK cells may co-express any of the CAR constructs with at least two metabolism modulating polypeptides such as those disclosed herein. In some embodiments, the CAR construct may comprise a co-stimulatory domain from 4-1BB or CD28 and the metabolism modulating polypeptides. The CAR construct may further comprise a hinge and transmembrane domain from CD8 (e.g., CD8α) or CD28. In other embodiments, the genetically engineered NK cells may co-express any of the ACTR constructs with at least two metabolism modulating polypeptides such as those disclosed herein. In some embodiments, the ACTR construct may comprise a co-stimulatory domain from 4-1BB or CD28. The ACTR constructs may further comprise a hinge and transmembrane domain from CD8 or CD28. Alternatively, the genetically engineered immune cells disclosed herein may not express any chimeric receptor polypeptides. In some embodiments, the genetically engineered NK cells, which may express or overly express at least two metabolism modulating polypeptides as disclosed herein, may be derived from tumor-infiltrating lymphocytes (TILs). Expression or overexpression of the metabolism modulating polypeptide may enhance the anti-tumor activity or the TILs in the TME. In some embodiments, the genetically engineered NK cells, which may overly express at least one metabolic modulating polypeptide as disclosed herein, may be derived from tumor- infiltrating lymphocytes (TILs). Overexpression of the metabolic modulating polypeptide may enhance the anti-tumor activity or the TILs in tumor microenvironment. In further embodiments of the invention the genetically engineered NK cell comprises a nucleic acid or nucleic acid set, which collectively comprises a first nucleotide sequence encoding the at least one metabolism modulating polypeptide; and a second nucleotide sequence encoding the chimeric receptor polypeptide. In some instances, such metabolism modulating polypeptides are identical to an endogenous protein of the immune cell. Introducing additional copies of the coding sequences of such polypeptides into the NK cell would enhance the expression level of such polypeptide(s) (i.e., overly expressed) as relative to the native counterpart. In some instances, the at least one metabolism modulating polypeptide to be introduced into the NK cell are heterologous to the NK cell, i.e., do not exist or are not expressed (i.e., at a measurable level, e.g., by western/immuno blotting) in the NK cell. Such a heterologous metabolism modulating polypeptide described herein may be a naturally-occurring protein not expressed in the NK cell in nature (e.g., from a different species, 64 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) or from a different cell type of the same species). Alternatively, such heterologous metabolism modulating polypeptides may be a variant of a native protein, such as those described herein. In some examples, the exogenous (i.e., not native to the NK cells) copy of the coding nucleic acid may exist extra-chromosomally. In other examples, the exogenous copy of the coding sequence may be integrated into the chromosome of the NK cell, and may be located at a site that is different from the native locus of the endogenous gene. The genetically engineered NK cells, when expressing a chimeric receptor polypeptide as disclosed herein, can recognize and inhibit target cells, either directly (e.g., by CAR- NK cells) or via an Fc-containing therapeutic agents such as an anti-tumor antibody (e.g., by ACTR-NK cells). Given their expected high proliferation rate, bioactivity, and/or survival rate in low glucose, low amino acid, low pH, and/or hypoxic environments (e.g., in a TME), the genetically engineered NK cells would be expected to have higher therapeutic efficacy relative to chimeric receptor polypeptide NK cells that do not express or express a lower level or less active form of the metabolism modulating polypeptides. To construct the NK cells that express at least one metabolism modulating polypeptide and optionally the chimeric receptor polypeptide described herein, expression vectors may be created via conventional methods as described in the present invention and introduced into immune cells. For example, nucleic acids encoding at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides may be cloned into one or two suitable expression vectors, such as a viral vector or a non-viral vector in operable linkage to a suitable promoter. In some instances, each of the coding sequences for the chimeric receptor polypeptide and the at least one metabolism modulating polypeptide are on two separate nucleic acid molecules and can be cloned into two separate vectors, which may be introduced into NK cells simultaneously or sequentially. In other embodiments, the coding sequences for the chimeric receptor polypeptide and at least one metabolism modulating polypeptide are on one nucleic acid molecule and can be cloned into one vector. Accordingly, it is one embodiment that the NK cell comprises the nucleic acid, which comprises a first nucleotide sequence, and a second nucleotide sequence. The coding sequences of the chimeric receptor polypeptide and at least one metabolism modulating polypeptide may be in operable linkage to two distinct promoters such that the expression of the two polypeptides is controlled by different promoters. In some instances, the coding sequences of the chimeric receptor polypeptide and two separate metabolism 65 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) modulating polypeptides may be in operable linkage to two or three distinct promoters such that the expression of the three polypeptides is controlled by different promoters (i.e., in case of two metabolic modulating polypeptides) and so on. Alternatively, the coding sequences of the chimeric receptor polypeptide and three separate metabolism modulating polypeptides may be in operably linkage to one promoter such that the expression of the two polypeptides is controlled by a single promoter. Suitable sequences may be inserted between the coding sequences of the two or more metabolism modulating polypeptides so that two or more separate polypeptides can be translated from a single mRNA molecule. Such sequences, for example, IRES or ribosomal skipping site, are well known in the art. A variety of promoters can be used for expression of the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides described herein, including, without limitation, cytomegalovirus (CMV) intermediate early promoter, a viral LTR such as the Rous sarcoma virus LTR, HIV-LTR, HTLV-1 LTR, the simian virus 40 (SV40) early promoter, the human EF1-alpha promoter, or herpes simplex tk virus promoter. Additional promoters for expression of the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides include any constitutively active promoter in a NK cell. Alternatively, any regulatable/inducible promoter may be used, such that its expression can be modulated within a NK cell. Suitable induction systems are known in the art, see e.g., Kallunki et al. (Cells, 8(8): 796 (2019)). The NK cells described herein may comprise two metabolism modulating polypeptides selected from GOT2, GLUT1, LDHA, PDK1, TIGAR, CTH, ASS1 and PSPH. In further embodiments of the invention the genetically engineered NK cell comprises a nucleic acid or nucleic acid set, which collectively comprises a first nucleotide sequence encoding the first metabolism modulating polypeptide; a second nucleotide sequence encoding the second metabolism modulating polypeptide; and a third nucleotide sequence encoding the chimeric receptor polypeptide. In some instances, each of the coding sequences for the chimeric receptor polypeptide and at least one metabolism modulating polypeptides are on separate nucleic acid molecules and can be cloned into separate vectors, which may be introduced into NK cells simultaneously or sequentially. In some instances, each of the coding sequences for the chimeric receptor polypeptide and at least one metabolism modulating polypeptides are on separate nucleic acid molecules and can be cloned into one vector which may be introduced into NK cells. 66 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) In further embodiments the nucleic acid or nucleic acid set is comprised within one or more viral vectors. The nucleic acids and the vector(s) may be contacted, under suitable conditions, with a restriction enzyme to create complementary ends on each molecule that can pair with each other and be joined with a ligase. Alternatively, synthetic nucleic acid linkers can be ligated to the termini of the nucleic acid encoding at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides. The synthetic linkers may contain nucleic acid sequences that correspond to a particular restriction site in the vector. The selection of expression vectors/plasmids/viral vectors would depend on the NK cells for expression of the at least one metabolism modulating polypeptides described herein and/or the chimeric receptor polypeptides, but should be suitable for integration and replication in eukaryotic cells. An exemplary embodiment is a method of modifying the metabolism of NK cells, comprising transfecting immune cells transiently or stably with the vector or vector set and collecting immune cells transfected with the vector or vector set. Additionally, the vector may contain, for example, some or all of the following: a selectable marker gene, such as the neomycin gene or the kanamycin gene for selection of stable or transient transfectants in NK cells; enhancer/promoter sequences from the immediate early gene of human CMV for high levels of transcription; intron sequences from the human EF1-alpha gene, transcription termination and RNA processing signals from SV40 for mRNA stability; SV40 or polyomavirus origins of replication and ColE1 for proper episomal replication; internal ribosome binding sites (IRESs), versatile multiple cloning sites; T7 and SP6 RNA promoters for in vitro transcription of sense and antisense RNA; a “suicide switch” or “suicide gene” which when triggered causes cells carrying the vector to die (e.g., HSV thymidine kinase or an inducible caspase such as iCasp9), and reporter gene(s) for assessing expression of the metabolism modulating polypeptide and/or the chimeric receptor polypeptide. In one specific embodiment, such vectors also include a suicide gene. As used herein, the term “suicide gene” refers to a gene that causes the cell expressing the suicide gene to die. The suicide gene can be a gene (e.g., HSV thymidine kinase) that confers sensitivity to an agent, e.g., a drug (e.g., ganciclovir for HSV thymidine kinase), upon the cell in which the gene is expressed, and causes the cell to die when the cell is contacted with or exposed to the agent. Suicide genes are known in the art (see, for example, Springer, C. J. (Suicide Gene Therapy: Methods and Reviews, Humana Press (2004)) and include, for example, the Herpes Simplex 67 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Virus (HSV) thymidine kinase (TK) gene, cytosine deaminase, purine nucleoside phosphorylase, nitroreductase, and caspases such as caspase 8 or caspase-9 (iCasp9). Suitable vectors and methods for producing vectors containing transgenes are well known and available in the art. Examples of the preparation of vectors for expression of metabolism modulating polypeptides and/or chimeric receptor polypeptides can be found, for example, in US 2014/0106449, herein incorporated in its entirety by reference. Any of the vectors comprising a nucleic acid sequence that encodes the metabolism modulating polypeptides and/or a chimeric receptor polypeptide described herein is also within the scope of the present invention. Such a vector, or the sequence encoding such metabolism modulating polypeptides and/or a chimeric receptor polypeptide contained therein, may be delivered into immune cells such as immune cells by any suitable method. Methods of delivering vectors to immune cells are well known in the art and may include DNA electroporation, RNA electroporation, transfection using reagents such as liposomes, or viral transduction (e.g., retroviral transduction such as lentiviral or gamma-retroviral transduction). In some embodiments, the vectors for expression of the at least one metabolism modulating polypeptides and/or the chimeric receptor polypeptides are delivered to immune cells by viral transduction (e.g., retroviral transduction such as lentiviral or gamma-retroviral transduction). Exemplary viral methods for delivery include, but are not limited to, recombinant retroviruses (see, e.g., WO 90/07936; WO 94/03622; WO 93/25698; WO 93/25234; WO 93/11230; WO 93/10218; and WO 91/02805; US 5,219,740 and US 4,777,127; GB 2,200,651; and EP 0345242), alphavirus-based vectors, and adeno-associated virus (AAV) vectors (see, e.g., WO 94/12649, WO 93/03769; WO 93/19191; WO 94/28938; WO 95/11984; and WO 95/00655). In some embodiments, the vectors for expression of the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides are retroviruses. In a preferred embodiment, the vectors are lentiviruses. Examples of references describing retroviral transduction include US 5,399,346; Mann et al. (Cell, 33(1): 153-159 (1983)); US 4,650,764; US 4,980,289; Markowitz et al. (J Virol, 62(4): 1120-1124 (1988)); US 5,124,263; WO 95/07358 and Kuo et al. (Blood, 82(3): 845-852 (1993)). WO 95/07358 describes high efficiency transduction of primary B lymphocytes. See also WO 2016/040441A1, all incorporated by reference herein for the purpose and subject matter referenced herein. 68 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) In examples in which the vectors encoding at least one metabolism modulating polypeptides s and/or, the chimeric receptor polypeptides are introduced to the NK cells using a viral vector, viral particles that are capable of infecting the immune cells and carry the vector may be produced by any method known in the art and can be found, for example in WO 91/02805A2, WO 98/09271A1, and US 6,194,191. The viral particles are harvested from the cell culture supernatant and may be isolated and/or purified prior to contacting the viral particles with the immune cells. In some embodiments, RNA molecules encoding the at least one metabolism modulating polypeptides and/or the chimeric receptor polypeptides as described herein may be prepared by a conventional method (e.g., in vitro transcription) and then introduced into suitable immune cells, e.g., those described herein, via known methods, e.g., Rabinovich et al. (Human Gene Therapy, 17(10): 1027-1035 (2006)). The disclosure also relates to a nucleic acid of the present invention. In some instances, the nucleic acid encoding at least one metabolism modulating polypeptide and the nucleic acid encoding a suitable chimeric receptor polypeptide may be cloned into separate expression vectors, which may be introduced into suitable immune cells concurrently or sequentially. For example, an expression vector (or an RNA molecule) for expressing at least one metabolism modulating polypeptide may be introduced into NK cells first and the transfected NK cells expressing at least one metabolism modulating polypeptides may be isolated and cultured in vitro. In another example, an expression vector (or an RNA molecule) expressing a suitable chimeric receptor polypeptide can then introduced into the NK cells expressing at least one metabolism modulating polypeptide where both polypeptides can be isolated. In another example, expression vectors (or RNA molecules) each for expressing at least one metabolism modulating polypeptide and the chimeric receptor polypeptide can be introduced into NK cells simultaneously and transfected NK cells expressing both polypeptides can be isolated via routine methodology. In some instances, the nucleic acid(s) encoding at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptide may be delivered into NK cells via transposons (e.g., piggybac). In some instances, the encoding nucleic acid(s) may be delivered into NK cells via gene editing, for example, by CRISPR, TALEN, zinc-finger nuclease (ZFN), or meganucleases. In other instances, the nucleic acid encoding at least one metabolism modulating polypeptide and the nucleic acid encoding the chimeric receptor polypeptide may be cloned 69 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) into the same expression vector. Polynucleotides (including vectors in which such polynucleotides are operably linked to at least one regulatory element) for expression of the chimeric receptor polypeptide and at least one metabolism modulating polypeptide are also within the scope of the present disclosure. Non-limiting examples of useful vectors of the disclosure include viral vectors such as, e.g., retroviral vectors including gamma retroviral vectors and lentiviral vectors, and adeno-associated virus vectors (AAV vectors). In some instances, the nucleic acid described herein may comprise two coding sequences, one encoding a chimeric receptor polypeptide as described herein, and the other at least one encoding metabolism modulating polypeptide. The nucleic acid comprising the coding sequences described herein may be configured such that the coding sequences encoding the metabolism modulating polypeptides can be expressed as independent (and physically separate) polypeptides. To achieve this goal, the nucleic acid described herein may contain a third nucleotide sequence located between the coding sequences for the metabolism modulating polypeptide and the Chimeric receptor polypeptide. This third nucleotide sequence may, for example, encode a ribosomal skipping site. A ribosomal skipping site is a sequence that impairs normal peptide bond formation. This mechanism results in the translation of additional open reading frames from one messenger RNA. This third nucleotide sequence may, for example, encode a P2A, T2A, or F2A peptide (see, for example, Kim, Lee et al. (PLoS One, 6(4): e18556 (2011)). See Table 13 below. Table 13. Exemplary Ribosomal Skipping Peptides Ribosomal Skipping Site Sequence SEQ ID NO
