WO2024040037A1 - Scutellaria extracts and uses thereof - Google Patents
Scutellaria extracts and uses thereof Download PDFInfo
- Publication number
- WO2024040037A1 WO2024040037A1 PCT/US2023/072188 US2023072188W WO2024040037A1 WO 2024040037 A1 WO2024040037 A1 WO 2024040037A1 US 2023072188 W US2023072188 W US 2023072188W WO 2024040037 A1 WO2024040037 A1 WO 2024040037A1
- Authority
- WO
- WIPO (PCT)
- Prior art keywords
- scutellaria
- subject
- extract
- ocmulgee
- administration
- Prior art date
Links
- 241000207929 Scutellaria Species 0.000 title claims abstract description 86
- 239000000284 extract Substances 0.000 title claims abstract description 70
- 238000000034 method Methods 0.000 claims abstract description 33
- HIMJIPRMECETLJ-UHFFFAOYSA-N Wogonin Natural products COc1cc(O)c(O)c2C(=O)C=C(Oc12)c3ccccc3 HIMJIPRMECETLJ-UHFFFAOYSA-N 0.000 claims abstract description 27
- XLTFNNCXVBYBSX-UHFFFAOYSA-N wogonin Chemical compound COC1=C(O)C=C(O)C(C(C=2)=O)=C1OC=2C1=CC=CC=C1 XLTFNNCXVBYBSX-UHFFFAOYSA-N 0.000 claims abstract description 27
- 210000000577 adipose tissue Anatomy 0.000 claims abstract description 25
- OKKJLVBELUTLKV-UHFFFAOYSA-N Methanol Chemical compound OC OKKJLVBELUTLKV-UHFFFAOYSA-N 0.000 claims description 57
- 239000000203 mixture Substances 0.000 claims description 39
- XLYOFNOQVPJJNP-UHFFFAOYSA-N water Substances O XLYOFNOQVPJJNP-UHFFFAOYSA-N 0.000 claims description 25
- 230000002829 reductive effect Effects 0.000 claims description 18
- 230000011759 adipose tissue development Effects 0.000 claims description 7
- 230000026731 phosphorylation Effects 0.000 claims description 7
- 238000006366 phosphorylation reaction Methods 0.000 claims description 7
- 210000004027 cell Anatomy 0.000 description 26
- 239000003814 drug Substances 0.000 description 25
- RTIXKCRFFJGDFG-UHFFFAOYSA-N chrysin Chemical compound C=1C(O)=CC(O)=C(C(C=2)=O)C=1OC=2C1=CC=CC=C1 RTIXKCRFFJGDFG-UHFFFAOYSA-N 0.000 description 23
- 150000001875 compounds Chemical class 0.000 description 23
- 229940002612 prodrug Drugs 0.000 description 23
- 239000000651 prodrug Substances 0.000 description 23
- -1 isomers Substances 0.000 description 22
- 210000001789 adipocyte Anatomy 0.000 description 20
- 239000003795 chemical substances by application Substances 0.000 description 20
- 208000037265 diseases, disorders, signs and symptoms Diseases 0.000 description 19
- 230000001225 therapeutic effect Effects 0.000 description 18
- 229940079593 drug Drugs 0.000 description 17
- 150000003839 salts Chemical class 0.000 description 17
- IAZDPXIOMUYVGZ-UHFFFAOYSA-N Dimethylsulphoxide Chemical compound CS(C)=O IAZDPXIOMUYVGZ-UHFFFAOYSA-N 0.000 description 15
- 230000009286 beneficial effect Effects 0.000 description 15
- 230000000694 effects Effects 0.000 description 14
- 238000011282 treatment Methods 0.000 description 14
- 208000008589 Obesity Diseases 0.000 description 12
- 235000001014 amino acid Nutrition 0.000 description 12
- 229940024606 amino acid Drugs 0.000 description 12
- 235000020824 obesity Nutrition 0.000 description 12
- NYCXYKOXLNBYID-UHFFFAOYSA-N 5,7-Dihydroxychromone Natural products O1C=CC(=O)C=2C1=CC(O)=CC=2O NYCXYKOXLNBYID-UHFFFAOYSA-N 0.000 description 11
- 235000015838 chrysin Nutrition 0.000 description 11
- 229940043370 chrysin Drugs 0.000 description 11
- 230000037396 body weight Effects 0.000 description 10
- 150000002148 esters Chemical class 0.000 description 9
- 241000196324 Embryophyta Species 0.000 description 8
- 230000004071 biological effect Effects 0.000 description 8
- 229910052805 deuterium Inorganic materials 0.000 description 8
- NOESYZHRGYRDHS-UHFFFAOYSA-N insulin Chemical compound N1C(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(NC(=O)CN)C(C)CC)CSSCC(C(NC(CO)C(=O)NC(CC(C)C)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CCC(N)=O)C(=O)NC(CC(C)C)C(=O)NC(CCC(O)=O)C(=O)NC(CC(N)=O)C(=O)NC(CC=2C=CC(O)=CC=2)C(=O)NC(CSSCC(NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2C=CC(O)=CC=2)NC(=O)C(CC(C)C)NC(=O)C(C)NC(=O)C(CCC(O)=O)NC(=O)C(C(C)C)NC(=O)C(CC(C)C)NC(=O)C(CC=2NC=NC=2)NC(=O)C(CO)NC(=O)CNC2=O)C(=O)NCC(=O)NC(CCC(O)=O)C(=O)NC(CCCNC(N)=N)C(=O)NCC(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC=CC=3)C(=O)NC(CC=3C=CC(O)=CC=3)C(=O)NC(C(C)O)C(=O)N3C(CCC3)C(=O)NC(CCCCN)C(=O)NC(C)C(O)=O)C(=O)NC(CC(N)=O)C(O)=O)=O)NC(=O)C(C(C)CC)NC(=O)C(CO)NC(=O)C(C(C)O)NC(=O)C1CSSCC2NC(=O)C(CC(C)C)NC(=O)C(NC(=O)C(CCC(N)=O)NC(=O)C(CC(N)=O)NC(=O)C(NC(=O)C(N)CC=1C=CC=CC=1)C(C)C)CC1=CN=CN1 NOESYZHRGYRDHS-UHFFFAOYSA-N 0.000 description 8
- 239000002207 metabolite Substances 0.000 description 8
- 108090000765 processed proteins & peptides Proteins 0.000 description 8
- 108090000623 proteins and genes Proteins 0.000 description 8
- 150000001408 amides Chemical class 0.000 description 7
- 239000012634 fragment Substances 0.000 description 7
- 125000002887 hydroxy group Chemical group [H]O* 0.000 description 7
- 150000002632 lipids Chemical class 0.000 description 7
- 229920001184 polypeptide Polymers 0.000 description 7
- 102000004196 processed proteins & peptides Human genes 0.000 description 7
- 102000004169 proteins and genes Human genes 0.000 description 7
- 230000009467 reduction Effects 0.000 description 7
- 239000002904 solvent Substances 0.000 description 7
- 229940124597 therapeutic agent Drugs 0.000 description 7
- YZCKVEUIGOORGS-OUBTZVSYSA-N Deuterium Chemical compound [2H] YZCKVEUIGOORGS-OUBTZVSYSA-N 0.000 description 6
- 239000002253 acid Substances 0.000 description 6
- 150000001413 amino acids Chemical class 0.000 description 6
- 201000010099 disease Diseases 0.000 description 6
- 230000002401 inhibitory effect Effects 0.000 description 6
- 230000004962 physiological condition Effects 0.000 description 6
- 230000002265 prevention Effects 0.000 description 6
- 239000013543 active substance Substances 0.000 description 5
- 230000004069 differentiation Effects 0.000 description 5
- 239000003925 fat Substances 0.000 description 5
- 229910052739 hydrogen Inorganic materials 0.000 description 5
- 239000001257 hydrogen Substances 0.000 description 5
- 238000001727 in vivo Methods 0.000 description 5
- 210000000229 preadipocyte Anatomy 0.000 description 5
- 238000006467 substitution reaction Methods 0.000 description 5
- CIWBSHSKHKDKBQ-JLAZNSOCSA-N Ascorbic acid Chemical compound OC[C@H](O)[C@H]1OC(=O)C(O)=C1O CIWBSHSKHKDKBQ-JLAZNSOCSA-N 0.000 description 4
- 102000004877 Insulin Human genes 0.000 description 4
- 108090001061 Insulin Proteins 0.000 description 4
- 206010033307 Overweight Diseases 0.000 description 4
- YASAKCUCGLMORW-UHFFFAOYSA-N Rosiglitazone Chemical compound C=1C=CC=NC=1N(C)CCOC(C=C1)=CC=C1CC1SC(=O)NC1=O YASAKCUCGLMORW-UHFFFAOYSA-N 0.000 description 4
- 229910052799 carbon Inorganic materials 0.000 description 4
- HVYWMOMLDIMFJA-DPAQBDIFSA-N cholesterol Chemical compound C1C=C2C[C@@H](O)CC[C@]2(C)[C@@H]2[C@@H]1[C@@H]1CC[C@H]([C@H](C)CCCC(C)C)[C@@]1(C)CC2 HVYWMOMLDIMFJA-DPAQBDIFSA-N 0.000 description 4
- 238000009472 formulation Methods 0.000 description 4
- 229940125396 insulin Drugs 0.000 description 4
- 239000000463 material Substances 0.000 description 4
- 230000000116 mitigating effect Effects 0.000 description 4
- 231100000252 nontoxic Toxicity 0.000 description 4
- 230000003000 nontoxic effect Effects 0.000 description 4
- 230000000069 prophylactic effect Effects 0.000 description 4
- 230000004044 response Effects 0.000 description 4
- 239000012453 solvate Substances 0.000 description 4
- CSCPPACGZOOCGX-UHFFFAOYSA-N Acetone Chemical compound CC(C)=O CSCPPACGZOOCGX-UHFFFAOYSA-N 0.000 description 3
- OKTJSMMVPCPJKN-UHFFFAOYSA-N Carbon Chemical compound [C] OKTJSMMVPCPJKN-UHFFFAOYSA-N 0.000 description 3
- 239000006144 Dulbecco’s modified Eagle's medium Substances 0.000 description 3
- LFQSCWFLJHTTHZ-UHFFFAOYSA-N Ethanol Chemical compound CCO LFQSCWFLJHTTHZ-UHFFFAOYSA-N 0.000 description 3
- WSFSSNUMVMOOMR-UHFFFAOYSA-N Formaldehyde Chemical compound O=C WSFSSNUMVMOOMR-UHFFFAOYSA-N 0.000 description 3
- PEDCQBHIVMGVHV-UHFFFAOYSA-N Glycerine Chemical compound OCC(O)CO PEDCQBHIVMGVHV-UHFFFAOYSA-N 0.000 description 3
- DGAQECJNVWCQMB-PUAWFVPOSA-M Ilexoside XXIX Chemical compound C[C@@H]1CC[C@@]2(CC[C@@]3(C(=CC[C@H]4[C@]3(CC[C@@H]5[C@@]4(CC[C@@H](C5(C)C)OS(=O)(=O)[O-])C)C)[C@@H]2[C@]1(C)O)C)C(=O)O[C@H]6[C@@H]([C@H]([C@@H]([C@H](O6)CO)O)O)O.[Na+] DGAQECJNVWCQMB-PUAWFVPOSA-M 0.000 description 3
- KFZMGEQAYNKOFK-UHFFFAOYSA-N Isopropanol Chemical compound CC(C)O KFZMGEQAYNKOFK-UHFFFAOYSA-N 0.000 description 3
- 229910019142 PO4 Inorganic materials 0.000 description 3
- 239000002202 Polyethylene glycol Substances 0.000 description 3
- 239000002585 base Substances 0.000 description 3
- 239000003153 chemical reaction reagent Substances 0.000 description 3
- 125000004122 cyclic group Chemical group 0.000 description 3
- 208000035475 disorder Diseases 0.000 description 3
- 239000003937 drug carrier Substances 0.000 description 3
- 238000002474 experimental method Methods 0.000 description 3
- 238000000605 extraction Methods 0.000 description 3
- 229930003935 flavonoid Natural products 0.000 description 3
- 150000002215 flavonoids Chemical class 0.000 description 3
- 235000017173 flavonoids Nutrition 0.000 description 3
- 239000003112 inhibitor Substances 0.000 description 3
- 230000005764 inhibitory process Effects 0.000 description 3
- 230000000155 isotopic effect Effects 0.000 description 3
- 239000007788 liquid Substances 0.000 description 3
- 239000010452 phosphate Substances 0.000 description 3
- 229920001223 polyethylene glycol Polymers 0.000 description 3
- 238000002360 preparation method Methods 0.000 description 3
- 230000035755 proliferation Effects 0.000 description 3
- 229910052708 sodium Inorganic materials 0.000 description 3
- 239000011734 sodium Substances 0.000 description 3
- 239000007787 solid Substances 0.000 description 3
- 208000024891 symptom Diseases 0.000 description 3
- RTZKZFJDLAIYFH-UHFFFAOYSA-N Diethyl ether Chemical compound CCOCC RTZKZFJDLAIYFH-UHFFFAOYSA-N 0.000 description 2
- DHMQDGOQFOQNFH-UHFFFAOYSA-N Glycine Chemical compound NCC(O)=O DHMQDGOQFOQNFH-UHFFFAOYSA-N 0.000 description 2
- 102000002254 Glycogen Synthase Kinase 3 Human genes 0.000 description 2
- 108010014905 Glycogen Synthase Kinase 3 Proteins 0.000 description 2
- 241000282412 Homo Species 0.000 description 2
- UFHFLCQGNIYNRP-UHFFFAOYSA-N Hydrogen Chemical compound [H][H] UFHFLCQGNIYNRP-UHFFFAOYSA-N 0.000 description 2
- 206010020772 Hypertension Diseases 0.000 description 2
- 238000008214 LDL Cholesterol Methods 0.000 description 2
- 241000699666 Mus <mouse, genus> Species 0.000 description 2
- NPGIHFRTRXVWOY-UHFFFAOYSA-N Oil red O Chemical compound Cc1ccc(C)c(c1)N=Nc1cc(C)c(cc1C)N=Nc1c(O)ccc2ccccc12 NPGIHFRTRXVWOY-UHFFFAOYSA-N 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-N Phosphoric acid Chemical compound OP(O)(O)=O NBIIXXVUZAFLBC-UHFFFAOYSA-N 0.000 description 2
- ZLMJMSJWJFRBEC-UHFFFAOYSA-N Potassium Chemical compound [K] ZLMJMSJWJFRBEC-UHFFFAOYSA-N 0.000 description 2
- 241000519987 Scutellaria alpina Species 0.000 description 2
- 240000004534 Scutellaria baicalensis Species 0.000 description 2
- 235000017089 Scutellaria baicalensis Nutrition 0.000 description 2
- 241000915604 Scutellaria barbata Species 0.000 description 2
- 241000487138 Scutellaria integrifolia Species 0.000 description 2
- 241000632296 Scutellaria lateriflora Species 0.000 description 2
- 241001163126 Scutellaria montana Species 0.000 description 2
- 241000487136 Scutellaria racemosa Species 0.000 description 2
- 208000006011 Stroke Diseases 0.000 description 2
- 238000009825 accumulation Methods 0.000 description 2
- 125000000217 alkyl group Chemical group 0.000 description 2
- 239000005557 antagonist Substances 0.000 description 2
- 235000010323 ascorbic acid Nutrition 0.000 description 2
- 239000011668 ascorbic acid Substances 0.000 description 2
- 238000003556 assay Methods 0.000 description 2
- QVGXLLKOCUKJST-UHFFFAOYSA-N atomic oxygen Chemical compound [O] QVGXLLKOCUKJST-UHFFFAOYSA-N 0.000 description 2
- WPYMKLBDIGXBTP-UHFFFAOYSA-N benzoic acid group Chemical group C(C1=CC=CC=C1)(=O)O WPYMKLBDIGXBTP-UHFFFAOYSA-N 0.000 description 2
- 230000015572 biosynthetic process Effects 0.000 description 2
- 239000000872 buffer Substances 0.000 description 2
- 150000001732 carboxylic acid derivatives Chemical class 0.000 description 2
- 238000004113 cell culture Methods 0.000 description 2
- 230000003833 cell viability Effects 0.000 description 2
- 238000006243 chemical reaction Methods 0.000 description 2
- 235000012000 cholesterol Nutrition 0.000 description 2
- 208000029078 coronary artery disease Diseases 0.000 description 2
- 238000001514 detection method Methods 0.000 description 2
- 238000011161 development Methods 0.000 description 2
- 230000018109 developmental process Effects 0.000 description 2
- 206010012601 diabetes mellitus Diseases 0.000 description 2
- 239000003085 diluting agent Substances 0.000 description 2
- 239000000839 emulsion Substances 0.000 description 2
- 208000020694 gallbladder disease Diseases 0.000 description 2
- 229940093915 gynecological organic acid Drugs 0.000 description 2
- 150000002431 hydrogen Chemical class 0.000 description 2
- 238000003384 imaging method Methods 0.000 description 2
- 238000010874 in vitro model Methods 0.000 description 2
- 230000006698 induction Effects 0.000 description 2
- 239000004615 ingredient Substances 0.000 description 2
- 230000003834 intracellular effect Effects 0.000 description 2
- 230000005445 isotope effect Effects 0.000 description 2
- 230000000670 limiting effect Effects 0.000 description 2
- 150000007524 organic acids Chemical class 0.000 description 2
- 235000005985 organic acids Nutrition 0.000 description 2
- 201000008482 osteoarthritis Diseases 0.000 description 2
- 229910052760 oxygen Inorganic materials 0.000 description 2
- 239000001301 oxygen Substances 0.000 description 2
- 230000036961 partial effect Effects 0.000 description 2
- 239000008194 pharmaceutical composition Substances 0.000 description 2
- 239000000546 pharmaceutical excipient Substances 0.000 description 2
- NBIIXXVUZAFLBC-UHFFFAOYSA-K phosphate Chemical compound [O-]P([O-])([O-])=O NBIIXXVUZAFLBC-UHFFFAOYSA-K 0.000 description 2
- 239000002953 phosphate buffered saline Substances 0.000 description 2
- 102000040430 polynucleotide Human genes 0.000 description 2
- 108091033319 polynucleotide Proteins 0.000 description 2
- 239000002157 polynucleotide Substances 0.000 description 2
- 229920002981 polyvinylidene fluoride Polymers 0.000 description 2
- 238000002600 positron emission tomography Methods 0.000 description 2
- 229910052700 potassium Inorganic materials 0.000 description 2
- 239000011591 potassium Substances 0.000 description 2
- 239000002243 precursor Substances 0.000 description 2
- 230000008569 process Effects 0.000 description 2
- 235000018102 proteins Nutrition 0.000 description 2
- 229960004586 rosiglitazone Drugs 0.000 description 2
- JVXZRQGOGOXCEC-UHFFFAOYSA-N scutellarein Chemical compound C1=CC(O)=CC=C1C1=CC(=O)C2=C(O)C(O)=C(O)C=C2O1 JVXZRQGOGOXCEC-UHFFFAOYSA-N 0.000 description 2
- 238000002603 single-photon emission computed tomography Methods 0.000 description 2
- JUJBNYBVVQSIOU-UHFFFAOYSA-M sodium;4-[2-(4-iodophenyl)-3-(4-nitrophenyl)tetrazol-2-ium-5-yl]benzene-1,3-disulfonate Chemical compound [Na+].C1=CC([N+](=O)[O-])=CC=C1N1[N+](C=2C=CC(I)=CC=2)=NC(C=2C(=CC(=CC=2)S([O-])(=O)=O)S([O-])(=O)=O)=N1 JUJBNYBVVQSIOU-UHFFFAOYSA-M 0.000 description 2
- 241000894007 species Species 0.000 description 2
- 239000003381 stabilizer Substances 0.000 description 2
- 210000000130 stem cell Anatomy 0.000 description 2
- UCSJYZPVAKXKNQ-HZYVHMACSA-N streptomycin Chemical compound CN[C@H]1[C@H](O)[C@@H](O)[C@H](CO)O[C@H]1O[C@@H]1[C@](C=O)(O)[C@H](C)O[C@H]1O[C@@H]1[C@@H](NC(N)=N)[C@H](O)[C@@H](NC(N)=N)[C@H](O)[C@H]1O UCSJYZPVAKXKNQ-HZYVHMACSA-N 0.000 description 2
- 239000000126 substance Substances 0.000 description 2
- 230000004083 survival effect Effects 0.000 description 2
- 150000003505 terpenes Chemical class 0.000 description 2
- VZCYOOQTPOCHFL-UHFFFAOYSA-N trans-butenedioic acid Natural products OC(=O)C=CC(O)=O VZCYOOQTPOCHFL-UHFFFAOYSA-N 0.000 description 2
- 150000003626 triacylglycerols Chemical class 0.000 description 2
- 239000003981 vehicle Substances 0.000 description 2
- 210000000636 white adipocyte Anatomy 0.000 description 2
- BQCIDUSAKPWEOX-UHFFFAOYSA-N 1,1-Difluoroethene Chemical compound FC(F)=C BQCIDUSAKPWEOX-UHFFFAOYSA-N 0.000 description 1
- HNSDLXPSAYFUHK-UHFFFAOYSA-N 1,4-bis(2-ethylhexyl) sulfosuccinate Chemical compound CCCCC(CC)COC(=O)CC(S(O)(=O)=O)C(=O)OCC(CC)CCCC HNSDLXPSAYFUHK-UHFFFAOYSA-N 0.000 description 1
- KPGXRSRHYNQIFN-UHFFFAOYSA-L 2-oxoglutarate(2-) Chemical compound [O-]C(=O)CCC(=O)C([O-])=O KPGXRSRHYNQIFN-UHFFFAOYSA-L 0.000 description 1
- QTBSBXVTEAMEQO-UHFFFAOYSA-M Acetate Chemical compound CC([O-])=O QTBSBXVTEAMEQO-UHFFFAOYSA-M 0.000 description 1
- QGZKDVFQNNGYKY-UHFFFAOYSA-O Ammonium Chemical compound [NH4+] QGZKDVFQNNGYKY-UHFFFAOYSA-O 0.000 description 1
- 239000004475 Arginine Substances 0.000 description 1
- DCXYFEDJOCDNAF-UHFFFAOYSA-N Asparagine Natural products OC(=O)C(N)CC(N)=O DCXYFEDJOCDNAF-UHFFFAOYSA-N 0.000 description 1
- FXNFHKRTJBSTCS-UHFFFAOYSA-N Baicalein Natural products C=1C(=O)C=2C(O)=C(O)C(O)=CC=2OC=1C1=CC=CC=C1 FXNFHKRTJBSTCS-UHFFFAOYSA-N 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-M Bicarbonate Chemical compound OC([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-M 0.000 description 1
- 241000283690 Bos taurus Species 0.000 description 1
- COVZYZSDYWQREU-UHFFFAOYSA-N Busulfan Chemical compound CS(=O)(=O)OCCCCOS(C)(=O)=O COVZYZSDYWQREU-UHFFFAOYSA-N 0.000 description 1
- OYPRJOBELJOOCE-UHFFFAOYSA-N Calcium Chemical compound [Ca] OYPRJOBELJOOCE-UHFFFAOYSA-N 0.000 description 1
- 241000282472 Canis lupus familiaris Species 0.000 description 1
- 241000283707 Capra Species 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-L Carbonate Chemical compound [O-]C([O-])=O BVKZGUZCCUSVTD-UHFFFAOYSA-L 0.000 description 1
- KRKNYBCHXYNGOX-UHFFFAOYSA-K Citrate Chemical compound [O-]C(=O)CC(O)(CC([O-])=O)C([O-])=O KRKNYBCHXYNGOX-UHFFFAOYSA-K 0.000 description 1
- FBPFZTCFMRRESA-FSIIMWSLSA-N D-Glucitol Natural products OC[C@H](O)[C@H](O)[C@@H](O)[C@H](O)CO FBPFZTCFMRRESA-FSIIMWSLSA-N 0.000 description 1
- FBPFZTCFMRRESA-KVTDHHQDSA-N D-Mannitol Chemical compound OC[C@@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-KVTDHHQDSA-N 0.000 description 1
- FBPFZTCFMRRESA-JGWLITMVSA-N D-glucitol Chemical compound OC[C@H](O)[C@@H](O)[C@H](O)[C@H](O)CO FBPFZTCFMRRESA-JGWLITMVSA-N 0.000 description 1
- WQZGKKKJIJFFOK-QTVWNMPRSA-N D-mannopyranose Chemical compound OC[C@H]1OC(O)[C@@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-QTVWNMPRSA-N 0.000 description 1
- 239000004375 Dextrin Substances 0.000 description 1
- 229920001353 Dextrin Polymers 0.000 description 1
- FEWJPZIEWOKRBE-JCYAYHJZSA-N Dextrotartaric acid Chemical compound OC(=O)[C@H](O)[C@@H](O)C(O)=O FEWJPZIEWOKRBE-JCYAYHJZSA-N 0.000 description 1
- KCXVZYZYPLLWCC-UHFFFAOYSA-N EDTA Chemical compound OC(=O)CN(CC(O)=O)CCN(CC(O)=O)CC(O)=O KCXVZYZYPLLWCC-UHFFFAOYSA-N 0.000 description 1
- 241000283086 Equidae Species 0.000 description 1
- 241000282326 Felis catus Species 0.000 description 1
- VZCYOOQTPOCHFL-OWOJBTEDSA-N Fumaric acid Chemical compound OC(=O)\C=C\C(O)=O VZCYOOQTPOCHFL-OWOJBTEDSA-N 0.000 description 1
- 108010010803 Gelatin Proteins 0.000 description 1
- 208000032612 Glial tumor Diseases 0.000 description 1
- 206010018338 Glioma Diseases 0.000 description 1
- WQZGKKKJIJFFOK-GASJEMHNSA-N Glucose Natural products OC[C@H]1OC(O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-GASJEMHNSA-N 0.000 description 1
- 239000004471 Glycine Substances 0.000 description 1
- 102000019058 Glycogen Synthase Kinase 3 beta Human genes 0.000 description 1
- 108010051975 Glycogen Synthase Kinase 3 beta Proteins 0.000 description 1
- AEMRFAOFKBGASW-UHFFFAOYSA-N Glycolic acid Polymers OCC(O)=O AEMRFAOFKBGASW-UHFFFAOYSA-N 0.000 description 1
- 101150019946 Gsk3b gene Proteins 0.000 description 1
- VEXZGXHMUGYJMC-UHFFFAOYSA-N Hydrochloric acid Chemical compound Cl VEXZGXHMUGYJMC-UHFFFAOYSA-N 0.000 description 1
- AVXURJPOCDRRFD-UHFFFAOYSA-N Hydroxylamine Chemical compound ON AVXURJPOCDRRFD-UHFFFAOYSA-N 0.000 description 1
- 108060003951 Immunoglobulin Proteins 0.000 description 1
- ODKSFYDXXFIFQN-BYPYZUCNSA-P L-argininium(2+) Chemical compound NC(=[NH2+])NCCC[C@H]([NH3+])C(O)=O ODKSFYDXXFIFQN-BYPYZUCNSA-P 0.000 description 1
- DCXYFEDJOCDNAF-REOHCLBHSA-N L-asparagine Chemical compound OC(=O)[C@@H](N)CC(N)=O DCXYFEDJOCDNAF-REOHCLBHSA-N 0.000 description 1
- ZDXPYRJPNDTMRX-VKHMYHEASA-N L-glutamine Chemical compound OC(=O)[C@@H](N)CCC(N)=O ZDXPYRJPNDTMRX-VKHMYHEASA-N 0.000 description 1
- KDXKERNSBIXSRK-YFKPBYRVSA-N L-lysine Chemical compound NCCCC[C@H](N)C(O)=O KDXKERNSBIXSRK-YFKPBYRVSA-N 0.000 description 1
- 241000207923 Lamiaceae Species 0.000 description 1
- WHXSMMKQMYFTQS-UHFFFAOYSA-N Lithium Chemical compound [Li] WHXSMMKQMYFTQS-UHFFFAOYSA-N 0.000 description 1
- KDXKERNSBIXSRK-UHFFFAOYSA-N Lysine Natural products NCCCCC(N)C(O)=O KDXKERNSBIXSRK-UHFFFAOYSA-N 0.000 description 1
- 239000004472 Lysine Substances 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-L Malonate Chemical compound [O-]C(=O)CC([O-])=O OFOBLEOULBTSOW-UHFFFAOYSA-L 0.000 description 1
- OFOBLEOULBTSOW-UHFFFAOYSA-N Malonic acid Chemical compound OC(=O)CC(O)=O OFOBLEOULBTSOW-UHFFFAOYSA-N 0.000 description 1
- 241000124008 Mammalia Species 0.000 description 1
- 229930195725 Mannitol Natural products 0.000 description 1
- 241001465754 Metazoa Species 0.000 description 1
- AFVFQIVMOAPDHO-UHFFFAOYSA-N Methanesulfonic acid Chemical class CS(O)(=O)=O AFVFQIVMOAPDHO-UHFFFAOYSA-N 0.000 description 1
- 241000699670 Mus sp. Species 0.000 description 1
- 229910002651 NO3 Inorganic materials 0.000 description 1
- NHNBFGGVMKEFGY-UHFFFAOYSA-N Nitrate Chemical compound [O-][N+]([O-])=O NHNBFGGVMKEFGY-UHFFFAOYSA-N 0.000 description 1
- IPQKDIRUZHOIOM-UHFFFAOYSA-N Oroxin A Natural products OC1C(O)C(O)C(CO)OC1OC(C(=C1O)O)=CC2=C1C(=O)C=C(C=1C=CC=CC=1)O2 IPQKDIRUZHOIOM-UHFFFAOYSA-N 0.000 description 1
- 241000283973 Oryctolagus cuniculus Species 0.000 description 1
- MUBZPKHOEPUJKR-UHFFFAOYSA-N Oxalic acid Chemical compound OC(=O)C(O)=O MUBZPKHOEPUJKR-UHFFFAOYSA-N 0.000 description 1
- 241001494479 Pecora Species 0.000 description 1
- 229930182555 Penicillin Natural products 0.000 description 1
- JGSARLDLIJGVTE-MBNYWOFBSA-N Penicillin G Chemical compound N([C@H]1[C@H]2SC([C@@H](N2C1=O)C(O)=O)(C)C)C(=O)CC1=CC=CC=C1 JGSARLDLIJGVTE-MBNYWOFBSA-N 0.000 description 1
- 108091005804 Peptidases Proteins 0.000 description 1
- 239000004952 Polyamide Substances 0.000 description 1
- 229920002732 Polyanhydride Polymers 0.000 description 1
- 229920000954 Polyglycolide Polymers 0.000 description 1
- 241000288906 Primates Species 0.000 description 1
- XBDQKXXYIPTUBI-UHFFFAOYSA-M Propionate Chemical compound CCC([O-])=O XBDQKXXYIPTUBI-UHFFFAOYSA-M 0.000 description 1
- 239000004365 Protease Substances 0.000 description 1
- 241000700159 Rattus Species 0.000 description 1
- 102100037486 Reverse transcriptase/ribonuclease H Human genes 0.000 description 1
- 102000007562 Serum Albumin Human genes 0.000 description 1
- 108010071390 Serum Albumin Proteins 0.000 description 1
- FAPWRFPIFSIZLT-UHFFFAOYSA-M Sodium chloride Chemical compound [Na+].[Cl-] FAPWRFPIFSIZLT-UHFFFAOYSA-M 0.000 description 1
- QAOWNCQODCNURD-UHFFFAOYSA-L Sulfate Chemical compound [O-]S([O-])(=O)=O QAOWNCQODCNURD-UHFFFAOYSA-L 0.000 description 1
- YZCKVEUIGOORGS-NJFSPNSNSA-N Tritium Chemical compound [3H] YZCKVEUIGOORGS-NJFSPNSNSA-N 0.000 description 1
- 238000002679 ablation Methods 0.000 description 1
- 238000002835 absorbance Methods 0.000 description 1
- 230000002378 acidificating effect Effects 0.000 description 1
- 150000007513 acids Chemical class 0.000 description 1
- 230000004913 activation Effects 0.000 description 1
- 230000002411 adverse Effects 0.000 description 1
- 229910052783 alkali metal Inorganic materials 0.000 description 1
- 150000001340 alkali metals Chemical class 0.000 description 1
- 229910052784 alkaline earth metal Inorganic materials 0.000 description 1
- 150000001342 alkaline earth metals Chemical class 0.000 description 1
- 229930013930 alkaloid Natural products 0.000 description 1
- 125000003282 alkyl amino group Chemical group 0.000 description 1
- 230000029936 alkylation Effects 0.000 description 1
- 238000005804 alkylation reaction Methods 0.000 description 1
- 229910000147 aluminium phosphate Inorganic materials 0.000 description 1
- 230000009435 amidation Effects 0.000 description 1
- 238000007112 amidation reaction Methods 0.000 description 1
- 150000001412 amines Chemical class 0.000 description 1
- 125000003277 amino group Chemical group 0.000 description 1
- APKFDSVGJQXUKY-INPOYWNPSA-N amphotericin B Chemical compound O[C@H]1[C@@H](N)[C@H](O)[C@@H](C)O[C@H]1O[C@H]1/C=C/C=C/C=C/C=C/C=C/C=C/C=C/[C@H](C)[C@@H](O)[C@@H](C)[C@H](C)OC(=O)C[C@H](O)C[C@H](O)CC[C@@H](O)[C@H](O)C[C@H](O)C[C@](O)(C[C@H](O)[C@H]2C(O)=O)O[C@H]2C1 APKFDSVGJQXUKY-INPOYWNPSA-N 0.000 description 1
- 238000004458 analytical method Methods 0.000 description 1
- 150000008064 anhydrides Chemical class 0.000 description 1
- 150000001450 anions Chemical class 0.000 description 1
- 230000001093 anti-cancer Effects 0.000 description 1