In another embodiment, the third nucleotide sequence may encode an internal ribosome entry site (IRES). An IRES is an RNA element that allows translation initiation in an end- independent manner, also permitting the translation of additional open reading frames from one messenger RNA. Alternatively, the third nucleotide sequence may encode a promoter controlling the expression of the first polypeptide and/or the second polypeptide. The third nucleotide sequence may also encode more than one ribosomal skipping sequence, IRES 70 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) sequence, additional promoter sequence, or a combination thereof. An exemplar IRES sequence is provided as SEQ ID NO: 91. Exemplary IRES Sequence (SEQ ID NO: 91) GAGGGCCCGGAAACCTGGCCCTGTCTTCTTGACGAGCATTCCTAGGGGTCTTTCCCC TCTCGCCAAAGGAATGCAAGGTCTGTTGAATGTCGTGAAGGAAGCAGTTCCTCTGGA AGCTTCTTGAAGACAAACAACGTCTGTAGCGACCCTTTGCAGGCAGCGGAACCCCCC ACCTGGCGACAGGTGCCTCTGCGGCCAAAAGCCACGTGTATAAGATACACCTGCAAA GGCGGCACAACCCCAGTGCCACGTTGTGAGTTGGATAGTTGTGGAAAGAGTCAAATG GCTCTCCTCAAGCGTATTCAACAAGGGGCTGAAGGATGCCCAGAAGGTACCCCATTG TATGGGATCTGATCTGGGGCCTCGGTGCACATGCTTTACATGTGTTTAGTCGAGGTT AAAAAAACGTCTAGGCCCCCCGAACCACGGGGACGTGGTTTTCCTTTGAAAAACACG ATGATAA The nucleic acid may also include additional coding sequences (including, but not limited to, third coding sequences) encoding further metabolism modulating polypeptides and may be configured such that the polypeptides encoded by the additional coding sequences are expressed as further independent and physically separate polypeptides. To this end, the additional coding sequences may be separated from other coding sequences for a polypeptide by one or more nucleotide sequences encoding one or more ribosomal skipping sequences, IRES sequences, or additional promoter sequences. In some examples, the nucleic acid (e.g., an expression vector or an RNA molecule as described herein) may comprise coding sequences for at least one metabolism modulating polypeptide and a suitable chimeric receptor polypeptide, the coding sequences (for example, two), in any order, being separated by a third nucleotide sequence coding for a P2A peptide (e.g., SEQ ID NO: 74). As a result, two separate polypeptides, at least the one metabolism modulating polypeptide and the chimeric receptor, can be produced from such a nucleic acid, wherein at least one P2A portion (e.g., SEQ ID NO: 74) is linked to the upstream polypeptide (encoded by the upstream coding sequence) and residue P from the P2A peptide is linked to the downstream polypeptide (encoded by the downstream coding sequence). In some examples, the chimeric receptor polypeptide is the upstream one and the at least one metabolism modulating polypeptide is the downstream one. In other examples, the at least one metabolism modulating polypeptide is the upstream one and the chimeric receptor polypeptide is the downstream one. In some embodiments, the nucleic acid (e.g., an expression vector or an RNA molecule as described herein) may comprise coding sequences of at least one metabolism modulating 71 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) polypeptides (e.g., those described herein) and a suitable ACTR or CAR polypeptide, the coding sequences, in any order, being separated by an additional nucleotide sequence coding for a P2A peptide (e.g., SEQ ID NO: 74). As a result, at least two separate polypeptides, the metabolism modulating polypeptide and the ACTR or CAR) can be produced from such a nucleic acid, wherein the P2A portion (e.g., SEQ ID NO: 74 is linked to the upstream polypeptide (encoded by the upstream coding sequence) and residue P from the P2A peptide is linked to the downstream polypeptide (encoded by the downstream coding sequence). In some embodiments, the ACTR or CAR polypeptide is the upstream one and the two metabolism modulating polypeptides are the downstream one. In other embodiments, the two metabolism modulating polypeptides are the upstream one and the ACTR or CAR polypeptide is the downstream one. In some examples, the nucleic acid described above may further encode a linker (e.g., a GSG linker) between two segments of the encoded sequences, for example, between the upstream polypeptide and the P2A peptide. Specific embodiments relate to a vector or vector set comprising the nucleic acid or nucleic acid set. In some embodiments, the vector or vector set is comprised within a viral vector wherein the viral vector is lentiviral or retroviral. The method of producing viral particles using the viral vector comprising the nucleic acid or nucleic acid are well known in the art and have been described below. Specific embodiments relate to a method of producing viral particles, wherein (a) providing host cells stably transfected with the nucleic acid or nucleic acid set of or the vector or vector set; (b) growing the stably transfected host cells in a cell culture medium under conditions allowing for producing viral particles by the host cells; and (c) harvesting the viral particles from the cell culture medium. Some embodiments relate to the viral particle produced. Exemplary embodiments relates to a method of producing a NK cell that expresses the metabolism modulating polypeptide and the chimeric receptor polypeptide, comprising incubating NK cells with the viral particle under conditions allowing for infection of immune cells by the viral particle. In preferred embodiment, a NK cell is prodced by the method described herein. In a preferred embodiment, the NK cell expresses at least one metabolism modulating polypeptide (e.g., any of SEQ ID Nos: SEQ ID NO: 75 – SEQ ID NO: 82), and/or the chimeric receptor polypeptide. 72 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Following introduction into the NK cells a vector encoding at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides provided herein, or the nucleic acid encoding the chimeric receptor polypeptide and/or metabolism modulating polypeptide, the NK cells may be cultured under conditions that allow for expression of the polypeptide and/or the chimeric receptor polypeptide (e.g., under a regulatable promoter, the immune cells may be cultured in conditions wherein the regulatable promoter is activated). In some embodiments, the promoter is an inducible promoter and the NK cells are cultured in the presence of the inducing molecule or in conditions in which the inducing molecule is produced. Determining whether the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptide is expressed will be evident to one of skill in the art and may be assessed by any known method, for example, mRNA by quantitative reverse transcriptase PCR (qRT- PCR) or protein by methods including Western/immuno blotting, fluorescence microscopy, and flow cytometry. Alternatively, expression of the chimeric receptor polypeptide may take place in vivo after the NK cells are administered to a subject. As used herein, the term “subject” refers to any mammal such as a human, monkey, mouse, rabbit, or domestic mammal. For example, the subject may be a primate. In a preferred embodiment, the subject is human. Alternatively, expression of at least one metabolism modulating polypeptide, and/or a chimeric receptor polypeptide in the NK cells disclosed herein can be achieved by introducing RNA molecules. Such RNA molecules can be prepared by in vitro transcription or by chemical synthesis. The RNA molecules can then be introduced into the NK cells by, e.g., electroporation. For example, RNA molecules can be synthesized and introduced into the NK cells following the methods described in Rabinovich, Komarovskaya et al. (Human Gene Therapy, 17(10): 1027-1035 (2006)) and WO 2013/040557. In certain embodiments, a vector(s) or RNA molecule(s) comprising at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptide may be introduced to the NK cells in vivo. As a non-limiting example, this may be accomplished by administering a vector or RNA molecule described herein directly to the subject (e.g., through intravenous administration). An exemplary embodiment is a method of modifying the metabolism of NK cells, comprising transfecting NK cells transiently or stably with the vector or vector set and collecting NK cells transfected with the vector or vector set. In some other embodiments, the method for generating modified NK cells in vivo comprises administering to 73 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) a subject in need thereof the nucleic acid or nucleic acid set, the vector or vector set, or the viral particles described herein. A preferred embodiment is a population of genetically engineered NK cells for use in inhibiting cells expressing a target antigen in a subject. In other embodiments, the population of genetically engineered NK cells for use, wherein at least some of the cells expressing the target antigen are located in a low-glucose environment. Methods for preparing NK cells expressing at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides described herein may also comprise activating the NK cells ex vivo. Activating the NK cell means stimulating a NK cell into an activated state in which the NK cell may be able to perform effector functions. In exemplary embodiment, the NK cells are activated ex vivo in the presence of one or more molecules such as a 4-1BB ligand, an anti-4-1BB antibody, IL-2, IL-15, an anti-IL-15 receptor antibody, IL12, IL-21, K562 cells, and/or engineered artificial stimulatory cells or particles. In some embodiments, the NK cells of the present invention and described herein are activated ex vivo prior to administration to a subject. Determining whether the NK cell is activated will be evident to one of skill in the art and may include assessing expression of one or more cell surface markers associated with NK cell activation, expression or secretion of cytokines, and morphology. Expanding NK cells may involve any method that results in an increase in the number of NK cells expressing metabolism modulating polypeptides and/or chimeric receptor polypeptides, for example, allowing the NK cells to proliferate or stimulating the NK cells to proliferate. Methods for stimulating expansion of NK cells will be evident to one of skill in the art. In some embodiments, the NK cells expressing at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptides are activated, expanded or both ex vivo prior to administration of the cells to the subject. NK cell activation and expansion may be used to allow integration of a viral vector into the genome and expression of the gene encoding the at least one metabolism modulating polypeptide and/or the chimeric receptor polypeptide as described herein. If mRNA electroporation is used, no activation and/or expansion may be required, although electroporation may be more effective when performed on activated NK cells. In some instances, the at least one metabolism modulating polypeptide and/or a chimeric receptor polypeptide is transiently expressed in the NK cell (e.g., for 3-5 days). Transient expression may be advantageous if there is a potential toxicity and should be helpful in initial phases of clinical testing for possible side effects. 74 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Any of the NK cells of the present invention may be mixed preferably, with a pharmaceutically acceptable carrier to form a pharmaceutical composition, which is also within the scope of the present disclosure. Therefore, a pharmaceutical composition, comprising a genetically engineered immune cell of the invention is another embodiment. The phrase “pharmaceutically acceptable”, as used in connection with compositions of the present disclosure, refers to molecular entities and other ingredients of such compositions that are physiologically tolerable and do not typically produce untoward reactions when administered to a mammal (e.g., a human). Preferably, as used herein, the term “pharmaceutically acceptable” means approved by a regulatory agency of the Federal or a state government or listed in the U.S. Pharmacopeia or other generally recognized pharmacopeia for use in mammals, and more particularly in humans. “Acceptable” means that the carrier is compatible with the active ingredient of the composition (e.g., the nucleic acids, vectors, cells, or therapeutic antibodies) and does not negatively affect the subject to which the composition(s) are administered. Any of the pharmaceutical compositions to be used in the present methods can comprise pharmaceutically acceptable carriers, excipients, or stabilizers in the form of lyophilized formations or aqueous solutions. Pharmaceutically acceptable carriers, including buffers, are well known in the art, and may comprise phosphate, citrate, and other organic acids; antioxidants including ascorbic acid and methionine; preservatives; low molecular weight polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; amino acids; hydrophobic polymers; monosaccharides; disaccharides; and other carbohydrates; metal complexes; and/or non-ionic surfactants. See, e.g. Remington: The Science and Practice of Pharmacy 20th Ed. (2000) Lippincott Williams and Wilkins, Ed. K. E. Hoover. The pharmaceutical compositions of the disclosure may also contain one or more additional active compounds as necessary for the particular indication being treated, preferably those with complementary activities that do not adversely affect each other. Non-limiting examples of possible additional active compounds include, e.g., IL-2 as well as various agents known in the field and listed in the discussion of combination treatments, below. IV. Immunotherapy Using the Genetically Engineered NK Cells Described Herein The genetically engineered NK cells disclosed herein may be used in immunotherapy against various disorders, for example, cancer, infectious diseases, and autoimmune diseases. 75 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Accordingly, another embodiment of the present invention is a method for inhibiting/and or killing cells expressing a target antigen in a subject, the method comprising administering to a subject in need thereof a population of the genetically engineered NK cells set forth herein or a pharmaceutical composition comprising a population of the genetically engineered NK cells set forth herein. A. Combined Immunotherapy of Genetically Engineered NK Cells Expressing ACTR Polypeptides and Fc-Containing Therapeutic Agents The exemplary ACTR polypeptides of the present disclosure enhance antibody- dependent cell cytotoxicity (ADCC) in NK cells. The degree of affinity of CD16 for the Fc portion of Ig is a critical determinant of ADCC and thus to clinical responses to antibody immunotherapy. The CD16 with the V158 polymorphism which has a higher binding affinity for Ig and mediates superior ADCC relative to CD16 with the F158 polymorphism was selected as an example. Although the F158 receptor has lower potency than the V158 receptor in induction of T cell proliferation and ADCC, the F158 receptor may have lower in vivo toxicity than the V158 receptor making it useful in some clinical contexts. At least one metabolism modulating polypeptide co-expressed with an ACTR polypeptide in NK cells would facilitate NK-cell therapy by allowing the cells to grow and/or function effectively in a low glucose, low amino acid, low pH, and/or hypoxic environment. Antibody-directed cytotoxicity could be stopped whenever required by simple withdrawal of antibody administration. Clinical safety can be further enhanced by using mRNA electroporation to express at least one metabolism modulating polypeptide and/or the ACTR polypeptides transiently, to limit any potential autoimmune reactivity. Thus, in one embodiment, the disclosure provides a method for enhancing efficacy of an antibody-based immunotherapy of a cancer in a subject in need thereof, which subject is being treated with an Fc-containing therapeutic agent such as a therapeutic antibody, which can bind to antigen-expressing cells. The Fc-containing therapeutic agent contains an Fc portion, for example, a human or humanized Fc portion, which can be recognized and bound by the Fc-binding portion (e.g., the extracellular domain of human CD16A) of the ACTR expressed on the engineered immune cells. Exemplary ACTR constructs are provided in Table 10 above. 