- 230000001857 anti-mycotic effect Effects 0.000 description 1
- 239000002543 antimycotic Substances 0.000 description 1
- 239000003963 antioxidant agent Substances 0.000 description 1
- 235000006708 antioxidants Nutrition 0.000 description 1
- XADJWCRESPGUTB-UHFFFAOYSA-N apigenin Natural products C1=CC(O)=CC=C1C1=CC(=O)C2=CC(O)=C(O)C=C2O1 XADJWCRESPGUTB-UHFFFAOYSA-N 0.000 description 1
- 235000008714 apigenin Nutrition 0.000 description 1
- KZNIFHPLKGYRTM-UHFFFAOYSA-N apigenin Chemical compound C1=CC(O)=CC=C1C1=CC(=O)C2=C(O)C=C(O)C=C2O1 KZNIFHPLKGYRTM-UHFFFAOYSA-N 0.000 description 1
- 229940117893 apigenin Drugs 0.000 description 1
- ODKSFYDXXFIFQN-UHFFFAOYSA-N arginine Natural products OC(=O)C(N)CCCNC(N)=N ODKSFYDXXFIFQN-UHFFFAOYSA-N 0.000 description 1
- 229940072107 ascorbate Drugs 0.000 description 1
- 229960005070 ascorbic acid Drugs 0.000 description 1
- 229960001230 asparagine Drugs 0.000 description 1
- 235000009582 asparagine Nutrition 0.000 description 1
- 238000003149 assay kit Methods 0.000 description 1
- 125000004429 atom Chemical group 0.000 description 1
- UDFLTIRFTXWNJO-UHFFFAOYSA-N baicalein Chemical compound O1C2=CC(=O)C(O)=C(O)C2=C(O)C=C1C1=CC=CC=C1 UDFLTIRFTXWNJO-UHFFFAOYSA-N 0.000 description 1
- 229940015301 baicalein Drugs 0.000 description 1
- IKIIZLYTISPENI-ZFORQUDYSA-N baicalin Chemical compound O1[C@H](C(O)=O)[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1OC(C(=C1O)O)=CC2=C1C(=O)C=C(C=1C=CC=CC=1)O2 IKIIZLYTISPENI-ZFORQUDYSA-N 0.000 description 1
- 229960003321 baicalin Drugs 0.000 description 1
- AQHDANHUMGXSJZ-UHFFFAOYSA-N baicalin Natural products OC1C(O)C(C(O)CO)OC1OC(C(=C1O)O)=CC2=C1C(=O)C=C(C=1C=CC=CC=1)O2 AQHDANHUMGXSJZ-UHFFFAOYSA-N 0.000 description 1
- 150000007514 bases Chemical class 0.000 description 1
- 230000008901 benefit Effects 0.000 description 1
- WQZGKKKJIJFFOK-VFUOTHLCSA-N beta-D-glucose Chemical compound OC[C@H]1O[C@@H](O)[C@H](O)[C@@H](O)[C@@H]1O WQZGKKKJIJFFOK-VFUOTHLCSA-N 0.000 description 1
- 229920002988 biodegradable polymer Polymers 0.000 description 1
- 239000004621 biodegradable polymer Substances 0.000 description 1
- 210000001593 brown adipocyte Anatomy 0.000 description 1
- 150000001669 calcium Chemical class 0.000 description 1
- 229910052791 calcium Inorganic materials 0.000 description 1
- 239000011575 calcium Substances 0.000 description 1
- 150000001720 carbohydrates Chemical class 0.000 description 1
- 235000014633 carbohydrates Nutrition 0.000 description 1
- BVKZGUZCCUSVTD-UHFFFAOYSA-N carbonic acid Chemical compound OC(O)=O BVKZGUZCCUSVTD-UHFFFAOYSA-N 0.000 description 1
- 230000006315 carbonylation Effects 0.000 description 1
- 238000005810 carbonylation reaction Methods 0.000 description 1
- 125000003178 carboxy group Chemical class [H]OC(*)=O 0.000 description 1
- 150000001735 carboxylic acids Chemical class 0.000 description 1
- 239000000969 carrier Substances 0.000 description 1
- 230000004663 cell proliferation Effects 0.000 description 1
- 238000001516 cell proliferation assay Methods 0.000 description 1
- 239000002738 chelating agent Substances 0.000 description 1
- 239000007979 citrate buffer Substances 0.000 description 1
- 239000013068 control sample Substances 0.000 description 1
- 238000002425 crystallisation Methods 0.000 description 1
- 230000008025 crystallization Effects 0.000 description 1
- WZHCOOQXZCIUNC-UHFFFAOYSA-N cyclandelate Chemical compound C1C(C)(C)CC(C)CC1OC(=O)C(O)C1=CC=CC=C1 WZHCOOQXZCIUNC-UHFFFAOYSA-N 0.000 description 1
- 239000007857 degradation product Substances 0.000 description 1
- 230000002939 deleterious effect Effects 0.000 description 1
- UREBDLICKHMUKA-CXSFZGCWSA-N dexamethasone Chemical compound C1CC2=CC(=O)C=C[C@]2(C)[C@]2(F)[C@@H]1[C@@H]1C[C@@H](C)[C@@](C(=O)CO)(O)[C@@]1(C)C[C@@H]2O UREBDLICKHMUKA-CXSFZGCWSA-N 0.000 description 1
- 229960003957 dexamethasone Drugs 0.000 description 1
- 235000019425 dextrin Nutrition 0.000 description 1
- 150000004985 diamines Chemical class 0.000 description 1
- FDPIMTJIUBPUKL-UHFFFAOYSA-N dimethylacetone Natural products CCC(=O)CC FDPIMTJIUBPUKL-UHFFFAOYSA-N 0.000 description 1
- LOKCTEFSRHRXRJ-UHFFFAOYSA-I dipotassium trisodium dihydrogen phosphate hydrogen phosphate dichloride Chemical compound P(=O)(O)(O)[O-].[K+].P(=O)(O)([O-])[O-].[Na+].[Na+].[Cl-].[K+].[Cl-].[Na+] LOKCTEFSRHRXRJ-UHFFFAOYSA-I 0.000 description 1
- 150000002016 disaccharides Chemical class 0.000 description 1
- 238000012377 drug delivery Methods 0.000 description 1
- 235000013399 edible fruits Nutrition 0.000 description 1
- 230000032050 esterification Effects 0.000 description 1
- 238000005886 esterification reaction Methods 0.000 description 1
- 229940124600 folk medicine Drugs 0.000 description 1
- 125000000524 functional group Chemical group 0.000 description 1
- 229920000159 gelatin Polymers 0.000 description 1
- 239000008273 gelatin Substances 0.000 description 1
- 235000019322 gelatine Nutrition 0.000 description 1
- 235000011852 gelatine desserts Nutrition 0.000 description 1
- 239000008103 glucose Substances 0.000 description 1
- ZDXPYRJPNDTMRX-UHFFFAOYSA-N glutamine Natural products OC(=O)C(N)CCC(N)=O ZDXPYRJPNDTMRX-UHFFFAOYSA-N 0.000 description 1
- 229930182470 glycoside Natural products 0.000 description 1
- 150000002338 glycosides Chemical class 0.000 description 1
- 125000005241 heteroarylamino group Chemical group 0.000 description 1
- 108091008147 housekeeping proteins Proteins 0.000 description 1
- 125000004435 hydrogen atom Chemical group [H]* 0.000 description 1
- 229920001477 hydrophilic polymer Polymers 0.000 description 1
- 102000018358 immunoglobulin Human genes 0.000 description 1
- 229940072221 immunoglobulins Drugs 0.000 description 1
- 238000000099 in vitro assay Methods 0.000 description 1
- 238000005462 in vivo assay Methods 0.000 description 1
- 239000005414 inactive ingredient Substances 0.000 description 1
- 238000011534 incubation Methods 0.000 description 1
- 210000001596 intra-abdominal fat Anatomy 0.000 description 1
- 230000004068 intracellular signaling Effects 0.000 description 1
- 238000007917 intracranial administration Methods 0.000 description 1
- 238000007918 intramuscular administration Methods 0.000 description 1
- 238000007912 intraperitoneal administration Methods 0.000 description 1
- 238000001990 intravenous administration Methods 0.000 description 1
- 238000007914 intraventricular administration Methods 0.000 description 1
- 239000003446 ligand Substances 0.000 description 1
- 125000005647 linker group Chemical group 0.000 description 1
- 229910052744 lithium Inorganic materials 0.000 description 1
- 238000011068 loading method Methods 0.000 description 1
- 159000000003 magnesium salts Chemical class 0.000 description 1
- 230000031852 maintenance of location in cell Effects 0.000 description 1
- VZCYOOQTPOCHFL-UPHRSURJSA-N maleic acid Chemical compound OC(=O)\C=C/C(O)=O VZCYOOQTPOCHFL-UPHRSURJSA-N 0.000 description 1
- IWYDHOAUDWTVEP-UHFFFAOYSA-M mandelate Chemical compound [O-]C(=O)C(O)C1=CC=CC=C1 IWYDHOAUDWTVEP-UHFFFAOYSA-M 0.000 description 1
- 239000000594 mannitol Substances 0.000 description 1
- 235000010355 mannitol Nutrition 0.000 description 1
- 238000004519 manufacturing process Methods 0.000 description 1
- 238000005259 measurement Methods 0.000 description 1
- 239000012528 membrane Substances 0.000 description 1
- 230000002503 metabolic effect Effects 0.000 description 1
- 230000004060 metabolic process Effects 0.000 description 1
- 150000002772 monosaccharides Chemical class 0.000 description 1
- 230000007935 neutral effect Effects 0.000 description 1
- 239000002736 nonionic surfactant Substances 0.000 description 1
- 239000003960 organic solvent Substances 0.000 description 1
- 230000003647 oxidation Effects 0.000 description 1
- 238000007254 oxidation reaction Methods 0.000 description 1
- 229940049954 penicillin Drugs 0.000 description 1
- 230000003285 pharmacodynamic effect Effects 0.000 description 1
- 230000000144 pharmacologic effect Effects 0.000 description 1
- 239000008363 phosphate buffer Substances 0.000 description 1
- 239000007981 phosphate-citrate buffer Substances 0.000 description 1
- UEZVMMHDMIWARA-UHFFFAOYSA-M phosphonate Chemical compound [O-]P(=O)=O UEZVMMHDMIWARA-UHFFFAOYSA-M 0.000 description 1
- 238000005954 phosphonylation reaction Methods 0.000 description 1
- 229920000747 poly(lactic acid) Polymers 0.000 description 1
- 229920002647 polyamide Polymers 0.000 description 1
- 229920000728 polyester Polymers 0.000 description 1
- 239000004626 polylactic acid Substances 0.000 description 1
- 239000001267 polyvinylpyrrolidone Substances 0.000 description 1
- 229920000036 polyvinylpyrrolidone Polymers 0.000 description 1
- 235000013855 polyvinylpyrrolidone Nutrition 0.000 description 1
- 230000002285 radioactive effect Effects 0.000 description 1
- 238000006722 reduction reaction Methods 0.000 description 1
- 238000011160 research Methods 0.000 description 1
- 239000000523 sample Substances 0.000 description 1
- 229930182490 saponin Natural products 0.000 description 1
- 235000017709 saponins Nutrition 0.000 description 1
- 150000007949 saponins Chemical class 0.000 description 1
- 239000011780 sodium chloride Substances 0.000 description 1
- 230000007928 solubilization Effects 0.000 description 1
- 238000005063 solubilization Methods 0.000 description 1
- 239000000243 solution Substances 0.000 description 1
- 239000000600 sorbitol Substances 0.000 description 1
- 238000010186 staining Methods 0.000 description 1
- 238000010561 standard procedure Methods 0.000 description 1
- 150000003431 steroids Chemical class 0.000 description 1
- 230000000638 stimulation Effects 0.000 description 1
- 238000003860 storage Methods 0.000 description 1
- 229960005322 streptomycin Drugs 0.000 description 1
- 238000007920 subcutaneous administration Methods 0.000 description 1
- 210000004003 subcutaneous fat Anatomy 0.000 description 1
- 125000001424 substituent group Chemical group 0.000 description 1
- 239000000758 substrate Substances 0.000 description 1
- KDYFGRWQOYBRFD-UHFFFAOYSA-L succinate(2-) Chemical compound [O-]C(=O)CCC([O-])=O KDYFGRWQOYBRFD-UHFFFAOYSA-L 0.000 description 1
- 150000005846 sugar alcohols Chemical class 0.000 description 1
- 150000003457 sulfones Chemical class 0.000 description 1
- 235000011149 sulphuric acid Nutrition 0.000 description 1
- 239000013589 supplement Substances 0.000 description 1
- 235000007586 terpenes Nutrition 0.000 description 1
- 238000012360 testing method Methods 0.000 description 1
- 150000003568 thioethers Chemical class 0.000 description 1
- 210000001519 tissue Anatomy 0.000 description 1
- 238000003354 tissue distribution assay Methods 0.000 description 1
- JOXIMZWYDAKGHI-UHFFFAOYSA-N toluene-4-sulfonic acid Chemical compound CC1=CC=C(S(O)(=O)=O)C=C1 JOXIMZWYDAKGHI-UHFFFAOYSA-N 0.000 description 1
- 230000000699 topical effect Effects 0.000 description 1
- 125000002088 tosyl group Chemical group [H]C1=C([H])C(=C([H])C([H])=C1C([H])([H])[H])S(*)(=O)=O 0.000 description 1
- 230000002110 toxicologic effect Effects 0.000 description 1
- 231100000027 toxicology Toxicity 0.000 description 1
- 229910052722 tritium Inorganic materials 0.000 description 1
- 230000017260 vegetative to reproductive phase transition of meristem Effects 0.000 description 1
- 230000003442 weekly effect Effects 0.000 description 1
- 239000013585 weight reducing agent Substances 0.000 description 1
- 238000001262 western blot Methods 0.000 description 1
- 239000000080 wetting agent Substances 0.000 description 1
Classifications
-
- A—HUMAN NECESSITIES
- A61—MEDICAL OR VETERINARY SCIENCE; HYGIENE
- A61K—PREPARATIONS FOR MEDICAL, DENTAL OR TOILETRY PURPOSES
- A61K36/00—Medicinal preparations of undetermined constitution containing material from algae, lichens, fungi or plants, or derivatives thereof, e.g. traditional herbal medicines
- A61K36/18—Magnoliophyta (angiosperms)
- A61K36/185—Magnoliopsida (dicotyledons)
- A61K36/53—Lamiaceae or Labiatae (Mint family), e.g. thyme, rosemary or lavender
- A61K36/539—Scutellaria (skullcap)
-
- C—CHEMISTRY; METALLURGY
- C07—ORGANIC CHEMISTRY
- C07D—HETEROCYCLIC COMPOUNDS
- C07D311/00—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings
- C07D311/02—Heterocyclic compounds containing six-membered rings having one oxygen atom as the only hetero atom, condensed with other rings ortho- or peri-condensed with carbocyclic rings or ring systems
- C07D311/04—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring
- C07D311/22—Benzo[b]pyrans, not hydrogenated in the carbocyclic ring with oxygen or sulfur atoms directly attached in position 4
Definitions
- the present disclosure relates to Scutellaria extracts and uses thereof.