76 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) The methods described herein may comprise introducing into the subject a therapeutically effective amount an antibody and a therapeutically effective amount of the genetically engineered NK cells, of the present invention. The subject (e.g., a human patient such as a human cancer patient) has been treated or is being treating with an Fc-containing therapeutic agent specific to a target antigen. A target antigen may be any molecule that is associated with a disease or condition, including, but are not limited to, tumor antigens, pathogenic antigens (e.g., bacterial, fungal or viral), or antigens present on diseased cells, such as those described herein. In the context of the present disclosure insofar as it relates to any of the disease conditions recited herein, the terms “treat”, “treatment”, and the like mean to relieve or alleviate at least one symptom associated with such condition, or to slow or reverse the progression of such condition. Within the meaning of the present disclosure, the term “treat” also denotes to arrest, delay the onset (i.e., the period prior to clinical manifestation of a disease) and/or reduce the risk of developing or worsening a disease. For example, in connection with cancer the term “treat” may mean eliminate or reduce a patient’s tumor burden, or prevent, delay or inhibit metastasis, etc. As used herein the term “therapeutically effective” applied to dose or amount refers to that quantity of a compound or pharmaceutical composition that is sufficient to result in a desired activity upon administration to a subject in need thereof. Note that when a combination of active ingredients is administered (e.g., a first pharmaceutical composition comprising an antibody, and a second pharmaceutical composition comprising a population of the genetically modified NK cells that express at least one metabolism modulating polypeptide and/or an antibody-coupled T-cell receptor (ACTR) construct, the effective amount of the combination may or may not include amounts of each ingredient that would have been effective if administered individually. Within the context of the present disclosure, the term “therapeutically effective” refers to that quantity of a compound or pharmaceutical composition that is sufficient to delay the manifestation, arrest the progression, relieve or alleviate at least one symptom of a disorder treated by the methods of the present disclosure. NK cells expressing at least one metabolism modulating polypeptides and an ACTR polypeptides described herein are useful for enhancing ADCC in a subject, for enhancing the efficacy of an antibody-based immunotherapy and/or for enhancing growth and/or proliferation of the genetically engineered NK cells in a low-glucose environment. In some embodiments, 77 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) the subject is a mammal, such as a human, monkey, mouse, rabbit, or domestic mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a human cancer patient. In some embodiments, the subject has been treated or is being treated with any of the therapeutic antibodies described herein. To practice the method described herein, an effective amount of the NK cells, described herein and an effective amount of an antibody, or compositions thereof may be administered to a subject in need of the treatment via a suitable route, such as intravenous administration. As used herein, an effective amount refers to the amount of the respective agent (e.g., the genetically engineered NK cells of the present invention and the ACTR polypeptide, antibodies, or compositions thereof) that upon administration confers a therapeutic effect on the subject. Determination of whether an amount of the cells or compositions described herein achieved the therapeutic effect would be evident to one of skill in the art. Effective amounts vary, as recognized by those skilled in the art, depending on the particular condition being treated, the severity of the condition, the individual patient parameters including age, physical condition, size, gender, sex, and weight, the duration of the treatment, the nature of concurrent therapy (if any), the specific route of administration and like factors within the knowledge and expertise of the health practitioner. In some embodiments, the effective amount alleviates, relieves, ameliorates, improves, reduces the symptoms, or delays the progression of any disease or disorder in the subject. In some embodiments, the subject in need of treatment is a human. In some embodiments, the subject in need of treatment is a human cancer patient. In some embodiments, the subject in need of treatment suffers from one or more pathogenic infections (e.g., viral, bacterial, and/or fungal infections). In some embodiments, the genetically engineered NK cells described herein are administered to a subject in an amount effective in enhancing ADCC activity by least 20% and/or by at least 2-fold, e.g., enhancing ADCC by 50%, 80%, 100%, 2-fold, 5-fold, 10-fold, 20-fold, 50-fold, 100-fold, or more. The NK cells are co-administered with an Fc-containing therapeutic agent such as a therapeutic antibody in order to target cells expressing the antigen to which the Fc-containing therapeutic agent binds. In some embodiments, more than one Fc- containing therapeutic agents, such as more than one antibody can be co-used with the immune cells. Antibody-based treatment may therefore, improve the overall health status of the patient in need receiving the treatment. An antibody (interchangeably used in plural form) is 78 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) an immunoglobulin molecule capable of specific binding to a target, such as a carbohydrate, polynucleotide, lipid, polypeptide, etc., through at least one antigen recognition site, located in the variable region of the immunoglobulin molecule. As used herein, the term “antibody” encompasses not only intact (i.e., full-length) polyclonal or monoclonal antibodies, but also antigen-binding fragments thereof which comprise an Fc region, mutants thereof, fusion proteins comprising an antibody portion, humanized antibodies, chimeric antibodies, diabodies, single domain antibodies (e.g., nanobodies), linear antibodies, multispecific antibodies (e.g., bispecific antibodies) and any other modified configuration of the immunoglobulin molecule that comprises an antigen recognition site of the required specificity and an Fc region, including glycosylation variants of antibodies, amino acid sequence variants of antibodies, and covalently modified antibodies. An antibody includes an antibody of any class, such as IgD, IgE, IgG, IgA, or IgM (or sub-class thereof), and the antibody need not be of any particular class. Depending on the antibody amino acid sequence of the constant domain of its heavy chains, immunoglobulins can be assigned to different classes. There are five major classes of immunoglobulins: IgA, IgD, IgE, IgG, and IgM, and several of these may be further divided into subclasses (isotypes), e.g., IgG1, IgG2, IgG3, IgG4, IgA1 and IgA2. The heavy- chain constant domains that correspond to the different classes of immunoglobulins are called alpha, delta, epsilon, gamma, and mu, respectively. The subunit structures and three- dimensional configurations of different classes of immunoglobulins are well known. The antibody for use in the present disclosure contains an Fc region recognizable by the co-used ACTR- NK cells. The Fc region may be a human or humanized Fc region. Any of the antibodies described herein can be either monoclonal or polyclonal. A “monoclonal antibody” refers to a homogenous antibody population and a “polyclonal antibody” refers to a heterogeneous antibody population. These two terms do not limit the source of an antibody or the manner in which it is made. In some embodiments, the antibodies described herein specifically bind to the corresponding target antigen or an epitope thereof. An antibody that “specifically binds” to an antigen or an epitope is a term well understood in the art. A molecule is said to exhibit “specific binding” if it reacts more frequently, more rapidly, with greater duration and/or with greater affinity with a particular target antigen than it does with alternative targets. An antibody “specifically binds” to a target antigen or epitope if it binds with greater affinity, avidity, more readily, and/or with greater duration than it binds to other substances. For example, an antibody 79 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) that specifically (or preferentially) binds to an antigen or an antigenic epitope therein is an antibody that binds this target antigen with greater affinity, avidity, more readily, and/or with greater duration than it binds to other antigens or other epitopes in the same antigen. It is also understood with this definition that, for example, an antibody that specifically binds to a first target antigen may or may not specifically or preferentially bind to a second target antigen. As such, “specific binding” or “preferential binding” does not necessarily require (although it can include) exclusive binding. In some examples, an antibody that “specifically binds” to a target antigen or an epitope thereof may not bind to other antigens or other epitopes in the same antigen. In some embodiments, an antibody as described herein has a suitable binding affinity for the target antigen (e.g., any one of the targets described herein) or antigenic epitopes thereof. The antibodies for use in the immune therapy methods described herein may bind to (e.g., specifically bind to) a target antigen of interest, or a specific region or an antigenic epitope therein. Table 4 above lists exemplary target antigens of interest and exemplary antibodies specific to such. The methods of the disclosure may be used for treatment of any cancer have been described herein. The methods of this disclosure may also be used for treating infectious diseases, which may be caused by bacterial infection, viral infection, or fungus infection. In such instances, the genetically engineered immune cells can be co-used with an Fc-containing therapeutic agent (e.g., an antibody) that targets a pathogenic antigen (e.g., an antigen associated with the bacterium, virus, or fungus that causes the infection). B. Immunotherapy of Genetically Engineered NK Cells Expressing CAR Polypeptides The genetically engineered NK cells described herein, co-expressing at least one metabolism modulating polypeptide and a CAR polypeptide can be used in NK-cell therapy for inhibiting and/or killing diseased cells expressing an antigen to which the CAR polypeptide targets, directly or indirectly (e.g., via a therapeutic agent conjugated to a tag to which the CAR polypeptide binds). Their co-expression with a CAR polypeptide in NK cells would facilitate the cell-based immune therapy by allowing the cells to grow and/or function effectively in a low glucose, low amino acid, low pH, and/or a hypoxic environment, for example, in a tumor microenvironment. Clinical safety may be further enhanced by using mRNA electroporation to express the at least one metabolism modulating polypeptide from above and/or the CAR polypeptides transiently, to limit any potential non-tumor specific reactivity. 80 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) The methods described herein may comprise introducing into the subject a therapeutically effective amount of genetically engineered NK cells which co-express the at least one metabolism modulating polypeptide and a CAR polypeptide of the disclosure (see exemplary examples in Table 11). The subject (e.g., a human patient) may additionally have been treated or is being treated with an anti-cancer or anti-infection therapy including, but not limited to, an anti-cancer therapeutic agent or anti-infection agent. NK cells (e.g., T and NK cells) expressing at least one metabolism modulating polypeptides and a CAR polypeptide described herein are useful for inhibiting cells expressing a target antigen and/or for enhancing growth and/or proliferation of immune cells in a low- glucose environment, a low amino acid environment, a low pH environment, and/or a hypoxic environment, for example, in a tumor microenvironment. In some embodiments, the subject is a mammal, such as a human, monkey, mouse, rabbit, or domestic mammal. In some embodiments, the subject is a human. In some embodiments, the subject is a human cancer patient. In some embodiments, the subject is a human patient suffering from an infectious disease. To practice the method described herein, an effective amount of the genetically engineered NK cells described herein, or compositions thereof may be administered to a subject in need of the treatment via a suitable route, such as intravenous, subcutaneous and intradermal administration, preferably intravenous. As used herein, an effective amount refers to the amount of the respective agent (i.e., the NK and/or T cells expressing metabolism modulating polypeptide CAR polypeptides, or compositions thereof) that upon administration confers a therapeutic effect on the subject. Determination of whether an amount of the cells or compositions described herein achieved the therapeutic effect would be evident to one of skill in the art. Effective amounts vary, as recognized by those skilled in the art and have been described herein. The methods of the disclosure may be used for treatment of any cancer or any pathogen. Specific non-limiting examples of cancers which can be treated by the methods of the disclosure include, for example, lymphoma, breast cancer, gastric cancer, neuroblastoma, osteosarcoma, lung cancer, skin cancer, prostate cancer, colorectal cancer, renal cell carcinoma, ovarian cancer, rhabdomyosarcoma, leukemia, mesothelioma, pancreatic cancer, head and neck cancer, retinoblastoma, glioma, glioblastoma, thyroid cancer, hepatocellular cancer, esophageal cancer, and cervical cancer. In certain embodiments, the cancer may be a solid 81 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) tumor. In certain embodiments, the cancer may be a liquid tumor. Accordingly, a preferred embodiment is a method for inhibiting cells expressing a target antigen in a subject, wherein the subject is a human patient suffering from a cancer and the target antigen is a tumor antigen; wherein the cancer is selected from the group consisting of carcinoma, lymphoma, sarcoma, blastoma, and leukemia, preferably wherein the cancer is selected from the group consisting of a cancer of B-cell origin, breast cancer, gastric cancer, neuroblastoma, osteosarcoma, lung cancer, skin cancer, prostate cancer, colon cancer, renal cell carcinoma, ovarian cancer, rhabdomyosarcoma, leukemia, mesothelioma, pancreatic cancer, head and neck cancer, retinoblastoma, glioma, glioblastoma, liver cancer, and thyroid cancer; or the cancer of B-cell origin is selected from the group consisting of B-lineage acute lymphoblastic leukemia, B-cell chronic lymphocytic leukemia, and B-cell non-Hodgkin’s lymphoma. The methods of this disclosure may also be used for treating infectious diseases, which may be caused by bacterial infection, viral infection, or fungal infection. In such instances, genetically engineered NK cells expressing a CAR polypeptide specific to a pathogenic antigen, (e.g., an antigen associated with the bacterium, virus, or fungus that causes the infection) can be used to eliminate infected cells. Specific non-limiting examples of pathogenic antigens include, but are not limited to, bacterial, viral, and/or fungal antigens. In some embodiments, the NK cells are administered to a subject in an amount effective in inhibiting cells expressing the target antigen by least 20% and/or by at least 2-fold, e.g., inhibiting cells expressing the target antigen by 50%, 80%, 100%, 2-fold, 5-fold, 10-fold, 20- fold, 50-fold, 100-fold, or more. Additional therapeutic agents (e.g., antibody-based immunotherapeutic agents) may be used to treat, alleviate, or reduce the symptoms of any disease or disorder for which the therapeutic agent is considered useful in a subject. The efficacy of the cell-based immunotherapy as described herein may be assessed by any method known in the art and would be evident to a skilled medical professional. For example, the efficacy of cell-based immunotherapy may be assessed by survival of the subject or tumor or cancer burden in the subject or tissue or sample thereof. In some embodiments, the NK cells are administered to a subject in need of the treatment in an amount effective in enhancing the efficacy of an cell- based immunotherapy by at least 20% and/or by at least 2-fold, e.g., enhancing the efficacy of an antibody-based immunotherapy by 50%, 80%, 100%, 2-fold, 5-fold, 10-fold, 20-fold, 50- fold, 100-fold or more, as compared to the efficacy in the absence of the immune cells 82 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) expressing at least one metabolism modulating polypeptide and/or the CAR polypeptide. In any of the compositions or methods described herein, the NK cells may be autologous to the subject, i.e., the NK cells may be obtained from the subject in need of the treatment, genetically engineered for expression of at least one metabolism modulating polypeptide described herein and/or the CAR polypeptides, and then administered to the same subject. In one specific embodiment, prior to re-introduction into the subject, the autologous NK cells are activated and/or expanded ex vivo. Administration of autologous cells to a subject may result in reduced rejection of the immune cells as compared to administration of non- autologous cells. Alternatively, the NK cells are allogeneic cells, i.e., the cells are obtained from a first subject, genetically engineered for expression of at least one metabolism modulating polypeptide described herein and/or the CAR polypeptide and administered to a second subject that is different from the first subject but of the same species. For example, allogeneic NK cells may be derived from a human donor and administered to a human recipient who is different from the donor. NK cells can be activated by any method known in the art, e.g., in the presence of one or more agents selected from the group consisting of CD137 ligand protein, CD137 antibody, IL-15, IL-15 receptor antibody, IL-2, IL-12, IL-21, and cells from the K562 cell line, and/or engineered artificial stimulatory cells or particles. See, e.g., US 7,435,596 and US 8,026,097 for the description of useful methods for expanding NK cells. For example, NK cells used in the compositions or methods of the disclosure may be preferentially expanded by exposure to cells that lack or poorly express major histocompatibility complex I and/or II molecules and which have been genetically modified to express membrane bound IL-15 and 4-1BB ligand (CD137L). Such cell lines include, but are not necessarily limited to, K562 [ATCC, CCL 243; (Lozzio and Lozzio, Blood, 45(3): 321-334 (1975); Klein et al., Int J Cancer, 18(4): 421-431 (1976))], and the Wilms tumor cell line HFWT (Fehniger and Caligiuri, Int Rev Immunol, 20(3- 4): 503-534 (2001); Harada et al., Exp Hematol, 32(7): 614-621 (2004)), the uterine endometrium tumor cell line HHUA, the melanoma cell line HMV-II, the hepatoblastoma cell line HuH-6, the lung small cell carcinoma cell lines Lu-130 and Lu-134-A, the neuroblastoma cell lines NB19 and N1369, the embryonal carcinoma cell line from testis NEC 14, the cervix carcinoma cell line TCO-2, and the bone marrow-metastasized neuroblastoma cell line TNB 1 (Harada et al., Jpn J Cancer Res, 93(3): 313-319 (2002)). Preferably the cell line used lacks 83 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) or poorly expresses both MHC I and II molecules, such as the K562 and HFWT cell lines. A solid support may be used instead of a cell line. Such support should preferably have attached on its surface at least one molecule capable of binding to NK cells and inducing a primary activation event and/or a proliferative response or capable of binding a molecule having such an affect thereby acting as a scaffold. The support may have attached to its surface the CD137 ligand protein, a CD137 antibody, the IL-15 protein or an IL-15 receptor antibody. Preferably, the support will have IL-15 receptor antibody and CD137 antibody bound on its surface. In one embodiment of the described compositions or methods, introduction (or re- introduction) of NK cells to the subject is followed by administering to the subject a therapeutically effective amount of IL-2. In additional aspects, the method further comprises cryopreserving the population of engineered NK cells. Further provided herein is a genetically engineered NK cells are cryopreserved. In accordance with the present disclosure, patients can be treated by infusing therapeutically effective doses of NK cells comprising at least one metabolism modulating polypeptide and/or a CAR polypeptide of the disclosure in the range of about 105 to 1010 or more cells per kilogram of body weight (cells/Kg). The infusion can be repeated as often and as many times as the patient can tolerate until the desired response is achieved. The appropriate infusion dose and schedule will vary from patient to patient, but can be determined by the treating physician for a particular patient. Typically, initial doses of approximately 106 cells/kg will be infused, escalating to 108 or more cells/kg. IL-2 can be co-administered to expand infused cells. The amount of IL-2 can be about 1-5 x 106 international units per square meter of body surface. The term “about” or “approximately” means within an acceptable error range for the particular value as determined by one of ordinary skill in the art, which will depend in part on how the value is measured or determined, i.e., the limitations of the measurement system. For example, “about” can mean within an acceptable standard deviation, per the practice in the art. Alternatively, “about” can mean a range of up to ±20%, preferably up to ±10%, more preferably up to ±5%, and more preferably still up to ±1% of a given value. Alternatively, particularly with respect to biological systems or processes, the term can mean within an order of magnitude, preferably within 2-fold, of a value. Where particular values are described in the application and claims, unless otherwise stated, the term “about” is implicit and in this context means within an acceptable error range for the particular value. 84 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) The efficacy of the compositions or methods described herein may be assessed by any method known in the art and would be evident to a skilled medical professional. For example, the efficacy of the compositions or methods described herein may be assessed by survival of the subject or cancer or pathogen burden in the subject or tissue or sample thereof. In some embodiments, the compositions and methods described herein may be assessed based on the safety or toxicity of the therapy (e.g., administration of the immune cells expressing the metabolism modulating polypeptides that redirect glucose metabolites and the CAR polypeptides) in the subject, for example, by the overall health of the subject and/or the presence of adverse events or severe adverse events. C. Other Immunotherapies Some embodiments provide for a composition comprising an effective amount of the engineered NK cells of the embodiments for use in the treatment of a disease or disorder in a subject. Also provided herein is the use of a composition comprising an effective amount of the engineered NK cells of the embodiments for the treatment of an immune-related disorder in a subject. A further embodiment provides for a method of treating an immune-related disorder in a subject comprising administering an effective amount of engineered NK cells of the embodiments to the subject. In exemplary embodiments, the method does not comprise performing HLA matching. In particular embodiments, the NK cells are KIR-ligand mismatched between the subject and donor. In further specific embodiments, the method does not comprise performing HLA matching. In particular embodiments, the absence of HLA matching does not result in graft versus host disease or toxicity. V. Combination Treatments The compositions and methods described in the present disclosure may be utilized in conjunction with other types of therapy for cancer, such as chemotherapy, immunotherapy, surgery, radiation, gene therapy, and so forth, or anti-infection therapy. Such therapies can be administered simultaneously or sequentially (in any order) with the immunotherapy according to the present disclosure. When co-administered with an additional therapeutic agent, suitable therapeutically effective dosages for each agent may be lowered due to the additive action or synergy. 85 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) In some embodiments, the genetically engineered NK cells disclosed herein may be administered to a subject who has been treated or is being treated with an additional therapeutic agent (e.g., an additional anti-cancer therapeutic agent). For example, these genetically engineered NK cells may be administered to a human subject simultaneously with the additional therapeutic agent. In some embodiments, the genetically engineered NK cells may be administered to a human subject before the additional therapeutic agent. In some embodiments, the genetically engineered NK cells may be administered to a human subject after the additional therapeutic agent. Genetically engineered NK cells that co-express at least one metabolism modulating polypeptide and a CAR polypeptide specific to a tag can be co-used with a therapeutic agent conjugated to the tag. Via the therapeutic agent, which is capable of binding to an antigen associated with diseased cells such as tumor cells, such genetically engineered NK cells can be engaged with the diseased cells and inhibit their growth. Any of the antibodies listed in Table 4 above, or others specific to the same target antigen also listed in Table 4 can be conjugated to a suitable tag (e.g., those described herein) and be co-used with immune cells co-expressing the factor that redirects glucose metabolites and a CAR polypeptide specific to the tag. The treatments of the disclosure can be combined with other immunomodulatory treatments such as, e.g., therapeutic vaccines (including but not limited to GVAX, dendritic cell (DC)-based vaccines, etc.), checkpoint inhibitors (including but not limited to agents that block CTLA-4, PD-1, LAG3, TIM3, etc.) or activators (including but not limited to agents that enhance 41BB, OX40, etc.). In some embodiments, genetically engineered NK cells that co- express at least one metabolism modulating polypeptide and a CAR polypeptide is combined with an immunomodulatory treatment. Non-limiting examples of other therapeutic agents useful for combination with the immunotherapy of the disclosure include: (i) anti-angiogenic agents (e.g., TNP-470, platelet factor 4, thrombospondin-1, tissue inhibitors of metalloproteases (TIMP1 and TIMP2), prolactin (16-Kd fragment), angiostatin (38-Kd fragment of plasminogen), endostatin, bFGF soluble receptor, transforming growth factor beta, interferon alpha, soluble KDR and FLT-1 receptors, placental proliferin-related protein, as well as those listed by Carmeliet and Jain (Nature, 407(6801): 249-257 (2000)); (ii) a VEGF antagonist or a VEGF receptor antagonist such as anti-VEGF antibodies, VEGF variants, soluble VEGF receptor fragments, aptamers capable of blocking VEGF or VEGFR, neutralizing anti-VEGFR antibodies, inhibitors of 86 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) VEGFR tyrosine kinases and any combinations thereof; and (iii) chemotherapeutic compounds such as, e.g., pyrimidine analogs (5-fluorouracil, floxuridine, capecitabine, gemcitabine and cytarabine), purine analogs, folate antagonists and related inhibitors (mercaptopurine, thioguanine, pentostatin and 2-chlorodeoxyadenosine (cladribine)); antiproliferative/antimitotic agents including natural products such as vinca alkaloids (vinblastine, vincristine, and vinorelbine), microtubule disruptors such as taxane (paclitaxel, docetaxel), vincristine, vinblastine, nocodazole, epothilones, and navelbine, epidipodophyllotoxins (etoposide and teniposide), DNA damaging agents (actinomycin, amsacrine, anthracyclines, bleomycin, busulfan, camptothecin, carboplatin, chlorambucil, cisplatin, cyclophosphamide, cytoxan, dactinomycin, daunorubicin, doxorubicin, epirubicin, hexamethylmelamine oxaliplatin, iphosphamide, melphalan, merchlorehtamine, mitomycin, mitoxantrone, nitrosourea, plicamycin, procarbazine, paclitaxel, docetaxel, teniposide, triethylenethiophosphoramide and etoposide (VP16)); antibiotics such as dactinomycin (actinomycin D), daunorubicin, doxorubicin (adriamycin), idarubicin, anthracyclines, mitoxantrone, bleomycin, plicamycin (mithramycin) and mitomycin; enzymes (L-asparaginase which systemically metabolizes L-asparagine and deprives cells which do not have the capacity to synthesize their own asparagine); antiplatelet agents; antiproliferative/antimitotic alkylating agents such as nitrogen mustards (mechlorethamine, cyclophosphamide and analogs, melphalan, chlorambucil), ethylenimines and methylmelamines (hexamethylmelamine and thiotepa), alkyl sulfonates-busulfan, nitrosoureas (carmustine) and analogs, streptozocin), trazenes-dacarbazinine (DTIC); antiproliferative/antimitotic antimetabolites such as folic acid analogs (methotrexate); platinum coordination complexes (cisplatin, carboplatin), procarbazine, hydroxyurea, mitotane, aminoglutethimide; hormones, hormone analogs (estrogen, tamoxifen, goserelin, bicalutamide, nilutamide) and aromatase inhibitors (letrozole, anastrozole); anticoagulants (heparin, synthetic heparin salts and other inhibitors of thrombin); fibrinolytic agents (such as tissue plasminogen activator, streptokinase and urokinase), aspirin, dipyridamole, ticlopidine, clopidogrel, abciximab; antimigratory agents; antisecretory agents (brefeldin); immunosuppressives (cyclosporine, tacrolimus (FK-506), sirolimus (rapamycin), azathioprine, mycophenolate mofetil); anti-angiogenic compounds (e.g., TNP-470, genistein, bevacizumab) and growth factor inhibitors (e.g., fibroblast growth factor (FGF) inhibitors); angiotensin receptor blocker; nitric oxide donors; anti-sense oligonucleotides; antibodies (trastuzumab); cell cycle inhibitors and differentiation inducers (tretinoin); AKT inhibitors 87 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) (such as MK-2206 2HCl, Perifosine (KRX-0401), GSK690693, Ipatasertib (GDC-0068), AZD5363, uprosertib, afuresertib, or triciribine); mTOR inhibitors, topoisomerase inhibitors (doxorubicin (adriamycin), amsacrine, camptothecin, daunorubicin, dactinomycin, eniposide, epirubicin, etoposide, idarubicin, mitoxantrone, topotecan, and irinotecan), corticosteroids (cortisone, dexamethasone, hydrocortisone, methylprednisolone, prednisone, and prednisolone); growth factor signal transduction kinase inhibitors; mitochondrial dysfunction inducers and caspase activators; and chromatin disruptors. For examples of additional useful agents see also Physician’s Desk Reference, 59th edition, (2005), Thomson P D R, Montvale N.J.; Gennaro et al., Eds. Remington’s The Science and Practice of Pharmacy 20th edition, (2000), Lippincott Williams and Wilkins, Baltimore Md.; Braunwald et al., Eds. Harrison’s Principles of Internal Medicine, 15th edition, (2001), McGraw Hill, NY; Berkow et al., Eds. The Merck Manual of Diagnosis and Therapy, (1992), Merck Research Laboratories, Rahway N.J. The administration of an additional therapeutic agent can be performed by any suitable route, including systemic administration as well as administration directly to the site of the disease (e.g., to a tumor). In some embodiments, the method involves administering the additional therapeutic agent (e.g., an antibody) to the subject in one dose. In some embodiments, the method involves administering the additional therapeutic agent (e.g., an antibody) to the subject in multiple doses (e.g., at least 2, 3, 4, 5, 6, 7, or 8 doses). In some embodiments, the additional therapeutic agent (e.g., an antibody) is administered to the subject in multiple doses, with the first dose of the additional therapeutic agent (e.g., an antibody) administered to the subject about 1, 2, 3, 4, 5, 6, or 7 days prior to administration of the NK cells expressing at least one metabolism modulating polypeptide and/or the CAR polypeptide. In some embodiments, the first dose of the additional therapeutic agent (e.g., an antibody) is administered to the subject between about 24-48 hours prior to the administration of the immune cells described herein. In some embodiments, the first dose of the additional therapeutic agent (e.g., an antibody) is administered to the subject prior to the administration of the genetically engineered NK cells described herein. In some embodiments, the additional therapeutic agent (e.g., an antibody) is administered to the subject prior to administration of the genetically engineered NK cells described herein and then subsequently about every two weeks. In some embodiments, the first two doses of the additional therapeutic agent (e.g., an antibody) are 88 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) administered about one week (e.g., about 6, 7, 8, or 9 days) apart. In certain embodiments, the third and following doses are administered about every two weeks. In any of the embodiments described herein, the timing of the administration of the additional therapeutic agent (e.g., an antibody) is approximate and includes three days prior to and three days following the indicated day (e.g., administration every three weeks encompasses administration on day 18, day 19, day 20, day 21, day 22, day 23, or day 24). Efficacy of immune system induction for disease therapy may be enhanced by combination with other agents that, for example, reduce tumor burden prior to administration of the genetically engineered immune cells of the present invention. Antibody-drug conjugates (ADCs) can efficiently reduce tumor burden in many types of cancers. Numerous exemplary ADCs are known in the art (Mullard, Nat Rev Drug Discov, 12(5): 329-332 (2013); Coats et al., Clinical Cancer Research, 25(18): 5441-5448 (2019); Zhao et al., Acta Pharmaceutica Sinica B, 10(9): 1589-1600 (2020); Fu et al., Signal Transduction and Targeted Therapy, 7(1): 93 (2022)). Any such known ADC may be used in combination with a CAR-NK construct as described herein. Thus, in some embodiments, where an ADC is used in combination with a CAR-NK, the ADC is administered prior to the CAR-NK. In some embodiments, an ADC is used in combination with a CAR-NK as disclosed herein. In some embodiments, the first dose of the ADC is administered to the subject prior to the administration of the genetically engineered NK cells described herein. In another embodiment, the efficacy of the immune system induction for the disease therapy may be enhanced by combination with other immunotherapeutic agents, e.g., cytokines that stimulate the CAR-NK cells in vivo (e.g., agonists of the IL-2/IL-15Rβγ such as IL-2, IL- 15 (IL-2/IL-15 superagonists); IL-7, or IL-12, or derivatives thereof) or immune checkpoint inhibitors (e.g., anti-PD-1 antibodies, anti-PD-L1 antibodies, anti-LAG3 antibodies, anti- CTLA4 antibodies or anti-TIM3 antibodies). In some embodiments, the method further comprises administering a lymphocyte reduction treatment, preferably selected from cyclophosphamide and fludarabine. Such lymphodepletion treatment is preferably applied prior to the infusion of the NK cells expressing a CAR in order to allow for greater T cell expansion of the infused cells (Shank et al., Pharmacotherapy, 37(3): 334-345 (2017)). The efficacy of the methods described herein may be assessed by any method known in the art and would be evident to a skilled medical professional and/or those described herein. 