- Figures 1 A-l C show that Scutellaria Ocmulgee Leaf (SocL) extract inhibits white adipogenesis without significantly inhibiting the proliferation of the pre-adipocyte 3T3-L1 cells.
- Figure 1A shows representative figures of 3T3-L1 cell culture in the absence (control) or presence of SocL extract (500 pg/ml).
- Figure IB shows quantitative measurement of the oil-red uptake by differentiated cells after solubilization of the stain in 2-isopropanol.
- Figure 1C shows proliferation/survival of 3T3-L1 cells in the presence of SocL extract, as determined by WST-1 dye conversion assay. *p > 0.05 versus vehicle control.
- FIG. 2 shows that SocL extract inhibits insulin-induced phosphorylation of GSK-3P in 3T3-L1 cells.
- Total GSK-3P (middle panel) and P-actin (lower panel) are controls for unphosphorylated (total) protein and house-keeping protein, respectively.
- a method of reducing body fat and/or body fat gain in a subject in need thereof that includes administering to the subject a therapeutically effective amount of an extract of Scutellaria ocmulgee, wherein the extract comprises wogonin.
- the extract is obtained from a Scutellaria ocmulgee leaf, a Scutellaria ocmulgee stem, or a Scutellaria ocmulgee root.
- the extract is obtained from a Scutellaria ocmulgee leaf.
- the extract can be obtained by contacting Scutellaria ocmulgee with a mixture of methanol and water.
- the ratio of methanol and water is between about 60:40 and 95:5. In some aspects, the ratio of methanol and water is about 80:20.
- the concentration of wogonin in the extract is at least 0. 1 pg/mg.
- Administration of the extract of Scutellaria ocmulgee reduces adipogenesis in the subject, in some embodiments. In other or further embodiments, administration of the extract of Scutellaria ocmulgee reduces phosphorylation of GSK-3P in a cell in the subject. Accordingly, the subject can be obese or overweight prior to the administration.
- the subject’s body mass index (BMI) is reduced after the administration. In other or further embodiments, the subject’s body fat percentage is reduced after the administration. In some embodiments, the subject’s weight is reduced after the administration, whereas in other embodiments, the subject’s weight is maintained after the administration.
- BMI body mass index
- SoCL Scutellaria Ocmulgee leaf
- a cell includes a plurality of cells, including mixtures thereof.
- Adipocyte refers to a cell specialized for the storage of fat. Adipocytes include white adipocytes, brown adipocytes and beige adipocytes. In some embodiments, the adipocyte is a white adipocyte.
- adipogenesis refers to the formation of adipocytes from precursor stem cells via differentiation of the precursor stem cells.
- administering to a subject includes any route of introducing or delivering to a subject an agent. Administration can be carried out by any suitable route, including oral, topical, intravenous, subcutaneous, transcutaneous, transdermal, intramuscular, intra-joint, parenteral, intra-arteriole, intradermal, intraventricular, intracranial, intraperitoneal, intralesional, intranasal, rectal, vaginal, by inhalation, via an implanted reservoir, or via a transdermal patch, and the like. Administration includes self-administration and the administration by another.
- beneficial agent and “active agent” are used interchangeably herein to refer to a chemical compound or composition that has a beneficial biological effect.
- beneficial biological effects include both therapeutic effects, i.e., treatment of a disorder or other undesirable physiological condition, and prophylactic effects, i.e., prevention of a disorder or other undesirable physiological condition.
- the terms also encompass pharmaceutically acceptable, pharmacologically active derivatives of beneficial agents specifically mentioned herein, including, but not limited to, salts, esters, amides, prodrugs, active metabolites, isomers, fragments, analogs, and the like.
- biocompatible generally refers to a material and any metabolites or degradation products thereof that are generally non-toxic to the recipient and do not cause significant adverse effects to the subject.
- body fat refers to fat or lipid stores in a subject’s body.
- composition refers to any agent that has a beneficial biological effect.
- beneficial biological effects include both therapeutic effects, e.g., treatment of a disorder or other undesirable physiological condition, and prophylactic effects, e.g., prevention of a disorder or other undesirable physiological condition.
- the terms also encompass pharmaceutically acceptable, pharmacologically active derivatives of beneficial agents specifically mentioned herein, including, but not limited to, a vector, polynucleotide, cells, salts, esters, amides, proagents, active metabolites, isomers, fragments, analogs, and the like.
- composition includes the composition per se as well as pharmaceutically acceptable, pharmacologically active vector, polynucleotide, salts, esters, amides, proagents, conjugates, active metabolites, isomers, fragments, analogs, etc.
- Contacting Placement in direct physical association, for example solid, liquid or gaseous forms. Contacting includes, for example, direct physical association of fully- and partially- solvated molecules.
- control is an alternative subject or sample used in an experiment for comparison purposes.
- a control can be "positive” or “negative.”
- an “effective amount” of a therapeutic agent is meant a nontoxic but sufficient amount of a beneficial agent to provide the desired effect.
- the amount of beneficial agent that is “effective” will vary from subject to subject, depending on the age and general condition of the subject, the particular beneficial agent or agents, and the like. Thus, it is not always possible to specify an exact “effective amount.” However, an appropriate “effective” amount in any subject case may be determined by one of ordinary skill in the art using routine experimentation. Also, as used herein, and unless specifically stated otherwise, an “effective amount” of a beneficial can also refer to an amount covering both therapeutically effective amounts and prophylactically effective amounts.
- “Inhibit”, “inhibiting,” and “inhibition” mean to decrease an activity, response, condition, disease, or other biological parameter. This can include but is not limited to the complete ablation of the activity, response, condition, or disease. This may also include, for example, a 10% reduction in the activity, response, condition, or disease as compared to the native or control level. Thus, the reduction can be a 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between as compared to native or control levels.
- Inhibitors of expression or of activity are used to refer to inhibitory molecules, respectively, identified using in vitro and in vivo assays for expression or activity of a described target protein, e.g., ligands, antagonists, and their homologs and mimetics. Inhibitors are agents that, e.g., inhibit expression or bind to, partially or totally block stimulation or protease activity, decrease, prevent, delay activation, inactivate, desensitize, or down regulate the activity of the described target protein, e.g., antagonists.
- a control sample (untreated with inhibitors) are assigned a relative activity value of 100%. Inhibition of a described target protein is achieved when the activity value relative to the control is about 80%, optionally 50% or 25, 10%, 5% or 1%.
- “obese” and “obesity” refer to a subject having a body mass index of 30.0 or higher. “Overweight” refers to a subject having a body mass index of 25.0 to 30.0.
- “Pharmaceutically acceptable” component can refer to a component that is not biologically or otherwise undesirable, i.e., the component may be incorporated into a pharmaceutical formulation of the invention and administered to a subject as described herein without causing significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the formulation in which it is contained.
- the term When used in reference to administration to a human, the term generally implies the component has met the required standards of toxicological and manufacturing testing or that it is included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug Administration.
- “Pharmaceutically acceptable carrier” (sometimes referred to as a “carrier”) means a carrier or excipient that is useful in preparing a pharmaceutical or therapeutic composition that is generally safe and non-toxic, and includes a earner that is acceptable for veterinary and/or human pharmaceutical or therapeutic use.
- carrier or “pharmaceutically acceptable carrier” can include, but are not limited to, phosphate buffered saline solution, water, emulsions (such as an oil/water or water/oil emulsion) and/or various types of wetting agents.
- carrier encompasses any excipient, diluent, fdler, salt, buffer, stabilizer, solubilizer, lipid, stabilizer, or other material well known in the art for use in pharmaceutical formulations.
- the choice of a earner for use in a composition will depend upon the intended route of administration for the composition.
- the preparation of pharmaceutically acceptable carriers and formulations containing these materials is described in, e.g., Remington's Pharmaceutical Sciences, 21st Edition, ed. University of the Sciences in Philadelphia, Lippincott, Williams & Wilkins, Philadelphia, PA, 2005.
- physiologically acceptable carriers include saline, glycerol, DMSO, buffers such as phosphate buffers, citrate buffer, and buffers with other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEENTM (ICI, Inc.; Bridgewater, New Jersey), polyethylene glycol (PEG), and PLURONICSTM (BASF; Florham Park, NJ).
- buffers such as phosphate buffer
- the term “pharmacologically active” can refer to a derivative or analog (e g., a salt, ester, amide, conjugate, metabolite, isomer, fragment, etc.) having the same type of pharmacological activity as the parent compound and approximately equivalent in degree.
- subject is defined herein to include animals such as mammals, including, but not limited to, primates (e.g., humans), cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice and the like. In some embodiments, the subject is a human.
- treat include partially or completely delaying, alleviating, mitigating or reducing the intensity of one or more attendant symptoms of a disorder or condition and/or alleviating, mitigating or impeding one or more causes of a disorder or condition.
- Treatments according to the invention may be applied preventively, palliatively or remedially. Treatments can be administered to a subject prior to onset (e g., before obvious signs of obesity), during early onset (e g., upon initial signs and symptoms of obesity), or after an established development of a disease or disorder (e.g., obesity). Prophylactic administration can occur for several days to years prior to the manifestation of symptoms of a disease or disorder.
- “Therapeutic agent” refers to any composition that has a beneficial biological effect.
- Beneficial biological effects include both therapeutic effects, e.g., treatment of a disorder or other undesirable physiological condition, and prophylactic effects, e.g., prevention of a disorder or other undesirable physiological condition.
- the terms also encompass pharmaceutically acceptable, pharmacologically active derivatives of beneficial agents specifically mentioned herein, including, but not limited to, salts, esters, amides, proagents, active metabolites, isomers, fragments, analogs, and the like.
- therapeutic agent when used, then, or when a particular agent is specifically identified, it is to be understood that the term includes the agent per se as well as pharmaceutically acceptable, pharmacologically active salts, esters, amides, proagents, conjugates, active metabolites, isomers, fragments, analogs, etc.
- “Therapeutically effective amount” or “therapeutically effective dose” of a composition refers to an amount that is effective to achieve a desired therapeutic result.
- Therapeutically effective amounts of a given therapeutic agent will typically vary with respect to factors such as the type and severity of the disorder or disease being treated and the age, gender, and weight of the subject.
- the term can also refer to an amount of a therapeutic agent, or a rate of delivery of a therapeutic agent (e.g., amount over time), effective to facilitate a desired therapeutic effect, such as a reduced number of adipocytes in a subject.
- a desired therapeutic effect will vary according to the condition to be treated, the tolerance of the subject, the agent and/or agent formulation to be administered (e g., the potency of the therapeutic agent, the concentration of agent in the formulation, and the like), and a variety of other factors that are appreciated by those of ordinary skill in the art.
- a desired biological or medical response is achieved following administration of multiple dosages of the composition to the subject over a period of days, weeks, or years.
- a method of reducing body fat gain in a subject in need comprising administering to the subject a therapeutically effective amount of an extract of Scutellaria (for example, Scutellaria Ocmulgee), wherein the extract comprises flavonoid wogonin and terpenoids.
- the extract of Scutellaria has surprising effects of reducing formation of new adipocytes in the subject.
- the compositions and methods reduce the weight and/or BMI of a subject in need.
- the methods treat obesity in a subject in need.
- Scutellaria is a member of the mint family which has been used in traditional Chinese medicine (TCM) as well as in Native American folk medicine. Scutellaria family members are also known as skullcaps.
- the species of Scutellaria include, for example, Scutellaria baicalensis, Scutellaria barbata, Scutellaria alpina, Scutellaria angulosa, Scutellaria costaricana, Scutellaria integrifolia, Scutellaria lateriflora, Scutellaria montana, Scutellaria ocmulgee, Scutellaria ovata, Scutellaria racemosa, Scutellaria scandens, and Scutellaria suffrutescens .
- the method disclosed herein comprises administering to the subject a therapeutically effective amount of an extract of Scutellaria, wherein the extract is obtained from a species of Scutellaria selected from the group consisting of Scutellaria ocmulgee, Scutellaria baicalensis, Scutellaria barbata, Scutellaria alpina, Scutellaria angulosa, Scutellaria costaricana, Scutellaria integrifolia, Scutellaria lateriflora, Scutellaria montana, Scutellaria ocmulgee, Scutellaria ovata, Scutellaria racemosa, Scutellaria scandens, and Scutellaria suffrutescens .
- the extract is obtained from Scutellaria ocmulgee.
- extract refers to a solid, viscid, or liquid substance or preparation that includes one or more active agents of a plant. Extraction of medicinal plants is a process of separating certain ingredients that possess biological activities, such as alkaloids, flavonoids, terpenes, saponins, steroids, and glycosides from inert or inactive material using an appropriate solvent and standard extraction procedure. The ingredients of interest are then solubilized and contained within the solvent. In some examples, the extract is obtained by contacting any part (e g., leaf) or combination parts of Scutellaria ocmulgee with a mixture of methanol and water.
- the extract is obtained by contacting any part (e g., leaf) or combination parts of Scutellaria ocmulgee with a mixture of methanol and water, wherein the ratio of methanol and water in the mixture is about 80:20. In some embodiments, the extract is obtained by contacting any part (e.g., leaf) or combination parts of Scutellaria ocmulgee using the methods described herein.
- the ratio of methanol and water is between about 60:40 and 95:5, about 70:30 and 90:10, about 75:25 and 85: 15, or about 78:22 and 82: 18. In some embodiments, the ratio of methanol and water (methanol: water) is about 80:20.
- the part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture is for about 1 to 60 minutes, about 5 to 30 minutes, about 10 to 20 minutes, or about 5 to 10 minutes. Tn some embodiments the part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture for about 5 to 10 minutes.
- the part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture at a temperature of between about 50 and 200 °C. In other or further embodiments, the part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture at a pressure of about 500 to 3000 psi. In certain aspects, the part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture for about 5 to 10 minutes, at a temperature of between about 50 and 200 °C, and at a pressure of about 500 to 3000 psi.
- the extract of Scutellaria can be derived from any part, or combination parts, of the Scutellaria plant, including, but not limited to, the root, leaf, fruit, flower, vine, and stalk.
- the extract is obtained from a Scutellaria leaf, a Scutellaria stem, or a Scutellaria root.
- the extract is obtained from a Scutellaria ocmulgee leaf, a Scutellaria ocmulgee stem, or a Scutellaria ocmulgee root.
- the extract is obtained from the Scutellaria ocmulgee leaf.
- the active agents obtained from Scutellaria include, but not limited to, apigenin, baicalein, baicalin, chrysin, scutellarein, and/or wogonin.
- the extract of Scutellaria ocmulgee comprises one or more active agents, including, for example, wogonin and/or chrysin.
- the extract of Scutellaria ocmulgee leaf or Scutellaria ocmulgee stem comprises wogonin.
- the extract of Scutellaria ocmulgee root comprises wogonin and/or chrysin having the below chemical structures. wogonin chrysin
- the wogonin and chrysin compounds described herein include tautomers and other isomers, such as retainers, as if each is specifically described, unless otherwise indicated or otherwise excluded by context.
- Pharmaceutically-acceptable salts and prodrugs of the disclosed wogonin and chrysin compounds include salts of the disclosed compounds that are prepared with acids or bases, depending on the particular substituents found on the compounds. Under conditions where the compounds disclosed herein are sufficiently basic or acidic to form stable nontoxic acid or base salts, administration of the compounds as salts can be appropriate.
- Examples of pharmaceutically-acceptable base addition salts include sodium, potassium, calcium, ammonium, or magnesium salt.
- physiologically-acceptable acid addition salts include hydrochloric, hydrobromic, nitric, phosphoric, carbonic, sulphuric, and organic acids like acetic, propionic, benzoic, succinic, fumaric, mandelic, oxalic, citric, tartaric, malonic, ascorbic, alpha-ketoglutaric, alphaglycophosphoric, maleic, tosyl acid, methanesulfonic, and the like.
- Pharmaceutically acceptable salts of a compound can be obtained using standard procedures well know n in the art, for example, by reacting a sufficiently basic compound such as an amine with a suitable acid affording a physiologically acceptable anion.
- Alkali metal (for example, sodium, potassium or lithium) or alkaline earth metal (for example calcium) salts of carboxylic acids can also be made.
- the present disclosure also includes wogonin and chrysin compounds with at least one desired isotopic substitution of an atom, at an amount above the natural abundance of the isotope, i.e., enriched.
- isotopes that can be incorporated into compounds of the present disclosure include isotopes of hydrogen, carbon, and oxygen, such as 2 H, 3 H, n C, 13 C, 17 O, and 18 O, respectively.
- isotopically labeled compounds can be used in metabolic studies (with 14 C), reaction kinetic studies (with, for example 2 H or 3 H), detection or imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug and substrate tissue distribution assays, or in radioactive treatment of patients.
- PET positron emission tomography
- SPECT single-photon emission computed tomography
- an 18 F labeled compound (such as by replacing a hydrogen with 18 F) may be particularly desirable for PET or SPECT studies.
- Isotopically labeled compounds of this invention and prodrugs thereof can generally be prepared by carrying out the procedures disclosed herein by substituting a readily available isotopically labeled reagent for a non-isotopically labeled reagent.
- isotopes of hydrogen for example deuterium ( 2 H) and tritium ( 3 H) may optionally be used anywhere in described structures that achieves the desired result.
- isotopes of carbon e g., 13 C and 14 C, may be used.
- the isotopic substitution is replacing hydrogen with a deuterium at one or more locations on the molecule to improve the performance of the molecule as a drug, for example, the pharmacodynamics, pharmacokinetics, biodistribution, half-life, stability, AUC, Tmax, Cmax, etc.
- the deuterium can be bound to carbon in allocation of bond breakage during metabolism (an alpha-deuterium kinetic isotope effect) or next to or near the site of bond breakage (a beta-deuterium kinetic isotope effect).
- Isotopic substitutions for example deuterium substitutions, can be partial or complete. Partial causingum substitution means that at least one hydrogen is substituted with deuterium.
- the isotope is 80, 85, 90, 95, or 99% or more enriched in an isotope at any location of interest.
- deuterium is 80, 85, 90, 95, or 99% enriched at a desired location. Unless otherwise stated, the enrichment at any point is above natural abundance, and in an embodiment is enough to alter a detectable property of the compounds as a drug in a human.
- the wogonin and chrysin compounds of the present disclosure may form a solvate with solvents (including water). Therefore, in one embodiment, the invention includes a solvated form of the active wogonin and/or chrysin compound.
- solvate refers to a molecular complex of a compound of the present invention (including a salt thereof) with one or more solvent molecules. Non-limiting examples of solvents are water, ethanol, dimethyl sulfoxide, acetone and other common organic solvents.
- hydrate refers to a molecular complex comprising a disclosed compound and water.
- solvates in accordance with the invention include those wherein the solvent of crystallization may be isotopically substituted, e g., D2O, de-acetone, or de-DMSO.
- a solvate can be in a liquid or solid form.
- a “prodrug” as used herein means a wogonin or chrysin compound which when administered to a host in vivo is converted into a parent drug.
- the term “parent drug” means the presently described compound herein.
- Prodrugs can be used to achieve any desired effect, including to enhance properties of the parent drug or to improve the pharmaceutic or pharmacokinetic properties of the parent, including to increase the half-life of the drug in vivo.
- Prodrug strategies provide choices in modulating the conditions for in vivo generation of the parent drug.
- Non-limiting examples of prodrug strategies include covalent attachment of removable groups, or removable portions of groups, for example, but not limited to, acylating, phosphorylation, phosphonylation, phosphorarmdate derivatives, amidation, reduction, oxidation, esterification, alkylation, other carboxy derivatives, sulfoxy or sulfone derivatives, carbonylation, or anhydrides, among others.
- the prodrug renders the parent compound more lipophilic.
- a prodrug can be provided that has several prodrug moieties in a linear, branched, or cyclic manner.
- non-limiting embodiments include the use of a divalent linker moiety such as a dicarboxylic acid, amino acid, diamine, hydroxy carboxylic acid, hydroxyamine, di-hydroxy compound, or other compound that has at least two functional groups that can link the parent compound with another prodrug moiety, and is typically biodegradable in vivo.
- a divalent linker moiety such as a dicarboxylic acid, amino acid, diamine, hydroxy carboxylic acid, hydroxyamine, di-hydroxy compound, or other compound that has at least two functional groups that can link the parent compound with another prodrug moiety, and is typically biodegradable in vivo.
- 2, 3, 4, or 5 prodrug biodegradable moieties are covalently bound in a sequence, branched, or cyclic fashion to the parent compound.
- Non-limiting examples of prodrugs according to the present disclosure are formed with: a hydroxyl group on the parent drug and a carboxylic acid on the prodrug moiety to form an ester; a hydroxyl on the parent drug and a hydroxylated prodrug moiety to form an ester; a hydroxyl on the parent drug and a phosphonate on the prodrug to form a phosphonate ester; a hydroxyl on the parent drug and a phosphoric acid prodrug moiety to form a phosphate ester; a hydroxyl on the parent drug and a prodrug of the structure HO-(CH2)2-O-(C'2-24 alkyl) to form an ether; a hydroxyl on the parent drug and a prodrug of the structure HO-(CH2)2-S-(C2-24 alkyl) to form an thioether; and a hydroxyl on the parent compound and a prodrug moiety that is a biodegradable polymer or oligo
- a prodrug is provided by attaching a natural or non-natural amino acid to an appropriate functional moiety on the parent wogonin and/or chrysin compound, for example, oxygen, usually in a manner such that the ammo acid is cleaved in vivo to provide the parent drug.
- the amino acid can be used alone or covalently linked (straight, branched or cyclic) to one or more other prodrug moieties to modify the parent drug to achieve the desired performance, such as increased half-life, lipophilicity, or other drug delivery or pharmacokinetic properties.
- the amino acid can be any compound with an amino group and a carboxylic acid, which includes an aliphatic amino acid, alkyl amino acid, aromatic amino acid, heteroaliphatic amino acid, heteroalkyl amino acid, heterocyclic amino acid, or heteroaryl amino acid.
- compositions and methods for reducing body fat and/or body fat gain in a subject in need comprising administering to the subject a therapeutically effective amount of a Scutellaria extract comprising wogonin.
- the methods reduce or inhibit an increase in the amount of body fat in a subject.
- the subject maintains a same body fat percentage and/or BM1 over time following the administration of the Scutellaria extract.
- the subject ’s bodyfat percentage and/or BMI is reduced over time following the administration of the Scutellaria extract.
- the subject’s body fat percentage is reduced by at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19% or 20%. In some embodiments, the subject’s body fat percentage is reduced by about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19% or 20%. In some embodiments, the subject’s body fat percentage is reduced by about 1% to 20%, 1-5%, 5%-10%, 10-15%, or 15-20%.
- the subject’s body fat percentage is reduced by about 20%-25% or 20%-30%. In some embodiments, the subject’s BMI is reduced by a number of 1-10 or 1-5 over time following the administration of the Scutellaria extract. In some embodiments, the subject’s BMI is reduced by 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. In some embodiments, the amount of time is 1 week, 2 weeks, 3 weeks or 4 weeks. In some embodiments, the amount of time is 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 1 1 months, or 12 months. In some embodiments the amount of time is 1 year, 2 years, 3 years, 4 years or 5 years. In some embodiments, the body fat is subcutaneous fat. In some embodiments, the body fat is visceral fat.
- the average number of adipocytes are maintained in the subject over time following the administration of the Scutellaria extract. In some embodiments, the average number of adipocytes are reduced in the subject over time following the administration of the Scutellaria extract. In some embodiments, there is a further treatment, prevention, reduction, and/or mitigation of an obesity associated disorder, including, for example, hypertension, high LDL cholesterol, low HDL cholesterol, high levels of triglycerides, diabetes, coronary heart disease, stroke, gallbladder disease, or osteoarthritis.
- an obesity associated disorder including, for example, hypertension, high LDL cholesterol, low HDL cholesterol, high levels of triglycerides, diabetes, coronary heart disease, stroke, gallbladder disease, or osteoarthritis.
- a method of treating obesity or reducing body fat gain in a subject in need comprising administering to the subject a therapeutically effective amount of an extract of Scutellaria ocmulgee, wherein the extract comprises wogonin.
- the concentration of wogonin in the extract may range from 0.001 pg/mg to 100 pg/mg, 0.01 pg/mg to 10 pg/mg, 0.05 pg/mg, to 5 pg/mg, 0.05 pg/mg to 1 pg/mg, 0.05 pg/mg to 0.5 pg/mg, or 0. 1 pg/mg to 0.5 pg/mg.
- the concentration of wogonin in the extract is about 0.001 pg/mg, about 0.01 pg/mg, about 0.05 pg/mg, about 0.1 pg/mg, about 0.2 pg/mg, about 0.5 pg/mg, about 1 pg/mg, about 5 pg/mg, or about 10 pg/mg.
- the extract further comprises chrysin.
- the concentration of chrysin in the extract may range from 0.001 pg/mg to 100 pg/mg, 0.01 pg/mg to 10 pg/mg, 0.05 pg/mg, to 5 pg/mg, 0.05 pg/mg to 1 pg/mg, 0.05 pg/mg to 0.5 pg/mg, or 0. 1 pg/mg to 0.5 pg/mg.
- the concentration of chrysin in the extract is about 0.001 pg/mg, about 0.01 pg/mg, about 0.05 pg/mg, about 0.1 pg/mg, about 0.2 pg/mg, about 0.5 pg/mg, about 1 pg/mg, about 5 pg/mg, or about 10 pg/mg.
- the therapeutically effective amount of wogonin or chrysin typically vary from about 0.001 mg/kg body weight to about 1000 mg/kg body weight, from about 0.01 mg/kg body weight to about 750 mg/kg body weight, from about 100 mg/kg body weight to about 500 mg/kg body weight, from about 1 mg/kg body weight to about 250 mg/kg body weight, from about 10 mg/kg body weight to about 150 mg/kg body weight in one or more dose administrations daily, for one or several days (depending of course of the mode of administration and the factors discussed above).
- Other suitable dose ranges include 1 mg to 10,000 mg per day, 100 mg to 10,000 mg per day, 500 mg to 10,000 mg per day, and 500 mg to 1,000 mg per day. In some embodiments, the amount is less than 10,000 mg per day with a range of 750 mg to 9,000 mg per day.
- a desired therapeutic result is inhibiting an increase in the amount of body fat in a subject.
- a desired therapeutic result is a reduced amount of fat in a subject.
- a desired therapeutic result is inhibiting an increase in the number of adipocytes in a subject.
- a desired therapeutic result is a reduced number of adipocytes in a subject.
- a desired therapeutic result is inhibiting an increase in the average adipocyte volume in a subject.
- a desired therapeutic result is reducing the average adipocyte volume in a subject. In some embodiments, a desired therapeutic result is a reduction of the subject’s body mass index (BMI). Tn some embodiments, a desired therapeutic result is a treatment, prevention, reduction, and/or mitigation of an obesity associated disorder, including, for example, hypertension, high LDL cholesterol, low HDL cholesterol, high levels of triglycerides, diabetes, coronary heart disease, stroke, gallbladder disease, or osteoarthritis. Accordingly, in some embodiments, the extract of Scutellaria (e.g., Scutellaria ocmulgee) inhibits an increase in or reduces the amount of adipocytes in the subject. In some embodiments, the extract of Scutellaria (e.g., Scutellaria ocmulgee) inhibits an increase in or reduces the body mass index (BMI) of the subject.
- BMI body mass index
- the extract of Scutellaria (e.g., Scutellaria ocmulgee) described herein can inhibit or reduce adipogenesis. In some embodiments, the extract of Scutellaria (e.g., Scutellaria ocmulgee) described herein can inhibit phosphorylation of GSK-3
- GSK-3P refers herein to a polypeptide that, in humans, is encoded by the GSK3B gene.
- the GSK3B polypeptide is that identified in one or more publicly available databases as follows: HGNC: 4617, NCBI Entrez Gene: 2932, Ensembl: ENSG00000082701, OMIM®: 605004, UniProtKB/Swiss-Prot: P49841.
- the GSK-3P polypeptide comprises the sequence of SEQ ID NO: 1, or a polypeptide sequence having at or greater than about 80%, about 85%, about 90%, about 95%, or about 98% homology with SEQ ID NO: 1, or a polypeptide comprising a portion of SEQ ID NO: 1.
- the GSK-3P polypeptide of SEQ ID NO: 1 may represent an immature or pre-processed form of mature GSK- 3P, and accordingly, included herein are mature or processed portions of the GSK-3P polypeptide in SEQ ID NO: 1.
- Dosing frequency for the composition disclosed herein includes, but is not limited to, at least once every 12 months, once every 1 1 months, once every 10 months, once every 9 months, once every 8 months, once every 7 months, once every 6 months, once every 5 months, once every 4 months, once every 3 months, once every two months, once every month; or at least once every three weeks, once every two weeks, once a week, twice a week, three times a week, four times a week, five times a week, six times a week, or daily.
- the interval between each administration is less than about 4 months, less than about 3 months, less than about 2 months, less than about a month, less than about 3 weeks, less than about 2 weeks, or less than less than about a week, such as less than about any of 6, 5, 4, 3, 2, or 1 day.
- the dosing frequency for the composition includes, but is not limited to, at least once a day, twice a day, or three times a day.
- the interval between each administration is less than about 48 hours, 36 hours, 24 hours, 22 hours, 20 hours, 18 hours, 16 hours, 14 hours, 12 hours, 10 hours, 9 hours, 8 hours, or 7 hours.
- the interval between each administration is less than about 24 hours, 22 hours, 20 hours, 18 hours, 16 hours, 14 hours, 12 hours, 10 hours, 9 hours, 8 hours, 7 hours, or 6 hours. In some embodiments, the interval between each administration is constant. For example, the administration can be carried out daily, every two days, every three days, every four days, every five days, or weekly. Administration can also be continuous and adjusted to maintaining a level of the compound within any desired and specified range.
- Plants were cultivated in the greenhouse conditions to minimize batch-to-batch variation. New plants were established through root divisions in March that reach maturity in May and leaves were harvested before the onset of flowering. The leaves were dried with constant turning in shade at room temperature to remove about 80% moisture. The dried leaves were then finely ground and processed for methanol: water (80:20) extraction using an ASE apparatus (Dionex Corporation, Sunnyvale, CA). The extracts were concentrated under vacuum using a Savant SpeedVac. The extract has been characterized and tested for anti-cancer activity against U87- MG glioma cell line and wogonin was used as an internal standard as described previously (Parajuli et al., 2009; Parajuli et al., 2011).
- the flavonoid wogonin (purity 98%) was purchased from Sigma Chemical Co. (St. Louis, MO). Wogonin was reconstituted in dimethyl sulfoxide (DMSO) and then diluted in appropriate media, as indicated. The final concentration of DMSO in the media for all experiments were ⁇ 0.1%. Therefore, 0.1% DMSO was used in the Control media for all experiments.
- DMSO dimethyl sulfoxide
- EXAMPLE 2 Mouse pre-adipocyte cell line.
- 3T3-L1 mouse pre-adipocyte cells
- 3T3-L1 cells obtained from ATCC
- DMEM fetal calf serum
- Anti bi otic/ anti mycotic penicillin /streptomycin /fungizone, Invitrogen
- 3T3-L1 cells were seeded in 96-well flat-bottom plates (2 xlO 4 cells/well) and cultured in the presence of varying doses of SocL extract. After incubation at 37°C for 3 days, cell viability was evaluated using the WST-1 assay kit (Clonetech Laboratories, Mountain View, CA) as per the manufacturer’s protocol. Cell viability /proliferation was expressed as a percent of vehicle control (cells cultured with DMSO alone). See Figure 1C.
- 3T3-L1 cells were seeded in 6-well plate and cultured with DMEM+10% FCS till confluence. Two days post confluence, (designed as Day 0), the cells were stimulated with Adipocyte Induction Media (AIM - DMEM supplemented with 10% FBS and containing 0.5mM IBMX, I LIM dexamethasone and lOpg/mL insulin and lOpM rosiglitazone) [All reagents were obtained from Sigma]. Media with respective supplements were replaced every two days.
- Adipocyte Induction Media AIM - DMEM supplemented with 10% FBS and containing 0.5mM IBMX, I LIM dexamethasone and lOpg/mL insulin and lOpM rosiglitazone
- EXAMPLE 5 Intracellular (GSK-3P) activity (phosphorylation) analysis via western blot assay.
- 3T3-L1 cells were seeded in 6-well plates and cultured with Insulin and rosiglitazone in the presence of SocL (200 pg/ml) for various timepoints, as indicated. The cells were then lysed, 20-30 pg aliquots of total protein were electrophoresed, transferred onto a poly vinylidene difluoride (PVDF) membrane, and probed with anti-GSK30 and anti-phospho-GSK3p antibodies. Detection of HRP-conjugated secondary Abs was performed using SuperSignal (Pierce, Rockford, IL) and chemiluminescence was recorded using an Omega imaging sy stem (UltraLum Inc., Claremont, CA) as per manufacturer's instructions. P-actin was used as the loading control. The density of protein bands was quantified using TmageJ software. See Figure 2.