89 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) VI. Kits for Therapeutic Use The present disclosure also provides kits for use of any of the compositions described herein. For example, the present disclosure also provides kits comprising a population of genetically engineered NK cells (e.g., T or NK cells, constructed in vitro or in vivo) that express at least one metabolism modulating polypeptide and optionally a chimeric receptor (ACTR or CAR) polypeptide described herein for use in inhibiting the growth of diseased cells, e.g., tumor cells and/or enhancing NK cell growth and/or proliferation in a low glucose environment, a low amino acid environment, a low-pH environment, and/or hypoxic environment, for example, in a tumor microenvironment. The kit may further comprise a therapeutic agent or a therapeutic agent conjugated to a tag (e.g., those described herein), to which the chimeric receptor polypeptide expressed on the NK cells bind. Such kits may include one or more containers comprising the population of the genetically engineered NK cells as described herein, and optionally a therapeutic agent or a therapeutic agent conjugated to a tag. In some embodiments, the kit comprises genetically engineered NK cells described herein which are expanded ex vivo. In another embodiment, the kit comprises genetically engineered NK cells described herein and an antibody specific to a cell surface antibody that is present on activated NK cells. In exemplary embodiments, the kit comprises NK cells expressing at least the one metabolism modulating polypeptides and CAR constructs known in the art or disclosed herein. Alternatively, the kit disclosed herein may comprise a nucleic acid or a nucleic acid set as described herein, which collectively encodes any of the chimeric receptor polypeptides and at least the one metabolism modulating polypeptide as also described herein. In some embodiments, the kit can additionally comprise instructions for use in any of the methods described herein. The included instructions may comprise a description of administration of the first and second pharmaceutical compositions to a subject to achieve the intended activity, e.g., inhibiting target cell growth in a subject. The kit may further comprise a description of selecting a subject suitable for treatment based on identifying whether the subject is in need of the treatment. In some embodiments, the kit may further comprise a description of selecting a subject suitable for treatment based on identifying whether the subject is in need of the treatment. Non-limiting examples of such methods of identification may include expression of target in blood, DNA or tissue (e.g., immunohistochemistry). Further, in some instances, a cut-off range may be used to adjust treatment dosage. 90 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) In some embodiments, the instructions comprise a description of administering the population of genetically engineered NK cells and optionally a description of administering the tag-conjugated therapeutic agent. The instructions relating to the use of the NK cells and optionally the tag-conjugated therapeutic agent as described herein generally include information as to dosage, dosing schedule, and route of administration for the intended treatment. The containers may be unit doses, bulk packages (e.g., multi-dose packages) or sub- unit doses. Instructions supplied in the kits of the disclosure are typically written instructions on a label or package insert. The label or package insert indicates that the pharmaceutical compositions are used for treating, delaying the onset, and/or alleviating a disease or disorder in a subject. The kits provided herein are in suitable packaging. Suitable packaging includes, but is not limited to, vials, bottles, jars, flexible packaging, and the like. Also contemplated are packages for use in combination with a specific device, such as an inhaler, nasal administration device, or an infusion device. A kit may have a sterile access port (for example, the container may be an intravenous solution bag or a vial having a stopper pierceable by a hypodermic injection needle). The container may also have a sterile access port. At least one active agent in the second pharmaceutical composition is an antibody as described herein. At least one active agent in the first pharmaceutical composition is a population of genetically engineered NK cells as described herein. Kits optionally may provide additional components such as buffers and interpretive information. Normally, the kit comprises a container and a label or package insert(s) on or associated with the container. In some embodiment, the disclosure provides articles of manufacture comprising contents of the kits described above. GENERAL TECHNIQUES The practice of the present disclosure will employ, unless otherwise indicated, conventional techniques of molecular biology (including recombinant techniques), microbiology, cell biology, biochemistry, and immunology, which are within the skill of the art. Such techniques are explained fully in the literature, such as Molecular Cloning: A Laboratory Manual, second edition (Sambrook, et al., 1989) Cold Spring Harbor Press; Oligonucleotide Synthesis (M. J. Gait, ed. 1984); Methods in Molecular Biology, Humana Press; Cell Biology: A Laboratory Notebook (J. E. Cellis, ed., 1989) Academic Press; Animal 91 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Cell Culture (R. I. Freshney, ed. 1987); Introduction to Cell and Tissue Culture (J. P. Mather and P. E. Roberts, 1998) Plenum Press; Cell and Tissue Culture: Laboratory Procedures (A. Doyle, J. B. Griffiths, and D. G. Newell, eds. 1993-8) J. Wiley and Sons; Methods in Enzymology (Academic Press, Inc.); Handbook of Experimental Immunology (D. M. Weir and C. C. Blackwell, eds.): Gene Transfer Vectors for Mammalian Cells (J. M. Miller and M. P. Calos, eds., 1987); Current Protocols in Molecular Biology (F. M. Ausubel, et al. eds. 1987); PCR: The Polymerase Chain Reaction, (Mullis, et al., eds. 1994); Current Protocols in Immunology (J. E. Coligan et al., eds., 1991); Short Protocols in Molecular Biology (Wiley and Sons, 1999); Immunobiology (C. A. Janeway and P. Travers, 1997); Antibodies (P. Finch, 1997); Antibodies: a practice approach (D. Catty., ed., IRL Press, 1988-1989); Monoclonal antibodies: a practical approach (P. Shepherd and C. Dean, eds., Oxford University Press, 2000); Using antibodies: a laboratory manual (E. Harlow and D. Lane (Cold Spring Harbor Laboratory Press, 1999); The Antibodies (M. Zanetti and J. D. Capra, eds. Harwood Academic Publishers, 1995); DNA Cloning: A practical Approach, Volumes I and II (D.N. Glover ed. 1985); Nucleic Acid Hybridization (B.D. Hames & S.J. Higgins eds.(1985); Transcription and Translation (B.D. Hames & S.J. Higgins, eds. (1984»; Animal Cell Culture (R.I. Freshney, ed. (1986); Immobilized Cells and Enzymes (lRL Press, (1986); and B. Perbal, A practical Guide To Molecular Cloning (1984); F.M. Ausubel et al. (eds.). Without further elaboration, it is believed that one skilled in the art can, based on the above description, utilize the present disclosure to its fullest extent. The following specific embodiments are, therefore, to be construed as merely illustrative, and not limitative of the remainder of the disclosure in any way whatsoever. All publications cited herein are incorporated by reference for the purposes or subject matter referenced herein. EXAMPLES The following examples are intended only to illustrate methods and embodiments in accordance with the invention, and as such should not be construed as imposing limitations upon the claims. 92 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) Example 1: Impact of expressing one or more exemplary polypeptides in NK cell function expressing an ACTR polypeptide in lower glucose environments At least one transgenes encoding one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) is co-expressed in the same NK cell with an ACTR polypeptide. The transgene is, for example, encoding GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75). The NK cells are transduced with a virus encoding the ACTR polypeptide and at least one metabolism modulating polypeptide herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence. The NK cells are mixed at a given effector-to- target (E:T) ratio with tumor target cells, such as IGROV-1 cells, and a tumor-targeting antibody such as an anti-FOLRα antibody. Reactions are then incubated at 37˚C in a 5 % CO2 incubator for a period of time (e.g., 6 – 8 days) at different starting concentrations of glucose (e.g., 0 – 20 mM). NK cell function is then evaluated, for example, using cytokine production or proliferation assays or for resistance to chronic stimulation. Cytokine production (e.g., IL- 2 and/or IFN-gamma) is measured from the reaction supernatant. For proliferation experiments, co-cultures are harvested and stained with α-CD3, α-CD14, α-CD33, α-CD45, α- CD56 antibodies and a live-dead cell stain. As a measure of NK cell proliferation, the live NK cells are enumerated on CD45+CD33-CD3-CD14-CD56+ and a live-dead cell stain is evaluated by flow cytometry. NK cells expressing at least one polypeptide described herein in addition to the ACTR polypeptide show enhanced NK cell function relative to NK cells expressing ACTR alone including, for example, enhanced cytokine production or enhanced proliferation. This enhanced function may be more pronounced at lower glucose concentrations. These experiments demonstrate that expressing at least one such polypeptides in NK cells has a positive impact on NK cell activity. Example 2: Impact of expressing one or more exemplary polypeptides in NK cell function expressing an ACTR polypeptide in environments with higher soluble inhibitor concentrations At least one transgenes encoding one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) is co-expressed in the same NK cell with an ACTR polypeptide. The transgene is, for example, encoding GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75). The NK cells are transduced with a virus encoding the ACTR polypeptide and at least one metabolism modulating polypeptideherein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for 93 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) example, by a P2A ribosomal skip sequence. The NK cells are mixed at a given effector-to- target (E:T) ratio with tumor target cells, such as IGROV-1 cells, and a tumor-targeting antibody such as an anti-FOLRα antibody. Reactions are then incubated at 37˚C in a 5 % CO2 incubator for a period of time (e.g., 6 – 8 days) at different starting concentrations of glucose (e.g., 0 – 20 mM). NK cell function is then evaluated, for example, using cytokine production or proliferation assays or for resistance to chronic stimulation. Cytokine production (e.g., IL- 2 and/or IFN-gamma) is measured from the reaction supernatant. For proliferation experiments, co-cultures of NK are harvested, stained and evaluated by flow cytometry (see Example 1). NK cells expressing at least one polypeptide described herein in addition to the ACTR polypeptide show enhanced cellular function relative to NK cells expressing ACTR alone including, for example, enhanced cytokine production. This enhanced function may be achieved at higher soluble inhibitor concentrations. These experiments demonstrate that expressing at least one such polypeptide in NK cells has a positive impact on NK cell activity. Example 3: Impact of expressing one or more exemplary polypeptides in NK cell function expressing an ACTR polypeptide in environments with greater immunosuppressive cell presence At least one transgenes encoding one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) is co-expressed in the same NK cell with an ACTR polypeptide. The transgene is, for example, encoding GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75). The NK cells are transduced with a virus encoding the ACTR polypeptide and at least one metabolism modulating polypeptideherein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence. The NK cells are mixed at a given effector-to- target (E:T) ratio with tumor target cells, such as IGROV-1 cells, and a tumor-targeting antibody such as an anti-FOLRα antibody. Reactions are then incubated at 37˚C in a 5 % CO2 incubator for a period of time (e.g., 6 – 8 days) at different starting concentrations of glucose (e.g., 0 – 20 mM). NK cell function is then evaluated, for example, using cytokine production or proliferation assays or for resistance to chronic stimulation. Cytokine production (e.g., IL- 2 and/or IFN-gamma) is measured from the reaction supernatant. Proliferation experiments is performed and evaluated as described in example 1. NK cells expressing at least one polypeptide described herein in addition to the ACTR or CAR polypeptide show enhanced NK cell function relative to NK cells expressing ACTR 94 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) or CAR alone including, for example, enhanced cytokine production or enhanced proliferation. This enhanced function may be achieved in the presence of increased amounts (e.g., greater number or percentage) of immunosuppressive cells. These experiments demonstrate that expressing at least one such polypeptide in NK cells has a positive impact on NK cell activity. Example 4: Impact of expressing one or more exemplary polypeptides in NK cell function expressing an ACTR polypeptide on tumor models At least one transgenes encoding a metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) is co-expressed in the same NK cell with an ACTR polypeptide. The transgene is, for example, encoding GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75). The NK cells are transduced with a virus encoding the ACTR polypeptide and at least one metabolism modulating polypeptide herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence. Transduced NK cells are evaluated for anti-tumor activity in mouse tumor models. For these experiments, a tumor cell line, for example IGROV- 1, is inoculated into NSG™ (NOD scid gamma, NOD.Cg-Prkdcscid IL2rgtm1Wjl/SzJ, Strain 005557) mice. Tumor-bearing mice are subsequently dosed with a tumor-targeting antibody, for example an anti-FOLRα antibody, and NK cells expressing ACTR alone or ACTR and a metabolism modulating polypeptide. Tumor growth is monitored throughout the course of the experiment. In combination with a tumor-targeting antibody, NK cells expressing at least one polypeptide described herein in addition to an ACTR polypeptide show enhanced anti-tumor activity relative to NK cells expressing an ACTR polypeptide alone. Additionally, in combination with a tumor-targeting antibody, NK cells expressing at least one polypeptide described herein in addition to an ACTR polypeptide may show enhanced NK cell activity including, for example, enhanced proliferation, enhanced NK cell persistence, and/or enhanced cytokine production relative to NK cells expressing the ACTR polypeptide alone. These experiments demonstrate that expressing at least one such polypeptide in ACTR-expressing NK cells has a positive impact on NK cell function in vivo. Example 5: Impact of expressing one or more exemplary polypeptides in NK cell function using a GPC3-targeting CAR-NK expression construct Gamma-retrovirus encoding an exemplary GPC3-targeting CAR polypeptide expression construct (SEQ ID NO: 86 or SEQ ID NO: 87) is generated via recombinant 95 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) technology and used to infect primary human NK-cells to generate cells expressing a GPC3- targeting CAR polypeptide on their cell surface. Additionally, gamma-retroviruses encoding an exemplary GPC3-targeting CAR polypeptide and at least one transgene encoding for factors (SEQ ID NO: 75 – SEQ ID NO: 82) are generated via recombinant technology and used to infect primary human NK- cells to generate cells that express a GPC3-targeting polypeptide and a metabolism modulating polypeptide. In the constructs encoding both the CAR polypeptide and at least one polypeptide, the two polypeptides are separated, for example, by at least one P2A ribosomal skip sequence. A six-day flow-based proliferation assay is then used to test the functionality of the GPC3-targeting CAR expressing cells. Specifically, 200,000 untransduced mock NK cells, NK cells expressing a GPC3-targeting CAR polypeptide, or NK cells expressing a GPC3-targeting CAR polypeptide and at least one metabolism modulating polypeptide are incubated together at a ratio of 4:1 (effector cells/CAR- NK cells to target cells) with 50,000 GPC3+ hepatocellular carcinoma JHH7 tumor cells. The co-culture is incubated at 37 °C in a 5% CO2 for six days in the presence of 1.25 mM glucose (tumor-relevant) and 10 mM glucose (approximate peripheral blood levels). At the end of six days, co-cultures are harvested, and co-cultures are harvested and stained with α-CD3, α-CD14, α-CD33, α-CD45, α-CD56 antibodies and a live-dead cell stain. As a measure of NK cell proliferation, the