- SocL extract significantly inhibited the process of adipogenesis in an in vitro model using the pre-adipocyte 3T3-L1 cells.
- the proliferation/survival of 3T3-L1 cells were however not significantly affected by SocL treatment.
Abstract
Provided herein are extracts of Scutellaria ocmulgee and methods of reducing body fat and/or body fat gain in a subject including administering to the subject a therapeutically effective amount of an extract of Scutellaria ocmulgee, wherein the extract comprises wogonin.
Description
SCUTELLARIA EXTRACTS AND USES THEREOF
CROSS-REFERENCE TO RELATED APPLICATIONS
This application claims the benefit of U.S. Provisional Application No. 63/398,351, filed August 16, 2022, which is expressly incorporated herein by reference in its entirety .
STATEMENT REGARDING FEDERALLY SPONSORED RESEARCH OR DEVELOPMENT
This invention was made with government support under CSREES Award # 2011-38821- 30928 awarded by the U.S Department of Agriculture (USDA). The government has certain rights in this invention.
FIELD
The present disclosure relates to Scutellaria extracts and uses thereof.
BACKGROUND
Obesity affects virtually all age and socioeconomic groups and threatens to overwhelm both developed and developing countnes. In 1995, there were an estimated 200 million obese adults worldwide and another 18 million under-five children classified as overweight. In 2016, more than 1.9 billion adults, 18 years and older, were overweight. Of these over 650 million were obese. A major cause and indication of obesity is an accumulation of adipose (fat) tissue, which in turn is caused by an increase in the number and size of adipocytes. Adipocytes differentiate from pre-adipocytic cells due to enhanced intracellular storage of fats in lipid droplets. What is needed is a composition and method for treating obesity, reducing body fat gain and/or reducing body fat in a subject. The compositions and methods disclosed herein address these and other needs.
DESCRIPTION OF DRAWINGS
Figures 1 A-l C show that Scutellaria Ocmulgee Leaf (SocL) extract inhibits white adipogenesis without significantly inhibiting the proliferation of the pre-adipocyte 3T3-L1 cells. Figure 1A shows representative figures of 3T3-L1 cell culture in the absence (control) or presence of SocL extract (500 pg/ml). Figure IB shows quantitative measurement of the oil-red uptake by differentiated cells after solubilization of the stain in 2-isopropanol. Figure 1C shows
proliferation/survival of 3T3-L1 cells in the presence of SocL extract, as determined by WST-1 dye conversion assay. *p > 0.05 versus vehicle control.
Figure 2 shows that SocL extract inhibits insulin-induced phosphorylation of GSK-3P in 3T3-L1 cells. Treatment with insulin induced phosphorylation of the intracellular signaling molecule GSK-3 in 3T3-L1 cells, which is significantly inhibited by SocL extract as early as 6h after treatment and the inhibition persists until 48h (upper panel). Total GSK-3P (middle panel) and P-actin (lower panel) are controls for unphosphorylated (total) protein and house-keeping protein, respectively.
SUMMARY
Provided herein is a method of reducing body fat and/or body fat gain in a subject in need thereof that includes administering to the subject a therapeutically effective amount of an extract of Scutellaria ocmulgee, wherein the extract comprises wogonin. In some aspects, the extract is obtained from a Scutellaria ocmulgee leaf, a Scutellaria ocmulgee stem, or a Scutellaria ocmulgee root. In some aspects, the extract is obtained from a Scutellaria ocmulgee leaf.
In some aspects, the extract can be obtained by contacting Scutellaria ocmulgee with a mixture of methanol and water. In some aspects, the ratio of methanol and water is between about 60:40 and 95:5. In some aspects, the ratio of methanol and water is about 80:20.
In some embodiments, the concentration of wogonin in the extract is at least 0. 1 pg/mg.
Administration of the extract of Scutellaria ocmulgee reduces adipogenesis in the subject, in some embodiments. In other or further embodiments, administration of the extract of Scutellaria ocmulgee reduces phosphorylation of GSK-3P in a cell in the subject. Accordingly, the subject can be obese or overweight prior to the administration.
In some embodiments, the subject’s body mass index (BMI) is reduced after the administration. In other or further embodiments, the subject’s body fat percentage is reduced after the administration. In some embodiments, the subject’s weight is reduced after the administration, whereas in other embodiments, the subject’s weight is maintained after the administration.
DETAILED DESCRIPTION
The present disclosure shows that Scutellaria Ocmulgee leaf (SoCL) extracts significantly inhibit adipocyte differentiation as indicated by reduced accumulation of lipid
droplets in the cells. This is a novel finding and indicates that SocL extract has an application in weight reduction and the treatment or prevention of obesity.
Terms used throughout this application are to be construed with ordinary and typical meaning to those of ordinary skill in the art. However, Applicants desire that the following terms be given the particular definition as provided below.
Terminology
As used in the specification and claims, the singular form "a," "an," and "the" include plural references unless the context clearly dictates otherwise. For example, the term "a cell" includes a plurality of cells, including mixtures thereof.
The term “about” as used herein when referring to a measurable value such as an amount, a percentage, and the like, is meant to encompass variations of ±20%, ±10%, ±5%, or ±1% from the measurable value.
“Adipocyte” refers to a cell specialized for the storage of fat. Adipocytes include white adipocytes, brown adipocytes and beige adipocytes. In some embodiments, the adipocyte is a white adipocyte.
As used herein, the word “adipogenesis” refers to the formation of adipocytes from precursor stem cells via differentiation of the precursor stem cells.
“Administration” to a subject includes any route of introducing or delivering to a subject an agent. Administration can be carried out by any suitable route, including oral, topical, intravenous, subcutaneous, transcutaneous, transdermal, intramuscular, intra-joint, parenteral, intra-arteriole, intradermal, intraventricular, intracranial, intraperitoneal, intralesional, intranasal, rectal, vaginal, by inhalation, via an implanted reservoir, or via a transdermal patch, and the like. Administration includes self-administration and the administration by another.
As used here, the terms “beneficial agent” and “active agent” are used interchangeably herein to refer to a chemical compound or composition that has a beneficial biological effect. Beneficial biological effects include both therapeutic effects, i.e., treatment of a disorder or other undesirable physiological condition, and prophylactic effects, i.e., prevention of a disorder or other undesirable physiological condition. The terms also encompass pharmaceutically acceptable, pharmacologically active derivatives of beneficial agents specifically mentioned herein, including, but not limited to, salts, esters, amides, prodrugs, active metabolites, isomers, fragments, analogs, and the like. When the terms “beneficial agent” or “active agent” are used, then, or when a particular agent is specifically identified, it is to be understood that the term
includes the agent per se as well as pharmaceutically acceptable, pharmacologically active salts, esters, amides, prodrugs, conjugates, active metabolites, isomers, fragments, analogs, etc.
The term “biocompatible" generally refers to a material and any metabolites or degradation products thereof that are generally non-toxic to the recipient and do not cause significant adverse effects to the subject.
As used herein “body fat” refers to fat or lipid stores in a subject’s body.
The term “comprising” and variations thereof as used herein is used synonymously with the term “including” and variations thereof and are open, non-limiting terms. Although the terms “comprising” and “including” have been used herein to describe various embodiments, the terms “consisting essentially of’ and “consisting of’ can be used in place of “comprising” and “including” to provide for more specific embodiments and are also disclosed.
The term “composition” refers to any agent that has a beneficial biological effect. Beneficial biological effects include both therapeutic effects, e.g., treatment of a disorder or other undesirable physiological condition, and prophylactic effects, e.g., prevention of a disorder or other undesirable physiological condition. The terms also encompass pharmaceutically acceptable, pharmacologically active derivatives of beneficial agents specifically mentioned herein, including, but not limited to, a vector, polynucleotide, cells, salts, esters, amides, proagents, active metabolites, isomers, fragments, analogs, and the like. When the term “composition” is used, then, or when a particular composition is specifically identified, it is to be understood that the term includes the composition per se as well as pharmaceutically acceptable, pharmacologically active vector, polynucleotide, salts, esters, amides, proagents, conjugates, active metabolites, isomers, fragments, analogs, etc.
Contacting: Placement in direct physical association, for example solid, liquid or gaseous forms. Contacting includes, for example, direct physical association of fully- and partially- solvated molecules.
A “control” is an alternative subject or sample used in an experiment for comparison purposes. A control can be "positive" or "negative."
By the term “effective amount” of a therapeutic agent is meant a nontoxic but sufficient amount of a beneficial agent to provide the desired effect. The amount of beneficial agent that is “effective” will vary from subject to subject, depending on the age and general condition of the subject, the particular beneficial agent or agents, and the like. Thus, it is not always possible to specify an exact “effective amount.” However, an appropriate “effective” amount in any subject case may be determined by one of ordinary skill in the art using routine experimentation. Also,
as used herein, and unless specifically stated otherwise, an “effective amount” of a beneficial can also refer to an amount covering both therapeutically effective amounts and prophylactically effective amounts.
"Inhibit", "inhibiting," and "inhibition" mean to decrease an activity, response, condition, disease, or other biological parameter. This can include but is not limited to the complete ablation of the activity, response, condition, or disease. This may also include, for example, a 10% reduction in the activity, response, condition, or disease as compared to the native or control level. Thus, the reduction can be a 10, 20, 30, 40, 50, 60, 70, 80, 90, 100%, or any amount of reduction in between as compared to native or control levels.
“Inhibitors” of expression or of activity are used to refer to inhibitory molecules, respectively, identified using in vitro and in vivo assays for expression or activity of a described target protein, e.g., ligands, antagonists, and their homologs and mimetics. Inhibitors are agents that, e.g., inhibit expression or bind to, partially or totally block stimulation or protease activity, decrease, prevent, delay activation, inactivate, desensitize, or down regulate the activity of the described target protein, e.g., antagonists. A control sample (untreated with inhibitors) are assigned a relative activity value of 100%. Inhibition of a described target protein is achieved when the activity value relative to the control is about 80%, optionally 50% or 25, 10%, 5% or 1%.
As used herein, “obese” and “obesity” refer to a subject having a body mass index of 30.0 or higher. “Overweight” refers to a subject having a body mass index of 25.0 to 30.0.
"Pharmaceutically acceptable" component can refer to a component that is not biologically or otherwise undesirable, i.e., the component may be incorporated into a pharmaceutical formulation of the invention and administered to a subject as described herein without causing significant undesirable biological effects or interacting in a deleterious manner with any of the other components of the formulation in which it is contained. When used in reference to administration to a human, the term generally implies the component has met the required standards of toxicological and manufacturing testing or that it is included on the Inactive Ingredient Guide prepared by the U.S. Food and Drug Administration.
"Pharmaceutically acceptable carrier" (sometimes referred to as a “carrier”) means a carrier or excipient that is useful in preparing a pharmaceutical or therapeutic composition that is generally safe and non-toxic, and includes a earner that is acceptable for veterinary and/or human pharmaceutical or therapeutic use. The terms "carrier" or "pharmaceutically acceptable
carrier" can include, but are not limited to, phosphate buffered saline solution, water, emulsions (such as an oil/water or water/oil emulsion) and/or various types of wetting agents.
As used herein, the term “carrier” encompasses any excipient, diluent, fdler, salt, buffer, stabilizer, solubilizer, lipid, stabilizer, or other material well known in the art for use in pharmaceutical formulations. The choice of a earner for use in a composition will depend upon the intended route of administration for the composition. The preparation of pharmaceutically acceptable carriers and formulations containing these materials is described in, e.g., Remington's Pharmaceutical Sciences, 21st Edition, ed. University of the Sciences in Philadelphia, Lippincott, Williams & Wilkins, Philadelphia, PA, 2005. Examples of physiologically acceptable carriers include saline, glycerol, DMSO, buffers such as phosphate buffers, citrate buffer, and buffers with other organic acids; antioxidants including ascorbic acid; low molecular weight (less than about 10 residues) polypeptides; proteins, such as serum albumin, gelatin, or immunoglobulins; hydrophilic polymers such as polyvinylpyrrolidone; amino acids such as glycine, glutamine, asparagine, arginine or lysine; monosaccharides, disaccharides, and other carbohydrates including glucose, mannose, or dextrins; chelating agents such as EDTA; sugar alcohols such as mannitol or sorbitol; salt-forming counterions such as sodium; and/or nonionic surfactants such as TWEEN™ (ICI, Inc.; Bridgewater, New Jersey), polyethylene glycol (PEG), and PLURONICS™ (BASF; Florham Park, NJ). To provide for the administration of such dosages for the desired therapeutic treatment, compositions disclosed herein can advantageously comprise between about 0.1% and 99% by weight of the total of one or more of the subject compounds based on the weight of the total composition including carrier or diluent.
Also, as used herein, the term “pharmacologically active” (or simply “active”), as in a “pharmacologically active” derivative or analog, can refer to a derivative or analog (e g., a salt, ester, amide, conjugate, metabolite, isomer, fragment, etc.) having the same type of pharmacological activity as the parent compound and approximately equivalent in degree.
The term “subject” is defined herein to include animals such as mammals, including, but not limited to, primates (e.g., humans), cows, sheep, goats, horses, dogs, cats, rabbits, rats, mice and the like. In some embodiments, the subject is a human.
The terms “treat,” “treating,” “treatment,” and grammatical variations thereof as used herein, include partially or completely delaying, alleviating, mitigating or reducing the intensity of one or more attendant symptoms of a disorder or condition and/or alleviating, mitigating or impeding one or more causes of a disorder or condition. Treatments according to the invention may be applied preventively, palliatively or remedially. Treatments can be administered to a
subject prior to onset (e g., before obvious signs of obesity), during early onset (e g., upon initial signs and symptoms of obesity), or after an established development of a disease or disorder (e.g., obesity). Prophylactic administration can occur for several days to years prior to the manifestation of symptoms of a disease or disorder.
“Therapeutic agent” refers to any composition that has a beneficial biological effect. Beneficial biological effects include both therapeutic effects, e.g., treatment of a disorder or other undesirable physiological condition, and prophylactic effects, e.g., prevention of a disorder or other undesirable physiological condition. The terms also encompass pharmaceutically acceptable, pharmacologically active derivatives of beneficial agents specifically mentioned herein, including, but not limited to, salts, esters, amides, proagents, active metabolites, isomers, fragments, analogs, and the like. When the terms “therapeutic agent” is used, then, or when a particular agent is specifically identified, it is to be understood that the term includes the agent per se as well as pharmaceutically acceptable, pharmacologically active salts, esters, amides, proagents, conjugates, active metabolites, isomers, fragments, analogs, etc.
“Therapeutically effective amount” or “therapeutically effective dose” of a composition (e.g., a composition comprising an agent) refers to an amount that is effective to achieve a desired therapeutic result. Therapeutically effective amounts of a given therapeutic agent will typically vary with respect to factors such as the type and severity of the disorder or disease being treated and the age, gender, and weight of the subject. The term can also refer to an amount of a therapeutic agent, or a rate of delivery of a therapeutic agent (e.g., amount over time), effective to facilitate a desired therapeutic effect, such as a reduced number of adipocytes in a subject. The precise desired therapeutic effect will vary according to the condition to be treated, the tolerance of the subject, the agent and/or agent formulation to be administered (e g., the potency of the therapeutic agent, the concentration of agent in the formulation, and the like), and a variety of other factors that are appreciated by those of ordinary skill in the art. In some instances, a desired biological or medical response is achieved following administration of multiple dosages of the composition to the subject over a period of days, weeks, or years.
Compositions and Methods
Disclosed herein is a method of reducing body fat gain in a subject in need, comprising administering to the subject a therapeutically effective amount of an extract of Scutellaria (for example, Scutellaria Ocmulgee), wherein the extract comprises flavonoid wogonin and terpenoids. The extract of Scutellaria has surprising effects of reducing formation of new
adipocytes in the subject. Tn some embodiments, the compositions and methods reduce the weight and/or BMI of a subject in need. In some embodiments, the methods treat obesity in a subject in need.