live NK cells are enumerated in CD45+CD33-CD3-CD14-CD56+ and a live-dead cell stain is evaluated by flow cytometry. NK cells expressing the at least the one polypeptide described herein in addition to the CAR polypeptide demonstrate enhanced NK cell proliferation relative to NK cells expressing the CAR construct alone. This enhanced proliferation also occurs at tumor-relevant low glucose concentrations. These experiments demonstrate that expressing at least one such polypeptide in NK cells has a positive impact on CAR-NK cell proliferation activity. Example 6: Impact of expressing one or more exemplary polypeptides in immune cell function expressing a CAR polypeptide in environments with higher soluble inhibitor concentrations At least one transgene encoding one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) are co-expressed in the same NK cell with an CAR polypeptide. The transgenes are, for example, encoding GOT2 (SEQ ID NO: 77). The NK cells are transduced with a virus encoding the ACTR polypeptide and the at least one polypeptide 96 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) described herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence. Transduced NK cells are mixed at a given effector-to-target (E:T) ratio with tumor target cells, such as HepG2 cells, in media containing different concentrations of soluble inhibitors that are present in the tumor microenvironment (e.g., TGFβ, PGE2, kynurenine, and/or adenosine). Reactions are then incubated at 37 °C in a 5% CO2 incubator for a period of time (e.g., 6 – 8 days). NK cell function is then evaluated, for example, using cytokine production or proliferation assays or for resistance to chronic stimulation. Cytokine production (e.g., IL-2 and/or IFN-gamma) is measured from the reaction supernatant. For proliferation experiments, co-cultures of NK are harvested, stained, and evaluated by flow cytometry. NK cells expressing at least one polypeptide described herein in addition to the CAR polypeptide show enhanced NK cell function relative to NK cells expressing CAR alone including, for example, enhanced cytokine production or enhanced proliferation. This enhanced function may be achieved at higher soluble inhibitor concentrations. These experiments demonstrate that expressing at least one such polypeptide described herein in NK cells has a positive impact on NK cell activity. Example 7: Impact of expressing one or more exemplary polypeptides in immune cell function expressing a CAR polypeptide in environments with greater immunosuppressive cell presence At least one transgene encoding at least one metabolism modulating polypeptide (e.g., SEQ ID NO: 68 – SEQ ID NO: 75) are co-expressed in the same NK cell with a CAR polypeptide. The transgenes are, for example, GOT2 (SEQ ID NO: 77). The NK cells are transduced with a virus encoding the CAR polypeptide and the at least one polypeptides described herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by a P2A ribosomal skip sequence. Transduced NK cells are mixed at a given effector-to-target (E:T) ratio with tumor target cells, such as HepG2 cells, in the presence of immunosuppressive cells (e.g., myeloid-derived suppressor cells and/or regulatory T cells). Reactions are then incubated at 37°C in a 5% CO2 incubator for a period of time (e.g., 3 – 10 days). NK cell function is then evaluated, for example, using cytokine production or cell proliferation assays or for resistance to chronic stimulation. Cytokine production (e.g., IL-2 and/or IFN-gamma) is measured from the reaction supernatant. Proliferation experiments is performed and evaluated as described in example 1. NK cells expressing the at least one polypeptide described herein in addition to the 97 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) CAR polypeptide show enhanced NK cell function relative to NK cells expressing CAR alone including, for example, enhanced cytokine production or enhanced proliferation. This enhanced function may be achieved in the presence of increased amounts (e.g., greater number or percentage) of immunosuppressive cells. These experiments demonstrate that expressing at least one such polypeptide in immune NK cells has a positive impact on immune cell activity. Example 8: Impact of expressing one or more exemplary polypeptides in NK cells expressing an ACTR polypeptide At least one transgene encoding at least one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82)are co-expressed in the same NK cell with a ACTR polypeptide. The transgenes are, for example, GOT2 (SEQ ID NO: 77). The NK cells are stimulated with anti-CD3 and anti-CD28 for a time period (e.g., 1 – 4 days) followed by transduction with virus (e.g., lentivirus or gamma-retrovirus) encoding the ACTR polypeptide and the at least one polypeptide described herein (SEQ ID NO: 75 – SEQ ID NO: 82), which can be separated, for example, by a P2A ribosomal skip sequence. The transduced cells are supplemented with cytokines (e.g., IL-2) for 3 – 10 days. All reactions are incubated at 37°C in a 5% CO2 incubator. For glucose uptake measurements, cells are harvested and assayed for glucose uptake using Glucose Uptake Glo Kit. This luminescence-based assay is evaluated, and data represented as a fold change. Complimentary cell metabolic flux assays are performed to capture changes in basal oxygen consumption rate (OCR) using seahorse extracellular flux analyzer. NK cells expressing the at least one factor described herein, in addition to the ACTR polypeptide, are expected to show enhanced glucose uptake. This enhanced function is suggestive of increased metabolic fitness and has a positive impact on the NK cell activity. Example 9: Impact of expressing one or more exemplary polypeptides in NK cells expressing a CAR polypeptide At least one transgenes encoding at least one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) are co-expressed in the same NK cell with a CAR polypeptide. The transgenes are, for example, GOT2 (SEQ ID NO: 77). The NK cells are stimulated with anti-CD3 and anti-CD28 for a time period (e.g., 1 – 4 days) followed by transduction with virus (e.g., lentivirus or gamma-retrovirus) encoding the CAR polypeptide and the at least one polypeptide described herein, which can be separated, for example, by a P2A ribosomal skip sequence. The transduced cells are supplemented with cytokines (e.g., IL- 98 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) 2) for 3 – 10 days. All reactions are incubated at 37 °C in a 5% CO2 incubator. For glucose uptake measurements, cells are harvested and assayed for glucose uptake using Glucose Uptake Glo Kit. This luminescence-based assay is evaluated, and data represented as a fold change. Complimentary cell metabolic flux assays are performed to capture changes in basal oxygen consumption rate (OCR) using seahorse extracellular flux analyzer. NK cells expressing the at least one polypeptide described herein, in addition to the CAR polypeptide, are expected to show enhanced glucose uptake. This enhanced function is suggestive of increased metabolic fitness and has a positive impact on NK cell activity. Example 10: Impact of expressing one or more exemplary polypeptides that redirect lactate production in immune cells expressing an ACTR polypeptide At least one transgene encoding at least one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) are co-expressed in the same NK cell with a ACTR polypeptide. The transgenes are, for example, GOT2 (SEQ ID NO: 77)). The NK cells are stimulated with anti-CD3 and anti-CD28 for a time period (e.g., 1 – 4 days) followed by transduction with virus (e.g., lentivirus or gamma-retrovirus) encoding the ACTR polypeptide and the at least one polypeptide described herein (SEQ ID NO: 75 – SEQ ID NO: 82), which can be separated, for example, by a P2A ribosomal skip sequence. The transduced cells are supplemented with cytokines (e.g., IL-2) and additionally with stimulants (e.g., PMA and/or Ionomycin) for 3 – 10 days. All reactions are incubated at 37 °C in a 5% CO2 incubator. Cells are harvested and assayed for lactate production using Lactate Glow Assay. This luminescence- based assay was evaluated, and data represented as a fold change. NK cells expressing the at least one polypeptide described herein in addition to the ACTR polypeptide are expected to show enhanced lactate production. This enhanced function is suggestive of increased metabolic fitness and has a positive impact on NK cell activity. Example 11: Impact of expressing one or more exemplary polypeptides that redirect lactate production in NK cells expressing a CAR polypeptide At least one transgene encoding at least one metabolism modulating polypeptide (e.g., SEQ ID NO: 75 – SEQ ID NO: 82) are co-expressed in the same NK cell with a CAR polypeptide. The transgenes are, for example, GOT2 (SEQ ID NO: 77). The NK cells are stimulated with anti-CD3 and anti-CD28 for a time period (e.g., 1 – 4 days) followed by 99 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) transduction with virus (e.g., lentivirus or gamma-retrovirus) encoding the CAR polypeptide and the at least one polypeptide described herein (SEQ ID NO: 75 – SEQ ID NO: 82), which can be separated, for example, by a P2A ribosomal skip sequence. The transduced cells are supplemented with cytokines (e.g., IL-2) and additionally with stimulants (e.g., PMA and/or Ionomycin) for 3 – 10 days. All reactions are incubated at 37 °C in a 5% CO2 incubator. Cells are harvested and assayed for lactate production using Lactate Glow Assay. This luminescence- based assay was evaluated, and data represented as a fold change. NK cells expressing the at least one polypeptide described herein, in addition to the CAR polypeptide, are expected to show enhanced lactate production. This enhanced function is suggestive of increased metabolic fitness and has a positive impact on NK cell activity. Example 12: Production of retroviral particles On day 1, 12x106 low passage HEK293T cells were plated on 15 cm coated tissue culture plates in DMEM media containing 10% FBS. The following day, i.e., day 2, the cells were 80% confluent. On day 3, the cells were subjected to transfection. 3 ml of transfection mix containing 10 µg of GAG/Pol, 6.6 µg of GALV helper, 20 µg of transfer plasmids and 74 µl of PEI Pro transfection reagent (Cat # 115-010, PolyPlus) was prepared and added to the cell culture plates. The transfected cells were replenished with fresh DMEM media containing 10% FBS media 6 h post-transfection. The viral supernatants were harvested at 24 h and 36 h post-transfection and concentrated through a 0.45 µm filter and stored at -80°C until further use. Example 13: Initiation and transduction of NK cells NK cells were isolated either from fresh blood samples or are derived from cell lines. Peripheral blood mononuclear cells (PBMCs) containing the Nk cells were isolated by the density gradient method using Ficoll-paque. Briefly, equal volume of whole blood and PBS was mixed carefully by inversion, overlayed on Ficoll-paque followed by centrifugation at 400 g for 30 min at RT. The PBMCs were retrieved from the buffy layer (see (Low and Wan Abas, Biomed Res Int, 2015: 239362 (2015))). PBMCs were stimulated with anti-CD3 and anti-CD28 until day2 prior to transduction. The NK-92 cell line was used in assessment of NK cell functions. 1x106 NK-92 cells were grown in T75 flasks and stimulated with IL-2 (100 UI/ml) in RPMI media containing 100 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) 10% FBS. The cells were maintained for one week by supplementing IL-2 (100 UI/ml) every 48 h. At least one transgenes encoding at least one metabolism modulating polypeptide as disclosed herein (e.g., SEQ ID NO: 75 – SEQ ID NO: 82)are co-expressed in the same NK cell with an ACTR (see Table 10) or CAR (see Table 11) polypeptide. The transgenes are, for example, GOT2 (SEQ ID NO: 77) and/or TIGAR (SEQ ID NO: 75). The NK cells were transduced with a virus encoding the ACTR or CAR polypeptide and at least one polypeptide described herein (SEQ ID NO: 75 – SEQ ID NO: 82) separated, for example, by at least one P2A ribosomal skip sequence. Briefly, 1x106 cells were mixed with 1 ml of viral supernatant (see Example 1) in a total volume of 2 ml, centrifuged at 1200 g for 45 min followed by plating into a 24-well plate. The cells were then incubated at 37˚C in a 5 % CO2 incubator. In case of NK-92 transduced cells, the culture was monitored for growth every 48 h and split to a final concentration of 0.5 x106 cell/ml by supplementing IL-2 (100 UI/ml) every 48 h. The transduced NK cells were assessed for the transgene expression by immunoblotting. The transduced cells (e.g., NK-92), were harvested by centrifuging at 1500 rpm for 5 min at RT. The supernatant was removed, and the cell pellet was washed twice in 1XPBS before flash freezing in liquid nitrogen and stored at -80°C until further use. Cell pellets were subsequently lysed in 200 μl of SDS Lysis buffer (Cat # NP0008; Novex) containing 1x HALT Protease Inhibitor Cocktail (Cat# 78430; Thermo Fisher Scientific) followed by sonication. The suspension was centrifuged at 15,000 rpm for 15 min at RT and the supernatant containing total protein was collected. The total protein concentration was measured using Pierce 660 nm Protein Assay (Cat# 1861426; Thermo Fisher Scientific) followed by immunoblotting. 10 μg total protein was loaded in each lane of a Novex™ 4 to 12 % Tris- Glycine Plus, 1.0 mm, 20-well Midi Protein Gel (Invitrogen), transferred onto PVDF membrane using Transblot Turbo (Biorad) and blocked for 1 h at RT using LICOR Blocking buffer. The membrane was probed for transgenes (e.g., GOT2, TIGAR) using mouse α-Actin (3700S, CST; dilution 1:2000), Rabbit α-TIGAR (14751S CST; dilution 1:1000) and Rabbit α- GOT2 (NBP232241, Novus; dilution 1:2000) antibodies overnight (in 0.1% Tween 20 + LICOR Blocking buffer) at 4°C. The following day, membranes were washed thrice with 1x TBS containing 0.1% Tween20 detergent (w/v) for 5 min each. Membranes were subsequently incubated with standard rabbit or mouse secondary antibodies (LICOR; dilution 1:10,000) for 1 h. The membranes were washed thrice with 1x TBS containing 0.1% Tween20 detergent 101 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) (w/v) for 5 min each. Immunoblots were imaged using a CLX imager (LICOR) and processed in the Image Studio Software (v5.2; LICOR). Example 14: Analysis of CAR expression in transduced NK cells NK cells were isolated either from fresh blood samples or are derived from cell lines and were transduced as described in Example 13. On day7 post-transduction, the NK cells were harvested by centrifuging at 1500 rpm for 5 min at RT. The supernatant was removed, and the cell pellet was washed twice in 1X PBS followed by staining with Live Dead Aqua (Cat No. L34966; Thermo Fisher Scientific) for 10 min at RT. The cells were washed twice in 1x PBS followed by staining with primary and secondary antibody in 1X PBS with 2% FBS for assessing CAR expression. Living single cells were selected for and CAR expression was determined in comparison to an untransduced control (Null). Data were analyzed with FlowJo version 10.7.1 software (Tree Star Inc). Co-expression of a CAR construct alone or together with TIGAR or GOT2 has been demonstrated in NK92 cells, an IL-2 dependent NK cell line derived from a patient with lymphoma. Transgene overexpression was analyzed for harvested cells on day 7 by immunoblotting as shown in FIG. 1. GOT2 expression was observed with all constructs and control due to the endogenous expression of GOT2, whereas a stronger band was observed in case of GOT2 co-expression with the CAR. No endogenous TIGAR expression was observed under these conditions. Strong expression was only seen once TIGAR was co-expressed with the CAR. In addition, harvested cells were stained with a recombinant antibody against the Fc part of the CAR, and presence of the CAR on the surface of the NK cell was assessed using flow cytometry. FIGs. 2A-2D show that all constructs expressed the CAR on the surface of the NK92 cells. OTHER EMBODIMENTS All of the features disclosed in this specification may be combined in any combination. Each feature disclosed in this specification may be replaced by an alternative feature serving the same, equivalent, or similar purpose. Thus, unless expressly stated otherwise, each feature disclosed is only an example of a generic series of equivalent or similar features. From the above description, one of skill in the art can easily ascertain the essential characteristics of the present disclosure, and without departing from the spirit and scope 102 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) thereof, can make various changes and modifications of the disclosure to adapt it to various usages and conditions. Thus, other embodiments are also within the claims. EQUIVALENTS While several inventive embodiments have been described and illustrated herein, those of ordinary skill in the art will readily envision a variety of other means and/or structures for performing the function and/or obtaining the results and/or one or more of the advantages described herein, and each of such variations and/or modifications is deemed to be within the scope of the inventive embodiments described herein. More generally, those skilled in the art will readily appreciate that all parameters, dimensions, materials, and configurations described herein are meant to be exemplary and that the actual parameters, dimensions, materials, and/or