Scutellaria is a member of the mint family which has been used in traditional Chinese medicine (TCM) as well as in Native American folk medicine. Scutellaria family members are also known as skullcaps. The species of Scutellaria include, for example, Scutellaria baicalensis, Scutellaria barbata, Scutellaria alpina, Scutellaria angulosa, Scutellaria costaricana, Scutellaria integrifolia, Scutellaria lateriflora, Scutellaria montana, Scutellaria ocmulgee, Scutellaria ovata, Scutellaria racemosa, Scutellaria scandens, and Scutellaria suffrutescens . Accordingly, the method disclosed herein comprises administering to the subject a therapeutically effective amount of an extract of Scutellaria, wherein the extract is obtained from a species of Scutellaria selected from the group consisting of Scutellaria ocmulgee, Scutellaria baicalensis, Scutellaria barbata, Scutellaria alpina, Scutellaria angulosa, Scutellaria costaricana, Scutellaria integrifolia, Scutellaria lateriflora, Scutellaria montana, Scutellaria ocmulgee, Scutellaria ovata, Scutellaria racemosa, Scutellaria scandens, and Scutellaria suffrutescens . In some embodiments, the extract is obtained from Scutellaria ocmulgee.
As used herein, the term “extract” refers to a solid, viscid, or liquid substance or preparation that includes one or more active agents of a plant. Extraction of medicinal plants is a process of separating certain ingredients that possess biological activities, such as alkaloids, flavonoids, terpenes, saponins, steroids, and glycosides from inert or inactive material using an appropriate solvent and standard extraction procedure. The ingredients of interest are then solubilized and contained within the solvent. In some examples, the extract is obtained by contacting any part (e g., leaf) or combination parts of Scutellaria ocmulgee with a mixture of methanol and water. In some embodiments, the extract is obtained by contacting any part (e g., leaf) or combination parts of Scutellaria ocmulgee with a mixture of methanol and water, wherein the ratio of methanol and water in the mixture is about 80:20. In some embodiments, the extract is obtained by contacting any part (e.g., leaf) or combination parts of Scutellaria ocmulgee using the methods described herein.
In some embodiments, the ratio of methanol and water (methanol: water) is between about 60:40 and 95:5, about 70:30 and 90:10, about 75:25 and 85: 15, or about 78:22 and 82: 18. In some embodiments, the ratio of methanol and water (methanol: water) is about 80:20. The part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture is for about 1 to 60 minutes, about 5 to 30 minutes, about 10 to 20 minutes, or
about 5 to 10 minutes. Tn some embodiments the part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture for about 5 to 10 minutes. In some embodiments, the part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture at a temperature of between about 50 and 200 °C. In other or further embodiments, the part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture at a pressure of about 500 to 3000 psi. In certain aspects, the part or combination parts of the Scutellaria Ocmulgee plant is contacted with the methanol and water mixture for about 5 to 10 minutes, at a temperature of between about 50 and 200 °C, and at a pressure of about 500 to 3000 psi.
The extract of Scutellaria (e g., Scutellaria ocmulgee) can be derived from any part, or combination parts, of the Scutellaria plant, including, but not limited to, the root, leaf, fruit, flower, vine, and stalk. In some embodiments, the extract is obtained from a Scutellaria leaf, a Scutellaria stem, or a Scutellaria root. In some embodiments, the extract is obtained from a Scutellaria ocmulgee leaf, a Scutellaria ocmulgee stem, or a Scutellaria ocmulgee root. In some embodiments, the extract is obtained from the Scutellaria ocmulgee leaf. The active agents obtained from Scutellaria (e.g., Scutellaria ocmulgee) include, but not limited to, apigenin, baicalein, baicalin, chrysin, scutellarein, and/or wogonin. In some examples, the extract of Scutellaria ocmulgee comprises one or more active agents, including, for example, wogonin and/or chrysin. In some examples, the extract of Scutellaria ocmulgee leaf or Scutellaria ocmulgee stem comprises wogonin. In some examples, the extract of Scutellaria ocmulgee root comprises wogonin and/or chrysin having the below chemical structures.
wogonin
chrysin
In some embodiments, the wogonin and chrysin compounds described herein include tautomers and other isomers, such as retainers, as if each is specifically described, unless otherwise indicated or otherwise excluded by context.
Also disclosed herein are pharmaceutically-acceptable salts and prodrugs of the disclosed wogonin and chrysin compounds. Pharmaceutically-acceptable salts include salts of the disclosed compounds that are prepared with acids or bases, depending on the particular substituents found on the compounds. Under conditions where the compounds disclosed herein are sufficiently basic or acidic to form stable nontoxic acid or base salts, administration of the compounds as salts can be appropriate. Examples of pharmaceutically-acceptable base addition salts include sodium, potassium, calcium, ammonium, or magnesium salt. Examples of physiologically-acceptable acid addition salts include hydrochloric, hydrobromic, nitric, phosphoric, carbonic, sulphuric, and organic acids like acetic, propionic, benzoic, succinic, fumaric, mandelic, oxalic, citric, tartaric, malonic, ascorbic, alpha-ketoglutaric, alphaglycophosphoric, maleic, tosyl acid, methanesulfonic, and the like. Thus, disclosed herein are the hydrochloride, nitrate, phosphate, carbonate, bicarbonate, sulfate, acetate, propionate, benzoate, succinate, fumarate, mandelate, oxalate, citrate, tartarate, malonate, ascorbate, alphaketoglutarate, alpha-glycophosphate, maleate, tosylate, and mesylate salts. Pharmaceutically acceptable salts of a compound can be obtained using standard procedures well know n in the art, for example, by reacting a sufficiently basic compound such as an amine with a suitable acid affording a physiologically acceptable anion. Alkali metal (for example, sodium, potassium or lithium) or alkaline earth metal (for example calcium) salts of carboxylic acids can also be made.
The present disclosure also includes wogonin and chrysin compounds with at least one desired isotopic substitution of an atom, at an amount above the natural abundance of the isotope, i.e., enriched. Examples of isotopes that can be incorporated into compounds of the present disclosure include isotopes of hydrogen, carbon, and oxygen, such as 2H, 3H, nC, 13C, 17O, and 18O, respectively. In one embodiment, isotopically labeled compounds can be used in metabolic studies (with 14C), reaction kinetic studies (with, for example 2H or 3H), detection or
imaging techniques, such as positron emission tomography (PET) or single-photon emission computed tomography (SPECT) including drug and substrate tissue distribution assays, or in radioactive treatment of patients. In particular, an 18F labeled compound (such as by replacing a hydrogen with 18F) may be particularly desirable for PET or SPECT studies. Isotopically labeled compounds of this invention and prodrugs thereof can generally be prepared by carrying out the procedures disclosed herein by substituting a readily available isotopically labeled reagent for a non-isotopically labeled reagent.
By way of general example and without limitation, isotopes of hydrogen, for example deuterium (2H) and tritium (3H) may optionally be used anywhere in described structures that achieves the desired result. Alternatively or in addition, isotopes of carbon, e g., 13C and 14C, may be used. In one embodiment, the isotopic substitution is replacing hydrogen with a deuterium at one or more locations on the molecule to improve the performance of the molecule as a drug, for example, the pharmacodynamics, pharmacokinetics, biodistribution, half-life, stability, AUC, Tmax, Cmax, etc. For example, the deuterium can be bound to carbon in allocation of bond breakage during metabolism (an alpha-deuterium kinetic isotope effect) or next to or near the site of bond breakage (a beta-deuterium kinetic isotope effect).
Isotopic substitutions, for example deuterium substitutions, can be partial or complete. Partial deutenum substitution means that at least one hydrogen is substituted with deuterium. In certain embodiments, the isotope is 80, 85, 90, 95, or 99% or more enriched in an isotope at any location of interest. In some embodiments, deuterium is 80, 85, 90, 95, or 99% enriched at a desired location. Unless otherwise stated, the enrichment at any point is above natural abundance, and in an embodiment is enough to alter a detectable property of the compounds as a drug in a human.
The wogonin and chrysin compounds of the present disclosure may form a solvate with solvents (including water). Therefore, in one embodiment, the invention includes a solvated form of the active wogonin and/or chrysin compound. The term “solvate” refers to a molecular complex of a compound of the present invention (including a salt thereof) with one or more solvent molecules. Non-limiting examples of solvents are water, ethanol, dimethyl sulfoxide, acetone and other common organic solvents. The term “hydrate” refers to a molecular complex comprising a disclosed compound and water. Pharmaceutically acceptable solvates in accordance with the invention include those wherein the solvent of crystallization may be isotopically substituted, e g., D2O, de-acetone, or de-DMSO. A solvate can be in a liquid or solid form.
A “prodrug” as used herein means a wogonin or chrysin compound which when administered to a host in vivo is converted into a parent drug. As used herein, the term “parent drug” means the presently described compound herein. Prodrugs can be used to achieve any desired effect, including to enhance properties of the parent drug or to improve the pharmaceutic or pharmacokinetic properties of the parent, including to increase the half-life of the drug in vivo. Prodrug strategies provide choices in modulating the conditions for in vivo generation of the parent drug. Non-limiting examples of prodrug strategies include covalent attachment of removable groups, or removable portions of groups, for example, but not limited to, acylating, phosphorylation, phosphonylation, phosphorarmdate derivatives, amidation, reduction, oxidation, esterification, alkylation, other carboxy derivatives, sulfoxy or sulfone derivatives, carbonylation, or anhydrides, among others. In certain embodiments, the prodrug renders the parent compound more lipophilic. In certain embodiments, a prodrug can be provided that has several prodrug moieties in a linear, branched, or cyclic manner. For example, non-limiting embodiments include the use of a divalent linker moiety such as a dicarboxylic acid, amino acid, diamine, hydroxy carboxylic acid, hydroxyamine, di-hydroxy compound, or other compound that has at least two functional groups that can link the parent compound with another prodrug moiety, and is typically biodegradable in vivo. In some embodiments, 2, 3, 4, or 5 prodrug biodegradable moieties are covalently bound in a sequence, branched, or cyclic fashion to the parent compound. Non-limiting examples of prodrugs according to the present disclosure are formed with: a hydroxyl group on the parent drug and a carboxylic acid on the prodrug moiety to form an ester; a hydroxyl on the parent drug and a hydroxylated prodrug moiety to form an ester; a hydroxyl on the parent drug and a phosphonate on the prodrug to form a phosphonate ester; a hydroxyl on the parent drug and a phosphoric acid prodrug moiety to form a phosphate ester; a hydroxyl on the parent drug and a prodrug of the structure HO-(CH2)2-O-(C'2-24 alkyl) to form an ether; a hydroxyl on the parent drug and a prodrug of the structure HO-(CH2)2-S-(C2-24 alkyl) to form an thioether; and a hydroxyl on the parent compound and a prodrug moiety that is a biodegradable polymer or oligomer including but not limited to polylactic acid, polylactide-co- glycolide, polyglycolide, polyethylene glycol, polyanhydride, polyester, polyamide, or a peptide.
In some embodiments, a prodrug is provided by attaching a natural or non-natural amino acid to an appropriate functional moiety on the parent wogonin and/or chrysin compound, for example, oxygen, usually in a manner such that the ammo acid is cleaved in vivo to provide the parent drug. The amino acid can be used alone or covalently linked (straight, branched or cyclic) to one or more other prodrug moieties to modify the parent drug to achieve the desired
performance, such as increased half-life, lipophilicity, or other drug delivery or pharmacokinetic properties. The amino acid can be any compound with an amino group and a carboxylic acid, which includes an aliphatic amino acid, alkyl amino acid, aromatic amino acid, heteroaliphatic amino acid, heteroalkyl amino acid, heterocyclic amino acid, or heteroaryl amino acid.
As noted above, the present disclosure includes compositions and methods for reducing body fat and/or body fat gain in a subject in need, comprising administering to the subject a therapeutically effective amount of a Scutellaria extract comprising wogonin. In some embodiments, the methods reduce or inhibit an increase in the amount of body fat in a subject. In some embodiments, the subject maintains a same body fat percentage and/or BM1 over time following the administration of the Scutellaria extract. In some embodiments, the subject’s bodyfat percentage and/or BMI is reduced over time following the administration of the Scutellaria extract. In some embodiments, the subject’s body fat percentage is reduced by at least about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19% or 20%. In some embodiments, the subject’s body fat percentage is reduced by about 1%, 2%, 3%, 4%, 5%, 6%, 7%, 8%, 9%, 10%, 11%, 12%, 13%, 14%, 15%, 16%, 17%, 18%, 19% or 20%.In some embodiments, the subject’s body fat percentage is reduced by about 1% to 20%, 1-5%, 5%-10%, 10-15%, or 15-20%. In some embodiments, the subject’s body fat percentage is reduced by about 20%-25% or 20%-30%. In some embodiments, the subject’s BMI is reduced by a number of 1-10 or 1-5 over time following the administration of the Scutellaria extract. In some embodiments, the subject’s BMI is reduced by 1, 2, 3, 4, 5, 6, 7, 8, 9 or 10. In some embodiments, the amount of time is 1 week, 2 weeks, 3 weeks or 4 weeks. In some embodiments, the amount of time is 1 month, 2 months, 3 months, 4 months, 5 months, 6 months, 7 months, 8 months, 9 months, 10 months, 1 1 months, or 12 months. In some embodiments the amount of time is 1 year, 2 years, 3 years, 4 years or 5 years. In some embodiments, the body fat is subcutaneous fat. In some embodiments, the body fat is visceral fat.
In some embodiments, the average number of adipocytes are maintained in the subject over time following the administration of the Scutellaria extract. In some embodiments, the average number of adipocytes are reduced in the subject over time following the administration of the Scutellaria extract. In some embodiments, there is a further treatment, prevention, reduction, and/or mitigation of an obesity associated disorder, including, for example, hypertension, high LDL cholesterol, low HDL cholesterol, high levels of triglycerides, diabetes, coronary heart disease, stroke, gallbladder disease, or osteoarthritis.
Accordingly, included herein is a method of treating obesity or reducing body fat gain in a subject in need, comprising administering to the subject a therapeutically effective amount of an extract of Scutellaria ocmulgee, wherein the extract comprises wogonin. The concentration of wogonin in the extract may range from 0.001 pg/mg to 100 pg/mg, 0.01 pg/mg to 10 pg/mg, 0.05 pg/mg, to 5 pg/mg, 0.05 pg/mg to 1 pg/mg, 0.05 pg/mg to 0.5 pg/mg, or 0. 1 pg/mg to 0.5 pg/mg. In some embodiments, the concentration of wogonin in the extract is about 0.001 pg/mg, about 0.01 pg/mg, about 0.05 pg/mg, about 0.1 pg/mg, about 0.2 pg/mg, about 0.5 pg/mg, about 1 pg/mg, about 5 pg/mg, or about 10 pg/mg. In some embodiments, the extract further comprises chrysin. The concentration of chrysin in the extract may range from 0.001 pg/mg to 100 pg/mg, 0.01 pg/mg to 10 pg/mg, 0.05 pg/mg, to 5 pg/mg, 0.05 pg/mg to 1 pg/mg, 0.05 pg/mg to 0.5 pg/mg, or 0. 1 pg/mg to 0.5 pg/mg. In some embodiments, the concentration of chrysin in the extract is about 0.001 pg/mg, about 0.01 pg/mg, about 0.05 pg/mg, about 0.1 pg/mg, about 0.2 pg/mg, about 0.5 pg/mg, about 1 pg/mg, about 5 pg/mg, or about 10 pg/mg.
In some embodiments, the therapeutically effective amount of wogonin or chrysin typically vary from about 0.001 mg/kg body weight to about 1000 mg/kg body weight, from about 0.01 mg/kg body weight to about 750 mg/kg body weight, from about 100 mg/kg body weight to about 500 mg/kg body weight, from about 1 mg/kg body weight to about 250 mg/kg body weight, from about 10 mg/kg body weight to about 150 mg/kg body weight in one or more dose administrations daily, for one or several days (depending of course of the mode of administration and the factors discussed above). Other suitable dose ranges include 1 mg to 10,000 mg per day, 100 mg to 10,000 mg per day, 500 mg to 10,000 mg per day, and 500 mg to 1,000 mg per day. In some embodiments, the amount is less than 10,000 mg per day with a range of 750 mg to 9,000 mg per day.
As discussed above, “therapeutically effective amount” or “therapeutically effective dose” of a composition refers to an amount that is effective to achieve a desired therapeutic result. In some embodiments, a desired therapeutic result is inhibiting an increase in the amount of body fat in a subject. In some embodiments, a desired therapeutic result is a reduced amount of fat in a subject. In some embodiments, a desired therapeutic result is inhibiting an increase in the number of adipocytes in a subject. In some embodiments, a desired therapeutic result is a reduced number of adipocytes in a subject. In some embodiments, a desired therapeutic result is inhibiting an increase in the average adipocyte volume in a subject. In some embodiments, a desired therapeutic result is reducing the average adipocyte volume in a subject. In some embodiments, a desired therapeutic result is a reduction of the subject’s body mass index (BMI).