configurations will depend upon the specific application or applications for which the inventive teachings is/are used. Those skilled in the art will recognize, or be able to ascertain using no more than routine experimentation, many equivalents to the specific inventive embodiments described herein. It is, therefore, to be understood that the foregoing embodiments are presented by way of example only and that, within the scope of the appended claims and equivalents thereto, inventive embodiments may be practiced otherwise than as specifically described and claimed. Inventive embodiments of the present disclosure are directed to each individual feature, system, article, material, kit, and/or method described herein. In addition, any combination of two or more such features, systems, articles, materials, kits, and/or methods, if such features, systems, articles, materials, kits, and/or methods are not mutually inconsistent, is included within the inventive scope of the present disclosure. All definitions, as defined and used herein, should be understood to control over dictionary definitions, definitions in documents incorporated by reference, and/or ordinary meanings of the defined terms. All references, patents and patent applications disclosed herein are incorporated by reference with respect to the subject matter for which each is cited, which in some cases may encompass the entirety of the document. The indefinite articles “a” and “an,” as used herein in the specification and in the claims, unless clearly indicated to the contrary, should be understood to mean “at least one.” The phrase “and/or,” as used herein in the specification and in the claims, should be understood to mean “either or both” of the elements so conjoined, i.e., elements that are 103 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) conjunctively present in some cases and disjunctively present in other cases. Multiple elements listed with “and/or” should be construed in the same fashion, i.e., “one or more” of the elements so conjoined. Other elements may optionally be present other than the elements specifically identified by the “and/or” clause, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, a reference to “A and/or B”, when used in conjunction with open-ended language such as “comprising” can refer, in one embodiment, to A only (optionally including elements other than B); in another embodiment, to B only (optionally including elements other than A); in yet another embodiment, to both A and B (optionally including other elements); etc. As used herein in the specification and in the claims, “or” should be understood to have the same meaning as “and/or” as defined above. For example, when separating items in a list, “or” or “and/or” shall be interpreted as being inclusive, i.e., the inclusion of at least one, but also including more than one, of a number or list of elements, and, optionally, additional unlisted items. Only terms clearly indicated to the contrary, such as “only one of” or “exactly one of,” or, when used in the claims, “consisting of,” will refer to the inclusion of exactly one element of a number or list of elements. In general, the term “or” as used herein shall only be interpreted as indicating exclusive alternatives (i.e., “one or the other but not both”) when preceded by terms of exclusivity, such as “either”, “one of”, “only one of”, or “exactly one of”. “Consisting essentially of,” when used in the claims, shall have its ordinary meaning as used in the field of patent law. As used herein in the specification and in the claims, the phrase “at least one,” in reference to a list of one or more elements, should be understood to mean at least one element selected from any one or more of the elements in the list of elements, but not necessarily including at least one of each and every element specifically listed within the list of elements and not excluding any combinations of elements in the list of elements. This definition also allows that elements may optionally be present other than the elements specifically identified within the list of elements to which the phrase “at least one” refers, whether related or unrelated to those elements specifically identified. Thus, as a non-limiting example, “at least one of A and B” (or, equivalently, “at least one of A or B,” or, equivalently “at least one of A and/or B”) can refer, in one embodiment, to at least one, optionally including more than one, A, with no B present (and optionally including elements other than B); in another embodiment, to at least one, optionally including more than one, B, with no A present (and optionally including 104 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) elements other than A); in yet another embodiment, to at least one, optionally including more than one, A, and at least one, optionally including more than one, B (and optionally including other elements); etc. It should also be understood that, unless clearly indicated to the contrary, in any methods claimed herein that include more than one step or act, the order of the steps or acts of the method is not necessarily limited to the order in which the steps or acts of the method are recited. 105 DM_US 198678773-1.112309.0120
Claims
Attorney Docket No.: 112309-0120 (70006WO00) WHAT IS CLAIMED IS: 1. A genetically engineered natural killer (NK) cell, which (i) expresses or overly express at least one metabolism modulating polypeptide selected from the group consisting of Glutamic-oxaloacetic transaminase 2 (GOT2), Glucose transporter 1 (GLUT1), Lactate dehydrogenase A (LDHA), Pyruvate dehydrogenase kinase 1 (PDK1), TP53-inducible glycolysis and apoptosis regulator (TIGAR), Cystathionine gamma- lyase 1 (CTH1), Argininosuccinate synthase 1 (ASS1) and Phosphoserine phosphatase (PSPH); and (ii) expresses a chimeric receptor polypeptide; wherein the chimeric receptor polypeptide comprises: (a) an extracellular target binding domain; (b) a transmembrane domain; and (c) at least one cytoplasmic signaling domain. 2. The genetically engineered NK cell of claim 1, wherein the NK cell expresses or overly expresses two of the metabolism modulating polypeptides. 3. The genetically engineered NK cell of any of claims 1 or claim 2, wherein the chimeric receptor polypeptide comprises one or more of the following features: (i) the chimeric receptor polypeptide further comprises a signal peptide at its N- terminus; (ii) the chimeric receptor polypeptide further comprises a hinge domain, which is located at the C-terminus of (a) and the N-terminus of (b); (iii) the chimeric receptor polypeptide is free of a hinge domain; (iv) the chimeric receptor polypeptide further comprises at least one co-stimulatory signaling domain; (v) the chimeric receptor polypeptide is free of a co-stimulatory signaling domain; (vi) the cytoplasmic signaling domain comprises an immunoreceptor tyrosine- based activation motif (ITAM); and (vii) the cytoplasmic signaling domain (c) is located at the C-terminus of the chimeric receptor polypeptide. 106 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) 4. The genetically engineered NK cell of any one of claims 1 - 3, wherein the chimeric receptor polypeptide is a chimeric antigen receptor (CAR) polypeptide, in which (ii)(a) is an extracellular antigen binding domain. 5. The genetically engineered NK cell of claim 4, wherein the extracellular antigen binding domain is a single chain variable fragment (scFv) or a single domain antibody that binds to a tumor antigen, a pathogenic antigen, or an immune cell specific to an autoantigen. 6. The genetically engineered NK cell of claim 5 , wherein the extracellular antigen binding domain binds to the tumor antigen, which is associated with a solid tumor. 7. The genetically engineered NK cell of claim 5, wherein the extracellular antigen binding domain binds to the pathogenic antigen, which is a bacterial antigen, a viral antigen, or a fungal antigen. 8. The genetically engineered NK cell any one of claims 1 -7, wherein the transmembrane domain is of a membrane protein selected from the group consisting of CD8α, CD8β, 4-1BB, CD28, CD34, CD4, FcεRIγ, CD16A, OX40, CD3ζ, CD3ε, CD3γ, CD3δ, TCRα, CD32, CD64, VEGFR2, FAS, FGFR2B, DNAM-1, 2B4, NKG2D, NKp44 and NKp46. 9. The genetically engineered NK cell any one of claims 3-8, wherein the at least one co-stimulatory signaling domain (iv) is of a co-stimulatory molecule selected from the group consisting of 4-1BB, CD28, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL. 10. The genetically engineered NK cell of claim 9, wherein the at least one co- stimulatory signaling domain is a CD28 co-stimulatory signaling domain or a 4-1BB co- stimulatory signaling domain. 107 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) 11. The genetically engineered NK cell of any one of claims 3 - 10, wherein the chimeric receptor polypeptide comprises at least two co-stimulatory signaling domains. 12. The genetically engineered NK cell of claim 11, wherein (i) one of the co-stimulatory signaling domains is a CD28 co-stimulatory signaling domain; and the other co-stimulatory domain is selected from the group consisting of a CD8α, 4-1BB, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL co-stimulatory signaling domain; (ii) one of the co-stimulatory signaling domains is a CD8α co-stimulatory signaling domain; and wherein the other co-stimulatory domain is selected from the group consisting of a CD28, 4-1BB, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL co- stimulatory signaling domain; or (iii) one of the co-stimulatory signaling domains is a 4-1BB co-stimulatory signaling domain; and wherein the other co-stimulatory domain is selected from the group consisting of a CD8α, CD28, 2B4, OX40, OX40L, ICOS, CD27, GITR, HVEM, TIM1, LFA1, CD2, DAP10, DAP12, DNAM-1, NKG2D, NKp30, NKp44, NKp46 and JAMAL co- stimulatory signaling domain. 13. The genetically engineered NK cell of any one of claims 1-12, wherein the cytoplasmic signaling domain of (c) is a cytoplasmic domain of CD3ζor FcεR1γ, preferably CD3ζ. 14. The genetically engineered NK cell any one of claims 3-13, wherein the hinge domain (ii) is a hinge domain of CD8α, CD28 or IgG, preferably CD8α or CD28. 15. The genetically engineered NK cell of claim 4, wherein the CAR polypeptide is selected from the list of CARs shown in Table 11. 16. The genetically engineered NK cell of any one of claims 4 - 14, wherein the chimeric receptor polypeptide is a CAR polypeptide, which comprises 108 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) (i) a CD28 co-stimulatory domain, a CD28 transmembrane domain and a CD28 hinge domain; (ii) a 4-1BB co-stimulatory domain, a CD8α transmembrane domain and a CD8α hinge domain; 17. The genetically engineered NK cell of any one of claims 1 - 16 , wherein (i) the NK cell is derived from a cell line; or (ii) the NK cell is derived from peripheral blood mononuclear cells (PBMC), hematopoietic stem cells (HSCs), cord blood stem cells or induced pluripotent stem cells (iPSCs). 18. The genetically engineered NK cell of any one of claims 1 - 17, wherein the NK cell comprises a nucleic acid or a nucleic acid set, which collectively comprises: (A) a first nucleotide sequence encoding the at least one metabolism modulating polypeptide of (i); and (B) a second nucleotide sequence encoding the chimeric receptor polypeptide. 19. The genetically engineered NK cell of claim 18, wherein the NK cell comprises the nucleic acid, which comprises both the first nucleotide sequence and the second nucleotide sequence. 20. The genetically engineered NK cell of claims 18 - 19, wherein the nucleic acid further comprises a third nucleotide sequence located between the first nucleotide sequence and the second nucleotide sequence, wherein the third nucleotide sequence encodes a ribosomal skipping site, an internal ribosome entry site (IRES), or a promoter. 21. The genetically engineered NK cell of claim 20, wherein the nucleic acid or nucleic acid set is comprised within one or more viral vectors. 22. A pharmaceutical composition, comprising a genetically engineered NK cell of any of claims 1 - 21. 109 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) 23. A population of genetically engineered NK cells set forth in any one of claims 1 - 21 for use in inhibiting cells expressing a target antigen in a subject. 24. A method for inhibiting and/or killing cells expressing a target antigen in a subject, the method comprising administering to a subject in need thereof a population of the genetically engineered NK cells set forth in any one of claims 1 - 21 or a pharmaceutical composition comprising the population of the genetically engineered NK cells. 25. The method of claim 26 or the population of genetically engineered NK cells for use of claim 24, wherein the subject is a human patient suffering from a cancer and the target antigen is a tumor antigen of a solid tumor; optionally wherein (i) the cancer is selected from the group consisting of carcinoma, lymphoma, sarcoma and blastoma, or (ii) the cancer is selected from the group consisting of a cancer of B-cell origin, breast cancer, gastric cancer, neuroblastoma, osteosarcoma, lung cancer, skin cancer, prostate cancer, colon cancer, renal cell carcinoma, ovarian cancer, rhabdomyosarcoma, mesothelioma, pancreatic cancer, head and neck cancer, retinoblastoma, glioma, glioblastoma, liver cancer, and thyroid cancer; optionally wherein the cancer of B-cell origin is selected from the group consisting of Hodgkin lymphoma and non-Hodgkin lymphoma. 26. The method of claim 24 or claim 25, or the population of genetically engineered NK cells for use of claim 23 or claim 25, wherein at least some of the cells expressing the target antigen are located in a low-glucose environment. 27. The method of any one of claims 24-26, or the population of genetically engineered NK cells for use of any one of claims 23, 25 and 26 , wherein the NK cells meet one or more of the following: (iii) the NK cells are autologous; (iv) the NK cells are allogeneic; (v) the NK cells are activated, expanded, or both ex vivo, and 110 DM_US 198678773-1.112309.0120
Attorney Docket No.: 112309-0120 (70006WO00) (vi) wherein the NK cells are activated in the presence of one or more of 4-1BB ligand, anti-4-1BB antibody, IL-15, anti-IL-15 receptor antibody, IL-2, IL- 2/IL-15Rβγ super-agonist, IL-12, IL-21 and K562 cells, and an engineered artificial stimulatory cell or particle. 28. A nucleic acid or nucleic acid set, which collectively comprises: (A) a first nucleotide sequence encoding the at least one metabolism modulating polypeptide of (i) set forth in claim 1; and (B) a second nucleotide sequence encoding the chimeric receptor polypeptide set forth in any one of claims 3 - 16. 29. A vector or vector set comprising the nucleic acid or nucleic acid set of claim 28. 30. The vector or vector set of claim 29, wherein the vector(s) is a viral vector, preferably a lentiviral or retroviral vector. 31. A method for generating modified NK cells in vivo, the method comprising administering to a subject in need thereof the nucleic acid or nucleic acid set of claim 28 or a vector of claims 29. 111 DM_US 198678773-1.112309.0120
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202263399326P | 2022-08-19 | 2022-08-19 | |
US63/399,326 | 2022-08-19 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2024040207A1 true WO2024040207A1 (en) | 2024-02-22 |
Family
ID=88188898
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2023/072444 WO2024040207A1 (en) | 2022-08-19 | 2023-08-18 | Genetically engineered natural killer (nk) cells with chimeric receptor polypeptides in combination with trans metabolism molecules and therapeutic uses thereof |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2024040207A1 (en) |
Citations (38)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4650764A (en) | 1983-04-12 | 1987-03-17 | Wisconsin Alumni Research Foundation | Helper cell |
GB2200651A (en) | 1987-02-07 | 1988-08-10 | Al Sumidaie Ayad Mohamed Khala | A method of obtaining a retrovirus-containing fraction from retrovirus-containing cells |
US4777127A (en) | 1985-09-30 | 1988-10-11 | Labsystems Oy | Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus |
EP0345242A2 (en) | 1988-06-03 | 1989-12-06 | Smithkline Biologicals S.A. | Expression of gag proteins from retroviruses in eucaryotic cells |
WO1990007936A1 (en) | 1989-01-23 | 1990-07-26 | Chiron Corporation | Recombinant therapies for infection and hyperproliferative disorders |
US4980289A (en) | 1987-04-27 | 1990-12-25 | Wisconsin Alumni Research Foundation | Promoter deficient retroviral vector |
WO1991002805A2 (en) | 1989-08-18 | 1991-03-07 | Viagene, Inc. | Recombinant retroviruses delivering vector constructs to target cells |
US5124263A (en) | 1989-01-12 | 1992-06-23 | Wisconsin Alumni Research Foundation | Recombination resistant retroviral helper cell and products produced thereby |
WO1993003769A1 (en) | 1991-08-20 | 1993-03-04 | THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES | Adenovirus mediated transfer of genes to the gastrointestinal tract |
WO1993010218A1 (en) | 1991-11-14 | 1993-05-27 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Vectors including foreign genes and negative selective markers |
WO1993011230A1 (en) | 1991-12-02 | 1993-06-10 | Dynal As | Modified mammalian stem cell blocking viral replication |
US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
WO1993019191A1 (en) | 1992-03-16 | 1993-09-30 | Centre National De La Recherche Scientifique | Defective recombinant adenoviruses expressing cytokines for use in antitumoral treatment |
WO1993025698A1 (en) | 1992-06-10 | 1993-12-23 | The United States Government As Represented By The | Vector particles resistant to inactivation by human serum |
WO1993025234A1 (en) | 1992-06-08 | 1993-12-23 | The Regents Of The University Of California | Methods and compositions for targeting specific tissue |
WO1994003622A1 (en) | 1992-07-31 | 1994-02-17 | Imperial College Of Science, Technology & Medicine | D-type retroviral vectors, based on mpmv |
WO1994012649A2 (en) | 1992-12-03 | 1994-06-09 | Genzyme Corporation | Gene therapy for cystic fibrosis |
WO1994028938A1 (en) | 1993-06-07 | 1994-12-22 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy sponsorship |
WO1995000655A1 (en) | 1993-06-24 | 1995-01-05 | Mc Master University | Adenovirus vectors for gene therapy |
WO1995007358A1 (en) | 1993-07-30 | 1995-03-16 | University Of Medicine & Dentistry Of New Jersey | Efficient gene transfer into primary lymphocytes |
US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
WO1995011984A2 (en) | 1993-10-25 | 1995-05-04 | Canji, Inc. | Recombinant adenoviral vector and methods of use |
WO1998009271A1 (en) | 1996-08-28 | 1998-03-05 | Burgett, Inc. | Method and apparatus for actuating solenoids in a player piano |
WO2000032776A2 (en) | 1998-12-01 | 2000-06-08 | Genentech, Inc. | Secreted amd transmembrane polypeptides and nucleic acids encoding the same |
US6194191B1 (en) | 1996-11-20 | 2001-02-27 | Introgen Therapeutics, Inc. | Method for the production and purification of adenoviral vectors |
US7052906B1 (en) | 1999-04-16 | 2006-05-30 | Celltech R & D Limited | Synthetic transmembrane components |
US7435596B2 (en) | 2004-11-04 | 2008-10-14 | St. Jude Children's Research Hospital, Inc. | Modified cell line and method for expansion of NK cell |
WO2013040557A2 (en) | 2011-09-16 | 2013-03-21 | The Trustees Of The University Of Pennsylvania | Rna engineered t cells for the treatment of cancer |
US8673860B2 (en) | 2009-02-03 | 2014-03-18 | Amunix Operating Inc. | Extended recombinant polypeptides and compositions comprising same |
US20140106449A1 (en) | 2010-12-09 | 2014-04-17 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T Cells to Treat Cancer |
WO2015058018A1 (en) | 2013-10-17 | 2015-04-23 | National University Of Singapore | Chimeric receptor that triggers antibody-dependent cell cytotoxicity against multiple tumors |
WO2016040441A1 (en) | 2014-09-09 | 2016-03-17 | Unum Therapeutics | Chimeric receptors and uses thereof in immune therapy |
WO2017161333A1 (en) | 2016-03-18 | 2017-09-21 | Unum Therapeutics | Modified chimeric receptors and uses thereof in immune therapy |
WO2018140960A1 (en) | 2017-01-30 | 2018-08-02 | Unum Therapeutics Inc. | Improved antibody-coupled t cell receptor constructs and therapeutic uses thereof |
WO2020010110A1 (en) | 2018-07-03 | 2020-01-09 | Unum Therapeutics Inc. | Chimeric receptors in combination with trans metabolism molecules enhancing glucose import and therapeutic uses thereof |
WO2020037066A1 (en) | 2018-08-14 | 2020-02-20 | Unum Therapeutics Inc. | Chimeric antigen receptor polypeptides in combination with trans metabolism molecules modulating krebs cycle and therapeutic uses thereof |
WO2020051493A1 (en) | 2018-09-07 | 2020-03-12 | Unum Therapeutics Inc. | Chimeric receptor polypeptides in combination with trans metabolism molecules modulating intracellular lactate concentrations and therapeutic uses thereof |
WO2023049933A1 (en) | 2021-09-27 | 2023-03-30 | Sotio Biotech Inc. | Chimeric receptor polypeptides in combination with trans metabolism molecules that re-direct glucose metabolites out of the glycolysis pathway and therapeutic uses thereof |
-
2023
- 2023-08-18 WO PCT/US2023/072444 patent/WO2024040207A1/en unknown
Patent Citations (39)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US4650764A (en) | 1983-04-12 | 1987-03-17 | Wisconsin Alumni Research Foundation | Helper cell |
US4777127A (en) | 1985-09-30 | 1988-10-11 | Labsystems Oy | Human retrovirus-related products and methods of diagnosing and treating conditions associated with said retrovirus |
GB2200651A (en) | 1987-02-07 | 1988-08-10 | Al Sumidaie Ayad Mohamed Khala | A method of obtaining a retrovirus-containing fraction from retrovirus-containing cells |
US5219740A (en) | 1987-02-13 | 1993-06-15 | Fred Hutchinson Cancer Research Center | Retroviral gene transfer into diploid fibroblasts for gene therapy |
US4980289A (en) | 1987-04-27 | 1990-12-25 | Wisconsin Alumni Research Foundation | Promoter deficient retroviral vector |
EP0345242A2 (en) | 1988-06-03 | 1989-12-06 | Smithkline Biologicals S.A. | Expression of gag proteins from retroviruses in eucaryotic cells |
US5124263A (en) | 1989-01-12 | 1992-06-23 | Wisconsin Alumni Research Foundation | Recombination resistant retroviral helper cell and products produced thereby |
WO1990007936A1 (en) | 1989-01-23 | 1990-07-26 | Chiron Corporation | Recombinant therapies for infection and hyperproliferative disorders |
US5399346A (en) | 1989-06-14 | 1995-03-21 | The United States Of America As Represented By The Department Of Health And Human Services | Gene therapy |
WO1991002805A2 (en) | 1989-08-18 | 1991-03-07 | Viagene, Inc. | Recombinant retroviruses delivering vector constructs to target cells |
WO1993003769A1 (en) | 1991-08-20 | 1993-03-04 | THE UNITED STATES OF AMERICA, represented by THE SECRETARY, DEPARTEMENT OF HEALTH AND HUMAN SERVICES | Adenovirus mediated transfer of genes to the gastrointestinal tract |
WO1993010218A1 (en) | 1991-11-14 | 1993-05-27 | The United States Government As Represented By The Secretary Of The Department Of Health And Human Services | Vectors including foreign genes and negative selective markers |
WO1993011230A1 (en) | 1991-12-02 | 1993-06-10 | Dynal As | Modified mammalian stem cell blocking viral replication |
WO1993019191A1 (en) | 1992-03-16 | 1993-09-30 | Centre National De La Recherche Scientifique | Defective recombinant adenoviruses expressing cytokines for use in antitumoral treatment |
WO1993025234A1 (en) | 1992-06-08 | 1993-12-23 | The Regents Of The University Of California | Methods and compositions for targeting specific tissue |
WO1993025698A1 (en) | 1992-06-10 | 1993-12-23 | The United States Government As Represented By The | Vector particles resistant to inactivation by human serum |
WO1994003622A1 (en) | 1992-07-31 | 1994-02-17 | Imperial College Of Science, Technology & Medicine | D-type retroviral vectors, based on mpmv |
WO1994012649A2 (en) | 1992-12-03 | 1994-06-09 | Genzyme Corporation | Gene therapy for cystic fibrosis |
WO1994028938A1 (en) | 1993-06-07 | 1994-12-22 | The Regents Of The University Of Michigan | Adenovirus vectors for gene therapy sponsorship |
WO1995000655A1 (en) | 1993-06-24 | 1995-01-05 | Mc Master University | Adenovirus vectors for gene therapy |
WO1995007358A1 (en) | 1993-07-30 | 1995-03-16 | University Of Medicine & Dentistry Of New Jersey | Efficient gene transfer into primary lymphocytes |
WO1995011984A2 (en) | 1993-10-25 | 1995-05-04 | Canji, Inc. | Recombinant adenoviral vector and methods of use |
WO1998009271A1 (en) | 1996-08-28 | 1998-03-05 | Burgett, Inc. | Method and apparatus for actuating solenoids in a player piano |
US6194191B1 (en) | 1996-11-20 | 2001-02-27 | Introgen Therapeutics, Inc. | Method for the production and purification of adenoviral vectors |
WO2000032776A2 (en) | 1998-12-01 | 2000-06-08 | Genentech, Inc. | Secreted amd transmembrane polypeptides and nucleic acids encoding the same |
US7052906B1 (en) | 1999-04-16 | 2006-05-30 | Celltech R & D Limited | Synthetic transmembrane components |
US7435596B2 (en) | 2004-11-04 | 2008-10-14 | St. Jude Children's Research Hospital, Inc. | Modified cell line and method for expansion of NK cell |
US8026097B2 (en) | 2004-11-04 | 2011-09-27 | St. Jude Children's Research Hospital | Expansion of NK cells and therapeutic uses thereof |
US8673860B2 (en) | 2009-02-03 | 2014-03-18 | Amunix Operating Inc. | Extended recombinant polypeptides and compositions comprising same |
US20140106449A1 (en) | 2010-12-09 | 2014-04-17 | The Trustees Of The University Of Pennsylvania | Use of Chimeric Antigen Receptor-Modified T Cells to Treat Cancer |
WO2013040557A2 (en) | 2011-09-16 | 2013-03-21 | The Trustees Of The University Of Pennsylvania | Rna engineered t cells for the treatment of cancer |
WO2015058018A1 (en) | 2013-10-17 | 2015-04-23 | National University Of Singapore | Chimeric receptor that triggers antibody-dependent cell cytotoxicity against multiple tumors |
WO2016040441A1 (en) | 2014-09-09 | 2016-03-17 | Unum Therapeutics | Chimeric receptors and uses thereof in immune therapy |
WO2017161333A1 (en) | 2016-03-18 | 2017-09-21 | Unum Therapeutics | Modified chimeric receptors and uses thereof in immune therapy |
WO2018140960A1 (en) | 2017-01-30 | 2018-08-02 | Unum Therapeutics Inc. | Improved antibody-coupled t cell receptor constructs and therapeutic uses thereof |
WO2020010110A1 (en) | 2018-07-03 | 2020-01-09 | Unum Therapeutics Inc. | Chimeric receptors in combination with trans metabolism molecules enhancing glucose import and therapeutic uses thereof |
WO2020037066A1 (en) | 2018-08-14 | 2020-02-20 | Unum Therapeutics Inc. | Chimeric antigen receptor polypeptides in combination with trans metabolism molecules modulating krebs cycle and therapeutic uses thereof |
WO2020051493A1 (en) | 2018-09-07 | 2020-03-12 | Unum Therapeutics Inc. | Chimeric receptor polypeptides in combination with trans metabolism molecules modulating intracellular lactate concentrations and therapeutic uses thereof |
WO2023049933A1 (en) | 2021-09-27 | 2023-03-30 | Sotio Biotech Inc. | Chimeric receptor polypeptides in combination with trans metabolism molecules that re-direct glucose metabolites out of the glycolysis pathway and therapeutic uses thereof |
Non-Patent Citations (76)
Title |
---|
"Antibodies: a practice approach", 1988, IRL PRESS |
"Cell and Tissue Culture: Laboratory Procedures", 1993, J. WILEY AND SONS |
"Current Protocols in Immunology", 1991 |
"DNA Cloning: A practical Approach", vol. I, II, 1985 |
"Gene Transfer Vectors for Mammalian Cells", 1987, HUMANA PRESS |
"Handbook of Experimental Immunology", 1994, ACADEMIC PRESS, INC. |
"Harrison's Principles of Internal Medicine", 2001, MCGRAW HILL |
"Immobilized Cells and Enzymes", 1986, LRL PRESS |
"Remington's The Science and Practice of Pharmacy", 2000, LIPPINCOTT WILLIAMS AND WILKINS |
"The Antibodies", 1995, HARWOOD ACADEMIC PUBLISHERS |
"The Merck Manual of Diagnosis and Therapy", 1992, MERCK RESEARCH LABORATORIES |
ALTSCHUL ET AL., J MOL BIOL, vol. 215, no. 3, 1990, pages 403 - 410 |
ALTSCHUL ET AL., NUCLEIC ACIDS RES, vol. 25, no. 17, 1997, pages 3389 - 3402 |
B. PERBAL ET AL.: "A practical Guide To Molecular Cloning", 1984 |
BETTINI ET AL., J IMMUNOL, vol. 199, no. 5, 2017, pages 1555 - 1560 |
BRENTJENS ET AL., BLOOD, vol. 118, no. 18, 2011, pages 4817 - 4828 |
BRENTJENS ET AL., SCI TRANSL MED, vol. 5, no. 177, 2013, pages 177ra138 |
BRENTJENSLATOUCHE ET AL., NAT MED, vol. 9, no. 3, 2003, pages 279 - 286 |
C. A. JANEWAYP. TRAVERS, IMMUNOBIOLOGY, 1997 |
CAO ET AL., ANGEW CHEM INT ED ENGL, vol. 55, no. 26, 2016, pages 7520 - 7524 |
CARMELIETJAIN, NATURE, vol. 407, no. 6801, 2000, pages 249 - 257 |
CARTELLIERI ET AL., BLOOD CANCER J, vol. 6, no. 8, 2016, pages e458 |
CHO ET AL., CELL, vol. 173, no. 6, 2018, pages 1426 - 1438 |
COATS ET AL., CLINICAL CANCER RESEARCH, vol. 25, no. 18, 2019, pages 5441 - 5448 |
COOPER ET AL., BLOOD, vol. 101, no. 4, 2003, pages 1637 - 1644 |
E. HARLOWD. LANE: "Using antibodies: a laboratory manual", 1999, COLD SPRING HARBOR LABORATORY PRESS |
ESHHAR ET AL., PROC NATL ACAD SCI USA, vol. 90, no. 2, 1993, pages 720 - 724 |
FEHNIGERCALIGIURI, INT REV IMMUNOL, vol. 20, no. 3-4, 2001, pages 503 - 534 |
FU ET AL., SIGNAL TRANSDUCTION AND TARGETED THERAPY, vol. 7, no. 1, 2022, pages 93 |
GEIGER ET AL., THE JOURNAL OF IMMUNOLOGY, vol. 162, no. 10, 1999, pages 5931 - 5939 |
GONG ET AL., J HEMATOL ONCOL, vol. 14, no. 1, 2021, pages 73 |
GUBIN ET AL., J CLIN INVEST, vol. 125, no. 9, 2015, pages 3413 - 3421 |
HARADA ET AL., EXP HEMATOL,, vol. 32, no. 7, 2004, pages 614 - 621 |
HARADA ET AL., JPN J CANCER RES, vol. 93, no. 3, 2002, pages 313 - 319 |
HICKMAN T L ET AL: "BOXR1030, an anti-GPC3 CAR with exogenous GOT2 expression, shows enhanced T cell metabolism and improved anti-cell line derived tumor xenograft activity.", PLOS ONE, vol. 17, no. 5, E0266980, 4 May 2022 (2022-05-04), XP093019390, ISSN: 1932-6203 * |
IMAI ET AL., LEUKEMIA, vol. 18, no. 4, 2004, pages 676 - 684 |
J. P. MATHERP. E. ROBERTS: "Introduction to Cell and Tissue Culture", 1998, PLENUM PRESS |
JAYARAMAN ET AL., EBIOMEDICINE, vol. 58, 2020, pages 102931 |
KALLUNKI ET AL., CELLS, vol. 8, no. 8, 2019, pages 796 |
KARLINALTSCHUL, PROC NATL ACAD SCI U S A, vol. 87, no. 6, 1990, pages 2264 - 2268 |
KARLINALTSCHUL, PROC NATL ACAD SCI U S A, vol. 90, no. 12, 1993, pages 5873 - 5877 |
KIM ET AL., JAM CHEM SOC, vol. 137, no. 8, 2015, pages 2832 - 2835 |
KIM ET AL., JOURNAL OF MOLECULAR EVOLUTION, vol. 53, no. 1, 2001, pages 1 - 9 |
KIM, LEE ET AL., PLOS ONE, vol. 6, no. 4, 2011, pages e18556 |
KLEIN ET AL., INT J CANCER, vol. 18, no. 4, 1976, pages 421 - 431 |
KOCHENDERFER ET AL., BLOOD, vol. 119, no. 17, 2012, pages 3940 - 3950 |
KUDO ET AL., CANCER RES, vol. 74, no. 1, 2014, pages 93 - 103 |
KUO ET AL., BLOOD, vol. 82, no. 3, 1993, pages 845 - 852 |
LI ET AL., CELL STEM CELL, vol. 23, no. 2, 2018, pages 181 - 192 |
LINNEMANN ET AL., NAT MED, vol. 21, no. 1, 2015, pages 81 - 85 |
LIU ET AL., LEUKEMIA, vol. 32, no. 2, 2018, pages 520 - 531 |
LOHMUELLER, HAM ET AL., ONCOIMMUNOLOGY, vol. 7, no. 1, 2017, pages e1368604 |
LOZZIOLOZZIO, BLOOD, vol. 45, no. 3, 1975, pages 321 - 334 |
MA ET AL., PROC NATL ACAD SCI USA, vol. 113, no. 4, 2016, pages E450 - 458 |
MA, KIM ET AL., PROC NATL ACAD SCI U S A, vol. 113, no. 4, 2016, pages E450 - 458 |
MANN ET AL., CELL, vol. 33, no. 1, 1983, pages 153 - 159 |
MARKOWITZ ET AL., J VIROL, vol. 62, no. 4, 1988, pages 1120 - 1124 |
MULLARD, NAT REV DRUG DISCOV, vol. 12, no. 5, 2013, pages 329 - 332 |
P. FINCH, ANTIBODIES, 1997 |
PALLMEOXENIUS, FRONT IMMUNOL, vol. 7, 2016, pages 251 |
PORTER ET AL., NEW ENGLAND JOURNAL OF MEDICINE, vol. 365, no. 8, 2011, pages 725 - 733 |
PULE ET AL., NAT MED, vol. 14, no. 11, 2008, pages 1264 - 1270 |
RABINOVICHKOMAROVSKAYA ET AL., HUMAN GENE THERAPY, vol. 17, no. 10, 2006, pages 1027 - 1035 |
ROSENBERGHUANG, CURR OPIN CHEM ENG, vol. 19, 2018, pages 9 - 20 |
SAMBROOK ET AL.: "Molecular Cloning: A Laboratory Manual", 1989, COLD SPRING HARBOR LABORATORY PRESS |
SCHMIDT ET AL., FRONT IMMUNOL, vol. 11, 2020, pages 611163 |
SHANK ET AL., PHARMACOTHERAPY, vol. 37, no. 3, 2017, pages 334 - 345 |
TAMADA ET AL., CLIN CANCER RES, vol. 18, no. 23, 2012, pages 6436 - 6445 |
THOMSON P D RMONTVALE N.J.: "Physician's Desk Reference", 2005 |
URBANSKA ET AL., CANCER RES, vol. 72, no. 7, 2012, pages 1844 - 1852 |
UZHACHENKOSHANKER, FRONT IMMUNOL, vol. 10, 2019, pages 1906 |
WANG, JIANG ET AL., CANCER LETT, vol. 472, 2020, pages 175 - 180 |
WRONA ET AL., INT J MOL SCI,, vol. 22, no. 11, 2021 |
WRONABOROWIEC ET AL., INT J MOL SCI, vol. 22, no. 11, 2021 |
YING ET AL., NAT MED, vol. 25, no. 6, 2019, pages 947 - 953 |
ZHAO ET AL., ACTA PHARMACEUTICA SINICA B,, vol. 10, no. 9, 2020, pages 1589 - 1600 |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
US11549099B2 (en) | Cell secreted minibodies and uses thereof | |
US10144770B2 (en) | Chimeric receptors and uses thereof in immune therapy | |
CN113260368B (en) | Combination of anti-GPC 3 Chimeric Antigen Receptor (CAR) and trans-costimulatory molecules and therapeutic uses thereof | |
US20210340219A1 (en) | Chimeric receptor polypeptides in combination with trans metabolism molecules modulating intracellular lactate concentrations and therapeutic uses thereof | |
KR20210030950A (en) | Chimeric receptors in combination with trans metabolic molecules that enhance glucose uptake and their therapeutic uses | |
US20170281682A1 (en) | Chimeric receptors and uses thereof in immune therapy | |
JP7456638B2 (en) | Chimeric antigen receptor polypeptides combined with transmetabolic molecules that modulate the Krebs cycle and their therapeutic uses | |
WO2023049933A1 (en) | Chimeric receptor polypeptides in combination with trans metabolism molecules that re-direct glucose metabolites out of the glycolysis pathway and therapeutic uses thereof | |
US20210261646A1 (en) | Chimeric receptors in combination with trans metabolism molecules enhancing glucose import and therapeutic uses thereof | |
WO2020028572A2 (en) | ANTIBODY-COUPLED T CELL RECEPTORS (ACTRs) IN COMBINATION WITH TRANS CO-STIMULATORY MOLECULES AND THERAPEUTIC USES THEREOF | |
US20240026293A1 (en) | Methods and Compositions for Cells Expressing a Chimeric Intracellular Signaling Molecule | |
WO2024040207A1 (en) | Genetically engineered natural killer (nk) cells with chimeric receptor polypeptides in combination with trans metabolism molecules and therapeutic uses thereof | |
WO2024040208A1 (en) | Genetically engineered immune cells with chimeric receptor polypeptides in combination with multiple trans metabolism molecules and therapeutic uses thereof | |
US20240123068A1 (en) | Cd19 binders, car-t constructs comprising the same, and methods of using the same |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23776529 Country of ref document: EP Kind code of ref document: A1 |