Tn some embodiments, a desired therapeutic result is a treatment, prevention, reduction, and/or mitigation of an obesity associated disorder, including, for example, hypertension, high LDL cholesterol, low HDL cholesterol, high levels of triglycerides, diabetes, coronary heart disease, stroke, gallbladder disease, or osteoarthritis. Accordingly, in some embodiments, the extract of Scutellaria (e.g., Scutellaria ocmulgee) inhibits an increase in or reduces the amount of adipocytes in the subject. In some embodiments, the extract of Scutellaria (e.g., Scutellaria ocmulgee) inhibits an increase in or reduces the body mass index (BMI) of the subject.
In some embodiments, the extract of Scutellaria (e.g., Scutellaria ocmulgee) described herein can inhibit or reduce adipogenesis. In some embodiments, the extract of Scutellaria (e.g., Scutellaria ocmulgee) described herein can inhibit phosphorylation of GSK-3|3 in a cell. In some embodiments, the cell is a pre-adipocyte.
“GSK-3P” refers herein to a polypeptide that, in humans, is encoded by the GSK3B gene. In some embodiments, the GSK3B polypeptide is that identified in one or more publicly available databases as follows: HGNC: 4617, NCBI Entrez Gene: 2932, Ensembl: ENSG00000082701, OMIM®: 605004, UniProtKB/Swiss-Prot: P49841. In some embodiments, the GSK-3P polypeptide comprises the sequence of SEQ ID NO: 1, or a polypeptide sequence having at or greater than about 80%, about 85%, about 90%, about 95%, or about 98% homology with SEQ ID NO: 1, or a polypeptide comprising a portion of SEQ ID NO: 1. The GSK-3P polypeptide of SEQ ID NO: 1 may represent an immature or pre-processed form of mature GSK- 3P, and accordingly, included herein are mature or processed portions of the GSK-3P polypeptide in SEQ ID NO: 1.
Dosing frequency for the composition disclosed herein, includes, but is not limited to, at least once every 12 months, once every 1 1 months, once every 10 months, once every 9 months, once every 8 months, once every 7 months, once every 6 months, once every 5 months, once every 4 months, once every 3 months, once every two months, once every month; or at least once every three weeks, once every two weeks, once a week, twice a week, three times a week, four times a week, five times a week, six times a week, or daily. In some embodiments, the interval between each administration is less than about 4 months, less than about 3 months, less than about 2 months, less than about a month, less than about 3 weeks, less than about 2 weeks, or less than less than about a week, such as less than about any of 6, 5, 4, 3, 2, or 1 day. In some embodiments, the dosing frequency for the composition includes, but is not limited to, at least once a day, twice a day, or three times a day. In some embodiments, the interval between each administration is less than about 48 hours, 36 hours, 24 hours, 22 hours, 20 hours, 18 hours, 16
hours, 14 hours, 12 hours, 10 hours, 9 hours, 8 hours, or 7 hours. Tn some embodiments, the interval between each administration is less than about 24 hours, 22 hours, 20 hours, 18 hours, 16 hours, 14 hours, 12 hours, 10 hours, 9 hours, 8 hours, 7 hours, or 6 hours. In some embodiments, the interval between each administration is constant. For example, the administration can be carried out daily, every two days, every three days, every four days, every five days, or weekly. Administration can also be continuous and adjusted to maintaining a level of the compound within any desired and specified range.
EXAMPLES
The following examples are set forth below to illustrate the compositions, methods, and results according to the disclosed subject matter. These examples are not intended to be inclusive of all aspects of the subject matter disclosed herein, but rather to illustrate representative methods and results. These examples are not intended to exclude equivalents and variations of the present invention which are apparent to one skilled in the art.
EXAMPLE 1. Preparation and Characteristics of SocL extract.
Plants were cultivated in the greenhouse conditions to minimize batch-to-batch variation. New plants were established through root divisions in March that reach maturity in May and leaves were harvested before the onset of flowering. The leaves were dried with constant turning in shade at room temperature to remove about 80% moisture. The dried leaves were then finely ground and processed for methanol: water (80:20) extraction using an ASE apparatus (Dionex Corporation, Sunnyvale, CA). The extracts were concentrated under vacuum using a Savant SpeedVac. The extract has been characterized and tested for anti-cancer activity against U87- MG glioma cell line and wogonin was used as an internal standard as described previously (Parajuli et al., 2009; Parajuli et al., 2011). The flavonoid wogonin (purity 98%) was purchased from Sigma Chemical Co. (St. Louis, MO). Wogonin was reconstituted in dimethyl sulfoxide (DMSO) and then diluted in appropriate media, as indicated. The final concentration of DMSO in the media for all experiments were <0.1%. Therefore, 0.1% DMSO was used in the Control media for all experiments.
EXAMPLE 2. Mouse pre-adipocyte cell line.
Differentiation of mouse pre-adipocyte cells (3T3-L1) into adipocytes has been used as an in vitro model of adipogenesis. 3T3-L1 cells (obtained from ATCC) were maintained in
DMEM supplemented with 10% FCS and Anti bi otic/ anti mycotic (penicillin /streptomycin /fungizone, Invitrogen) at 37°C in 5% CO2.
EXAMPLE 3. Proliferation Assay
3T3-L1 cells were seeded in 96-well flat-bottom plates (2 xlO4 cells/well) and cultured in the presence of varying doses of SocL extract. After incubation at 37°C for 3 days, cell viability was evaluated using the WST-1 assay kit (Clonetech Laboratories, Mountain View, CA) as per the manufacturer’s protocol. Cell viability /proliferation was expressed as a percent of vehicle control (cells cultured with DMSO alone). See Figure 1C.
EXAMPLE 4. Adipocyte Differentiation Assay
3T3-L1 cells were seeded in 6-well plate and cultured with DMEM+10% FCS till confluence. Two days post confluence, (designed as Day 0), the cells were stimulated with Adipocyte Induction Media (AIM - DMEM supplemented with 10% FBS and containing 0.5mM IBMX, I LIM dexamethasone and lOpg/mL insulin and lOpM rosiglitazone) [All reagents were obtained from Sigma]. Media with respective supplements were replaced every two days.
Ten days after start of differentiation induction, 3T3-L1 cell cultures were washed with PBS and incubated with 4% phosphate-buffered formaldehyde for 30min at RT for fixation. This was followed by staining with Oil Red O stain for 1 hour to visualize neutral lipid deposits in the cells under a phase-contrast, inverted microscope (Olympus). Relative intracellular lipid content was quantified by eluting Oil Red O-stained lipid with 100% isopropyl alcohol and measuring the absorbance at 570 nm using a microplate reader. See Figures 1 A and IB.
EXAMPLE 5. Intracellular (GSK-3P) activity (phosphorylation) analysis via western blot assay.
3T3-L1 cells were seeded in 6-well plates and cultured with Insulin and rosiglitazone in the presence of SocL (200 pg/ml) for various timepoints, as indicated. The cells were then lysed, 20-30 pg aliquots of total protein were electrophoresed, transferred onto a poly vinylidene difluoride (PVDF) membrane, and probed with anti-GSK30 and anti-phospho-GSK3p antibodies. Detection of HRP-conjugated secondary Abs was performed using SuperSignal (Pierce, Rockford, IL) and chemiluminescence was recorded using an Omega imaging sy stem (UltraLum Inc., Claremont, CA) as per manufacturer's instructions. P-actin was used as the
loading control. The density of protein bands was quantified using TmageJ software. See Figure 2.
In summary, SocL extract significantly inhibited the process of adipogenesis in an in vitro model using the pre-adipocyte 3T3-L1 cells. The proliferation/survival of 3T3-L1 cells were however not significantly affected by SocL treatment.
SEQUENCES
SEQ ID NO: 1
MSGRPRTTSFAESCKPVQQPSAFGSMKVSRDKDGSKVTTVVATPGQGPDRPQEVSYTD TKVIGNGSFGVVYQAKLCDSGELVAIKKVLQDKRFKNRELQIMRKLDHCNIVRLRYFFY
S S GEKKDEVYLNLVLDYVPETVYRV ARHYSRAKQTLPVIYVKLYMYQLFRSL AYIHSF
GICHRDIKPQNLLLDPDTAVLKLCDFGSAKQLVRGEPNVSYICSRYYRAPELIFGATDYT
SSIDVWSAGCVLAELLLGQPIFPGDSGVDQLVEIIKVLGTPTREQIREMNPNYTEFKFPQI
KAHPWTKVFRPRTPPEA1ALCSRLLEYTPTARLTPLEACAHSFFDELRDPNVKLPNGRDT PALFNFTTQELSSNPPLATILIPPHARIQAAASTPTNATAASDANTGDRGQTNNAASASAS
NST
Claims
What is claimed is:
1. A method of reducing body fat and/or body fat gain in a subject in need thereof, comprising administering to the subject a therapeutically effective amount of an extract of Scutellaria ocmulgee, wherein the extract comprises wogonin.
2. The method of claim 1, wherein the extract is obtained from a Scutellaria ocmulgee leaf, a Scutellaria ocmulgee stem, or a Scutellaria ocmulgee root.
3. The method of claim 1 or 2, wherein the extract is obtained from a Scutellaria ocmulgee leaf.
4. The method of any one of claims 1-3, wherein the extract is obtained by contacting Scutellaria ocmulgee with a mixture of methanol and water.
5. The method of claim 4, wherein the ratio of methanol and water is between about 60:40 and 95:5.
6. The method of claim 4, wherein the ratio of methanol and water is about 80:20.
7. The method of any one of claims 1-6, wherein the extract of Scutellaria ocmulgee reduces adipogenesis in the subject.
8. The method of any one of claims 1-7, wherein the extract of Scutellaria ocmulgee reduces phosphorylation of GSK-3P in a cell in the subject.
9. The method of any one of claims 1-8, wherein the subject is obese prior to the administration.
10. The method of any one of claims 1-9, wherein the subject is overweight prior to the administration.
1 1 . The method of any one of claims 1 -10, wherein the subject’s body mass index (BMI) is reduced after the administration.
12. The method of any one of claims 1-11, wherein the subject’s body fat percentage is reduced after the administration.
13. The method of any one of claims 1-12, wherein the subject’s weight is reduced after the administration.
15. The method of any one of claims 1-13, wherein the concentration of wogonin in the extract is at least 0.1 pg/mg.
16. A composition comprising an extract of Scutellaria ocmulgee, wherein the extract comprises wogonin.
Applications Claiming Priority (2)
Application Number | Priority Date | Filing Date | Title |
---|---|---|---|
US202263398351P | 2022-08-16 | 2022-08-16 | |
US63/398,351 | 2022-08-16 |
Publications (1)
Publication Number | Publication Date |
---|---|
WO2024040037A1 true WO2024040037A1 (en) | 2024-02-22 |
Family
ID=89942355
Family Applications (1)
Application Number | Title | Priority Date | Filing Date |
---|---|---|---|
PCT/US2023/072188 WO2024040037A1 (en) | 2022-08-16 | 2023-08-15 | Scutellaria extracts and uses thereof |
Country Status (1)
Country | Link |
---|---|
WO (1) | WO2024040037A1 (en) |
Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7476406B1 (en) * | 2004-05-17 | 2009-01-13 | Nse Products, Inc. | Multifaceted weight control system |
US20130059907A1 (en) * | 2011-09-05 | 2013-03-07 | National Taiwan Normal University | Wogonin-containing pharmaceutical composition for inhibiting cancer stem cells growth and application thereof |
US20210007941A1 (en) * | 2017-04-07 | 2021-01-14 | Weidmann Holding Ag | Personal care composition |
-
2023
- 2023-08-15 WO PCT/US2023/072188 patent/WO2024040037A1/en unknown
Patent Citations (3)
Publication number | Priority date | Publication date | Assignee | Title |
---|---|---|---|---|
US7476406B1 (en) * | 2004-05-17 | 2009-01-13 | Nse Products, Inc. | Multifaceted weight control system |
US20130059907A1 (en) * | 2011-09-05 | 2013-03-07 | National Taiwan Normal University | Wogonin-containing pharmaceutical composition for inhibiting cancer stem cells growth and application thereof |
US20210007941A1 (en) * | 2017-04-07 | 2021-01-14 | Weidmann Holding Ag | Personal care composition |
Non-Patent Citations (2)
Title |
---|
BAK EUN-JUNG; KIM JINMOON; CHOI YUN HUI; KIM JI-HYE; LEE DONG-EUN; WOO GYE-HYEONG; CHA JEONG-HEON; YOO YUN-JUNG: "Wogonin ameliorates hyperglycemia and dyslipidemia via PPARα activation in db/db ", CLINICAL NUTRITION, CHURCHILL LIVINGSTONE, LONDON., GB, vol. 33, no. 1, 26 March 2013 (2013-03-26), GB , pages 156 - 163, XP028812513, ISSN: 0261-5614, DOI: 10.1016/j.clnu.2013.03.013 * |
ZAHRA GHARARI, KHADIJEH BAGHERI, MORTAZA KHODAEIAMINJAN, ALI SHARAFI: "Potential Therapeutic Effects and Bioavailability of Wogonin, the Flavone of Baikal Skullcap", JOURNAL OF NUTRITIONAL MEDICINE AND DIET CARE, vol. 5, no. 2, pages 1 - 11, XP093144238, ISSN: 2572-3278, DOI: 10.23937/2572-3278.1510039 * |
Similar Documents
Publication | Publication Date | Title |
---|---|---|
CA3158059A1 (en) | Tryptamine compositions for enhancing neurite outgrowth | |
US20060159790A1 (en) | Composition for preventing or treating dementia comprising a hydroxycinnamic acid derivative or an extract of a plant of genus angelicae containing same | |
KR101996245B1 (en) | Pharmaceutical combination comprising a selective s1p1 receptor agonist | |
EP3458448B1 (en) | Fasn inhibitors for use in treating non-alcoholic steatohepatitis | |
CN112716929B (en) | Application of kaurane compounds in medicine for treating ventricular enlargement and remodeling | |
US10959963B2 (en) | Method for the treatment of fatty liver disease | |
EP3146967B1 (en) | Use of an isoquinoline alkaloid derivative for preparing drug capable of promoting ampk activity | |
Aldenborg et al. | Mast cells and biogenic amines in radiation-induced pulmonary fibrosis | |
EP3542810A2 (en) | Composition containing artemisia annua extract as effective ingredient for alleviating skin disease and preparation method therefor | |
Hao et al. | Pharmacokinetics, tissue distribution and excretion of gambogic acid in rats | |
US9707222B2 (en) | Isoquinoline alkaloid derivative for activating AMP-dependent protein kinase | |
KR20160068776A (en) | Preparation and use of a composition for prevention and mitigation of the effects of radiation | |
US20220401414A1 (en) | Treatment and prevention of a neurodegenerative disorder | |
WO2024040037A1 (en) | Scutellaria extracts and uses thereof | |
Xiong et al. | Intermittent fasting alleviates type 1 diabetes-induced cognitive dysfunction by improving the frontal cortical metabolic disorder | |
EP2608783A1 (en) | Use of glycyrrhetinic acid, glycyrrhizic acid and related compounds for prevention and/or treatment of pulmonary fibrosis | |
US20070248702A1 (en) | Use of CB2 receptors agonists for the treatment of Huntington's disease | |
US20020168436A1 (en) | Decursinol or derivative thereof as analgesic agent | |
CA2671668A1 (en) | Therapeutic composition for interstitial pheumonia | |
CN112755011A (en) | A composition for preventing or treating liver disease | |
EP3459539A1 (en) | Pharmaceutical formulation for delaying incidence and/or treatment of pulmonary fibrosis | |
US20230054551A1 (en) | Oral pharmaceutical composition and method for delivering nitric oxide to a patient's circulatory system or brain | |
US20230098649A1 (en) | Mitochondria-targeted isoketal/isolevuglandin scavengers and uses thereof | |
US20210030714A1 (en) | Compounds for use in the treatment of brain diseases | |
JP2010539242A (en) | How to increase sarcosine levels |
Legal Events
Date | Code | Title | Description |
---|---|---|---|
121 | Ep: the epo has been informed by wipo that ep was designated in this application |
Ref document number: 23855601 Country of ref document: EP Kind code of ref document: A1 |